2V55A

Mechanism of multi-site phosphorylation from a rock-i:rhoe complex structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
399
structure length
393
Chain Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEETFPIPKAFVGNQLPFVGFTYYSNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RHO-ASSOCIATED PROTEIN KINASE 1
publication title Mechanism of Multi-Site Phosphorylation from a Rock-I:Rhoe Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 393
sequence length 399
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v55A01
3HGKA 3OVVA 3Q9WA 5A14A 4PX6A 2WMUA 3FI2A 2PVFA 1UNLA 1FMOE 3M11A 5J9ZA 3ZTXA 3VUTA 3NNUA 4NW5A 4XJ0A 4FT7A 5T68A 1OKZA 3FXWA 3HECA 3FKNA 4EK3A 2I1MA 2X4ZA 5CXHA 2BAKA 4BDJA 3FMKA 3TM0A 2J50A 2WMAA 3HDMA 4L01A 1WBWA 4TWOA 4YURA 1Q3DA 4O1OA 4FEVA 3DQWA 3FYKX 2VAGA 3R28A 3F7WA 4IBMA 5HNIX 4YJNA 4J7BA 3NPCA 3IONA 4ITHA 4DLJA 2ZM3A 3KVXA 3SLSA 2YAAA 3U55A 2C6TA 3FJQE 4Q9SA 3RWPA 2CN5A 3OBJA 5M4IA 5AV3A 2X2MA 1OECA 4R5SA 4DGLC 1VEBA 3E7VA 1H07A 3KN6A 3KU2A 4RA4A 3BYUA 3KVWA 2C5VA 5A3XA 4F1MA 2XK4A 3VUHA 5A6OA 5L2SA 3MVLA 3IK3A 2ZV2A 3EQHA 3QQHA 4FZ7A 1MRVA 5AR7A 3VN9A 2GNFA 4A9UA 5DRDA 3Q3BA 2VTMA 4TXCA 4N4SA 3Q6WA 2W1FA 3JUHA 1B6CB 1XBAA 5K3YA 4D1XA 4EUTA 2EWAA 3MIYA 4G3FA 4FTAA 3PFQA 4BI1A 4G3CA 2ZOQA 4RIXB 2ITXA 4F7LA 4QQJA 3KC3A 4RIYA 2PSQA 3KGAA 4FNYA 2ESMA 3ORMA 3QQFA 4WUNA 3EQGA 2ERKA 4I92A 2XUUA 3QKMA 5HTIA 2FH9A 2X8DA 1JKKA 1R1WA 4O21A 5EM6A 4B9DA 3ATTA 2WHBA 4NZWB 4AXAA 4D1ZA 4KABA 5EQPA 4FV3A 5EFQA 3WYYA 4FYNA 3G6GA 2BFXA 4FSYA 1T45A 2XNOA 4TYJA 4ZZNA 3R9RA 1OL7A 3PG3A 1Q8TA 5KMKA 3F3UA 3R01A 5KNJA 1I09A 4IZ7A 4ZZMA 4QMZA 4TWCA 4OT6A 5EM8A 3P08A 2JBOA 3WARA 5ETAA 4D2TA 1G8AA 3AD4A 3NW7A 4BWPA 1URWA 4Y83A 4AOJA 4WG4A 5DLSA 1YHVA 4G5PA 4L3PA 3G2FA 2QLUA 3ELJA 2E9PA 2PZYA 3V5WA 2F4JA 2WIPA 2P4IA 3FC1X 3Q4ZA 4YTIA 3QD3A 4KRDA 3U4WA 3ANRA 2VTQA 3D0EA 3EN7A 4GT3A 4PUZA 3RWQA 3BYMA 4L00A 5L2QA 5IMXA 4E5AX 4V05A 4FKSA 2QONA 3O23A 2OIBA 4AA5A 1UU7A 4FIJA 4EUUA 4XLVA 1J7IA 3SG8A 3MFSA 5IA1A 2G2FA 3PTGA 4FG7A 5KMJA 2GNGA 3QYZA 1ZARA 3NIEA 4LL5A 2W0JA 4KS8A 1PHKA 3P7BA 3FLSA 2R3LA 2UZVA 2VTRA 2W99B 3P4KA 2QR7A 4K33A 4X7QA 5CVHA 1UVRA 4QMOA 3LJ2A 4YLKA 4ANNA 4EORA 2FB8A 2LGCA 4FSWA 3WZUA 1H00A 4FV2A 3KREA 2Z7LA 4AX8A 3I0OA 5LWMA 5EOBA 3ZCLA 5JT2A 2YZLA 3UQGA 4F64A 5KKRC 2VWYA 4FSZA 2YN8A 2XBAA 3BGPA 3PIYA 4BBEA 4O0WA 3DQXA 3W2PA 4ZZOA 3MVMA 3ZSGA 5IQCA 3Q9ZA 2JBPA 2CLXA 2B55A 2O65A 4R7HA 3PVGA 5H9BA 3C51A 4FV7A 1OL6A 4DGGA 4PP9A 4RC2A 4GVJA 4AW0A 4DC2A 2DQ7X 1O6YA 5DA3A 3UG2A 2C5NA 2QOFA 4DFNA 3COMA 3RCJA 3RPOA 4EZ3A 3PLSA 4L43A 2XNNA 4OUCA 4QMSA 4FGRA 1P5EA 5C8MA 4ANSA 2F7ZE 5L8JA 1K3AA 2BHEA 3VUIA 3RZBA 5CEMA 3GU6A 3CTQA 4GS6A 2W5AA 3MB7A 1H27A 2W1CA 2ZDTA 1QL6A 3AQVA 5FXSA 3GBZA 4AZSA 4D4SA 4F70A 1XR1A 3SW7A 4ZY4A 5FEQA 4HGTA 4UY9A 1NW1A 3EOCA 3UZRA 4PDSA 4EKKA 3PXQA 3VBTA 4JS8A 2R7BA 3P79A 3U87A 4MBLA 1FINA 1OITA 4I6FA 4JRNA 3DZQA 4R5YA 2VGOA 4EH5A 2CKPA 2V22A 2YIQA 1UKIA 2Y8OA 4M8TA 4QYYA 4CV8A 3IDPA 4D0XA 5J1WA 2CNUA 3VBWA 2PPQA 3QTIA 3L9PA 3ZSHA 1J7UA 5DGZA 1PRYA 5T6KA 2VX1A 3RK5A 2I0YA 2BALA 5DE2A 4J71A 5BPYA 1A06A 2AYPA 3V5JA 2BRBA 2BDFA 4IANA 1NT2A 5HZNA 2GNHA 3LFDA 3JYAA 1WMKA 3VS0A 4NUSA 1H0VA 4HYIA 3SHEA 3VS3A 3ORIA 5D9HA 1ZY4A 3E93A 4BI0A 3MW1A 3AD5A 4FZ6A 3QCXA 2RFSA 4FT3A 5A54A 4YPDA 5TO8A 3ZUTA 2FO0A 5I9WA 4D4RA 3GENA 4KINA 1LPUA 3DDQA 2KTYA 2P0CA 1H1SA 2OZOA 4C59A 3Q2JA 3C50A 4WUAA 4LRJA 1GAGA 5M4FA 2I7QA 3A2CA 5M07A 3SQQA 3THBA 4EYMA 5E1SA 4EOMA 4FVRA 3PWDA 4XG3A 4TT7A 2OXXA 2HXQA 2Y4IC 2UZTA 4YJRA 3ZO2A 5BUIA 5EHYA 4IQ6A 5A4EA 2J2IB 5BUEA 2FSLX 3NLBA 5IEXA 2ZV8A 3PPJA 4MAOA 1U54A 3OCBA 3OF0A 2HIWA 3UMWA 3IS5A 3KF7A 2J6MA 4A06A 3FHIA 3DZOA 4HCVA 4CMTA 4DA5A 2X6EA 4A9TA 4BDEA 4K6ZA 4E4XA 5ANEA 4RWJA 2IPXA 3EWHA 3R7EA 4AN2A 2YM6A 4UMUA 1UV5A 4DH8A 1OUKA 2OJJA 2Y6OA 3D7ZA 5FP5A 5M4CA 2VU3A 4GKHA 2YM8A 5JFSA 1YWVA 2CMWA 5AUYA 3AT2A 3KEXA 4FZDB 3EL7A 2ITZA 1BI8A 1V1KA 3A60A 4CT2A 3DJ6A 4PPCA 4FKQA 3DFCB 2WEVA 4X6RA 3TZ9A 1BLXA 3FV8A 3ZOSA 2FSOX 4F99A 3MV5A 3SD0A 3V51A 4ITIA 1XWSA 2RGPA 2WKMA 2EU9A 5FDPA 4DE4A 4TN6A 3CSVA 4S33A 4FIHA 3VS1A 4EK5A 3HUCA 4FL1A 3FZPA 4L46A 4MK0A 4BCQA 2GQGA 3Q53A 1Q8ZA 3U51A 2REIA 2UZNA 3F3WA 4K1BA 4EK4A 2OJ9A 3SG9A 3UOKA 3M2WA 4JR3A 4P90A 3MH0A 3EQDA 3ZO4A 5TR6A 3F61A 4EJNA 4YTCA 3ERKA 5J7HA 3PZHA 4U5JA 5K5NA 3VC4A 4TL0A 4O7NA 1Q8YA 5LCKA 5DEYA 3UIUA 3BGQA 2UW4A 5E8SA 2WMWA 2B9FA 3GFEA 1BI7A 4C61A 3OROA 3FZRA 5C03A 1O9UA 2YLEA 4KIKA 4GT5A 2JAVA 2VTOA 2WFYA 2YJSA 4G16A 4IADA 2CDZA 4NJ3A 5EH0A 4D2WA 3DXPA 2NRYA 4XEYA 1WBTA 2V0DA 3EYHA 4NFMA 3O17A 3DDPA 2ITNA 2FGIA 4DGOA 2W4OA 3TT0A 4J8MA 4E20A 4OW8A 5IQBA 2O0UA 3QQKA 2Z7QA 4KIQA 4YZNA 2XEZA 4YHFA 4AGDA 5JMSA 1PKDA 5C01A 4A4LA 4MQ1A 5IKWA 3SKCA 3D5XA 3MYGA 3QZGA 1XBBA 3NAYA 2RFEA 4F1OA 3LQ3A 1IG1A 4CFWA 4E26A 3PP1A 3HRCA 3LLTA 5HKMA 3UMXA 4DBXA 4GL9A 5FBOA 5AV0A 5EHOA 4ACMA 3U9NA 3ZZWA 3E88A 3L9MA 1OKWA 5DIAA 3ATSA 3GU5A 1LP4A 2JDRA 3TL8A 3NNWA 3TUCA 1W0XC 1WFCA 2WOUA 3EKKA 4UMRA 3BYOA 4LOPA 2H96A 4FTLA 3AT3A 