2V55A

Mechanism of multi-site phosphorylation from a rock-i:rhoe complex structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
399
structure length
393
Chain Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEETFPIPKAFVGNQLPFVGFTYYSNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO-ASSOCIATED PROTEIN KINASE 1
publication title Mechanism of Multi-Site Phosphorylation from a Rock-I:Rhoe Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 393
sequence length 399
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v55A01
2IO6A 3QRIA 5EW9A 2ETRA 3EFKA 1Q8WA 4XV9A 2XBAA 2YDJA 2ZOQA 4I22A 4WG5A 2R3QA 1NY3A 5ETIA 4KS7A 4CFFA 4JQEA 3DQWA 1R78A 3HGKA 2C4GA 3LPBA 3UC4A 3ZUVA 4FIJA 4FEXA 2VX3A 2WGJA 2A27A 4GG5A 4ZEGA 3R9DA 4BTJA 2PZRA 1ZYSA 4FZFB 3NAXA 1V0OA 3DNDA 1YWRA 4YMJA 4FODA 1UWHA 2XKEA 3OF0A 3HVCA 5FTQA 2WOUA 5DLSA 4CV9A 4YURA 3NUYA 4YR8A 4FKPA 4L45A 2R3PA 3E62A 3PPJA 3UPZA 3R28A 2XVDA 1CSNA 1XBBA 4S34A 4G9CA 4DEIA 5HESA 2HXQA 5F1ZA 4CVAA 2J0JA 3ZZWA 1OL5A 3VBTA 4ACCA 2UZWE 2ZMDA 3F9NA 4IB5A 3OY1A 1TQPA 3U8WA 2R3IA 2ZDTA 4HVHA 4CRLA 3K3IA 3PJ8A 5L6OA 1ATPE 3MSSA 2UUEA 5IH5A 2R2PA 5I3RA 5CEQA 3DKCA 3IGOA 4GEOA 5AR2A 2ZM4A 3VS2A 1TVOA 2PMIA 4PDSA 4RFZA 2BFYA 3FLQA 3NPCA 3TXOA 4ANOA 4D58A 4KSPA 3GCPA 4IEBA 2XIXA 4FV0A 5ANGA 5L2SA 5DE2A 1FGIA 4KS8A 1O6YA 4BI1A 4EBVA 2XK6A 2WMVA 2SRCA 4EOOA 1YXVA 3FZSA 4HNFA 2J0LA 5DOSA 5CX9A 5EW8A 1WCCA 4FIHA 2XK9A 3POOA 4KKEA 3ZH8A 5HCZA 3TI1A 3VF8A 3ETAA 4A9RA 3MY0A 4BCJA 2YCQA 4WIHA 3TTJA 5IDNA 2B55A 4E26A 3VW6A 2IWIA 2HENA 2BTRA 1YKRA 4DAWA 2OBJA 3QQKA 2HY81 1JBPE 2VTJA 4R5SA 2UW4A 2WMQA 3REPA 5EDPA 4YSJA 2I0EA 4UMPA 5KHWA 3DZQA 1RJBA 2PUUA 5D7AA 5FRIA 5K4IA 2XB7A 3N4UA 3KMUA 5HGIA 5JZNA 3SD0A 3HAVA 4AW1A 3OD6X 4FTUA 3NSZA 4OTIA 2JEDA 1DAYA 3SX9A 4RX9A 3Q4CA 3S3IA 3I6UA 3LFFA 2YLEA 4EHZA 4QNAA 3D94A 2XKDA 3KY2A 4XYFA 2CHLA 4A9TA 4HCVA 4H3BA 3HUBA 1UNHA 1UNLA 4YHTA 3AXWA 4RJ8A 5F95A 1V1KA 3T3UA 4PDYA 5GJGA 2VTSA 5KUPA 5FDPA 4IM3A 4DFNA 4BICA 5ACKA 4FC0A 4XRLA 3VAPA 4TY1A 4YLLA 1Q8UA 2ZV2A 1M52A 4FZ7A 5L2QA 1E1XA 5AV3A 4L3JA 4EQMA 4YJOA 1UA2A 1OM1A 4JOAA 4LFIA 2WMTA 5KE0A 3R8LA 4JBQA 4O27B 5CEMA 3ATTA 2Y4IC 3ZC5A 5BYLA 4YJTA 3LCDA 4DBNA 3FUPA 2HOGA 1OUKA 2HXLA 4NTSA 2YERA 1H1RA 3K5UA 3VO3A 4YC3A 4QQJA 5ANIA 5HE2A 4G3GA 3W2PA 3AQVA 3CBLA 4GT4A 3N9XA 4M97A 4QMZA 2C3JA 3KF7A 4R3CA 5HNBA 4CFMA 2R5TA 2CGVA 4HJOA 2E9UA 5CEIA 3RPYA 5HTIA 5JKGA 5DEYA 4ENXA 3AD5A 4GFOA 3PE1A 4IIRA 1IAJA 2ERZE 4K2RA 5HG7A 5BX0A 5E8WA 3N4VA 3R2YA 2W1IA 2OSCA 5KZIA 2BPMA 4MNEB 1LEWA 4JG6A 4NIFB 3VQUA 5JK3A 3MTFA 2CLXA 1OIQA 4FTCA 3QTSA 4TTHB 3PP1A 2UV2A 2YACA 2PVHA 3O8UA 4P5QA 4QP4A 5ITAA 4O7TA 4NFMA 5FDXA 1KV1A 3GOPA 5J95A 4YPDA 3LW0A 4E6DA 4H39A 2CNVA 3RK5A 1XBAA 3KGAA 4CSVA 4U41A 4TYHB 5LWMA 2A1AB 4RA5A 4QTBA 3F5GA 4FL1A 3V5LA 3G9NA 4GFGA 3DXQA 2GNLA 5A54A 2V5QA 3KMMA 3I7BA 3ZO2A 1DAWA 1Q61A 4NCTC 3CIKA 4UMUA 3EFWA 2PZYA 2YIWA 4LRMA 4CMUA 2PVYA 2QKRA 1KWPA 1ZMVA 2C30A 4IJ9A 3Q2JA 5L6PA 4GU6A 4EOIA 1BYGA 1M2QA 2J50A 1G8AA 3DK3A 2A4LA 1WFCA 2XZSA 3C5UA 3WE8A 4FVQA 4PNKA 3KXXA 5EI2A 4ALUA 4BTMA 4BCNA 2IW6A 3F61A 3I81A 4NT4A 2BDJA 4DEHA 3HYHA 4RFYA 4UZHA 4KWPA 4OT6A 4DH3A 1YI3A 2XIRA 4NM0A 3KVWA 4TYJA 3ZFYA 1UWJA 4IANA 4EC9A 4CKRA 3C5IA 3GC0A 3EQIA 2VNWA 4F9CA 3QGWA 2BZHB 5BVFA 5IUHA 4F63A 5I0BA 5IZFA 4KUJA 4USFA 4LQMA 3S4QA 3SKCA 4BBFA 3RAIA 3PXRA 5HEZA 4GMYA 3UMWA 2B4SB 2UW8A 3IDCA 5EYKA 2BR1A 2VGPA 3ROCA 4ALWA 4UWBA 3PFQA 3WILA 2C6LA 2JFLA 1OL1A 4R7BA 4EH2A 4YJUA 3PVGA 4CCUA 1U46A 3F7WA 4JDHA 4EOSA 4GUEA 2JDSA 3UO6A 4W8EA 3UOLA 3HV5A 4JIAA 2ITVA 4MBJA 5L2TA 4FTTA 1CKIA 5M09A 3SRVB 4DFLA 3MB6A 5JQ8A 4K0YA 4RWLA 4OTQA 1PXJA 3AC8A 3P08A 3MN3A 4DF3A 1ERKA 3BKBA 2BAKA 3ERKA 2W06A 4H3PA 3OXTA 1PXKA 2VTOA 3HP5A 4RIYB 4TWNA 3WOWA 4DG2E 4EZ3A 5IA1A 2RG6A 3QD2B 1VEBA 1Z9XA 3EZVA 4HYSA 4RJ4A 3VS4A 3LCKA 5AIKA 4FG8A 3NNUA 5EH0A 3RGFA 2UZDA 3U6JA 2XIYA 3B2WA 4JRNA 1PYEA 2F7XE 5DNRA 4FV4A 4QP2A 4E4NA 5IMXA 2WTIA 4LYNA 5FD2A 3WZKA 2PVJA 4QMOA 3BPRA 4J95A 4U97A 3FL4A 4XOYA 3QHWA 1QL6A 2UVXA 3RM6A 5AV1A 3WF9A 2QKWB 3FI2A 2YZLA 1XHAA 4R6VA 4XV3A 5IEYA 2B53A 4P7EA 2RL5A 3LM5A 3WZEA 4L44A 4FKIA 1QMZA 2C6OA 1U5QA 1URCA 2XCKA 4HPUE 4NCTA 3C13A 4EH8A 4LL0A 4DFZE 4RLLA 4XNEA 2W9FB 2AC5A 3PY0A 3ODYX 3R83A 1YDSE 4IB1A 4KRCA 2VWVA 5LOHA 3UO5A 1R39A 2WMRA 1OZ1A 5CANA 4FNWA 4OGRA 4R7IA 4YJPA 4AZVA 3CCNA 3PG3A 3RKBA 1M7NA 3F5UA 4MAOA 1JSUA 4AA0A 4K6ZA 1VJYA 4FT9A 2ACXA 2QHNA 3P78A 1B6CB 4FKOA 4O0VA 2XK4A 4O91A 4IAYA 4MNFA 4ZXTA 3LIJA 1H0WA 4C2VA 4BDDA 2ITTA 4E5AX 1YOLA 3ZSHA 5BVWA 4BWPA 5B2LA 3PWDA 4J96A 3VJNA 4YLJA 3V51A 3DQXA 3PG1A 3UQFA 3LQ3A 4F6WA 4O0XA 1LPUA 5J5TA 2CNQA 1H27A 4L7FA 2IVUA 2PULA 4L9IA 4BDJA 3FHIA 4I6BA 1QPDA 3M1SA 1H0VA 4WNPA 5DPVA 3RI1A 4D4VA 5BPYA 5C4LA 1M7QA 3R30A 4RA4A 4FSQA 4FTMA 3FHRA 4XV2A 4N6YA 2WU7A 4CYJA 3ZLSA 4NZWB 3Q60A 3L8PA 3R6XA 3LXNA 1DS5A 2J0IA 4YTCA 1OMWA 4E4XA 3HDNA 3PE2A 3G15A 3C4ZA 2ETKA 2WNTA 3MVJA 2B9IA 5CU3A 4R78A 1XH5A 5LXMA 2C69A 1FVRA 4O1OA 2VU3A 1M2RA 3U6IA 3VVHA 1XJDA 3CSVA 5CZHA 1H1QA 1OBGA 3ATSA 5EFQA 1KE5A 2XJ2A 2H96A 2PYWA 4QP8A 4D5HA 2ITWA 3EZRA 4NKSA 4PTGA 3CEKA 2RG5A 4FSTA 4FKGA 4AWIA 1H07A 3WARA 3CKWA 2C6DA 5FEEA 4FTRA 3TM0A 2FVDA 4PMMA 3O8PA 5A4QA 1SNUA 5F20A 2WIHA 4BGHA 4UMQA 4Q5HA 4RBLA 2J9MA 3GCVA 5DYJA 4PX6A 4D0WA 3D83A 5DI1A 4E6AA 5HE3A 4D2WA 3CTJA 5FEDA 1MRVA 1H4LA 1WBTA 3LZBA 4BDHA 3WE4A 3OZ6A 1PYXA 4J99A 3KULA 1OL7A 3W8QA 3OOGA 5CU6A 4I41A 4G9RA 4CFWA 3KVXA 4IJPA 4DFUA 3GBZA 3DBEA 4GK2A 4FOBA 3FE3A 3GCQA 4E93A 2VZ6A 4CEGA 5AA8A 5AP1A 3IW8A 4KBCA 2HY0A 1YOJA 3SXSA 3BIZA 3VW8A 4PQNA 3QTUA 1W84A 4HGTA 4O1PA 4CNHA 2J7TA 1SYKA 2PE2A 3KRJA 4BN1A 4V04A 5CF6A 5HOAA 2HAKA 4DE4A 3EYGA 4ASXA 5E8XA 2YWVA 2XMYA 3QAME 2NO3A 4O21A 3BU6A 2QNJA 4NU1A 3BLQA 1PKGA 4XP0A 3VHEA 4DITA 5IUGA 5JH6A 5E9EA 3ZBXA 1PXIA 3FAAA 3FY0A 3ORZA 4QPSA 3ZMMA 4HNIA 2G1TA 1M14A 3AC5A 3CKXA 3Q04A 3NVKI 4G16A 1NA7A 2CJMA 2OFUA 2WTKC 4AS0A 3U51A 5CVHA 3FMNA 2JAVA 4EHGA 3NYOA 3QXOA 3V6SA 3ID6C 2VTQA 3ODZX 2JGZA 4F1OA 3NNXA 4YLKA 3V5PA 4IZAA 5JRQA 2CNUA 3U55A 4UY9A 3E5AA 3AD6A 3W32A 4R1VA 3GU6A 3NGAA 4FNXA 5HO7A 3E3BX 2HW6A 2QU5A 3H9RA 4PV0A 4G5PA 5IQAA 3ZO4A 2A2AA 2NRUA 4XG3A 2OU7A 3EHAA 2DWBA 2QOLA 3KL8A 4AW5A 5I9YA 5IG1A 4NYEA 4WNOA 3RPRA 3E7OA 2X39A 4S30A 3BGPA 3BWFA 3HKOA 4L00A 2XNNA 5AX3A 3G6HA 2P33A 4KNBA 4IWQA 5LMAA 3VBXA 4DG3E 4JX7A 5CF8A 4L01A 3RHXA 3W2QA 3VUMA 1YVJA 1W0XC 1YDTE 2C5OA 2C6KA 4LUEA 4O0TA 1SZMA 2V55A 3NUNA 3W2RA 2XS0A 3AOXA 2Y9QA 2VTNA 2YITA 1URWA 4XP2A 5J79A 2BRHA 5C26A 4IX5A 2Y4IB 4IM2A 1YW2A 5T6KA 4F4PA 3QZHA 3I60A 5E91A 1UU3A 3R21A 4WA9A 1BL7A 1GIJA 1ZOEA 4HCTA 3PXQA 4IH8A 4I5MA 1YWNA 3O71A 4IVBA 4QNYA 4UMRA 2QURA 4IBMA 5D10A 3NIZA 1U4DA 4IWOA 3GEQA 3MFTA 5EYCA 5AUXA 3FKNA 1PXMA 2W7XA 4C4EA 3NCZA 3TUBA 4O7RA 3R7OA 2ZM1A 4TYGA 3FKLA 3OCBA 4XP3A 4DG0E 2R3MA 3ZUUA 3KEXA 3K3JA 3LQ5A 3TIZA 5KMOA 2W96B 4WSYA 3NW6A 3AMBA 3FZ1A 4O84A 2BKZA 4FR4A 3KQ7A 5FGKA 4CQEA 2F49A 4X2GA 2VRXA 5CWZA 4CZTA 4DT8A 3FL5A 2JDRA 3ACKA 2BIYA 3B8QA 4DCEA 1GAGA 5EYDA 3ZXTA 3D14A 3ZTXA 3MDYA 3ORMA 5J9YA 1A06A 4JR3A 3UIXA 4H05A 3BYOA 5IU2A 1WVYA 2RSVA 3F88A 1MP8A 1H1WA 4LMUA 4UMTA 2RF9A 1QPJA 3RJCA 3R9OA 4BCPA 3OCSA 1PKDA 4YHFA 3Q2MA 4HOKA 4BIEA 4F6UA 2WMSA 2OH0E 4FKSA 4I3ZA 2WPAA 3E8CA 3U87A 4ZY5A 5HU3A 2C47A 4ZSAA 2B9JA 5CT0A 3F2AA 4BL1A 1PMEA 3TZMA 5K0XA 3LXKA 4G34A 4RC3A 3ROYA 3C9WA 5C8KA 2PVRA 3O0GA 2XKFA 5DMZA 4CFVA 5M57A 4LGHA 1WZYA 4V01A 4IVDA 4BYJA 3Q53A 4D2PA 3MIYA 3NX8A 2WB8A 3QLFA 3D5VA 4FSZA 4JX3A 3ZEWA 3EQPA 2RFDA 2VX1A 3UZRA 3Q9YA 3VBQA 3TKUA 3GCUA 4O7SA 2X7GA 4EH7A 4APPA 4EH4A 3PPKA 2FYSA 1CTPE 2VN9A 4NM7A 4GIHA 3EOCA 3ZOSA 4Y95A 3QD0A 5C1QB 3NYXA 4FX3A 4MXXA 3IDBA 4RC2A 1Q8ZA 4GYIA 1XBCA 4QP1A 4G1WA 5A46A 5B7VA 5GHVA 3FWQA 5EQPA 3CGFA 2V7OA 4LV8A 5HIBA 5CAUA 3VUTA 3ZHPC 3ZFMA 3PA5A 4DGOA 3RNYA 4P2KA 2YHVA 4HGEA 2UZNA 1I44A 5CF4A 1KE7A 3UE4A 4O6EA 3HV3A 4EH3A 1P4FA 3O2MA 3OCGA 2IZSA 3F3UA 3KRWA 3MJ2A 4WUAA 4FTQA 2DYLA 2GCDA 3PY3A 3ZYAA 4BDBA 1OITA 4FMQA 4RVLA 3UODA 3C4EA 4JR7A 5E8SA 4RQVA 3LCSA 4M66A 5CU4A 4RJ7A 2GQSA 1T45A 2PVFA 5HG8A 4DC2A 4PWNA 5AR4A 1NVRA 4II5A 4CXAA 5DT0A 2HZ4A 2GTMA 1KUTA 2R9SA 4EWHA 3MGYA 5FM3A 2J0KA 5C8NA 2OIDA 4KAOA 3ITZA 3NMUF 4D4RA 5AP6A 3KULB 3IONA 2CKEA 5AMNA 4I21A 2R3LA 2UVZA 3DPKA 3S1HA 5A6OA 2R3KA 2R7BA 2IVSA 3ELJA 3MYGA 4QTCA 4Y72A 3V8SA 1IA8A 5C8MA 4ORKA 2J5EA 2GHGA 2O65A 5G6VA 3TEIA 4JQ7A 4JBVA 5IEVA 4O2PA 5ICPA 4CFUA 2W5AA 3TKIA 4CRSA 4CLIA 3WF8A 4HYHA 5ANOA 3WIGA 3EQRA 5E4HA 3L9MA 3C4WA 2F7EE 3IOPA 2HYYA 1GZOA 2ZB1A 3PXFA 3IW5A 1IEPA 3QGYA 3R2BA 2VTHA 1PF8A 3A61A 3OROA 4XUFA 4TN6A 4PP7A 5HLWA 3VS1A 4L8MA 1ZWSA 2EVAA 3FKOA 4FZAB 4UZDA 1B38A 1ZAOA 1FMKA 4J71A 2YDIA 3VS7A 4XMOA 3NUUA 5EYMA 1X8BA 5DA3A 5A4LA 4NW6A 2EU9A 2X8IA 3GQLA 4ERKA 4UYNA 4RJ3A 2XYUA 3TIYA 3ZDUA 4UEUA 2OGVA 4AP7A 5F9EA 5AFVA 2YA9A 2P2HA 3HV6A 5M55A 5FWKK 2C6IA 4J98A 4FGBA 4GVJA 1LUFA 5CSHA 2WELA 4XG4A 1YXTA 2OJIA 2QOHA 3U4UA 4A7CA 5LMBA 2BZJA 3C0HA 5HE1A 2C3LA 3ALNA 3IDPA 1Q24A 5DN3A 4F99A 4AE6A 4FIFA 4IVCA 3LJ2A 1WBSA 2BIKB 4XG6A 1XKKA 3QF9A 5CVGA 5L8JA 4CGAA 3H0YA 2HK5A 1U5RA 3SA0A 5HKMA 2JIVA 5FXSA 4AX8A 4DEAA 5KKRC 2PUPA 3NRMA 3Q5ZA 3OWKA 5M4FA 4X2FA 2NNWB 4RSSA 3BQCA 1F3MC 4B4LA 3BYSA 5JN2A 4NJ3A 5B2KA 3OXZA 4X2KA 2ZV9A 3OT8A 2QD9A 4JQ8A 4S32A 1Q3WA 3F2RA 3F5PA 3V5TA 3H10A 4QYGA 3PPZA 5HQ0A 3R04A 4QMWA 3BHVA 4FKUA 2WIPA 2C1AA 1OKWA 1Y8YA 3LFEA 4MF0A 5K3YA 4D4YA 4JIKA 4LGGA 2UZBA 5J87A 3EYHA 3QA0A 5AIRA 2QOKA 3AC1A 2QO7A 3UZTA 2C0IA 3ZZEA 3FLYA 2BRMA 3IOKA 4L43A 3R7UA 1YRPA 4PPBA 3QX4A 4CD0A 3CP9A 4J7BA 5M4UA 2Z2WA 3PVWA 4DHFA 4CKJA 4MEDA 4RGJA 2PMOX 4NL0A 2E2BA 2WOTA 4J97A 2PVMA 2BHEA 1OKVA 2QOCA 4WSQA 4O6LA 4FUXA 4EL9A 4JRVA 4YNEA 5ANEA 1QPCA 3LXPA 4LM5A 3QTZA 4HVIA 5C9CA 5M56A 4HPTE 4BY9E 3VF9A 1Z5MA 3OW4A 3B8RA 3BE2A 3KCFA 4OTHA 4EH5A 1ZARA 4Z3VA 2X9EA 2QR7A 5DFPA 2ITQA 4AT3A 3DFCB 2JDVA 4D1SA 5KHXA 3Q9ZA 5FXRA 2CN8A 2WAJA 3QZFA 3ZM9A 2OIQA 3DNEA 4H1JA 4PF4A 5BVKA 5TE0A 4RC4A 1ZYDA 2Y0AA 1Y91A 2XK3A 3QHRA 4IZ5A 4D9UA 3QX2A 3DA6A 1YI6A 2NPQA 5JZJA 4YJQA 3IECA 3UTOA 5AX9A 2WTKB 5BNJA 3COKA 1WAKA 2QC6A 2JDTA 