5LVPA 5FP6A 2PZPA 3EQBA 2IW6A 4Q5HA 5KHXA 5AR5A 2ETMA 3DCVA 1O6KA 4O7LA 3SOCA 2J0KA 5CEPA 4ZTMA 3IECA 3Q9XA 5BVKA 2IW9A 4IWPA 4GK4A 3DLZA 4IAFA 3S1HA 4DEBA 2C0IA 4UMPA 4DT8A 2OJIA 3F66A 3ZXZA 1PYXA 5CEQA 3DY7A 2ZB1A 2BZKB 3CS9A 3M1SA 4UV0A 4USDA 2BPMA 2XYUA 4ZJIA 1I44A 3B8RA 4KB8A 4EH3A 2UVXA 5L4QA 2IZUA 4LGGA 3W10A 4JG7A 3OWPA 4I22A 3VBQA 4ANBA 3AMYA 4ARKA 2JLDA 3SA0A 2GS2A 5ACBC 1M17A 1A48A 3CGFA 3S00A 2I0VA 3C4WA 2OK1A 4RJ3A 2QU6A 3Q5ZA 1OPJA 3TJDA 3LAUA 2JKQA 4HVIA 3TV7A 4EK6A 4E5BA 1CKJA 2W4JA 1A9UA 5DG5A 2VZ6A 4JOAA 4RIOA 5CSPA 4F65A 3KQ7A 2H34A 4C4GA 4O81A 3RK9A 4FV6A 3QLGA 3EN4A 2VTHA 4ASZA 2GCDA 4OTGA 1OI9A 5C4KA 2QC6A 3C0HA 3NWWA 4B6LA 2VTSA 4J99A 3OCSA 5FQDC 4EQUA 4X2FA 4C62A 4D9TA 4CKJA 1KSWA 2ZB0A 3CTHA 4FIGA 5J5SA 4QMLA 4BYIA 2BTSA 4OTDA 3V6SA 4UX9A 4JAIA 4CFMA 3ZSIA 3LFSA 5K4JA 5L6PA 4A9RA 5CF4A 4M13A 4MNEA 3FE3A 4ALUA 1NXKA 5HE0A 3DBEA 2YCRA 1YXXA 4K77A 4BCNA 2C6OA 5KHWA 3K2LA 3RNYA 3UOHA 1CDKA 5HE3A 4RJ5A 4ENXA 1WBVA 4RBLA 3EN9A 3NEWA 4HGLA 5AP5A 3EN6A 2Q83A 5HD7A 2X6DA 3OT8A 2XP2A 3PUPA 4FV5A 4BCJA 3NUAA 4FUYA 3Q5IA 3GVUA 2ETKA 3G0EA 5KCVA 4I23A 2QKWB 1RJBA 3O71A 3SV0A 4C0TA 3KXXA 4NT4A 4TYEA 4XX9A 2HELA 5LARA 4U80A 4CTBA 4Y95A 1Q41A 5BMSA 1SNXA 4RWKA 4YJTA 2ITUA 3VRYA 2PYWA 3HRFA 4D28A 3C5IA 2HK5A 3FQHA 2ETRA 3EFKA 2C3KA 3BLQA 2WMTA 3AG9A 5HCYA 4ACHA 5IH4A 4OLIA 4AZFA 3R71A 4WNPA 5FM2A 4L45A 5CQUA 2VO3A 3SXSA 5HLNA 4QQTA 3IG7A 4XG7A 3C4XA 4C7TA 5M09A 4UBAA 3PRIA 3NX8A 1Y8GA 1CSNA 3WZDA 5IDPA 3QX2A 4WRGA 5CZHA 4AFJA 2WTIA 4LGHA 3L8SA 2VWXA 1S9IA 4FKGA 4IAZA 1NVSA 4DEEA 4XG2A 2WGJA 3ZXTA 2W1DA 1XH9A 3S95A 4EOKA 4LV8A 4QP9A 4KNBA 5CSWA 5LMKA 2BHHA 2C69A 2YABA 4GIIA 3A99A 3GT8A 1YWRA 3AXWA 3E92A 4NTTA 3O7LD 1JKSA 2WTDA 5A6NA 3QTWA 2Z7RA 5BMMA 4MX9A 3FMNA 5TT7A 1ZXEA 4ENYA 4U45A 3I4BA 5AR2A 1FOTA 2VTAA 4WBOA 3ZRLA 5F94A 1MQBA 1G5SA 4GYIA 3DKFA 4FVPA 3I7BA 5E91A 2R0IA 3QL8A 3LCKA 1FVTA 1XKKA 2XNEA 3D7TA 4I4FA 3B2TA 2GDOA 2PE0A 3IPHA 2C68A 3KK9A 3A7JA 4GIHA 4I0SA 4CZYB 5B2MA 4ERWA 5G6VA 1DAYA 4JIKA 4MF1A 3O8UA 5IA5A 4BCKA 4YU2A 5E7RA 3BBTB 3H30A 3R00A 3NVMB 1OKYA 4RX8A 3RPRA 5LMKC 4C4FA 2F57A 5GZAA 4U42A 3D5UA 4RFYA 3LPBA 4FV0A 4C4JA 3MVHA 2OW3A 5I0BA 4XV9A 4OBQA 1FQ1B 5AX9A 4MXZA 3QCQA 5FM3A 2X2LA 5CAQA 3CJGA 3TWJA 4FTOA 3NUXA 5CI6A 4BDHA 3LLAA 1GOLA 2VTPA 4DT9A 5HBHA 4LMUA 2WTCA 2QKRA 2WMRA 4II5A 3MH1A 4HYHA 3L9NA 1UWJA 3ZLXA 5EKNA 5HTCA 4P5ZA 4PRJA 5HLWA 2A0CX 3AGLA 2XNPA 3HP5A 5H8BA 5AV4A 4LOQA 3R1QA 5CF6A 3QC4A 4FTMA 4BGHA 3TACA 3GP0A 3VS6A 4BBFA 4W4WA 2JD5A 2ZMDA 4EHEA 2JIVA 2J7TA 4IVAA 5HG8A 2QOHA 3CIKA 2XJ0A 4Q5EA 3JY0A 4C34A 4EWHA 1YOJA 4UZDA 4QP1A 4B0GA 4C8BA 5IA3A 4LG4A 5BYYA 2DUVA 4E6AA 1XJDA 2VWUA 4PDPA 2VWBA 1RW8A 3DJ5A 3U8WA 2JIUA 1WBOA 2QD9A 3MY0A 4O0RA 4DFXE 2UZOA 2IO6A 2GFSA 3O7LB 3ZFMA 5HTBA 2ONLC 4LV5A 2HZNA 4BFMA 4RX5A 3WF5A 3TNWA 5IEYA 4CYIA 3HRBA 3FZTA 1FPUA 2B4SB 4PY1A 4OR5A 2QU5A 3AMBA 2BMCA 2PHKA 5CNNA 2CGVA 2CNQA 3VUKA 4R3RA 2F9GA 1Q24A 4TZRA 3QD0A 3FLQA 3NNVA 1BX6A 2QG5A 2BAQA 4JX3A 3LMIA 5HIDA 4NH1A 5JK3A 5LQFA 3UPXA 3NNXA 4AN9A 4DGNA 3C5UA 5HU3A 5HCZA 2JGZA 2OIDA 5ANKA 4BZNA 5E9EA 1G3NA 4YSJA 2QOLA 5H8GA 1SVGA 4PMTA 5FDXA 4BGQA 4TWPA 4ANQA 2AC3A 3VF8A 2CPKE 2OO8X 5CYIA 5CQWA 3Q9YA 3SRVB 4BDAA 3SX9A 4IACA 4L3LA 5IA2A 4DF3A 1Y57A 5GIOE 2ITWA 3KRJA 5HO6A 3TDWA 4WNOA 5ANJA 1B38A 3DU8A 4YC3A 5EDPA 4R7BA 3QRTA 2R3MA 3ZU7A 2XMYA 4MXAA 3A4OX 3MA6A 4FE2A 4CGAA 3R0TA 4N6ZA 3RHKA 4YO4A 2ITPA 3ZRKA 5LMBA 5I9XA 3OUKA 4AT4A 4CFVA 1R78A 2QURA 3SDJA 5LCJA 3D15A 2XRWA 3PRFA 4CFNA 2YM5A 3ULZA 4NM0A 3UIBA 4MD7E 3V01A 4O1PA 4QMTA 3FLWA 2RFNA 2VTIA 4QMXA 3PIZA 4Z3VA 2PMIA 4X2JA 3NSZA 2PUPA 1PMUA 3UZPA 4PF4A 4E6DA 4XCUA 5KMIA 1XH7A 4V0GA 4BCMA 4EH2A 2UZEA 2J0JA 1PXJA 5AP1A 3R2BA 3IGOA 3MTLA 4GU9A 3HX4A 3HV5A 4HYUA 1IAHA 3QUDA 3QZHA 3VQHA 4GUEA 3LMGA 4GFGA 4MBIA 3FLNC 3R1SA 4HPTE 4HCUA 5L6WL 1ZMUA 3DK7A 3QUPA 1PYEA 4LM5A 3KULB 3UQCA 5DR6A 3Q2MA 4F7JA 2HY0A 2GFCA 1JBPE 5HE2A 3DNEA 5KMNA 4XV2A 3BI6A 4RC3A 2UUEA 4I5CA 3TNHA 4A7CA 4X2KA 4BF2A 2R0UA 4C35A 5KBRA 4PPBA 2R3NA 4CCUA 2YJRA 2YWPA 2W4KA 4KBCA 4TRLA 3PE1A 2PMNX 5DOSA 3FDNA 3AOXA 4U9AA 5EKOA 1URCA 3UG1A 1DI8A 1PMEA 3RTPA 4BCFA 4ZTRA 3K3JA 3I60A 3P5KA 3R8LA 4AOIA 4FKRA 3R7VA 5CU3A 1OL5A 2WMVA 3HLLA 1TQMA 4QP8A 5DVRA 3RINA 4XUFA 2OF4A 5K5XA 3QA0A 2XK9A 2WQMA 4F0GA 5L2IA 3OEZA 3HEGA 5EI8A 4KBKA 2R3GA 3ZFXA 3UVPA 5CEIA 4IAKA 4RJ6A 1WBNA 4PNKA 4IM2A 4XG6A 1YHWA 5BVEA 3SVVA 3CD8A 1XH4A 3JVRA 4FT9A 1U5RA 3UODA 4F63A 3E8DA 3LOKA 4ONAA 3TN8A 2ZM4A 3ALNA 4ZIMA 4DH7A 3BHUA 5C4LA 3BHVA 3LFQA 3QTSA 4GK2A 1H01A 4GYGA 4ZSLA 3EFLA 5LMAA 2YCQA 4HJOA 4FIEA 4H3BA 2PY3A 2XIXA 4MD8E 3LJ1A 3OS3A 5D10A 5E8YA 3E8EA 3QAME 5JQ5A 5IQEA 3QUEA 3H9OA 5CALA 1XO2B 4L6QA 4RQKA 5IF1A 3KK8A 5C8NA 4ZXTA 5GJGA 2R3OA 4FTKA 3WF9A 3I5ZA 3FXZA 4RVTA 2R3HA 1JVPP 4EH7A 3E3PA 3RP9A 1PXMA 4IB5A 2NRUA 4JR7A 5EDRA 4DINA 4HZSA 3NCZA 3QALE 5E90A 4BHZA 4MQ2A 5DR9A 4R8QA 5EYDA 4DCEA 5ITAA 4RJ7A 4W4YA 4YGAA 4A4OA 3T8OA 3HA6A 1VJYA 4I6HA 4I0TA 5AUWA 2RKUA 3LFEA 5I3OA 5A4LA 1LEWA 4IAAA 3FXXA 4Y8DA 1CKIA 