5DR6A 3GP0A 3TG1A 4OAVB 2W4OA 4BGGA 4HVDA 4EK3A 1Q99A 4CKIA 3T8OA 4RFMA 4E3CA 3E8NA 4XLVA 4ZLZA 4E8AA 5C27A 4Z7HA 2BDWA 4JBOA 4IM0A 3VQHA 5IF1A 1UU7A 5DIAA 4LOQA 4IAAA 3OWJA 3EQDA 2R3GA 4Q9ZA 3UVRA 5GINE 3C4XA 3ORPA 3U9CA 2VO3A 3W2SA 3U4WA 2VWBA 4TW9A 2F4JA 4F7JA 3QLGA 4MXAA 4G31A 2X2MA 3AGMA 1Y57A 3TZ9A 4YJRA 2C5VA 5HNGA 4ANNA 4N6ZA 3Q9XA 4DN5A 1W82A 3IKAA 2Y8OA 4Z7GA 2XNEA 5TT7A 1WBVA 2JKMA 5H8GA 3MA6A 4EHEA 3BQRA 4QMXA 4DA5A 3PXKA 5J1WA 3QL8A 4ZIMA 2FSOX 3MVMA 3D7TA 4XG7A 1AGWA 2QHMA 5CSWA 3QRJA 5JEBA 2HWOA 4ZSGA 4BKJA 4ZY4A 5AP3A 5HCYA 2JITA 4GKHA 2WMUA 2X1NA 3MVLA 3DAKA 2QG5A 4XG9A 3LQ8A 4ZSLA 2ZM3A 2VTIA 4E73A 5HU9A 3TL8A 3D5WA 4KIKA 4WBBB 2OIBA 4UALA 4U81A 3PVUA 1OGUA 4X7QA 3V01A 4BWKA 3C7QA 5J5SA 4YPSA 1IASA 5FLFA 2XH5A 3THBA 3EB0A 2OWBA 3DKFA 4CLJA 4PDPA 1BL6A 2FGIA 1WBPA 3AT4A 3S95A 4DTBA 2BUJA 4PMTA 2QLQA 5I9WA 4RMZA 4XG2A 4GT3A 3DS6A 5D41A 3EFJA 4OW8A 3CR0A 1J91A 3VUIA 3QTWA 5AP7A 2PSQA 4O86A 4F09A 3DZOA 2E9PA 4G6LA 4X2NA 5ETCA 3MFSA 2C0OA 2W5HA 4S31A 4ZJJA 4M69A 3ULZA 1ZLTA 1LP4A 5EHLA 3ZLYA 3FBVA 4ASZA 1YXXA 3A60A 1R0PA 5DBXA 5FXQA 4AA4A 2IW9A 3DOGA 2C6EA 3UOHA 2DS1A 4F08A 3P9JA 4D2TA 1JKTA 2ZV8A 5T68A 2CKPA 1SVEA 5GIOE 5FBNC 3BBWA 5L2IA 4NWMA 1OIRA 5AV0A 2PUIA 2PMNX 2C5YA 4C0TA 1YHSA 4RJ6A 4K33A 3WF6A 5KMIA 1REKA 4FF8A 4FTKA 3A7HA 1H1SA 2Q0NA 3R7GA 5IPJA 4XX9A 1SNXA 3KN6A 2WEVA 4FIGA 4KIPA 4R8QA 4U0IA 4ZTRA 2QI8A 2ZVAA 5CT7A 3E87A 3GU5A 4FZ6A 4JDIA 4BIBA 5CAQA 3OEFX 1PXNA 2WQMA 3JUHA 2OFVA 2X4FA 4GIIA 4BB4A 3H9OA 2GNJA 2WTJA 4QOXA 5CF5A 4KIOA 4W4XA 2RFEA 5J9LA 3KRRA 4FT0A 4I0RA 2OK1A 4WRSA 4FUYA 2BRBA 2XCHA 2VWWA 3EQGA 3LM0A 4R5YA 4AOIA 4ZAUA 4L3PA 1Y8GA 3F6XA 2JC6A 3I5ZA 2B9FA 4NK9A 3EKNA 5DVRA 3TN8A 2PVKA 5A3XA 3R73A 3PVBA 3V6RA 3EWHA 4FVPA 4AA5A 4AT5A 3FLWA 3IQ7A 2BCJA 4APCA 4DT9A 3NZ0A 3PA4A 3FDNA 2OZAA 3DAEA 3JS2A 5ETFA 5AWMA 4DEGA 5LMKC 3FMMA 5AM6A 4FTAA 3EKKA 2WXVA 2G2HA 3W55A 3RP9A 3U9NA 3FQSA 1OPKA 3DLZA 1F0QA 4FEWA 4RX7A 2QOOA 4HYIA 3TCPA 1UU8A 1KOAA 4C34A 4CMTA 2CCHA 4DGNA 3FLNC 5CI7A 5D1JA 4OLIA 3FQHA 4BTKA 4FA2A 4ZZNA 4FNZA 3VS0A 1ZOHA 4J52A 2QQ7A 3HEGA 3HLLA 1JOWB 4M15A 2WQNA 2XIZA 4AF3A 3UIBA 3UIMA 4BWXA 2WO6A 5D11A 4EEVA 3OFMA 3F82A 2E9VA 2G15A 2W1EA 3QKLA 4FSYA 3SXRA 4TZRA 5KMKA 1H01A 2RGPA 3U54A 4PUZA 3UOJA 3MA3A 1OPJA 1PXPA 4YTFA 2IVVA 3QYZA 2PPQA 1H25A 5HBHA 1PMNA 2P3GX 2VTMA 3JVSA 4YSMA 4IAIA 3QRUA 2OI4X 5FM2A 2R3FA 4QMYA 3DTWA 4OBQA 5L8LA 4ACDA 4TNBA 4MQ2A 2XBJA 3R1YA 5HNIX 5HE0A 3FSFA 3TV6A 4KKHA 3LFNA 2PZ5A 4U8ZA 2VD5A 4JI9A 5B0XA 5CTPA 3WI6A 4C02A 4IDTA 4X3FC 4BCGA 3VBVA 4E6CA 4UB7A 3HA8A 2XNOA 4KBKA 5CYIA 3I1AA 1OUYA 3LCTA 1XR1A 2YM8A 3UC3A 3T9IA 4C37A 4Y46A 3G9LX 4HYUA 4ZTLA 5HVJA 3W10A 4CFNA 4AZWA 5JGAA 4N70A 4QP6A 3ZLWA 5KMJA 3RCJA 1FVTA 2GPHA 4RPVA 3CXWA 1WBNA 4M12A 4ZS0A 2IZTA 4GU9A 3NNVA 1OIYA 1JSTA 1SVGA 2QR8A 4ID7A 4AGDA 5IQBA 4C3RA 2ITUA 4UX9A 4ZZMA 2PTKA 5JGBA 3QQJA 3BV3A 4H1MA 5K0KA 3VNTA 5CASA 5A4EA 4I4FA 3UYTA 4B0GA 4Y73A 5E90A 3JYAA 3P1AA 3QCSA 4LRKA 2P55A 4EH9A 3SOAA 3HRCA 2GHLA 2XJ0A 5LMKA 2VGOA 3II5A 4GK3A 3RHKA 1BI7A 4GJ3A 4FSNA 4QTDA 4USDA 3ENMA 4OTDA 3GU8A 3FZOA 5LVPA 1J3HA 5C01A 2UW3A 4M0YA 4F0GA 3LMIA 2RFSA 4QQ5A 3PYYA 1GJOA 3ZM4A 4GS6A 2X8DA 3MJ1A 3EQHA 3NYVA 5LVOA 2YCFA 3WF5A 3SW4A 4ANMA 3FZRA 3MIAA 5IMEA 5KKRB 1OVEA 4L67A 4U9AA 1STCE 4CG9A 4E5WA 1S9IA 1XH8A 3EMGA 3OS3A 1O9UA 2JAMA 3ZO1A 2JKOA 3G0FA 4PL3A 3RVGA 3D15A 4O0YA 4C62A 3DTCA 3DV3A 3HECA 2I40A 2CGUA 4RWJA 4Q5EA 2ITXA 3OWPA 3PJ3A 4GVAA 4RZWA 1B39A 4QT1A 1FVVA 4AG8A 4YO6A 3SLSA 3SGCA 3LMGA 2QOIA 2B9HA 3NEWA 4IAFA 4IQ6A 3HA6A 4C2WA 3O96A 5GZ9A 2WU6A 3CJGA 3D7TB 3Q6WA 1Z57A 2Z7QA 5C03A 3VIDA 3LFDA 5K5XA 3FYJX 2PY3A 2A0CX 3QQLA 3BWJA 4XG8A 2QLUA 4M13A 2GDOA 3P7BA 5CY3A 4YJSA 2R3OA 2JIUA 4KIKB 4M0ZA 4X3FA 3H4JA 1LEZA 4FTLA 3IW7A 1PY5A 4QO9A 4XV1A 3WZDA 2WTDA 1DI9A 3ORKA 3V3VA 3PJ1A 3A8XA 3IW4A 4YUQA 5HVYA 5CAPA 4TWCA 3M11A 4I93A 1R0EA 3QTIA 2ITNA 4MK0A 4PL5A 4BDAA 3A4OX 4J1RA 5IA3A 3H0ZA 5HG5A 3ZO3A 3L8XA 3TJDA 5M4CA 4PDOA 3Q5IA 4D2SA 5I9VA 5AAFA 4FKQA 2YJRA 5TF9A 3UVPA 2B54A 3JXWA 2ZMCA 2W1ZA 2IJMA 3D0EA 3DFAA 4YP8A 1IAHA 3HMOA 4M69B 4XBRA 5CAVA 3P86A 5AAEA 3HMIA 1I09A 5EOLA 2VTRA 4DH1A 1CKPA 3F7ZA 5AR5A 3CPCA 3G0EA 5IEXA 4QTAA 4O83A 3FMKA 2R3HA 4F9AA 2JIIA 1JQHA 4ZP5A 3FZTA 5FP6A 3MH3A 3TZ8A 2GQGA 5HI2A 3TUDA 4AT4A 4G3FA 4YTIA 2ZDUA 4BCIA 3FEGA 4IWDA 4RJ5A 4C33A 3L8VA 4DEDA 3FLZA 4C61A 4M3QA 4GRBA 4TNDA 3N4TA 2EUFB 5HO6A 3MW1A 4BCKA 2OXDA 3E92A 5AJQA 4FKLA 2UW9A 3VUDA 4QP7A 3VULA 5IA4A 2FUMA 3LFSA 3KK9A 4ASDA 2IPXA 3GU4A 5HO8A 4O82A 2FA2A 4MH7A 5CEPA 4C4FA 2W4JA 2G01A 5J7BA 3Q4TA 4F7SA 4TWPA 4ZZOA 4QYHA 2ESMA 2J4ZA 2UZVA 2Z60A 4I94A 4AXAA 2WMBA 3DU8A 4BI0A 3EH9A 3D2IA 2JLDA 2GFSA 2PHKA 2FSLX 2W05A 2ZAZA 3FC1X 4ITJA 5HLPA 1WBWA 5HTCA 1PMUA 2YIRA 2Z02A 3OBJA 1W7HA 2WTWA 3F5XA 2OZAB 2YN8A 3MWUA 4M8TA 4ENYA 4QQCA 5A9UA 5L4QA 5M06A 4GT5A 3A4PA 3HV7A 2UW5A 3PWYA 4ZLYA 3A7GA 4JNWA 1CM8A 4P4CA 1ZYCA 3RTPA 3OMVA 3AT3A 3JR1A 5BVEA 3LOKA 5LJJA 3QRTA 5E92A 5D12A 3UBDA 3MTLA 5EW3A 4I0SA 5J7HA 2YDKA 4MD7E 1V0PA 3I0QA 3RAKA 3PRIA 3A8WA 5BMSA 4EHVA 4ZJVA 3BU5A 4PTEA 4FIIA 5TKDA 4Z55A 3D5UA 3UNJA 1PRYA 3UMXA 3GC7A 3GFEA 4FOCA 5DT3A 2OW3A 3G2FA 2ZB0A 3UDBA 4XJ0A 5FTGA 4V0GA 1YOMA 4NUSA 4YTHA 3DCVA 5AR7A 2CKQA 3ZSGA 4M84A 2CDZA 3F2NA 2XIKA 4D28A 2GS2A 1G8SA 4QMLA 5AUTA 1OECA 2YCRA 4FV3A 3SHEA 1IRKA 1GIIA 3EQBA 3RWPA 5EHYA 4FTOA 2GSFA 3MPMA 4I0TA 4D9TA 3HMMA 1P2AA 5E1SA 1K3AA 3C4FA 3BLHA 4QD6A 4AW0A 5L8KA 3M2WA 3O51A 5AUVA 3TNWA 3MI9A 4W4VA 2BTSA 2EWAA 5HLNA 1PHKA 2H6DA 1FMOE 2R7IA 2YJSA 2W1HA 3EL8A 3PUPA 2Q0BA 1ZZ2A 2J90A 3NW5A 4FTNA 2OICA 1VZOA 4R3RA 4AN9A 4FTIA 1ZY4A 4DH5A 3Q96A 3BV2A 4FKRA 5EOBA 3OW3A 2OJGA 4UYAA 1BUHA 4C4HA 3KA0A 5FG8A 5IQFA 1ZYJA 4K77A 2E9OA 4ACGA 4ZS4A 1O6LA 5LCJA 1Y6AA 3EJ1A 5AV2A 3CY3A 3ORIA 5FEQA 3TUCA 2O0UA 2GNIA 2WMWA 3KC3A 3CQUA 2H34A 3PTGA 3I6WA 2FH9A 2VWZA 4EK5A 3R9RA 4FKJA 3QTRA 1W8CA 5FP5A 4IXPA 2Z8CA 5CXZA 2XK7A 2PMLX 5BVDA 1PXLA 4YC6A 3O23A 4JAJA 3H3CA 2AUHA 3NUXA 3S0OA 5E8YA 1OBDA 4I20A 4O2ZA 1FBNA 4IB3A 4FSRA 4IADA 2EXEA 3UVQA 1YQJA 4ANLA 3PJ2A 4IACA 1YXUA 2YM4A 1CKJA 3R22A 4U6RA 2FB8A 4RIWA 3W2CA 2CN5A 4ACHA 3W18A 3F3ZA 3BRBA 3KKVA 2BZIB 3B2TA 4GSBA 4ALVA 2ITOA 2JBPA 1KE6A 2BAQA 4O22A 5IQIA 4YC8A 2OF2A 3KU2A 2LGCA 3R1NA 1QCFA 1OKYA 4O0UA 4UXQA 1VR2A 3LXLA 4MD9E 4TL0A 1IA9A 3BGQA 3QKMA 4BRXA 3CE3A 2EB2A 4QP3A 4TXCA 3ZLXA 2O63A 4IWPA 4E20A 4EONA 4L68A 3LLTA 2BALA 2LAVA 2UW7A 4CZUA 4QMQA 4OTWA 2OXXA 3OOMA 3MFUA 1JWHA 2F57A 1MQBA 4NFNA 3MVHA 3IG7A 5CNNA 3DJ5A 4L53A 2UW0A 4KIQA 4X21A 3VS5A 4EOMA 4MTAA 4XRJA 3HX4A 4FSMA 2I0VA 4FV2A 4U7ZA 4B6LA 3EIDA 5G1XA 2PE1A 4JXFA 5AAGA 3E63A 1G5SA 4MWIA 3BLRA 4G5JA 1AQ1A 3TNHA 3ORXA 1XWSA 3Q6UA 5J8IA 2UZLA 1OI9A 4DTAA 5HVKA 3F66A 3VHKA 4BDKA 4LMNA 3CJFA 1J1CA 3RINA 3DKOA 4DGMA 3R7YA 2R3RA 3VBYA 5I9ZA 1JVPP 4TYIA 3D7ZA 3COHA 1NVQA 4G3EA 4I5CA 3DJ7A 4X3FB 5HICA 3V5WA 3VUGA 4WD5A 3E93A 4YNOA 5AR3A 4ZY6A 3VUKA 5CNOA 4F7LA 4RIOA 4NSTA 2X0GA 4XEYA 4QQTA 3QXPA 4MXZA 4O38A 2VTTA 3HMPA 5H3QA 2IVTA 4MQ1A 3RAHA 2W1GA 3VUHA 5EKOA 4TWOA 3ZBFA 4UXLA 4IMYA 2ERKA 1MQ4A 4MKCA 4U40A 5M08A 3O50A 4EH6A 2IG7A 1JKKA 3QCYA 4JT3A 4IC8A 1V0BA 4IB0A 4O0SA 3ZRMA 4Y85A 4EQCA 3FV8A 2X2LA 4Y8DA 4YBJA 2IZRA 4MF1A 1BMKA 2EB3A 4P5ZA 3SG8A 4Y5QA 4D5KA 4AOJA 3HUCA 3DJ6A 4IZYA 4RLKA 5AUWA 1GZKA 4F70A 2E9NA 5JMSA 3QALE 4YZMA 4TYHA 3LMHA 3LFCA 3L9LA 3PJCA 4FKVA 4RVTA 3SVVA 5AADA 5BVOA 1W98A 3FPQA 3SC1A 5JGDA 3C0IA 4QP9A 5LQFA 3VRZA 5LVNA 5DG5A 2REIA 3BHHA 1SMHA 2KULA 3MPTA 2J6MA 2GFCA 3GQIA 3QTQA 4LG4A 2YABA 3LKMA 3U6HA 4A4LA 1TQMA 3KRXA 3VS6A 5HZNA 1GZNA 4FEQA 4KBAA 4EYJA 4WG4A 5KO1A 2F7ZE 3ACJA 3FMLA 2WZJA 1GNGA 4YO4A 2GS7A 3BX5A 4F6SA 5JQ5A 3BHYA 5K5NA 2PUNA 5AEPA 4LGDA 3PDTA 1T46A 2C5XA 3FSKA 3NUPA 3SOCA 3R0TA 4IAKA 5CS6A 4CMOA 4AACA 3HZTA 3QTXA 2X6DA 1ZYLA 3OVVA 4QRCA 5EI6A 4EWQA 4B9DA 3PSDA 2W99B 2YLFA 1KE8A 4EZ5A 4ANQA 4F9YA 2W0JA 4B8MA 5L6WL 4RVKA 4EORA 3VRYA 4G6OA 2VWYA 3V8WA 5BYYA 1XH7A 2BRGA 2XUUA 4TYEA 4FL3A 1YHVA 4OTFA 3PIZA 4F1MA 4E6QA 3R7EA 5BUJA 4OR5A 3GENA 3I4BA 2W17A 3O7LB 1K9AA 4HZRA 3L9NA 3DAJA 2Y6MA 2X8EA 4RIYA 2F2CB 2F9GA 3R7VA 3I7CA 3P0MA 4OTGA 3UO4A 4A9SA 3EQFA 4ASEA 5CVFA 3OXIA 3R02A 3I79A 3W16A 4FVRA 1LR4A 2GTNA 3QD4A 4V0GB 1FOTA 3NUSA 4CT1A 4C4GA 1K2PA 5GJDA 5HIEA 4BYIA 4QMVA 3RPSA 2FO0A 3PLSA 1J7LA 3CQEA 3MPAA 3OHTA 4DFBA 1OL2A 2W4KA 5AP2A 4EBWA 1FGKA 3LAUA 3QKKA 5HHWA 3V5JA 1F5QA 2PVLA 4D4SA 2GHMA 4RZVA 3ZDIA 2JD5A 4FT3A 5M07A 4D55A 3BE9A 2BZKB 3ZXZA 2VWIA 4EJ7A 4USEA 3ZCLA 2QVSE 2YIQA 5TO8A 2Y6OA 4L52A 3T3VA 5JFXA 2XRUA 2C5NA 4GJ2A 3KXGA 2RKUA 4BKYA 5BVNA 4EKLA 4L3LA 4MX9A 3LVPA 5GIPE 3HMNA 3KFAA 3WZUA 4AOTA 2YAKA 3DB8A 3TACA 3R8MA 3W8LA 3UOKA 4C58A 2WEIA 3V04A 1H26A 2VTAA 3QC4A 3ANRA 3S2PA 3R1SA 4GW8A 5E8ZA 3JY0A 4R7HA 4I6QA 4BIDA 5HORA 4GV1A 3R01A 4UV0A 4CT2A 3FI4A 3AMAA 2EXMA 3UNKA 3R8VA 2PK9A 4QMSA 4A9UA 3CGOA 4X6RA 2YCSA 3QRKA 3F3WA 4G17A 3OC1A 4CZYB 1PJKA 1BX6A 1QPEA 2P2IA 4U44A 4XS2A 3CS9A 4ONAA 4LL5A 4EK8A 4QTEA 1JKSA 4S33A 3BU3A 5A4CA 5CEOA 4JBPA 2QO9A 3OUNB 3GOKA 3IO7A 4RIWB 1ZMWA 3FY2A 3CQWA 1OPLA 2OJJA 3L9PA 2OO8X 2Q83A 2NP8A 2OKRA 3PXZA 5HD7A 2CCIA 3UYSA 1RW8A 3R7IA 3SDJA 2JDOA 2R0IA 3FYKX 3UGCA 3Q52A 4FV9A 1JKLA 2I6LA 2BVAA 4FYNA 2C1BA 3MH2A 4NW5A 4NM3A 3DK6A 4AZFA 4FT5A 3DDQA 3LJ0A 1SVHA 3COIA 3D2KA 3EL7A 4ZLOA 4M14A 3OWLA 1JLUE 4HCUA 3PIYA 4IDVA 3QC9A 3RNIA 4ACMA 4EOQA 4I1ZA 2VV9A 5J1VA 3E3PA 3DXNA 4PMSA 4H58A 2YM5A 3R9HA 3C1XA 2YEXA 5CZIA 3PLAE 1JNKA 2H9VA 2Z7RA 4W4WA 3GB2A 4DEEA 4FICA 4BI2A 2QOFA 2YIXA 3VN9A 1RDQE 2V0DA 1Q8TA 5ANDA 4MYGA 4BDEA 2X7FA 5AP5A 1NXKA 4O7WA 4RX8A 2Z7LA 1H00A 4AQCA 4FYOA 4BHNA 2XJ1A 4WUNA 1SM2A 3CLYA 3VS3A 2VO7A 3DBQA 1UV5A 3R8PA 1VYWA 2QOBA 4CTCA 2GU8A 3R1QA 4X0MA 5DGZA 2OZOA 4MHAA 4I24A 1PMVA 3EFLA 5EDQA 5HTBA 4NM5A 5BQ0A 4D2VA 4KSQA 3UP7A 3D4QA 1GZ8A 1PW2A 4OT5A 5EKNA 1Q97A 4IX3A 3KXMA 4WRGA 4BKZA 4D2RA 3T9TA 2I0HA 3DBDA 3GFWA 3FXZA 2O8YA 4PMPA 5IQHA 4OTPA 3Q32A 2XM9A 4PNIA 5IQEA 2VNYA 4HW7A 3RK9A 4MCVA 4L6QA 4RWKA 3GNIB 4G3DA 4G2FA 4QYYA 5AM7A 3I0OA 4MBIA 5E8TA 2J2IB 4EOKA 4YZNA 3QD3A 3R63A 3KB7A 1R3CA 4GFMA 1J7UA 2JKQA 3KREA 5T3QA 