5F1ZA 3QXPA 2R3IA 3TIZA 1PY5A 3R6XA 4UYAA 2V55A 4BZDA 2QOKA 3HYHA 4Z55A 5EQYA 3E64A 3RPVA 4ASXA 4ZJVA 3OD6X 3P9JA 4BDGA 3L8VA 4R78A 4E93A 2A1AB 1FBNA 4LUEA 2PZIA 5HGIA 3GU4A 4C2WA 4FI1A 4LUDA 3BX5A 3ZDUA 2R3PA 1J3HA 3Q32A 5HORA 2PWLA 1EH4A 1OPLA 2JITA 3KMMA 4TTHB 3S2PA 3ZM4A 4AE6A 3KKVA 2CJMA 4L44A 5E92A 4FV8A 4ZSGA 1MUOA 2R3QA 2XEYA 3DKCA 4FIFA 2OBJA 4IEBA 3LFCA 2FA2A 3LM0A 3OOGA 4R3CA 3PP0A 5ETIA 4YBJA 4C4HA 2WMQA 3W8LA 1ZYJA 4RJ4A 4IJ9A 4FKTA 4BDFA 4V0GB 1OL2A 4RSSA 3VUDA 3II5A 2B9HA 4GK3A 5DMZA 4E4NA 3JR1A 4KKEA 4BDBA 4H58A 3UC3A 2OJGA 2X81A 5AM7A 1AQ1A 1H1RA 4O91A 1Z5MA 3MWUA 3WYXA 1YXSA 2B53A 3QQGA 5HCXA 5LVOA 2JFMA 2VV9A 4OTPA 5CAVA 3QC9A 4JDKA 4DTBA 2X9EA 3ET7A 3BU5A 5EW9A 4PMMA 4PTEA 5DEWA 3NUNA 4BWKA 3S4QA 3AC8A 3I1AA 3VF9A 3EZVA 2XIKA 2XKCA 5E8UA 4A9SA 4ANMA 5FD2A 3VQUA 3FUPA 2JAMA 3DGKA 1U5QA 2R2PA 2RG6A 3UOLA 4CMUA 4ZTLA 5C26A 3BKBA 3UO5A 4FBXA 1PF8A 3AC3A 3D83A 1MRYA 4R1YA 4CZTA 4F1TA 4P7EA 2B0QA 3ORLA 3CE3A 1WBPA 4IC7A 4O7TA 4RVMA 4XMOA 2YZAA 4WHZA 5FRIA 3VRZA 3IW6A 4HVGA 2BDJA 2Z60A 3T9TA 3TTJA 3TDVA 3A7HA 4FSRA 4EHGA 5JRQA 4FV4A 3MGYA 4KSQA 2QOBA 4OTRA 2O5KA 2C0TA 4RZVA 5J95A 4AA4A 5CF8A 2C4GA 2WOTA 3KRLA 4XG8A 3UO6A 1M52A 4LRMA 2CHLA 4BIDA 4CMOA 3L1SA 3OWLA 4M69B 5LVNA 2HENA 2HZIA 1H28A 1CMKE 4PTGA 3PVUA 4PDOA 3VS4A 4EC9A 4S2ZA 3UZTA 4GU6A 2NPQA 4EOJA 1FGIA 1H25A 1OL1A 2R3KA 2OGVA 4DEHA 3D14A 2O8YA 3W32A 5IUHA 1U4DA 1L8TA 3GC9A 3KXMA 3O51A 4ZSJA 5KE0A 4C4EA 4D55A 2BRMA 2W1HA 4ZP5A 3D5VA 1F0QA 1YDRE 5J79A 3FC2A 3LIJA 5DBXA 3WZJA 4GG7A 2XVDA 2RIOA 3O0GA 5CF5A 4ZOGA 2H6DA 3KY2A 2YIRA 1GIHA 3R83A 3ZZEA 4AFEA 4I6QA 3RALA 4UWYA 3ZEWA 5A4CA 5TKDA 3EL8A 3FZOA 2EVAA 3EZRA 4BY9E 4TYHA 3OTUA 4FKIA 1KE7A 4IM3A 2ZVAA 4MVFA 4F9WA 3H9RA 2VX3A 4USEA 5EOLA 4DFLA 3AC1A 4HNFA 3R9OA 1BL6A 1UA2A 3R1YA 4O6EA 4WA9A 2O64A 3E87A 4FZFB 1R0PA 3CKWA 1YW2A 3FZSA 4M68A 3RAIA 5AA9A 3UQFA 2PK9A 3A7FA 1V0PA 4BI2A 1YI6A 1JKLA 1YXVA 3ORNA 5AJQA 4U40A 3F6XA 4S34A 5C9CA 3RGFA 4C57A 3AT4A 3IQ7A 3ZO1A 3A62A 3QA8A 4HGEA 2DWBA 3I6UA 3CY2A 1BMKA 3QGYA 3WILA 5GJDA 4YNOA 4O0VA 5CAOA 4E73A 3DJ7A 3EQFA 3N9XA 4OTHA 3KA0A 3KXZA 3LXPA 3EFWA 4I6BA 4YP8A 2BIKB 3DOGA 2P2HA 4QMNA 5JZJA 3VS7A 3F88A 1E1VA 4NSTA 3MTFA 4YC6A 2BKKA 3KXHA 4GEOA 2WXVA 3DBDA 5AR3A 4EOQA 4J97A 3OW3A 3BQCA 2OJFE 2UW7A 4FEXA 2VD5A 1YOLA 2IVTA 5E8XA 4N70A 4U6RA 4RGJA 4YJUA 5I4NA 4CT1A 4MBJA 3LM5A 1K9AA 3NYXA 2VWWA 4FSUA 2FVDA 5B2KA 3HAMA 5IZFA 4G2FA 4XG9A 3RI1A 3PJ2A 4QQCA 4DG0E 3DXQA 3CR0A 3FI3A 2HW6A 3JXWA 5FEDA 2R3FA 1IRKA 3QX4A 1OM1A 3P7AA 3QGWA 2QNJA 2JKOA 3FMHA 3ZHPC 1VYWA 3OTVA 4ORKA 3DXNA 2BIYA 1DI9A 2OWBA 3A7GA 1FVRA 4RJ8A 4OAUC 5I3RA 3C4CA 3GXLA 3EYGA 3A7IA 1X8BA 5C1QB 2JDVA 1W83A 4C3FA 3NUPA 3BE2A 1KOAA 4BKZA 4AG8A 2XK7A 5AP0A 4IZAA 4BTFA 5A9UA 5E4HA 1SNUA 4RLKA 3ORXA 5HD4A 4CG9A 2W9FB 4YZCA 3EIDA 5IISA 2E9OA 3MA3A 4ZS4A 4FKWA 5M57A 3W8QA 3WOWA 4QNYA 1P2AA 4Y72A 3IOPA 4QPMA 5AP4A 4OTIA 3MSSA 2C6MA 3FMMA 3FSFA 1NY3A 3LFBA 2IZSA 5EG3A 5AM6A 5ETFA 3EQCA 4FMQA 4CZUA 4BICA 5HVJA 4GJ3A 2OLCA 2V62A 3UDBA 1KE6A 2RL5A 3KFAA 4JDJA 3B2WA 3GCPA 1Y91A 5CSHA 5IH6A 3COKA 3MJ2A 3A8WA 3RKBA 4CSVA 5IQHA 3HV3A 2B9IA 5CASA 5M53A 5KMOA 3PG1A 4XV3A 2VTTA 2XCHA 3TV6A 1Q8UA 3CQWA 2X2KA 4MH7A 3WF7A 5BYZA 2BKZA 4F6UA 3WBLA 4C38A 4CKRA 4L7FA 5CEOA 3MB6A 2WB8A 3NUUA 5CI7A 4BB4A 4CVAA 3PVBA 2CSNA 2QHNA 3WZKA 2GS7A 4O27B 3KRXA 4FL3A 4TYHB 4U3YA 2Q0NA 3FMEA 3P1AA 4ZTSA 2UVYA 3RM6A 3VBYA 3EQIA 3PA3A 2QOCA 4BKYA 3QTZA 2W1EA 4E1ZA 3DA6A 3MS9A 1J91A 4JQ7A 1GZOA 3PPKA 3ORZA 2C3JA 2W9ZB 4EH9A 1J1CA 3ZMMA 3QZFA 2OF2A 3W2QA 3HL7A 2QQ7A 3GOKA 4IAYA 3QBNA 4WKQA 4KA3A 4RFMA 5AP6A 5FEEA 2QVSE 4I94A 4O6LA 5LJJA 3CCNA 4L52A 2B9JA 3F5UA 3RPSA 1GZ8A 2OXDA 3WIKA 3DTCA 3W55A 4EJ7A 2VRXA 1GZKA 2P2IA 5CU6A 4O38A 4NYEA 4CKIA 4F0IA 3MPTA 4CFXA 2YFXA 2X1NA 3TUBA 3P78A 2XRUA 2EB3A 3OBGA 3V8WA 5KMLA 5B7VA 4PL3A 4HYSA 4U43A 4DEIA 3QWJA 1BYGA 1KV2A 2PVKA 4F9AA 3GU7A 4CQEA 3F5GA 4QYFA 4XBRA 5CZIA 4D2VA 4IVDA 4L7SA 3UTOA 1XQZA 3F5XA 4U7ZA 4FSMA 2WQEA 2A27A 3POOA 3HV7A 1TQIA 4IX5A 4K18A 4DLIA 2HAKA 3F2AA 3KL8A 5EYMA 3TEIA 4IVBA 2Z02A 1Q5KA 2ERZE 3GC7A 4QT1A 4O7YA 1PXLA 1STCE 2RFDA 2QOOA 5D11A 1R39A 2ITQA 4JJRA 3JPVA 2GSFA 2PVHA 4FG9A 2E2BA 1OIQA 3GCUA 3MBLA 4KKHA 4FV1A 3TCPA 2PMOX 4G9RA 2YIXA 4RWIA 5AV2A 2HYYA 4IX6A 4IJPA 1APME 2VO7A 3D4QA 2CN8A 3AC5A 4X6QC 4U3ZA 1XH8A 5ANDA 4F6SA 3UIMA 4MNFA 3H4JA 3VW6A 3ZLYA 2VX0A 4JAJA 2W1GA 4QP2A 4WSQA 4X3FB 4QRCA 5EDQA 2FYSA 3CC6A 2ITVA 5E8TA 3S0OA 4EEVA 4KKGA 5BX0A 3ZRMA 4GMYA 5DH3A 3QZIA 3R7GA 3VJNA 3GU8A 2XH5A 3Q4CA 3DFAA 4FG8A 4FEQA 3C9WA 4YZ9A 5ACKA 4DFYA 3LHJA 2X39A 4DH3A 2BRGA 3BQRA 4WOVA 1IEPA 1YWNA 4KSPA 5IG1A 4WRSA 2ZAZA 1H0WA 2OG8A 5A4TA 2YCFA 4JG8A 2UZLA 5LWNA 2O63A 4ZMFA 3CEKA 1ERKA 3HMMA 2PVLA 4IH8A 2WU7A 5EM5A 3BV2A 2GQSA 1PXNA 2W96B 3BBWA 4DH1A 3TTIA 3R7YA 1G8SA 4UMTA 2ZMCA 4YLJA 4JNWA 4AW2A 1YVJA 5J7BA 4V01A 4CD0A 4O96A 3E8NA 4IB0A 4M67A 1OBDA 3HMOA 3NW5A 4TKSA 1P14A 2UZBA 2W06A 2WTKB 3QRJA 5HG9A 3T9IA 4RT7A 2WMXA 3WF6A 4EH6A 3EN5A 4GG5A 1NA7A 1YOMA 2YDKA 3QU0A 2HOGA 4FVQA 3W2OA 