4AE9A 3G33A 4QPAA 4F65A 4OAUC 2FSTX 3TDVA 4IFCA 2IZUA 3PSBA 4AGWA 4OUCA 4ANBA 5IQDA 3NNWA 4IX6A 4XOZA 1M17A 2C3IB 2WFYA 3LFBA 5D9HA 3SXFA 3TNIA 4XBUA 4F9WA 5KBRA 1PXOA 5DEWA 2YWPA 2I0YA 3V5QA 5TOZA 4OBPA 5HD4A 3GC8A 3K54A 4XLIA 2UW6A 2YZAA 4M67A 1MRUA 4IC7A 2PL0A 5LWNA 2X81A 1XH9A 1JPAA 3OG7A 4KA3A 4WO5A 4WT6A 3R9NA 4BDFA 4U3YA 4EQUA 3D5XA 2XK8A 4W9WA 3QWKA 4AZTA 5HX8A 4NH1A 3MB7A 3WZJA 3TKHA 4Z16A 4GG7A 2B0QA 1HOWA 5CXHA 2UVYA 3TV4A 1UKIA 4FEVA 2DUVA 3LFAA 3RBWA 4JDKA 3O8TA 4N57A 4O7ZA 4UWCA 5CU0A 1APME 5CENA 5H9BA 3UG1A 5A14A 4FK6A 1TQIA 1UNGA 4I5HA 3HRBA 4I6FA 2X9FA 1OKZA 2R64A 4QMPA 4IHPA 3NS9A 4JAIA 4I92A 4L46A 3WYYA 5KCVA 4KINA 1J7IA 1KE9A 4U42A 3GCSA 3VC4A 3A99A 3L8SA 2XNPA 3PIXA 3ULIA 3UP2A 5GZAA 2P4IA 5IQGA 3R71A 3ZEPA 3DDPA 5DHJA 1ND4A 3HP2A 4JL9A 5FTOA 3R8ZA 3EQCA 3DKGA 4PPCA 4S2ZA 4ZSEA 4ZJIA 4GH2A 3BHTA 1Q5KA 4PP9A 4C38A 3BEGA 2QG7A 3FXWA 1A9UA 3O17A 1Q41A 3RZFA 4K1BA 3A7IA 4ZMFA 4M68A 2BAJA 3QU0A 4IFGA 4ZTQA 4B7TA 1ZXEA 4ARKA 4PPAA 2JFMA 4BCFA 4JDJA 2Y7JA 2WMAA 4QMNA 1BI8A 5B2MA 4IX4A 3VWAA 3R8UA 3TJCA 2GS6A 3F3VA 5CLPA 1KSWA 2OF4A 4ANSA 1A48A 4WOVA 2B52A 2JBOA 2R3NA 3NCGA 4AZSA 5I5ZA 4EC8A 5KBQA 5K4JA 5AP4A 1RE8A 3E8DA 3TTIA 3FMEA 1P14A 3KMWA 3Q4UA 4I5PA 2RIOA 3GT8A 4JVGA 5KZ0A 4FV8A 4C35A 4OTRA 2QODA 5IA5A 5EM5A 3Q4ZA 2O64A 5E1EA 4FG9A 4I6HA 4K8AA 3PZEA 3TV7A 4V05A 3PY1A 2CSNA 1KV2A 5LVMA 3HNGA 4YZBA 5GNKA 1Y6BA 2BROA 4BCHA 5CQUA 4FIEA 5KMNA 1NT2A 3FMDA 3FZPA 4GUBA 5HX6A 3N51A 3PRFA 5DT4A 4AZEA 3S00A 5BMMA 3UG2A 4EUUA 4PY1A 5LVLA 2W1FA 4FTJA 2R4BA 4B8LA 3I5NA 3M42A 4ZTNA 1MUOA 4FV6A 4E1ZA 4ZK5A 5BUIA 1GOLA 2WQBA 3RMFA 1NW1A 1REJA 2HZ0A 4AN2A 2C3KA 1O6KA 5CEKA 1XO2B 5KNJA 2PU8A 4U5JA 2UZEA 4EOPA 4QPMA 4DCAA 4X2JA 3OUKA 5ANKA 3DT1A 2R0UA 4GL9A 3BYMA 4HVSA 5TR6A 4YGAA 4ZTSA 2YM6A 2OG8A 1UKHA 4NTTA 4BC6A 4J53A 1TKIA 5D7VA 4BCOA 4BCMA 3WBLA 5J9ZA 4WNMA 5L3AA 5AUUA 4KKGA 4W9XA 4QYFA 4FSWA 3UNZA 5DRBA 2F2UA 2AYPA 4ERWA 5EK7A 4U3ZA 2BKKA 4EI4A 2CGXA 1H8FA 2H8HA 2XNGA 3UJGA 5I4NA 4LUDA 4X3JA 3DK7A 5A6NA 3QUEA 4MD8E 4ZOGA 4PRJA 2HW7A 4I23A 2YAAA 3QUDA 1P5EA 5JSMA 4BZOA 5BUEA 4U80A 1FPUA 3DXPA 3GC9A 4E5BA 3GGFA 4EK4A 4LOOA 1RQQA 2OJ9A 5M44A 1Q4LA 1W83A 3A7JA 3OBGA 3P7AA 5AP0A 4C7TA 4EOLA 5KMMA 3A62A 4HVGA 2XA4A 3OTUA 2HZIA 4F1TA 4EYMA 4FL2A 4O7LA 3LE6A 2VTPA 4GYGA 5A4TA 3BEAA 4RVMA 5JFVA 2ONLC 3ET7A 2ITPA 3UQCA 3F3TA 2CGWA 2QO2A 3EN5A 3LFQA 3O7LD 1S9JA 3RALA 3FC2A 4KRDA 5KMLA 2CKOA 5JFSA 3GUBA 3MY1A 1IR3A 3KXZA 4F64A 2YM7A 3WIKA 2YFXA 3E8EA 4AFEA 4QMUA 3QYWA 3E7VA 3OCTA 4G3CA 4QYEA 5I3OA 3CD8A 3AG9A 3AC4A 3IW6A 4FEUA 4RG0A 4OBOA 4RIXA 1E9HA 3P4KA 4FI1A 4FKTA 4WKQA 4C3PA 5L2WA 4FBXA 4O0RA 4BCQA 4TT7A 2VAGA 2O5KA 1U54A 3UQGA 4DYMA 3V8TA 3BI6A 5EM7A 4BZDA 3VJOA 5F94A 3G90X 3RK7A 3QCQA 4Q2AA 3JVRA 3Q3BA 4Q9SA 3NR9A 2GNGA 4HGLA 4WHZA 2WTVA 5EQEA 5F4NA 2GQRA 3LLAA 4R77A 4A4OA 5FUTA 4DGLC 3DLSA 4DH8A 3EN7A 2YM3A 3FQEA 4K9YA 3D9VA 3SG9A 3CC6A 3EN9A 3KXNA 4WBOA 4BHZA 4LOPA 5M53A 4FZDB 1U59A 3QQFA 4L7SA 3W1FA 4TPTA 3TNPC 4AW2A 3CD3A 3FJQE 4GK4A 1H1PA 2C6TA 4BF2A 2PZPA 5CSPA 5IH6A 1ZMUA 4YHJA 4YJNA 4JLCA 2PWLA 4XHKB 5HIDA 3H9FA 4BFMA 2DQ7X 4ZSJA 4KD1A 2EXCX 2WD1A 2PZIA 4RQKA 4BDGA 5K9IA 1WVWA 2HIWA 5JT2A 3SW7A 2RFNA 3IK3A 3NIEA 2WTCA 4H3QA 4K11A 2CLQA 2GNHA 4WNKA 4GKIA 3RCDA 3FLSA 3MESA 1BLXA 3MY5A 2FSMX 3DBFA 3EN6A 2XRWA 3G5DA 4F7NA 5CALA 3NAYA 5AUYA 3DBCA 4RX5A 2W9ZB 5IQCA 3PSCA 3MH0A 4CV8A 5JFWA 3ZRLA 1HCKA 3AC2A 4FV7A 3P7CA 3QA8A 3QBNA 5IH4A 3LJ1A 3RPVA 4O7NA 4W4YA 1R1WA 3C50A 3HRFA 4E4MA 3KXHA 4N4SA 5JRSA 3C51A 2ONLA 4JS8A 1OB3A 2BILB 4ITHA 4YZ9A 4X6QC 1CDKA 2XEYA 2O2UA 3QQUA 5H2UA 2JKKA 2R3JA 3QWJA 4DEBA 4JG8A 5HG9A 2OJFE 2XF0A 3NLBA 4NJDA 5M4IA 1DI8A 4NEUA 4RWIA 4D1ZA 4YZCA 2HELA 4CG8A 2XKCA 3ENHA 3MV5A 2CPKE 2UZOA 4JG7A 4EZ7A 5M51A 3ZC6A 1KOBA 1YI4A 2XNBA 2W1CA 3E64A 5EHOA 4BR3A 5DWRA 3FPMA 1FINA 1XH6A 2Y4PA 3WYXA 3POZA 3ZUTA 2P0CA 2J51A 3TT0A 1EH4A 3A7FA 4BBMA 1H08A 3GXLA 4YBKA 1JSVA 4B99A 4FV5A 5BYZA 4MXOA 2Z7SA 1H28A 5ANJA 4IE9A 3RZBA 5CAOA 2O3PA 4UWYA 4C57A 3HV4A 1J1BA 1E1VA 4LI5A 4C59A 2PE0A 4W8DA 4FV1A 1OIUA 3ZONA 3H30A 3UIUA 2C68A 4E4LA 2A19B 3K2LA 4MXYA 3Q9WA 3KN5A 3RM7A 1L3RE 2YIYA 4F0IA 2GNFA 2VTLA 2VWUA 3LCOA 4M7IA 3NUAA 4O7YA 1Q3DA 4FKWA 4C8BA 3KCKA 1ZZLA 3KRLA 5EQYA 2WKMA 3W33A 5EM6A 4CCBA 1ZRZA 4CTBA 5H8EA 3FI3A 2PVNA 1ZOGA 3MS9A 4XCUA 4C36A 4JJRA 1UVRA 3ORTA 3CTQA 3ZSIA 1FQ1B 1WVXA 3MFRA 3OTVA 4MXCA 2HWPA 5HCXA 3VBWA 2VO0A 3BBTB 3ZS5A 4EJNA 4PL4A 3ORLA 2IN6A 5AV4A 4AAAA 5GZ8A 2ITYA 3IGGA 2C6MA 5I9UA 4F0FA 4O7VA 5IISA 1P4OA 4FNYA 4O81A 1HCLA 1XQZA 5DR2A 4DINA 2I1MA 2KTYA 4NKAA 5HBJA 2B1PA 3G6GA 4WG3A 3UZPA 1Q62A 3BZ3A 4LV5A 1YWVA 4DTKA 2BDFA 2XEZA 2WQOA 5EG3A 3AD4A 3AGLA 3P79A 3COMA 4LRJA 4U43A 2G2FA 3JPVA 4IZ7A 5CU2A 3AMYA 2B7AA 3NWWA 2QCSA 5IKWA 1BKXA 5LCKA 4BBEA 1ZY5A 5LARA 4D0XA 2I7QA 4ZTMA 4MWHA 4FG7A 4G6NA 5I9XA 4FGRA 3EN4A 5CI6A 5DH3A 4RRVA 3NVMB 4IVAA 4AN3A 4UN0C 1WBOA 3OT3A 3FMHA 4DBXA 3TWJA 3FI8A 5IA2A 4DH7A 5AUZA 5IUIA 3AC3A 3ZFXA 3GVUA 2VWXA 4P90A 5AR8A 3FXXA 5AA9A 4I4EA 5C4KA 5KX8A 1VYZA 3BCEA 