2DS1A 5IQDA 2HZ0A 1YI3A 1XH5A 4TPTA 4CCBA 4S32A 1ZMWA 3EB0A 1FGKA 1IAJA 4O0YA 2XIZA 5IMEA 3L9LA 3NYOA 1OZ1A 3PY1A 3CKXA 4JIAA 5FG8A 2YACA 5HG5A 2JIIA 4U8ZA 3CJFA 4GCJA 4UXQA 4A4XA 3BPRA 5IDNA 4Q9ZA 2B7AA 3CD3A 3PYYA 4JX7A 3D9VA 4KS7A 3SRVA 2UW5A 3UYTA 4AQCA 3FHRA 4BC6A 5JKGA 3E7OA 4O2ZA 1M2QA 3OT3A 3G6HA 3PSBA 4J98A 4FNWA 3UVRA 4BR3A 1JNKA 3QRKA 3ZYAA 3WE4A 3EKNA 1Y6BA 2ZJWA 1KUTA 2YM3A 4QO9A 5TOZA 2YLFA 3EJ1A 4IB1A 3ROYA 4E7WA 1TKIA 5E8ZA 5EK7A 3SW4A 4Z16A 5L3AA 2YA9A 2C6IA 1F3MC 2DYLA 4CFUA 2XNBA 4WG3A 3W2SA 4F09A 4MTAA 4NKSA 4TWNA 5FTOA 1IR3A 4AN3A 3GQIA 1YQJA 4BL1A 3V5QA 4N57A 2XNMA 3HV4A 5HESA 4IX4A 2J4ZA 4KIPA 2E9UA 2IWIA 3ACJA 4FOCA 1H1PA 3TKUA 2R4BA 2WIHA 3BWFA 3NYVA 2XKFA 4BIBA 3COHA 4X0MA 1WVWA 2VTNA 2VO6A 3NGAA 3D5WA 4RWLA 4FTIA 4RVKA 1OB3A 4AAAA 4AZVA 2YIYA 4S31A 5DR2A 1ND4A 4EI4A 3H10A 1IASA 5IQAA 2YHVA 3KULA 4MKCA 4FKLA 4XP3A 2PVJA 2WAJA 3PVWA 2BVAA 2PULA 3FWQA 5EHLA 5AA8A 2V7AA 3QD2B 2A4LA 3VVHA 4DAWA 4EOSA 2GPHA 2QO9A 4QPSA 2QR8A 4MXOA 4TYIA 4R1VA 3G9LX 5JZNA 1H1QA 1OMWA 2XJ2A 4N6YA 5E1EA 5GIPE 4ALVA 4I21A 2G01A 4MD9E 4X2NA 5HNGA 4Z7GA 4K2RA 3GQLA 4NW6A 4YTFA 4DEGA 3BU6A 1Z9XA 3NRMA 2UV2A 4AW5A 3QYWA 4YZBA 4EL9A 4FYOA 1R0EA 2GNIA 4NJDA 3DAKA 2W17A 4J96A 4KWPA 4I20A 3FPQA 3TKIA 3LFAA 4HOKA 4XS2A 4E6CA 4M0YA 4DBNA 4IAIA 5ETCA 4DN5A 1UNHA 4BCPA 4YC8A 4M12A 5HO7A 2IG7A 3UE4A 4O7VA 2YDJA 3GFWA 4HNIA 4QTCA 2W1IA 2GHGA 2F49A 5H3QA 4EQMA 3AC4A 5FBNC 2GMXA 3C13A 3F69A 4FKPA 3ENHA 4UWBA 3HDNA 2F7EE 2RF9A 2IN6A 5CT7A 5B0XA 2CGUA 4G5JA 4D2PA 1SYKA 4PL4A 4IM0A 4OBOA 4QMWA 2WTWA 3O50A 1WAKA 4TYGA 3UNZA 5HVKA 2UVZA 3IKAA 3BCEA 4CTCA 4U79A 4RA5A 1Q97A 3GGFA 3LE6A 3VJOA 2OU7A 4NFNA 4NK9A 2G9XA 1PKGA 3S3IA 4AU8A 3CPCA 4OT5A 4RZWA 5AIKA 4DHFA 1OVEA 4D4YA 3QTXA 4XV1A 5LXMA 4AZWA 4LL0A 1AGWA 2BFYA 2H8HA 2I0HA 4IB3A 4ZY5A 1M7NA 5FUTA 4WIHA 2BUJA 3AGMA 3C4ZA 3FLYA 5CANA 3ALOA 4QP6A 3BHHA 2XIRA 4IDTA 3BGZA 4QNAA 2WMBA 4ZEGA 4F9YA 5HX6A 3FMLA 3K3IA 3DBQA 3QWKA 4HGSA 3EH9A 3QRUA 2QO2A 3RHXA 3BEGA 2VUWA 4EK8A 5BVDA 3F2NA 4L68A 4B99A 3GOPA 1R3CA 3FY0A 4O0XA 2EXCX 5FWKK 3KXGA 3UOJA 4W9WA 4D2RA 4MCVA 4DEDA 1LUFA 2CNVA 4O7RA 4O83A 1YDTE 2XIYA 3QTRA 4BCHA 3OP5A 1ZAOA 2C1BA 3EQPA 1HOWA 3NZ0A 4L53A 1LR4A 5GHVA 3RM7A 3FYJX 2ZV9A 3MY1A 3RPYA 5KZIA 5DT4A 3DV3A 2FSMX 5DT3A 3F3VA 4XRLA 3WF8A 3FI8A 2Y6MA 2X7GA 4C33A 4PDYA 3I81A 1MQ4A 4YBKA 3MH3A 3CBLA 3FLZA 4FIIA 5AWMA 3FEGA 1YKRA 3E3BX 3TNQB 3BELA 4IIRA 4AWIA 1GIJA 5EI6A 5HBJA 1BKXA 2BTRA 4RQVA 4R6VA 3COIA 3HVCA 4QOXA 4BTJA 2X0GA 5JFXA 4H3QA 3E63A 3ID6C 4R7IA 4NM3A 4XNEA 1Y8YA 2IVVA 5CLPA 3ZLWA 3DK6A 2XM8A 4APCA 4OTWA 1H24A 1Q62A 3MJ1A 5HVYA 3JVSA 4ZLZA 1UU3A 3OW4A 4YHJA 5M06A 4LOOA 1ZY5A 2GNLA 2CKEA 4I3ZA 2XK3A 1JPAA 4G34A 2VTLA 3POZA 4O7WA 4F7SA 1H26A 5L2WA 3G9NA 3ZBXA 2VWVA 4C3RA 4XOYA 4E3CA 5CWZA 5EW3A 2CKOA 4BWXA 1REKA 4E5WA 1KE8A 3KRWA 3PWYA 3CQEA 3D2KA 4AT3A 5M08A 3B8QA 2W5HA 5DHJA 2R64A 2Y7JA 3KXNA 1PMNA 4U97A 5CNOA 4ZJJA 3R9DA 2VTJA 5K4IA 2BZJA 2CGXA 4KBAA 4WNKA 2JFLA 3KMWA 3W33A 5KZ0A 3HNGA 5DWRA 4W9XA 4EZ5A 5HIBA 1WCCA 2G1TA 3UP2A 1PMVA 2Z8CA 4M69A 5ICPA 1U46A 3QTUA 1PW2A 2UZWE 4WT6A 3ZDIA 5AADA 5IU2A 5K9IA 3BLHA 4YHTA 1JOWB 1YRPA 5IQGA 4ITJA 5CU0A 1JSUA 3QD4A 2XCKA 4HW7A 2C6LA 4I24A 5CAUA 3BU3A 1QMZA 5HQ0A 4B7TA 3IGGA 4HZRA 2OSCA 3Q96A 4P4CA 5DT0A 5JRSA 3AMAA 3EQRA 2XZSA 4GH2A 4YNEA 4ZTNA 4FEUA 4Y5HA 4G17A 2GQRA 2BRNA 2F2UA 3BHTA 1Z57A 2A2AA 1UU9A 3VS5A 4FTCA 2HCKA 3TZ8A 4G3EA 1BUHA 4FTJA 4D0WA 5JFVA 1KV1A 5FTQA 4RVLA 3OHTA 4JBVA 5KO1A 2EXMA 4FOBA 2UW0A 1MP8A 3BZ3A 4BTKA 3OCGA 2R3RA 1CKPA 5JSMA 1B39A 4EKLA 3CPBA 5CAPA 1OUYA 2QHMA 1GZNA 4D4VA 4G6LA 5CEKA 3Q52A 1ZMVA 4EHVA 4QMVA 2C5XA 4MF0A 5AEPA 4NM7A 4ZSEA 4ZLYA 3R7IA 1PXPA 1K2PA 2J0IA 4G3GA 2PUIA 1IA8A 4CQGA 3OXZA 3ENMA 3G0FA 4FTNA 1GNGA 5CENA 2Y4PA 5CTPA 2XKEA 1SMHA 3PXRA 5CXZA 3H3CA 2PTKA 1BL7A 4AE9A 4ACCA 3LJ0A 4S30A 4LQMA 3C0GA 3JY9A 3R8VA 4GKIA 2IJMA 3D94A 4FKUA 4NTSA 1HCKA 3F3ZA 2WNTA 3V8SA 3VWAA 3HAVA 4JQ8A 5J9YA 3K54A 5HLPA 5HNBA 5D41A 1GJOA 4LYNA 4IWDA 4L8MA 3OY3A 1J1BA 3ODYX 4EOPA 5CT0A 5KMMA 4UN0C 1UWHA 2XJ1A 5GZ9A 3MN3A 2YISA 4GV1A 4RIWB 4GT4A 4RMZA 4FEWA 2J51A 3C0IA 4BDDA 4F6WA 4YMJA 2PL0A 2I40A 2X7OA 3LCSA 3FI4A 3L8PA 3MH2A 1ZOEA 2XBJA 3PJ1A 4NEUA 3LW0A 3SC1A 3NDMA 4OTQA 5TE0A 2OI4X 3FL5A 2C5YA 4W8EA 2Y0AA 3I6WA 3Q4UA 3QHWA 3QXOA 3K5UA 5CSVA 5M4UA 3V3VA 4L9IA 3W2RA 1V0BA 4CYJA 4IZYA 3I0QA 3NW6A 2GS6A 4TW9A 4JXFA 5EW8A 3MI9A 2BILB 2Q0BA 3PE2A 4RG0A 1Q61A 5J1VA 2Y9QA 2OZAA 4I5PA 2OFVA 4J52A 4BCIA 3I7CA 4EH8A 1NVQA 4O0SA 4QP4A 3LCDA 1GIIA 1OKVA 3FQEA 3ZC6A 4B4LA 4GW8A 4AGCA 5A46A 5D7AA 5LVLA 2W7XA 1F5QA 1UU8A 2C47A 2CCIA 5I9ZA 5JGAA 4BIEA 3ZUUA 5J5TA 1H8FA 3LQ5A 5DYJA 3RK7A 4G9CA 3TV4A 3ODZX 3HZTA 5F9EA 3MFTA 4O7ZA 4I5HA 5HICA 4WSYA 4FK3A 4RX7A 3IW5A 4YTHA 4O84A 2RG5A 4BRXA 4R3PA 3GCVA 3IO7A 3R9NA 3FQSA 3R22A 5CY3A 4AF3A 4ZLOA 4FNXA 3IDCA 5CSXA 5FXRA 5AUZA 4Z9LA 3PXYA 3LMHA 3P23A 4EYJA 3LVPA 4ZTHA 1ZRZA 2R7IA 3R63A 3OEFX 4ZSAA 3LXNA 4QTBA 1NVRA 5L8KA 2VO0A 4QQ5A 4OTFA 4BYJA 3R2YA 3TJCA 4TY1A 3PZEA 4O2PA 2IW8A 4C36A 1ZOHA 