3SAYA 3P5KA 1GIHA 3C0GA 3GI3A 3ORNA 4BTFA 3KF4A 1YDRE 4C4JA 4N0SA 1MRYA 2OH4A 2BHHA 5CSXA 2J0MB 4AU8A 2J5FA 3ZRKA 1JAMA 4GCJA 4DFYA 4FSUA 2ITZA 4QMTA 2CMWA 4R1YA 4IW0A 1OL6A 3PXYA 5E7RA 3G51A 1UU9A 4XH6A 1YHWA 3DY7A 4R3PA 4C4IA 5ACBC 2ETMA 4TRLA 3K5VA 3HL7A 4EK6A 3BGZA 4Y5HA 4MBLA 3QQGA 4Z9LA 1IG1A 5IA0A 4EKKA 2V7AA 4Y83A 1NVSA 3ALOA 4MNEA 2OXYA 4NIFA 4CYIA 1H24A 2UZTA 3A2CA 4L42A 3ANQA 4PTCA 5DRDA 4A06A 4C3FA 2WHBA 2WMXA 3DGKA 2WQEA 4U79A 3DB6A 1Q8YA 4YJVA 3AT2A 3WF7A 2OLCA 3QUPA 3SQQA 4D1XA 5ETAA 4CFXA 4ZMEA 3L1SA 3HAMA 2ZYBA 3PA3A 1YXSA 4U45A 2VO6A 3F69A 3LHJA 4IAZA 4K18A 2W1DA 5H8BA 3PP0A 2ZJWA 4UBAA 4BGQA 3BELA 3GU7A 3P23A 3RWQA 2YISA 3TNQB 3MH1A 4RIXB 3RAWA 4BDCA 2NRYA 4TKSA 3QCXA 3TZ7A 3NYNA 4EUTA 1U54B 4BVUA 3MBLA 1L8TA 3QZIA 3KK8A 3BYVA 2W5BA 2V62A 4MVFA 5EI8A 2XP2A 1CMKE 2BFXA 4E7WA 5HBEA 3QZGA 3RPOA 2X2KA 4DLJA 3BHUA 4J8MA 3CTHA 4J8NA 2HZNA 5GJFA 5CQWA 2QOQA 2VUWA 3QQHA 2QU6A 5EM8A 3W2OA 3TDWA 1AD5A 2BMCA 3NW7A 4HZSA 4O96A 5FBOA 4AFJA 2QONA 1GY3A 4A07A 2HCKA 2ZV7A 3PZHA 4ZTHA 4A9YA 3QFVA 2X6EA 4F9BA 3FMJA 4DGGA 4FE2A 4FT7A 1G3NA 5E8UA 4KB8A 5EDRA 2GMXA 4YZDA 4A4XA 4DLIA 4FK3A 3IS5A 4KABA 2G2IA 2X7OA 2C0TA 1M2PA 3E88A 2VX0A 4EOJA 4DFXE 5FQDC 4AGUA 2BRNA 2X4ZA 2AC3A 4ITIA 5DR9A 4H36A 4HGSA 2XYNA 2IW8A 3BYUA 2UZUE 1XH4A 2XNMA 2V22A 4RT7A 3OY3A 5CSVA 4AGCA 3SRVA 3NDMA 2XM8A 4BDIA 1WMKA 3ZU7A 3IPHA 5E8VA 4AUAA 3SV0A 3OP5A 4YU2A 3R00A 3CPBA 4O0WA 2G9XA 4CQGA 1DM2A 3CY2A 4QMMA 3HDMA 3JY9A 5IDPA 4BZNA 3OEZA 3C4CA 3UPXA
chains in the Genus database with same CATH superfamily
2IO6A 3QRIA 5EW9A 2ETRA 3EFKA 1Q8WA 4XV9A 2XBAA 2YDJA 2ZOQA 4I22A 4WG5A 2R3QA 1NY3A 5ETIA 4KS7A 4CFFA 4JQEA 3DQWA 1R78A 3HGKA 2C4GA 3LPBA 3UC4A 3ZUVA 4FIJA 4FEXA 2VX3A 2WGJA 2A27A 4GG5A 4ZEGA 3R9DA 4BTJA 2PZRA 1ZYSA 3AKLA 4FZFB 3NAXA 1V0OA 3DNDA 1YWRA 4YMJA 4FODA 1UWHA 2XKEA 3OF0A 3HVCA 5FTQA 2WOUA 5DLSA 4CV9A 4YURA 3NUYA 4YR8A 3NFGB 4FKPA 4L45A 2R3PA 3E62A 3PPJA 3UPZA 3R28A 2XVDA 1CSNA 1XBBA 4S34A 4G9CA 4DEIA 5HESA 2HXQA 5F1ZA 4CVAA 2J0JA 3ZZWA 1OL5A 3VBTA 4ACCA 2UZWE 2ZMDA 3F9NA 4IB5A 3OY1A 1TQPA 3U8WA 2R3IA 2ZDTA 4HVHA 4CRLA 3K3IA 3PJ8A 5L6OA 1ATPE 3MSSA 2UUEA 5IH5A 2R2PA 5I3RA 5CEQA 3DKCA 3IGOA 4GEOA 5AR2A 2ZM4A 3VS2A 1TVOA 2PMIA 4PDSA 4RFZA 2BFYA 3FLQA 3NPCA 3TXOA 4ANOA 4D58A 4KSPA 3GCPA 4IEBA 2XIXA 4FV0A 5ANGA 5L2SA 5DE2A 4QDVA 1FGIA 4KS8A 1O6YA 4BI1A 4EBVA 2XK6A 2XAMA 2WMVA 2SRCA 4EOOA 1YXVA 3FZSA 4HNFA 2J0LA 5DOSA 5CX9A 5EW8A 1WCCA 4FIHA 2XK9A 3POOA 4KKEA 3ZH8A 5HCZA 3TI1A 3VF8A 3ETAA 4A9RA 3MY0A 4BCJA 2YCQA 4WIHA 3TTJA 5IDNA 2B55A 4E26A 3VW6A 2IWIA 2HENA 2BTRA 1YKRA 4O4CA 4DAWA 2OBJA 3QQKA 2HY81 1JBPE 2VTJA 4R5SA 2UW4A 2WMQA 3REPA 5EDPA 4YSJA 2I0EA 4UMPA 5KHWA 3DZQA 1RJBA 2PUUA 5D7AA 5FRIA 5K4IA 2XB7A 3N4UA 3KMUA 5HGIA 5JZNA 3SD0A 3HAVA 4AW1A 3OD6X 4FTUA 3NSZA 4OTIA 2JEDA 1DAYA 3SX9A 4RX9A 3Q4CA 3S3IA 3I6UA 3LFFA 2YLEA 4EHZA 4QNAA 3D94A 2XKDA 3KY2A 4XYFA 2CHLA 4A9TA 4HCVA 4H3BA 3HUBA 1UNHA 1UNLA 4YHTA 3AXWA 4RJ8A 5F95A 1V1KA 3T3UA 4PDYA 5GJGA 2VTSA 5KUPA 5FDPA 4IM3A 4DFNA 4BICA 5ACKA 4FC0A 4XRLA 3VAPA 4TY1A 4YLLA 1Q8UA 2ZV2A 1M52A 4FZ7A 5L2QA 1E1XA 5AV3A 4L3JA 4EQMA 4YJOA 1UA2A 1OM1A 4JOAA 4LFIA 2WMTA 5KE0A 3R8LA 4JBQA 4O27B 5CEMA 3ATTA 2Y4IC 3ZC5A 5BYLA 4YJTA 3LCDA 4DBNA 3FUPA 2HOGA 1OUKA 2HXLA 4NTSA 2YERA 1H1RA 3K5UA 3VO3A 4YC3A 4QQJA 5ANIA 5HE2A 4G3GA 3W2PA 3AQVA 3CBLA 4GT4A 3N9XA 4M97A 4QMZA 2C3JA 3KF7A 4R3CA 5HNBA 4CFMA 2R5TA 2CGVA 4HJOA 2E9UA 3TMOA 5CEIA 3RPYA 5HTIA 5JKGA 5DEYA 4ENXA 3AD5A 4GFOA 3PE1A 4IIRA 1IAJA 2ERZE 4K2RA 5HG7A 5BX0A 5E8WA 3N4VA 3R2YA 2W1IA 2OSCA 5KZIA 2BPMA 4FRFA 4MNEB 1LEWA 4JG6A 4NIFB 3VQUA 5JK3A 3MTFA 2CLXA 1OIQA 4FTCA 3QTSA 4TTHB 3PP1A 2UV2A 2YACA 2PVHA 3O8UA 4P5QA 4QP4A 5ITAA 4O7TA 4NFMA 5FDXA 1KV1A 3GOPA 5J95A 4YPDA 3LW0A 4E6DA 4H39A 2CNVA 3RK5A 1XBAA 3KGAA 4CSVA 4U41A 4TYHB 5LWMA 2A1AB 4RA5A 4QTBA 3F5GA 4FL1A 3V5LA 3G9NA 4GFGA 3DXQA 2GNLA 5A54A 4AXFA 2V5QA 3KMMA 3I7BA 3ZO2A 1DAWA 1Q61A 4NCTC 3CIKA 4UMUA 3EFWA 2PZYA 2YIWA 4LRMA 4CMUA 2PVYA 2QKRA 1KWPA 5BV3A 1ZMVA 2C30A 4IJ9A 3Q2JA 3W0MA 5L6PA 4GU6A 4EOIA 1BYGA 1M2QA 2J50A 1G8AA 3DK3A 2A4LA 1WFCA 2XZSA 3C5UA 3WE8A 4FVQA 4PNKA 3KXXA 5EI2A 4ALUA 4BTMA 3AKKA 4BCNA 2IW6A 3F61A 3I81A 4NT4A 2BDJA 4DEHA 3HYHA 4RFYA 4UZHA 4KWPA 4OT6A 4DH3A 1YI3A 2XIRA 4NM0A 3KVWA 4TYJA 3ZFYA 1UWJA 4IANA 4EC9A 4CKRA 3C5IA 3GC0A 3EQIA 2VNWA 4F9CA 3QGWA 2BZHB 5BVFA 5IUHA 4F63A 5I0BA 5IZFA 4KUJA 4USFA 4LQMA 3S4QA 3SKCA 4BBFA 3RAIA 3PXRA 5HEZA 4GMYA 3UMWA 2B4SB 2UW8A 3IDCA 5EYKA 2BR1A 2VGPA 3ROCA 4ALWA 4UWBA 3PFQA 3WILA 2C6LA 2JFLA 1OL1A 4QDEA 4R7BA 4EH2A 4YJUA 3PVGA 4CCUA 1U46A 3F7WA 4JDHA 4EOSA 4GUEA 2JDSA 3UO6A 4W8EA 3UOLA 3HV5A 4JIAA 2ITVA 4MBJA 5L2TA 4FTTA 1CKIA 5M09A 3SRVB 4DFLA 3MB6A 5JQ8A 4K0YA 4RWLA 4OTQA 1PXJA 3AC8A 3P08A 3MN3A 4DF3A 1ERKA 3BKBA 2BAKA 3ERKA 2W06A 4H3PA 3OXTA 1PXKA 2VTOA 3HP5A 4RIYB 4TWNA 3WOWA 4DG2E 4EZ3A 5IA1A 2RG6A 3QD2B 1VEBA 1Z9XA 3EZVA 4HYSA 4RJ4A 4AXCA 3VS4A 3LCKA 5AIKA 4FG8A 3NNUA 5EH0A 3RGFA 2UZDA 3U6JA 2XIYA 3B2WA 4JRNA 1PYEA 2F7XE 5DNRA 4FV4A 4QP2A 4E4NA 