3WIGA 4IWQA 3N4UA 4NM5A 3CY3A 3F9NA 5I9VA 4YJSA 5BNJA 5AUVA 4JBQA 4Y73A 1KE5A 2WZJA 4JL9A 2YERA 3KRRA 2Z7SA 4JBPA 2LAVA 5G1XA 3MPAA 5A4QA 3WZEA 4ZS0A 4IFCA 3CGOA 4FUXA 4IC8A 4EONA 3R8MA 4M66A 5HIEA 3VHKA 3L8XA 4FTRA 4PQNA 4W4VA 3DKGA 1XHAA 1W84A 3SXFA 3ZFYA 1ZYLA 5HBEA 5AUUA 4GRBA 4UALA 4C2VA 3A4PA 2VWZA 4MEDA 4M84A 4QTAA 2QOQA 3R9HA 2G2HA 3C1XA 2R9SA 3U6JA 3QLFA 4H36A 3LQ8A 4RIYB 3ACKA 2IVUA 3ULIA 4CRLA 4C02A 4IDVA 4WG5A 2YDIA 4IMYA 4F7NA 2JDOA 1QPEA 3HUBA 4A07A 3PXFA 5I9YA 3F82A 5AAEA 3FBVA 1SVEA 3FKLA 4UYNA 3FAAA 3OWJA 4FF8A 3LFNA 4NIFA 3I5NA 3PSCA 1GY3A 2J9MA 4D1SA 3C4FA 1OGUA 3FY2A 1M7QA 1UKHA 4FL2A 2OKRA 3G5DA 4AGUA 2C5OA 3U54A 2ITTA 2QLQA 4DG3E 3OZ6A 4TNDA 4O86A 2CCHA 3QHRA 4YJVA 2W05A 4UEUA 5CS6A 1OIYA 4FSQA 4Y85A 1S9JA 4JDHA 4O0UA 4AOTA 5JGDA 5HO8A 3DS6A 4LGDA 4ACDA 1RE8A 4BZOA 3G15A 4CFFA 1QPDA 1ZZLA 3QCYA 4HVSA 2QG7A 3O2MA 4UXLA 3WI6A 3OC1A 4XRJA 2QI8A 3HMPA 2XKDA 4CLIA 2EUFB 3UYSA 5AUTA 4J1RA 5FGKA 4APPA 2YIWA 4CLJA 4K8AA 5EYKA 3TXOA 4I4EA 4UWCA 3RJCA 4BHNA 3R1NA 5FTGA 5KKRB 5HEZA 2XK6A 4KD1A 4U41A 2JKKA 4WBBB 4J8NA 5K0KA 3ZH8A 2ACXA 1QPJA 1QCFA 3IW7A 3BV3A 3TZMA 2PU8A 2OH4A 3ORPA 4FTQA 4FX3A 2C6KA 4BN1A 4FNZA 3ZONA 1ZOGA 2OZAB 5AFVA 2JDTA 5T3QA 5IA0A 2B54A 4N0SA 4IWOA 5M51A 3FMJA 4RLLA 4XHKB 3SXRA 4IFGA 4FTTA 3SAYA 1WVXA 4J53A 3V5TA 2J5FA 2P55A 3G33A 3IW4A 4X3FA 2ZDUA 4FT0A 4PMSA 5DFPA 2PUUA 3VS2A 1W7HA 3N4TA 4YZDA 5CU4A 4YPSA 3M42A 1JSVA 3OUNB 3FKOA 3KB7A 4QD6A 5IUIA 3QKLA 4G6NA 4GJ2A 4QP7A 4QTDA 4D5HA 1M2RA 3KMUA 4ID7A 1O6LA 4AUAA 3MFUA 5E8VA 4X21A 2JKMA 4MXYA 1ZYSA 2UW8A 3KCKA 3ZUVA 5L8LA 5IQIA 2X8IA 5IH5A 1ZYDA 3RAWA 3NS9A 1W8CA 3OMVA 3DBFA 4I5MA 2WU6A 3DB6A 4IW0A 3RMFA 3QCSA 5ANIA 4F08A 2O2UA 4EOLA 3FZ1A 4EH4A 4B8MA 5M56A 4WO5A 3GCSA 3UIXA 4BKJA 2H9VA 4FICA 4YJOA 2OH0E 2UZDA 3IW8A 2R5TA 2WQBA 4FGBA 4X3FC 3TIYA 3PPZA 4ASEA 3P7CA 3VULA 3LKMA 3F2RA 3RAKA 1JAMA 4HPUE 4D9UA 3E8CA 5AV1A 4EBWA 5IA4A 5EI2A 4JRVA 4Z7HA 5JQ8A 2C30A 1PXIA 2OICA 2X4FA 2BZHB 3H0ZA 1Q3WA 3BE9A 3T3VA 2WPAA 4O22A 4XBUA 2GNJA 4QYEA 3O8TA 1Q99A 2XYNA 4J95A 1H1WA 3IOKA 5AP7A 5GZ8A 3N4VA 4DH5A 2OFUA 3OOMA 4RPVA 3RBWA 4O7SA 4JQEA 1FMKA 3QFVA 3GC8A 3PY0A 1FVVA 2UW3A 4XP0A 3W16A 5LVMA 4YO6A 5AP3A 2A19B 4L42A 3SOAA 4O0TA 5E8WA 3DBCA 4PP7A 4MXCA 3BYVA 4MXXA 3TNPC 4BDKA 1PJKA 2VWIA 3MY5A 2HWPA 4BDCA 4H1MA 4NIFB 4AZEA 4FR4A 3V5LA 3LXKA 4D2SA 3NYNA 4QYGA 4ZK5A 4RC4A 4C4IA 1UNGA 4DFZE 4DGMA 2GHMA 4IE9A 4MWIA 5D12A 3MIAA 4CG8A 4E4MA 2Y4IB 5BVNA 4Y5QA 2C3LA 2WTKC 2G15A 4JVGA 4MHAA 3OY1A 1HCLA 2J90A 4NU1A 3VW8A 4ANOA 4QMMA 4G1WA 5AIRA 2X8EA 2UZUE 3CXWA 2WELA 3GCQA 4JBOA 4ZAUA 2XM9A 2J0LA 3TNIA 2GHLA 4LI5A 3VBXA 4EBVA 4FA2A 1LEZA 2VN9A 4CXAA 5H8EA 3BRBA 4PL5A 4GVAA 3PA5A 3NAXA 4QMYA 4AACA 2UW6A 4YUQA 1PXKA 2C6DA 2XK8A 4G6OA 4WNMA 4XOZA 3RVGA 4EWQA 3GI3A 2SRCA 4ACGA 3MDYA 2QOIA 2WO6A 4H1JA 1JLUE 2GTMA 4LFIA 3FL4A 4F9CA 4DCAA 5JGBA 2IVSA 4XLIA 5HU9A 2WD1A 3P0MA 3UPZA 4JDIA 5CU2A 4E6QA 3GUBA 4IHPA 4FSTA 4B8LA 1T46A 4Q2AA 3ZC5A 1YXUA 3DTWA 4P5QA 3U4UA 3KCFA 2YM7A 3QRIA 2Z2WA 4K9YA 4NCTA 5LOHA 1U54B 3ROCA 4OAVB 3N51A 4BDIA 4EC8A 5DRBA 5H2UA 3KF4A 3DK3A 4DFUA 5DPVA 3A8XA 3NUYA 5C27A 5F4NA 2YEXA 3PSDA 2WTVA 2YITA 4CEGA 4DYMA 4CV9A 1JSTA 1QPCA 3REPA 4HVHA 5ANOA 4JLCA 4FTUA 4QMUA 3DPKA 4JI9A 4XYFA 4EHZA 3OCTA 5HOAA 2HXLA 2C6EA 3DAJA 1WZYA 2PE1A 1E1XA 2O3PA 3HA8A 4U81A 3T3UA 4OGRA 2X9FA 2ITYA 3R02A 4ZTQA 1ZLTA 4C58A 2V5QA 4QYHA 4U44A 4BGGA 2CLQA 2GTNA 3K5VA 4BBMA 1CM8A 3PIXA 4NCTC 4AW1A 3NVKI 2E9VA 4X2GA 3ANQA 3GNIB 5D7VA 2RSVA 3R21A 3O96A 1OIUA 1XBCA 3QF9A 4UB7A 3HKOA 3RCDA 3I79A 2AUHA 2PMLX 4M7IA 4YLLA 4D58A 2IZRA 2BRHA 5DNRA 2ZV7A 4K11A 3VUMA 3ZO3A 1H08A 4AP7A 3C7QA 1ATPE 4G31A 3QQUA 4M97A 5CVGA 1RQQA 4M0ZA 4DTAA 4EOIA 3DNDA 3W18A 1M14A 1DM2A 2QCSA 4XP2A 4QPAA 5TF9A 4UZHA 2W5BA 2VGPA 2XB7A 1KOBA 3NMUF 4KIKB 2WEIA 3BEAA 3NR9A 4BCGA 5AUXA 2YM4A 3H9FA 3Q04A 3LCOA 5CX9A 5KBQA 1YHSA 3BHYA 1XH6A 1YI4A 2CGWA 5I5ZA 5M44A 5L6OA 2EB2A 3DAEA 3R7UA 3SGCA 4HVDA 4A9YA 3ORKA 2IZTA 1VR2A 2YAKA 4QMPA 1W98A 5HG7A 3Q60A 4AS0A 4ALWA 1V0OA 3ETAA 3VO3A 5BUJA 4BCOA 3HV6A 2NP8A 2PZ5A 1RDQE 4PWNA 4U0IA 1IA9A 4GFOA 3R04A 4GFMA 1REJA 2ZYBA 3D2IA 5GINE 3CQUA 5J9LA 1AD5A 3R73A 4OBPA 4AT5A 5HX8A 3U6HA 2ZM1A 2J0MB 1P4OA 4KIOA 2HY81 4LMNA 3G90X 2PVYA 3RAHA 1MRUA 3TG1A 1OBGA 3R30A 3OWKA 4F0FA 3ZEPA 1H4LA 1WVYA 3R8PA 1OIRA 4NWMA 3MESA 2I0EA 3LZBA 3DB8A 4PMPA 3C4EA 5B2LA 4KAOA 3UO4A 2BROA 4I41A 2XNGA 3RZFA 3NIZA 2XF0A 3UBDA 2NO3A 4XG4A 5GNKA 1DAWA 3ITZA 3R7OA 2GU8A 4I0RA 4EZ7A 4ANLA 1VYZA 1OPKA 5FXQA 2BDWA 1Q4LA 2YWVA 4RRVA 3HP2A 3R8UA 1YXTA 2C0OA 5AP2A 1Y6AA 3JS2A 4BVUA 4QMQA 2NNWB 3AD6A 2P3GX 3ZLSA 5AR4A 3EFJA 4UMQA 2YCSA 3KN5A 4I93A 4P2KA 5HE1A 5JH6A 3TUDA 5GJFA 4FC0A 4KRCA 4ERKA 3CP9A 3GC0A 2AC5A 4QP3A 5F95A 3UNJA 3BIZA 4IZ5A 2F2CB 5JFWA 3CTJA 1ZZ2A 4L67A 5EYCA 5BQ0A 2FSTX 2FUMA 2BZIB 2UW9A 4FZAB 3MFRA 1L3RE 1Q8WA 1W82A 3GEQA 3VIDA 4M15A 1ZYCA 4YR8A 5CVFA 2E9NA 2G2IA 3UNKA 3U9CA 3A61A 2BAJA 3OG7A 3PXKA 3VBVA 4FKVA 2P33A 5J8IA 3LFFA 4QTEA 5DN3A 2CKQA 4RFZA 3DLSA 2ITOA 4FKOA 3F7ZA 4FODA 5FLFA 2PZRA 3MVJA 3RNIA 3V8TA 2VNWA 4IXPA 1DS5A 3W2CA 2HZ4A 3GB2A 2PUNA 3VHEA 5ANGA 3F3TA 2PE2A 3QTQA 2F7XE 2ONLA 2EXEA 3LCTA 4PTCA 2VNYA 3P86A 5AAGA 2QO7A 1E9HA 3FSKA 1SM2A 3BYSA 3OFMA 4L3JA 3TZ7A 1CTPE 5BVWA 3ZBFA 2V7OA 1YDSE 2PVMA 3E5AA 3QQLA 2JDSA 4IX3A 4M14A 4GUBA 4MNEB 2BCJA 4YSMA 1VZOA 3TKHA 4EOOA 4MWHA 3ZS5A 4C37A 3UVQA 2X7FA 3FPMA 3WE8A 4Y46A 3HMNA 3VNTA 3PXZA 4G3DA 2XS0A 3PJ8A 5IEVA 2HWOA 3OXTA 3EMGA 5AAFA 4DITA 4NL0A 3ZM9A 4YJPA 4RIXA 2WMSA 4O82A 4D5KA 5JN2A 5KX8A 4NKAA 4DTKA 2I6LA 4AZTA 4EQCA 4AA0A 4FKJA 3W1FA 4ZMEA 4M3QA 3H0YA 4H3PA 4E8AA 5BVFA 4DEAA 1P4FA 4XH6A 4E4LA 4MYGA 2B52A 3IDBA 2R3JA 3BLRA 5DI1A 4AGWA 5AR8A 2PVRA 2B1PA 1TQPA 1TVOA 3FMDA 4PNIA 1U59A 4PV0A 3UJGA 3VAPA 4BTMA 4CRSA 2OXYA 5D1JA 4FV9A 5M55A 3V04A 2BR1A 4C3PA 2WTJA 3DT1A 5EM7A 5BYLA 4FK6A 4GSBA 3OXIA 4PPAA 1JQHA 2C1AA 3G51A 5JEBA 3V6RA 5IPJA 1WBSA 2XA4A 4DFBA 3F5PA 4H39A 5KUPA 3NUSA 3BWJA 3EHAA 2OIQA 3V5PA 5L2TA 4JT3A 3QQJA 4F9BA 3PLAE 1KE9A 4X3JA 4YJQA 1SZMA 3PY3A 3ORTA 4USFA 2WQOA 4F4PA 4RIWA 5EQEA 2JEDA 4FSNA 5BVOA 5F20A 3UP7A 3PJCA 4CNHA 2PVNA 2C3IB 4FT5A 5I9UA 4DG2E 5HHWA 5C8KA 5AMNA 5AX3A 4ASDA 1J7LA 1ZWSA 4I1ZA 4YZMA 3QKKA 3CLYA 5IUGA 3PDTA 2WQNA 3PA4A 4K0YA 3UGCA 1JKTA 3Q6UA 3AC2A 1JWHA 5K0XA 4LRKA 3R8ZA 4KUJA 3TI1A 1M2PA 4ZY6A 3E62A 1SVHA 3PJ3A 5HI2A 4RX9A 5J87A 4H05A 3LXLA 3DKOA 3VUGA 4W4XA 4V04A 4WD5A 3MPMA 2KULA 3O8PA 3D7TB 5IQFA 3UC4A 3NCGA 3U6IA 3HMIA 2HW7A 4HCTA 2W1ZA 4IVCA 4R77A 1KWPA 4W8DA 1PXOA 2J5EA 4TNBA 3Q4TA 4JG6A 2JC6A 2QODA
chains in the Genus database with same CATH superfamily
3W0PA 3HGKA 3OVVA 3Q9WA 5A14A 4PX6A 2WMUA 3FI2A 2PVFA 1UNLA 1FMOE 3M11A 5J9ZA 3ZTXA 3VUTA 3NNUA 4NW5A 4XJ0A 4FT7A 5T68A 1OKZA 3FXWA 3HECA 3FKNA 4EK3A 2I1MA 2X4ZA 5CXHA 2BAKA 4BDJA 3FMKA 3TM0A 2J50A 2WMAA 3HDMA 4L01A 1WBWA 4TWOA 4YURA 1Q3DA 4O1OA 4FEVA 3DQWA 3FYKX 2VAGA 3R28A 3F7WA 4IBMA 5HNIX 4YJNA 4J7BA 3NPCA 3IONA 4ITHA 4DLJA 2ZM3A 3KVXA 3SLSA 2YAAA 3U55A 2C6TA 3FJQE 4Q9SA 3RWPA 2CN5A 3OBJA 5M4IA 5AV3A 2X2MA 1OECA 4R5SA 4DGLC 1VEBA 3E7VA 1H07A 3KN6A 3KU2A 4RA4A 3BYUA 3KVWA 2C5VA 5A3XA 4F1MA 2XK4A 3VUHA 1G8JA 5A6OA 5L2SA 3MVLA 3IK3A 2ZV2A 3EQHA 3QQHA 4FZ7A 1MRVA 5AR7A 3VN9A 2GNFA 4A9UA 5DRDA 3Q3BA 2VTMA 4TXCA 4N4SA 3Q6WA 2W1FA 3JUHA 1B6CB 1XBAA 5K3YA 4D1XA 4EUTA 2EWAA 3MIYA 4G3FA 4FTAA 3PFQA 4BI1A 4G3CA 2ZOQA 4RIXB 2ITXA 4F7LA 4QQJA 3KC3A 4RIYA 2PSQA 3KGAA 4FNYA 2ESMA 3ORMA 3QQFA 4WUNA 3EQGA 2ERKA 4I92A 2XUUA 3QKMA 5HTIA 2FH9A 2X8DA 1JKKA 1R1WA 4O21A 5EM6A 4B9DA 3ATTA 2WHBA 4NZWB 4AXAA 4D1ZA 4KABA 5EQPA 4FV3A 5EFQA 3WYYA 4FYNA 3G6GA 2BFXA 4FSYA 1T45A 2XNOA 4TYJA 4ZZNA 3R9RA 1OL7A 3PG3A 1Q8TA 5KMKA 3F3UA 3R01A 5KNJA 1I09A 4IZ7A 4ZZMA 4QMZA 4TWCA 4OT6A 5EM8A 3P08A 2JBOA 3WARA 5ETAA 4D2TA 1G8AA 3AD4A 3NW7A 4BWPA 1URWA 4Y83A 4AOJA 4WG4A 5DLSA 1YHVA 4G5PA 4L3PA 3G2FA 2QLUA 3ELJA 2E9PA 2PZYA 3V5WA 2F4JA 2WIPA 2P4IA 3FC1X 3Q4ZA 4YTIA 3QD3A 4KRDA 3U4WA 3ANRA 2VTQA 3D0EA 3EN7A 4GT3A 4PUZA 3RWQA 1TFFA 3BYMA 4L00A 5L2QA 5IMXA 4E5AX 4V05A 4FKSA 2QONA 3O23A 2OIBA 4AA5A 1UU7A 4FIJA 4EUUA 4XLVA 1J7IA 3SG8A 3MFSA 5IA1A 2G2FA 3PTGA 4FG7A 5KMJA 2GNGA 3QYZA 1ZARA 3NIEA 4LL5A 2W0JA 4KS8A 1PHKA 3P7BA 3FLSA 2R3LA 2UZVA 2VTRA 2W99B 3P4KA 2QR7A 4K33A 4X7QA 5CVHA 1UVRA 4QMOA 3LJ2A 4YLKA 4ANNA 4EORA 2FB8A 2LGCA 4FSWA 3WZUA 1H00A 4FV2A 3KREA 2Z7LA 4AX8A 3I0OA 5LWMA 5EOBA 3ZCLA 5JT2A 2YZLA 3UQGA 4F64A 5KKRC 2VWYA 4FSZA 2YN8A 2XBAA 3BGPA 3PIYA 4BBEA 4O0WA 3DQXA 3W2PA 4ZZOA 3MVMA 3ZSGA 5IQCA 3Q9ZA 2JBPA 2CLXA 2B55A 2O65A 4R7HA 3PVGA 5H9BA 3C51A 4FV7A 1OL6A 4DGGA 4PP9A 4RC2A 4GVJA 4AW0A 4DC2A 2DQ7X 4DHIB 1O6YA 5DA3A 3UG2A 2C5NA 2QOFA 4DFNA 3COMA 3RCJA 3RPOA 4EZ3A 3PLSA 4L43A 2XNNA 4OUCA 4QMSA 4FGRA 4AQKA 1P5EA 5C8MA 4ANSA 2F7ZE 5L8JA 1K3AA 2BHEA 3VUIA 3RZBA 5CEMA 3GU6A 3CTQA 4GS6A 2W5AA 3MB7A 1H27A 2W1CA 2ZDTA 4FJVA 1QL6A 3AQVA 5FXSA 3GBZA 4AZSA 4D4SA 4F70A 1XR1A 3SW7A 4ZY4A 5FEQA 4HGTA 4UY9A 1NW1A 3EOCA 3UZRA 4PDSA 4EKKA 3PXQA 3VBTA 4JS8A 2R7BA 3P79A 3U87A 4MBLA 1FINA 1OITA 4I6FA 4JRNA 3DZQA 4R5YA 2VGOA 4EH5A 2CKPA 1XMMA 2V22A 2YIQA 1UKIA 2Y8OA 4M8TA 4QYYA 4CV8A 3IDPA 4D0XA 5J1WA 2CNUA 3VBWA 2PPQA 3QTIA 3L9PA 3ZSHA 1J7UA 5DGZA 1PRYA 5T6KA 2VX1A 3RK5A 2I0YA 2BALA 5DE2A 4J71A 5BPYA 1A06A 2AYPA 3V5JA 2BRBA 2BDFA 4IANA 1NT2A 5HZNA 2GNHA 3LFDA 3JYAA 1WMKA 3VS0A 4NUSA 1H0VA 4HYIA 3SHEA 3VS3A 3ORIA 5D9HA 1ZY4A 3E93A 4BI0A 3MW1A 3AD5A 4FZ6A 3QCXA 2RFSA 4FT3A 5A54A 4YPDA 5TO8A 3ZUTA 2FO0A 5I9WA 4D4RA 3GENA 4KINA 1LPUA 3DDQA 2KTYA 2P0CA 1H1SA 2OZOA 4C59A 3Q2JA 3C50A 4WUAA 4LRJA 1GAGA 5M4FA 4BJJA 2I7QA 3A2CA 5M07A 3SQQA 3THBA 4EYMA 5E1SA 4EOMA 4FVRA 3PWDA 4XG3A 4TT7A 2OXXA 2HXQA 2Y4IC 2UZTA 4YJRA 3ZO2A 5BUIA 5EHYA 4IQ6A 5A4EA 2J2IB 5BUEA 2FSLX 3NLBA 5IEXA 2ZV8A 3PPJA 4MAOA 1U54A 3OCBA 3OF0A 2HIWA 3UMWA 3IS5A 3KF7A 2J6MA 4A06A 3FHIA 3DZOA 4HCVA 4CMTA 4DA5A 2X6EA 4A9TA 4BDEA 4K6ZA 4E4XA 5ANEA 4RWJA 2IPXA 3EWHA 3R7EA 4AN2A 2YM6A 4UMUA 1UV5A 4DH8A 1OUKA 2OJJA 2Y6OA 3D7ZA 5FP5A 5M4CA 2VU3A 4GKHA 2YM8A 5JFSA 1YWVA 2CMWA 5AUYA 3AT2A 3KEXA 4FZDB 3EL7A 2ITZA 1BI8A 1V1KA 3A60A 4CT2A 3DJ6A 4PPCA 4FKQA 