5IMXA 2WTIA 4LYNA 5FD2A 3WZKA 2XAOA 2PVJA 4QMOA 3BPRA 4J95A 4U97A 3FL4A 4XOYA 3QHWA 1QL6A 2UVXA 3RM6A 5AV1A 3WF9A 2QKWB 3FI2A 2IEWA 2YZLA 1XHAA 4R6VA 4XV3A 5IEYA 2B53A 4P7EA 3W0NA 2RL5A 3LM5A 3WZEA 4L44A 4FKIA 1QMZA 2C6OA 1U5QA 1URCA 2XCKA 4HPUE 4NCTA 3C13A 4EH8A 4LL0A 2AEGA 4DFZE 4RLLA 4XNEA 2W9FB 2AC5A 3PY0A 3ODYX 3R83A 1YDSE 4IB1A 4KRCA 2VWVA 5LOHA 3UO5A 1R39A 2WMRA 1OZ1A 5CANA 4FNWA 4OGRA 4R7IA 4YJPA 4AZVA 3CCNA 3PG3A 3RKBA 1M7NA 3F5UA 4MAOA 1JSUA 4AA0A 4K6ZA 1VJYA 3P5JC 4FT9A 2ACXA 2QHNA 3P78A 1B6CB 4FKOA 4O0VA 2XK4A 4O91A 4IAYA 4MNFA 4ZXTA 3ML1A 3LIJA 1H0WA 4C2VA 4BDDA 2ITTA 4E5AX 1YOLA 3ZSHA 5BVWA 4BWPA 5B2LA 3PWDA 4J96A 3VJNA 4YLJA 3V51A 3DQXA 3PG1A 3UQFA 3LQ3A 4F6WA 4O0XA 1LPUA 5J5TA 2CNQA 1H27A 4L7FA 2IVUA 2PULA 4L9IA 4BDJA 3FHIA 4I6BA 1QPDA 3M1SA 1H0VA 4WNPA 5DPVA 3RI1A 4D4VA 5BPYA 5C4LA 1M7QA 3R30A 4RA4A 4FSQA 4FTMA 3FHRA 4XV2A 4N6YA 2WU7A 4CYJA 3ZLSA 4NZWB 3Q60A 3L8PA 3R6XA 3LXNA 1DS5A 2J0IA 4YTCA 1OMWA 4E4XA 3HDNA 3PE2A 3G15A 3C4ZA 2ETKA 2WNTA 3MVJA 2B9IA 5CU3A 4R78A 1XH5A 5LXMA 2C69A 1FVRA 4O1OA 2VU3A 1M2RA 3U6IA 3VVHA 1XJDA 3CSVA 3VONA 5CZHA 1H1QA 1OBGA 3ATSA 5EFQA 1KE5A 2XJ2A 2H96A 2PYWA 4QP8A 4D5HA 2ITWA 3EZRA 4NKSA 4PTGA 3CEKA 2RG5A 4FSTA 4FKGA 4AWIA 1H07A 3WARA 3CKWA 2C6DA 5FEEA 4FTRA 3TM0A 2FVDA 4PMMA 3O8PA 5A4QA 1SNUA 5F20A 2WIHA 4BGHA 4UMQA 4Q5HA 4RBLA 2J9MA 3GCVA 5DYJA 4PX6A 4D0WA 3D83A 5DI1A 4E6AA 5HE3A 4D2WA 3CTJA 5FEDA 1MRVA 1H4LA 1WBTA 3LZBA 4BDHA 3WE4A 3OZ6A 1PYXA 4J99A 3KULA 1OL7A 3W8QA 3OOGA 5CU6A 4I41A 4G9RA 4CFWA 3KVXA 4IJPA 4DFUA 3GBZA 3DBEA 4GK2A 4FOBA 3FE3A 3GCQA 4E93A 2VZ6A 4CEGA 5AA8A 5AP1A 3IW8A 4KBCA 2HY0A 1YOJA 3SXSA 3BIZA 3VW8A 4PQNA 3QTUA 1W84A 4HGTA 4O1PA 4CNHA 2J7TA 1SYKA 2PE2A 3KRJA 4BN1A 4V04A 5CF6A 5HOAA 2HAKA 4DE4A 3EYGA 4ASXA 5E8XA 2YWVA 2XMYA 3QAME 2NO3A 4O21A 3BU6A 2QNJA 4NU1A 3BLQA 1PKGA 4XP0A 3VHEA 4DITA 5IUGA 5JH6A 5E9EA 3ZBXA 1PXIA 3FAAA 3FY0A 3ORZA 4QPSA 3ZMMA 4HNIA 2G1TA 1M14A 3AC5A 3CKXA 3Q04A 3NVKI 4O4DA 2A98A 4G16A 1NA7A 2CJMA 2OFUA 2WTKC 4AS0A 3U51A 5CVHA 3FMNA 2JAVA 4EHGA 3NYOA 3QXOA 3V6SA 3ID6C 2VTQA 3ODZX 2JGZA 4F1OA 3NNXA 4YLKA 3V5PA 4IZAA 5JRQA 2CNUA 3U55A 4UY9A 3E5AA 3AD6A 3W32A 4R1VA 3GU6A 3NGAA 4FNXA 5HO7A 3E3BX 2HW6A 2QU5A 3H9RA 4PV0A 4G5PA 5IQAA 3ZO4A 2A2AA 2NRUA 4XG3A 3PFYA 2OU7A 3EHAA 2DWBA 2QOLA 3KL8A 4AW5A 5I9YA 5IG1A 4NYEA 4WNOA 3RPRA 3E7OA 2X39A 4S30A 3BGPA 3BWFA 3HKOA 4L00A 2XNNA 5AX3A 3G6HA 2P33A 4KNBA 4IWQA 5LMAA 3VBXA 4DG3E 4JX7A 5CF8A 4L01A 3RHXA 3W2QA 3VUMA 1YVJA 1W0XC 1YDTE 2C5OA 2C6KA 4LUEA 4O0TA 1SZMA 2V55A 3NUNA 3W2RA 2XS0A 3AOXA 2Y9QA 2VTNA 2YITA 1URWA 4XP2A 5J79A 2BRHA 5C26A 4IX5A 2Y4IB 4IM2A 1YW2A 5T6KA 4F4PA 3QZHA 3I60A 5E91A 3UDZA 1UU3A 3R21A 4WA9A 1BL7A 1GIJA 1ZOEA 4HCTA 3PXQA 4IH8A 4I5MA 1YWNA 3O71A 4IVBA 4QNYA 4UMRA 2QURA 4IBMA 5D10A 3NIZA 1U4DA 4IWOA 3GEQA 3MFTA 5EYCA 5AUXA 3FKNA 1PXMA 2W7XA 4C4EA 3NCZA 3TUBA 4O7RA 3R7OA 2ZM1A 4TYGA 3FKLA 3OCBA 4XP3A 4DG0E 2R3MA 3ZUUA 3KEXA 3K3JA 3LQ5A 3TIZA 5KMOA 2W96B 4WSYA 3NW6A 3AMBA 3FZ1A 4O84A 2BKZA 4FR4A 3KQ7A 5FGKA 4CQEA 2F49A 4X2GA 2VRXA 5CWZA 4CZTA 4DT8A 3FL5A 2JDRA 3ACKA 2BIYA 3B8QA 4DCEA 1GAGA 5EYDA 3ZXTA 3D14A 3ZTXA 3MDYA 3ORMA 5J9YA 1A06A 4JR3A 3UIXA 4H05A 3BYOA 5IU2A 1WVYA 2RSVA 3F88A 1MP8A 1H1WA 4LMUA 4UMTA 2RF9A 1QPJA 3RJCA 3R9OA 4BCPA 3OCSA 1PKDA 4YHFA 3Q2MA 4HOKA 4BIEA 4F6UA 2WMSA 2OH0E 4FKSA 4I3ZA 2WPAA 3E8CA 3U87A 4ZY5A 5HU3A 2C47A 4ZSAA 2B9JA 5CT0A 3F2AA 4BL1A 1PMEA 3TZMA 5K0XA 3LXKA 4G34A 4RC3A 3ROYA 3C9WA 5C8KA 2PVRA 3O0GA 2XKFA 5DMZA 4CFVA 5M57A 4LGHA 1WZYA 4V01A 4IVDA 4BYJA 3Q53A 4D2PA 3MIYA 3NX8A 2WB8A 3QLFA 3D5VA 4FSZA 4JX3A 3ZEWA 3EQPA 2RFDA 2VX1A 3UZRA 3Q9YA 3VBQA 3TKUA 3GCUA 4O7SA 2X7GA 4EH7A 4APPA 4EH4A 3PPKA 2FYSA 1CTPE 2VN9A 4NM7A 4GIHA 3EOCA 3ZOSA 4Y95A 3QD0A 5C1QB 3NYXA 4FX3A 4MXXA 3IDBA 4RC2A 1Q8ZA 4GYIA 1XBCA 4QP1A 4G1WA 5A46A 5B7VA 5GHVA 3FWQA 5EQPA 3CGFA 2V7OA 4LV8A 5HIBA 5CAUA 3VUTA 3ZHPC 3ZFMA 3PA5A 4DGOA 3RNYA 4P2KA 2YHVA 4HGEA 2UZNA 1I44A 5CF4A 1KE7A 3UE4A 4O6EA 3HV3A 4EH3A 1P4FA 3O2MA 3OCGA 2IZSA 3F3UA 3KRWA 3MJ2A 4WUAA 4FTQA 2DYLA 2GCDA 3PY3A 3ZYAA 4BDBA 1OITA 4FMQA 4RVLA 3UODA 3C4EA 4JR7A 5E8SA 4RQVA 3LCSA 4M66A 5CU4A 4RJ7A 2GQSA 1T45A 2PVFA 5HG8A 4DC2A 4PWNA 5AR4A 1NVRA 4II5A 4CXAA 5DT0A 1VLRA 2HZ4A 2GTMA 1KUTA 2R9SA 4EWHA 3MGYA 5FM3A 2J0KA 5C8NA 2OIDA 4KAOA 3ITZA 3NMUF 4D4RA 5AP6A 3KULB 3IONA 2CKEA 5AMNA 4I21A 2R3LA 2UVZA 3DPKA 3S1HA 5A6OA 2R3KA 2R7BA 2IVSA 3ELJA 3MYGA 4QTCA 4Y72A 3V8SA 1IA8A 5C8MA 4ORKA 2J5EA 2GHGA 2O65A 5G6VA 3TEIA 4JQ7A 4JBVA 5IEVA 4O2PA 5ICPA 4CFUA 2W5AA 3TKIA 4CRSA 4CLIA 3WF8A 4HYHA 5ANOA 3WIGA 3EQRA 5E4HA 3L9MA 3C4WA 2F7EE 3IOPA 2HYYA 1GZOA 2ZB1A 3PXFA 3IW5A 1IEPA 3QGYA 3R2BA 2VTHA 1PF8A 3A61A 3OROA 4XUFA 4TN6A 4PP7A 5HLWA 3VS1A 4L8MA 1ZWSA 2EVAA 3FKOA 4FZAB 4UZDA 1B38A 1ZAOA 1FMKA 4J71A 2YDIA 3VS7A 4XMOA 3NUUA 5EYMA 1X8BA 5DA3A 5A4LA 4NW6A 2EU9A 2X8IA 3GQLA 4ERKA 4UYNA 4LDTA 4RJ3A 2XYUA 3TIYA 3ZDUA 4UEUA 2OGVA 4AP7A 5F9EA 5AFVA 2YA9A 2P2HA 3HV6A 5M55A 5FWKK 2C6IA 4J98A 4FGBA 4GVJA 1LUFA 5CSHA 2WELA 4XG4A 1YXTA 2OJIA 2QOHA 