3DFCB 2WEVA 4X6RA 3TZ9A 1BLXA 3FV8A 3ZOSA 2FSOX 4F99A 3MV5A 3SD0A 3V51A 4ITIA 1XWSA 2RGPA 2WKMA 2EU9A 5FDPA 4DE4A 4TN6A 3CSVA 4S33A 4FIHA 3VS1A 4EK5A 3HUCA 4FL1A 3FZPA 4L46A 4MK0A 4BCQA 2GQGA 3Q53A 1Q8ZA 3U51A 2REIA 2UZNA 3F3WA 4K1BA 4EK4A 2OJ9A 3SG9A 3UOKA 3M2WA 4JR3A 4P90A 3MH0A 3EQDA 3ZO4A 5TR6A 3F61A 4EJNA 4YTCA 3ERKA 5J7HA 3PZHA 4U5JA 5K5NA 3VC4A 4TL0A 4O7NA 1Q8YA 5LCKA 5DEYA 3UIUA 3BGQA 2UW4A 5E8SA 2WMWA 2B9FA 3GFEA 1BI7A 4C61A 3OROA 3FZRA 5C03A 1O9UA 2YLEA 4KIKA 4GT5A 2JAVA 2VTOA 2WFYA 1W2CA 2YJSA 4G16A 4IADA 2CDZA 4NJ3A 5EH0A 4D2WA 3DXPA 2NRYA 4XEYA 1WBTA 2V0DA 3EYHA 4NFMA 3O17A 3DDPA 2ITNA 2FGIA 4DGOA 2W4OA 3TT0A 4J8MA 4E20A 4OW8A 5IQBA 2O0UA 3QQKA 2Z7QA 4KIQA 4YZNA 2XEZA 4YHFA 4AGDA 5JMSA 1PKDA 5C01A 4A4LA 4MQ1A 5IKWA 3SKCA 3D5XA 3MYGA 3QZGA 1XBBA 3NAYA 2RFEA 4F1OA 3LQ3A 1IG1A 4CFWA 4E26A 3PP1A 3HRCA 3LLTA 5HKMA 3UMXA 4DBXA 4GL9A 5FBOA 5AV0A 5EHOA 4ACMA 3U9NA 3ZZWA 3E88A 3L9MA 1OKWA 5DIAA 3ATSA 3GU5A 1LP4A 2JDRA 3TL8A 3NNWA 3TUCA 1W0XC 1WFCA 2WOUA 3EKKA 4UMRA 3BYOA 4LOPA 2H96A 4FTLA 3AT3A 5LVPA 5FP6A 2PZPA 3EQBA 2IW6A 4Q5HA 5KHXA 5AR5A 2ETMA 3DCVA 1O6KA 4O7LA 3SOCA 2J0KA 5CEPA 4ZTMA 3IECA 3Q9XA 5BVKA 2IW9A 4IWPA 4GK4A 3DLZA 4IAFA 3S1HA 4DEBA 2C0IA 4UMPA 4DT8A 2OJIA 3F66A 3ZXZA 4O4DA 1PYXA 5CEQA 3DY7A 2ZB1A 2BZKB 3CS9A 3M1SA 4UV0A 4USDA 2BPMA 2XYUA 4ZJIA 1I44A 3B8RA 4KB8A 4EH3A 2UVXA 5L4QA 2IZUA 4LGGA 3W10A 4JG7A 3OWPA 4I22A 3VBQA 4ANBA 3AMYA 4ARKA 2JLDA 3SA0A 2GS2A 5ACBC 1M17A 1A48A 3CGFA 3S00A 2I0VA 3C4WA 2OK1A 4RJ3A 2QU6A 3Q5ZA 1OPJA 3TJDA 3LAUA 2JKQA 4HVIA 3TV7A 4EK6A 4E5BA 1CKJA 2W4JA 1A9UA 5DG5A 2VZ6A 4JOAA 4RIOA 5CSPA 4F65A 3KQ7A 2H34A 4C4GA 4O81A 3RK9A 4FV6A 3QLGA 3EN4A 2VTHA 4ASZA 2GCDA 4OTGA 1OI9A 5C4KA 2QC6A 3C0HA 3NWWA 4B6LA 2VTSA 4J99A 3OCSA 5FQDC 4EQUA 4X2FA 4C62A 4D9TA 4CKJA 1KSWA 2ZB0A 3CTHA 4FIGA 5J5SA 4QMLA 4BYIA 2BTSA 4OTDA 3V6SA 4UX9A 4JAIA 4CFMA 3ZSIA 3LFSA 5K4JA 5L6PA 4A9RA 5CF4A 4M13A 4MNEA 3FE3A 4ALUA 1NXKA 5HE0A 3DBEA 2YCRA 1YXXA 4K77A 4BCNA 2C6OA 5KHWA 3K2LA 3RNYA 3UOHA 1CDKA 5HE3A 4RJ5A 4ENXA 1WBVA 4RBLA 3EN9A 3NEWA 4HGLA 5AP5A 3EN6A 2Q83A 5HD7A 2X6DA 3OT8A 2XP2A 3PUPA 4FV5A 4BCJA 3NUAA 4FUYA 3Q5IA 3GVUA 2ETKA 3G0EA 3BL7A 5KCVA 4I23A 2QKWB 1RJBA 3O71A 3SV0A 4C0TA 3KXXA 4NT4A 4TYEA 4XX9A 2HELA 5LARA 4U80A 4CTBA 4Y95A 1Q41A 5BMSA 1SNXA 4RWKA 4YJTA 2ITUA 3VRYA 4O4FA 3HRFA 4D28A 2PYWA 2HK5A 3C5IA 3FQHA 2ETRA 3EFKA 2C3KA 3BLQA 2WMTA 3AG9A 5HCYA 4ACHA 5IH4A 4OLIA 4AZFA 3R71A 4WNPA 5FM2A 4L45A 5CQUA 2VO3A 3SXSA 5HLNA 4QQTA 3IG7A 4XG7A 3C4XA 4C7TA 5M09A 4UBAA 3PRIA 3NX8A 1Y8GA 1CSNA 3WZDA 5IDPA 3QX2A 4WRGA 5CZHA 4AFJA 2WTIA 4LGHA 3L8SA 2VWXA 1S9IA 4FKGA 4IAZA 1NVSA 4DEEA 4XG2A 2WGJA 3ZXTA 2W1DA 1XH9A 3S95A 4EOKA 4LV8A 4QP9A 4KNBA 5CSWA 5LMKA 2BHHA 2C69A 2YABA 4GIIA 3A99A 3GT8A 1YWRA 3AXWA 3E92A 4NTTA 3O7LD 1JKSA 2WTDA 5A6NA 3QTWA 2Z7RA 5BMMA 4MX9A 3FMNA 5TT7A 1ZXEA 4ENYA 4U45A 3I4BA 5AR2A 1FOTA 2VTAA 4WBOA 3ZRLA 5F94A 1MQBA 1G5SA 4GYIA 3DKFA 4FVPA 3I7BA 5E91A 2R0IA 3QL8A 3LCKA 1FVTA 1XKKA 2XNEA 3D7TA 4I4FA 3B2TA 2GDOA 2PE0A 3IPHA 2C68A 3KK9A 3A7JA 4GIHA 4I0SA 4CZYB 5B2MA 4ERWA 5G6VA 1DAYA 4JIKA 4MF1A 3O8UA 5IA5A 4BCKA 4YU2A 5E7RA 3BBTB 3H30A 3R00A 3NVMB 1OKYA 4RX8A 3RPRA 5LMKC 4C4FA 2F57A 5GZAA 4U42A 3D5UA 4RFYA 3LPBA 4FV0A 4C4JA 3MVHA 2OW3A 5I0BA 4XV9A 4OBQA 1FQ1B 5AX9A 4MXZA 3QCQA 5FM3A 2X2LA 5CAQA 3CJGA 3TWJA 4FTOA 3NUXA 5CI6A 4BDHA 3LLAA 1GOLA 2VTPA 4DT9A 5HBHA 4LMUA 2WTCA 2QKRA 2WMRA 4II5A 3MH1A 4HYHA 3L9NA 1UWJA 3ZLXA 5EKNA 5HTCA 4P5ZA 4PRJA 5HLWA 2A0CX 3AGLA 2XNPA 3HP5A 5H8BA 5AV4A 4LOQA 4AAYA 3R1QA 5CF6A 3QC4A 4FTMA 4BGHA 3TACA 3GP0A 3VS6A 4BBFA 4W4WA 2JD5A 2ZMDA 4EHEA 4JMQA 2JIVA 2J7TA 4IVAA 5HG8A 2QOHA 3CIKA 2XJ0A 4Q5EA 3JY0A 4C34A 4EWHA 1YOJA 1VLRA 4UZDA 4QP1A 4B0GA 4C8BA 5IA3A 4LG4A 5BYYA 2DUVA 4E6AA 1XJDA 2VWUA 4PDPA 2VWBA 1RW8A 3DJ5A 3W0NA 3U8WA 2JIUA 1WBOA 2QD9A 3MY0A 4O0RA 4DFXE 2UZOA 2IO6A 2GFSA 3O7LB 3ZFMA 5HTBA 4MUQA 2ONLC 4LV5A 2HZNA 4BFMA 4RX5A 3WF5A 3TNWA 5IEYA 4CYIA 3HRBA 3FZTA 1FPUA 2B4SB 4PY1A 4OR5A 1G8KA 2QU5A 3AMBA 2BMCA 2PHKA 5CNNA 2CGVA 2CNQA 3VUKA 4R3RA 2F9GA 1Q24A 4TZRA 3QD0A 3FLQA 3NNVA 1BX6A 2QG5A 2BAQA 4JX3A 3LMIA 5HIDA 4NH1A 5JK3A 5LQFA 3UPXA 3NNXA 4AN9A 4DGNA 3C5UA 5HU3A 5HCZA 2JGZA 2OIDA 5ANKA 4BZNA 5E9EA 1G3NA 4YSJA 2QOLA 5H8GA 1SVGA 4PMTA 5FDXA 4BGQA 4TWPA 4ANQA 2AC3A 3VF8A 2CPKE 2OO8X 5CYIA 5CQWA 3Q9YA 3SRVB 4BDAA 3SX9A 4IACA 4L3LA 5IA2A 4DF3A 1Y57A 5GIOE 2ITWA 3KRJA 5HO6A 3TDWA 4WNOA 5ANJA 1B38A 3DU8A 4YC3A 5EDPA 4R7BA 3QRTA 4AXCA 2R3MA 3ZU7A 2XMYA 4MXAA 3A4OX 3MA6A 4FE2A 4CGAA 3R0TA 4N6ZA 3RHKA 4QDVA 4YO4A 2ITPA 3ZRKA 5LMBA 5I9XA 3OUKA 4AT4A 4CFVA 1R78A 2QURA 3SDJA 5LCJA 3D15A 2XRWA 3PRFA 4CFNA 2YM5A 3ULZA 4NM0A 3UIBA 4MD7E 3V01A 4O1PA 4QMTA 3FLWA 2RFNA 2VTIA 4QMXA 3PIZA 4Z3VA 2PMIA 4X2JA 3NSZA 2PUPA 1PMUA 3UZPA 4PF4A 4E6DA 4XCUA 5KMIA 1XH7A 4V0GA 4BCMA 4EH2A 2UZEA 2J0JA 1PXJA 5AP1A 3R2BA 3IGOA 3MTLA 4GU9A 3HX4A 3HV5A 4HYUA 1IAHA 3QUDA 3QZHA 3VQHA 4GUEA 4AXDA 3LMGA 4GFGA 4MBIA 3FLNC 3R1SA 4HPTE 4HCUA 5L6WL 1ZMUA 3DK7A 3QUPA 1PYEA 4LM5A 3KULB 3UQCA 5DR6A 2IEWA 3Q2MA 4F7JA 2HY0A 1XMLA 2GFCA 1JBPE 5HE2A 3DNEA 5KMNA 4XV2A 3BI6A 4RC3A 2UUEA 4I5CA 3TNHA 4A7CA 4X2KA 4BF2A 2R0UA 4C35A 5KBRA 4PPBA 2R3NA 4CCUA 2YJRA 2YWPA 2W4KA 4KBCA 4TRLA 3PE1A 2PMNX 5DOSA 3FDNA 3AOXA 4U9AA 5EKOA 1URCA 3UG1A 1DI8A 1PMEA 3RTPA 4BCFA 4ZTRA 3K3JA 3I60A 3P5KA 3R8LA 4AOIA 4FKRA 3R7VA 5CU3A 1OL5A 2WMVA 3HLLA 1TQMA 4QP8A 5DVRA 3RINA 4XUFA 2OF4A 5K5XA 3QA0A 2XK9A 2WQMA 4F0GA 5L2IA 3OEZA 3HEGA 5EI8A 4KBKA 2R3GA 3ZFXA 3UVPA 5CEIA 4IAKA 4RJ6A 1WBNA 4PNKA 2AQXA 4IM2A 4XG6A 1YHWA 5BVEA 3SVVA 3CD8A 1XH4A 3JVRA 4FT9A 1U5RA 3UODA 4F63A 3E8DA 3LOKA 4ONAA 3TN8A 2ZM4A 3ALNA 4ZIMA 4DH7A 3BHUA 5C4LA 3BHVA 3LFQA 3QTSA 4GK2A 1H01A 4GYGA 4ZSLA 3EFLA 5LMAA 2YCQA 4HJOA 4FIEA 4H3BA 2PY3A 2XIXA 4MD8E 3LJ1A 3OS3A 5D10A 5E8YA 3E8EA 3QAME 5JQ5A 5IQEA 3VONA 3QUEA 3H9OA 5CALA 1XO2B 4L6QA 4RQKA 5IF1A 3KK8A 5C8NA 4ZXTA 5GJGA 2R3OA 4FTKA 3WF9A 3I5ZA 3FXZA 4RVTA 2R3HA 1JVPP 4EH7A 3E3PA 3RP9A 1PXMA 4IB5A 2NRUA 4JR7A 5EDRA 4DINA 4HZSA 3NCZA 3QALE 5E90A 4BHZA 4MQ2A 5DR9A 4R8QA 5EYDA 4DCEA 5ITAA 4RJ7A 4W4YA 4YGAA 4A4OA 3T8OA 3HA6A 1VJYA 4I6HA 4I0TA 5AUWA 2RKUA 3LFEA 5I3OA 5A4LA 1LEWA 4IAAA 3FXXA 4Y8DA 1CKIA 5F1ZA 3QXPA 2R3IA 3TIZA 1PY5A 3R6XA 4UYAA 2V55A 4BZDA 2QOKA 3HYHA 4Z55A 5EQYA 3E64A 3RPVA 4ASXA 4ZJVA 3OD6X 3P9JA 4BDGA 3L8VA 3NFFB 4E93A 4R78A 2A1AB 1FBNA 4LUEA 2PZIA 5HGIA 3GU4A 4C2WA 4FI1A 4LUDA 3BX5A 3ZDUA 2R3PA 1J3HA 3Q32A 5HORA 2PWLA 1EH4A 1OPLA 2JITA 3KMMA 4TTHB 3S2PA 3ZM4A 4AE6A 3KKVA 2CJMA 4L44A 5E92A 4FV8A 4ZSGA 1MUOA 2R3QA 2XEYA 3DKCA 4FIFA 2OBJA 4IEBA 3LFCA 2FA2A 3LM0A 3OOGA 4R3CA 3PP0A 5ETIA 4YBJA 4C4HA 2WMQA 3W8LA 1ZYJA 4RJ4A 4IJ9A 4FKTA 4BDFA 4V0GB 1OL2A 4RSSA 3VUDA 3II5A 2B9HA 4GK3A 5DMZA 4E4NA 3JR1A 4KKEA 4BDBA 4H58A 3UC3A 3PFYA 2OJGA 2X81A 5AM7A 1AQ1A 1H1RA 4O91A 1Z5MA 3MWUA 3WYXA 1YXSA 2B53A 3QQGA 5HCXA 5LVOA 2JFMA 2VV9A 4OTPA 5CAVA 3QC9A 4JDKA 4DTBA 2X9EA 3ET7A 3BU5A 5EW9A 4PMMA 4PTEA 5DEWA 3NUNA 4BWKA 3S4QA 3AC8A 3I1AA 3VF9A 3EZVA 2XIKA 2XKCA 5E8UA 4A9SA 4ANMA 5FD2A 3VQUA 3FUPA 2JAMA 3DGKA 1U5QA 2R2PA 2RG6A 3W0QA 3UOLA 4CMUA 4ZTLA 5C26A 3BKBA 3UO5A 4FBXA 1PF8A 3AC3A 3D83A 1MRYA 4R1YA 4CZTA 4F1TA 4P7EA 2B0QA 3ORLA 3CE3A 1WBPA 4IC7A 4O7TA 4RVMA 4XMOA 2YZAA 4WHZA 5FRIA 3VRZA 3IW6A 4HVGA 2BDJA 2Z60A 3T9TA 3TTJA 3TDVA 3A7HA 4FSRA 4EHGA 5JRQA 4FV4A 3MGYA 4KSQA 2QOBA 4OTRA 2O5KA 2C0TA 4RZVA 5J95A 4AA4A 5CF8A 2C4GA 2WOTA 3KRLA 4XG8A 3UO6A 1M52A 4LRMA 2CHLA 4BIDA 4CMOA 3L1SA 3OWLA 4M69B 1OGYA 5LVNA 2HENA 2HZIA 1H28A 1CMKE 4PTGA 3PVUA 4PDOA 3VS4A 4EC9A 4S2ZA 3UZTA 4GU6A 2NPQA 4EOJA 1FGIA 1H25A 1OL1A 2R3KA 2OGVA 4DEHA 3D14A 2O8YA 3W32A 5IUHA 1U4DA 1L8TA 3GC9A 3KXMA 3O51A 4ZSJA 5KE0A 4C4EA 4D55A 2BRMA 2W1HA 4ZP5A 3D5VA 1F0QA 1YDRE 5J79A 3FC2A 3LIJA 5DBXA 3WZJA 4GG7A 2XVDA 2RIOA 3O0GA 5CF5A 4ZOGA 2H6DA 3KY2A 2YIRA 1GIHA 3R83A 3ZZEA 4AFEA 4I6QA 3RALA 4UWYA 3ZEWA 5A4CA 5TKDA 3EL8A 3FZOA 2EVAA 3EZRA 4BY9E 4TYHA 3OTUA 4FKIA 1KE7A 4IM3A 2ZVAA 4MVFA 4F9WA 3H9RA 2VX3A 4USEA 5EOLA 4DFLA 3AC1A 4HNFA 3R9OA 1BL6A 1UA2A 3R1YA 4O6EA 4WA9A 2O64A 3E87A 4FZFB 1R0PA 3CKWA 1YW2A 3FZSA 4M68A 3RAIA 5AA9A 3UQFA 2PK9A 3A7FA 3TYKA 1V0PA 4BI2A 1YI6A 1JKLA 1YXVA 3ORNA 5AJQA 4U40A 3F6XA 4S34A 5C9CA 3RGFA 4C57A 3AT4A 3IQ7A 3ZO1A 3A62A 3QA8A 4HGEA 2DWBA 3I6UA 3CY2A 1BMKA 3QGYA 3WILA 5GJDA 4YNOA 4O0VA 5CAOA 4E73A 3DJ7A 3EQFA 3N9XA 4OTHA 3KA0A 3KXZA 3LXPA 3EFWA 4I6BA 4YP8A 2BIKB 3DOGA 2P2HA 4QMNA 5JZJA 3VS7A 3F88A 1E1VA 4NSTA 3MTFA 4YC6A 2BKKA 3KXHA 4GEOA 2WXVA 3DBDA 1W2FA 5AR3A 4EOQA 4J97A 3OW3A 3BQCA 2OJFE 3BL9A 2UW7A 4FEXA 2VD5A 1YOLA 2IVTA 5E8XA 4N70A 4U6RA 4RGJA 4YJUA 5I4NA 4CT1A 4MBJA 3LM5A 1K9AA 3NYXA 2VWWA 4FSUA 2FVDA 5B2KA 3HAMA 5IZFA 4G2FA 4XG9A 3RI1A 3PJ2A 4QQCA 4DG0E 3DXQA 3CR0A 3FI3A 2HW6A 3JXWA 5FEDA 2R3FA 1IRKA 3QX4A 1OM1A 3P7AA 3QGWA 2QNJA 2JKOA 3FMHA 3ZHPC 1VYWA 3OTVA 4ORKA 3DXNA 2BIYA 1DI9A 2OWBA 3A7GA 1FVRA 4RJ8A 4OAUC 5I3RA 3C4CA 3GXLA 3EYGA 3A7IA 1X8BA 5C1QB 2JDVA 1W83A 4C3FA 3NUPA 3BE2A 1KOAA 4BKZA 4AG8A 2XK7A 5AP0A 4IZAA 4BTFA 5A9UA 5E4HA 1SNUA 4RLKA 3ORXA 5HD4A 4CG9A 2W9FB 4YZCA 3EIDA 5IISA 2E9OA 3MA3A 4ZS4A 4FKWA 5M57A 3W8QA 3WOWA 4QNYA 1P2AA 4Y72A 3IOPA 4QPMA 5AP4A 4OTIA 3MSSA 2C6MA 3FMMA 3FSFA 1NY3A 3LFBA 2IZSA 5EG3A 5AM6A 5ETFA 3EQCA 4FMQA 4CZUA 4BICA 5HVJA 4GJ3A 2OLCA 2V62A 3UDBA 1KE6A 2RL5A 3KFAA 4JDJA 3B2WA 3GCPA 1Y91A 5CSHA 5IH6A 3COKA 3MJ2A 3A8WA 3RKBA 4CSVA 5IQHA 3HV3A 2B9IA 5CASA 5M53A 5KMOA 3PG1A 4XV3A 2VTTA 2XCHA 3TV6A 1Q8UA 3CQWA 2X2KA 4MH7A 3WF7A 5BYZA 2BKZA 4F6UA 3WBLA 4C38A 4CKRA 4L7FA 5CEOA 3MB6A 2WB8A 3NUUA 5CI7A 4BB4A 4CVAA 3PVBA 2CSNA 2QHNA 3WZKA 2GS7A 4O27B 2IF8A 3KRXA 4FL3A 4TYHB 4U3YA 3UDTA 2Q0NA 3FMEA 3P1AA 4ZTSA 2UVYA 3RM6A 3VBYA 3EQIA 3PA3A 2QOCA 4BKYA 3QTZA 2W1EA 4E1ZA 3DA6A 3MS9A 1J91A 4JQ7A 1GZOA 3PPKA 3ORZA 2C3JA 2W9ZB 4EH9A 1J1CA 3ZMMA 3QZFA 2OF2A 3W2QA 3HL7A 2QQ7A 3GOKA 4IAYA 3QBNA 4WKQA 4KA3A 4RFMA 5AP6A 5FEEA 2QVSE 4I94A 4O6LA 5LJJA 3CCNA 4L52A 2B9JA 3F5UA 3RPSA 1GZ8A 2OXDA 3WIKA 3DTCA 4FRFA 3W55A 4EJ7A 2VRXA 1GZKA 2P2IA 5CU6A 4O38A 4NYEA 4CKIA 4F0IA 3MPTA 4CFXA 2YFXA 2X1NA 3TUBA 3P78A 2XRUA 2EB3A