3U4UA 4A7CA 5LMBA 2BZJA 3C0HA 5HE1A 2C3LA 3ALNA 3IDPA 1Q24A 5DN3A 4F99A 4AE6A 4FIFA 4IVCA 3LJ2A 1WBSA 2BIKB 4XG6A 1XKKA 3QF9A 5CVGA 5L8JA 4CGAA 3H0YA 2HK5A 1U5RA 3SA0A 5HKMA 2JIVA 5FXSA 4AX8A 4DEAA 5KKRC 2PUPA 3NRMA 3Q5ZA 3OWKA 5M4FA 4X2FA 2NNWB 4RSSA 3BQCA 1F3MC 4B4LA 3BYSA 5JN2A 4NJ3A 5B2KA 3OXZA 4X2KA 2ZV9A 3OT8A 2QD9A 4JQ8A 4S32A 1Q3WA 3F2RA 3F5PA 3V5TA 3H10A 4QYGA 3PPZA 5HQ0A 3R04A 4QMWA 3BHVA 4FKUA 2WIPA 2C1AA 1OKWA 1Y8YA 3LFEA 4MF0A 5K3YA 4D4YA 4JIKA 4LGGA 2UZBA 5J87A 3EYHA 3QA0A 5AIRA 2QOKA 3AC1A 2QO7A 3UZTA 2C0IA 3O5AA 3ZZEA 3FLYA 2BRMA 3IOKA 4L43A 3R7UA 1YRPA 4PPBA 3QX4A 4CD0A 3CP9A 4J7BA 5M4UA 2Z2WA 3PVWA 4DHFA 4CKJA 4MEDA 4RGJA 2PMOX 4NL0A 2E2BA 2WOTA 4J97A 2PVMA 2BHEA 1OKVA 2QOCA 4WSQA 3KIOC 4O6LA 4FUXA 4EL9A 4JRVA 4YNEA 5ANEA 1QPCA 3LXPA 4LM5A 3QTZA 4HVIA 5C9CA 5M56A 4HPTE 4BY9E 3VF9A 1Z5MA 3OW4A 3B8RA 3BE2A 3KCFA 4OTHA 4EH5A 1ZARA 4Z3VA 2X9EA 2QR7A 5DFPA 2ITQA 4AT3A 3DFCB 2JDVA 4D1SA 5KHXA 3Q9ZA 5FXRA 2CN8A 2WAJA 3QZFA 3ZM9A 2OIQA 3DNEA 4H1JA 4PF4A 5BVKA 5TE0A 4RC4A 1ZYDA 2Y0AA 1Y91A 2XK3A 3QHRA 4IZ5A 4D9UA 3QX2A 3DA6A 4AXEA 1YI6A 2NPQA 5JZJA 4YJQA 3IECA 3UTOA 5AX9A 2WTKB 5BNJA 3COKA 1WAKA 2QC6A 2JDTA 5DR6A 3GP0A 3TG1A 4OAVB 1ST4A 4DHIB 2W4OA 4BGGA 4HVDA 4EK3A 1Q99A 4CKIA 3TYKA 3T8OA 4RFMA 4E3CA 3E8NA 4XLVA 4ZLZA 4E8AA 5C27A 4Z7HA 2BDWA 4JBOA 4IM0A 3VQHA 5IF1A 1UU7A 5DIAA 4LOQA 4IAAA 3OWJA 3EQDA 2R3GA 4Q9ZA 3UVRA 5GINE 3C4XA 3ORPA 3U9CA 2VO3A 3W2SA 3U4WA 2VWBA 4FJVA 4TW9A 2F4JA 4F7JA 3QLGA 4MXAA 4G31A 2X2MA 3AGMA 1Y57A 3TZ9A 4YJRA 2C5VA 5HNGA 4ANNA 4N6ZA 3Q9XA 4DN5A 1W82A 3IKAA 2Y8OA 4Z7GA 2XNEA 5TT7A 1WBVA 2JKMA 5H8GA 3MA6A 4EHEA 3BQRA 4QMXA 4DA5A 3PXKA 5J1WA 3QL8A 4ZIMA 2FSOX 3MVMA 3D7TA 4XG7A 1AGWA 2QHMA 5CSWA 3QRJA 5JEBA 2HWOA 4ZSGA 4BKJA 4ZY4A 5AP3A 5HCYA 2JITA 4GKHA 2WMUA 2X1NA 3MVLA 3DAKA 2QG5A 4XG9A 3LQ8A 4ZSLA 2ZM3A 2VTIA 4E73A 5HU9A 3TL8A 3D5WA 4KIKA 4WBBB 2OIBA 4UALA 4U81A 3PVUA 1OGUA 4X7QA 3V01A 4BWKA 3C7QA 5J5SA 4YPSA 1IASA 5FLFA 2XH5A 3THBA 3EB0A 2OWBA 3DKFA 4CLJA 4PDPA 1BL6A 2FGIA 1WBPA 3AT4A 3S95A 4DTBA 2BUJA 4PMTA 2QLQA 5I9WA 4RMZA 4XG2A 4GT3A 3DS6A 4LV7A 5D41A 3EFJA 4OW8A 3BL9A 3CR0A 1J91A 3VUIA 3QTWA 5AP7A 2PSQA 4O86A 4F09A 4MUQA 3DZOA 2E9PA 4G6LA 4X2NA 5ETCA 3MFSA 2C0OA 2W5HA 4S31A 4ZJJA 4M69A 3ULZA 1ZLTA 1LP4A 5EHLA 3ZLYA 3FBVA 4ASZA 1YXXA 3A60A 1R0PA 5DBXA 5FXQA 4AA4A 2IW9A 3DOGA 2C6EA 3UOHA 2DS1A 4F08A 3P9JA 4D2TA 1JKTA 2ZV8A 5T68A 2CKPA 1SVEA 5GIOE 5FBNC 3BBWA 5L2IA 4NWMA 1OIRA 5AV0A 2PUIA 2PMNX 2C5YA 4C0TA 1YHSA 4RJ6A 4K33A 3WF6A 5KMIA 1REKA 4FF8A 4FTKA 3A7HA 1H1SA 2Q0NA 3R7GA 5IPJA 4XX9A 1SNXA 3KN6A 2WEVA 4FIGA 4KIPA 4R8QA 4U0IA 4ZTRA 2QI8A 2ZVAA 5CT7A 3E87A 3GU5A 4FZ6A 4JDIA 4BIBA 5CAQA 3OEFX 1PXNA 2WQMA 3JUHA 2OFVA 2X4FA 4GIIA 4BB4A 3H9OA 2GNJA 2WTJA 4QOXA 5CF5A 4KIOA 2IF8A 4W4XA 2RFEA 5J9LA 3KRRA 4FT0A 4I0RA 2OK1A 1G8JA 4WRSA 4FUYA 2BRBA 2XCHA 2VWWA 3EQGA 3LM0A 4R5YA 4AOIA 4ZAUA 4L3PA 1Y8GA 3F6XA 2JC6A 3I5ZA 2B9FA 4NK9A 3EKNA 5DVRA 3TN8A 2PVKA 5A3XA 3R73A 3PVBA 3V6RA 3EWHA 4FVPA 4AA5A 4AT5A 3FLWA 3IQ7A 2BCJA 4APCA 4DT9A 3NZ0A 3PA4A 3FDNA 2OZAA 3DAEA 3JS2A 5ETFA 5AWMA 4DEGA 5LMKC 3FMMA 5AM6A 4FTAA 3EKKA 2WXVA 2G2HA 3W55A 3RP9A 3U9NA 3FQSA 1OPKA 3DLZA 1F0QA 1XMMA 4FEWA 4RX7A 2QOOA 4HYIA 3TCPA 1UU8A 1KOAA 4C34A 4CMTA 2CCHA 4DGNA 3FLNC 5CI7A 5D1JA 4OLIA 3FQHA 4BTKA 4FA2A 4ZZNA 4FNZA 3VS0A 1ZOHA 4J52A 2QQ7A 1G8KA 3HEGA 3HLLA 1JOWB 4M15A 2WQNA 2XIZA 4AF3A 3UIBA 3UIMA 4BWXA 2WO6A 5D11A 4EEVA 3OFMA 3F82A 2E9VA 2G15A 2W1EA 3QKLA 4FSYA 3SXRA 4TZRA 5KMKA 1H01A 2RGPA 3U54A 4PUZA 3UOJA 3MA3A 1OPJA 1PXPA 4YTFA 2IVVA 3QYZA 2PPQA 1H25A 5HBHA 1PMNA 2P3GX 2VTMA 3JVSA 4YSMA 4IAIA 3QRUA 2OI4X 5FM2A 2R3FA 4QMYA 3DTWA 4OBQA 5L8LA 4ACDA 4TNBA 4MQ2A 2XBJA 3R1YA 5HNIX 5HE0A 3FSFA 3TV6A 4KKHA 3LFNA 2PZ5A 4U8ZA 2VD5A 4JI9A 5B0XA 5CTPA 3WI6A 4C02A 4IDTA 4X3FC 4BCGA 3VBVA 4E6CA 4UB7A 3HA8A 2XNOA 4KBKA 5CYIA 3I1AA 1OUYA 3LCTA 1XR1A 2YM8A 3UC3A 1TZDA 3T9IA 4C37A 4Y46A 3G9LX 4HYUA 4ZTLA 5HVJA 3W10A 4CFNA 4AZWA 5JGAA 4N70A 4QP6A 1W2CA 3BLAA 3ZLWA 5KMJA 3RCJA 1FVTA 2GPHA 4RPVA 1WBNA 3CXWA 4M12A 4ZS0A 2IZTA 4GU9A 3NNVA 1OIYA 1JSTA 1SVGA 2QR8A 4ID7A 4AGDA 5IQBA 4C3RA 2ITUA 4UX9A 4ZZMA 2PTKA 5JGBA 3QQJA 3BV3A 4H1MA 5K0KA 3VNTA 5CASA 5A4EA 4I4FA 3UYTA 4B0GA 4Y73A 5E90A 3JYAA 3P1AA 3QCSA 4LRKA 2P55A 4EH9A 3SOAA 3HRCA 2GHLA 2XJ0A 5LMKA 2VGOA 3II5A 4GK3A 3RHKA 1BI7A 4GJ3A 4FSNA 4QTDA 4USDA 3ENMA 4OTDA 3GU8A 3FZOA 5LVPA 1J3HA 5C01A 2UW3A 4M0YA 4F0GA 3LMIA 2RFSA 4QQ5A 3PYYA 1GJOA 3ZM4A 4GS6A 2X8DA 3MJ1A 3EQHA 3NYVA 5LVOA 2YCFA 3WF5A 3SW4A 4ANMA 3FZRA 3MIAA 5IMEA 5KKRB 1OVEA 4L67A 4U9AA 1STCE 4CG9A 4E5WA 1S9IA 1XH8A 3EMGA 3OS3A 1O9UA 2JAMA 3ZO1A 2JKOA 3G0FA 4PL3A 3RVGA 3D15A 4O0YA 4C62A 3DTCA 3DV3A 3HECA 2I40A 2CGUA 4RWJA 4Q5EA 2ITXA 3OWPA 3PJ3A 1W2FA 4GVAA 4RZWA 1B39A 4QT1A 1FVVA 4AG8A 4YO6A 3SLSA 3SGCA 3LMGA 2QOIA 2B9HA 3NEWA 4IAFA 4IQ6A 3HA6A 4C2WA 3O96A 5GZ9A 2WU6A 3CJGA 3D7TB 3Q6WA 1Z57A 2Z7QA 5C03A 3VIDA 3LFDA 5K5XA 3FYJX 2PY3A 2A0CX 3QQLA 3BWJA 4XG8A 2QLUA 4M13A 2GDOA 3P7BA 5CY3A 4YJSA 2R3OA 2JIUA 4KIKB 4M0ZA 4X3FA