5AP1A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
268
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVVKDVGVNYMPPEAIKDMSSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 268
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap1A01
5JGBA 4XG2A 4B0GA 2OXYA 4AT4A 1H08A 4YU2A 1Y57A 2HK5A 4WA9A 3ZZWA 4IC8A 2H34A 3QXPA 1IAHA 3SXSA 2XK7A 4ZJJA 5TOZA 3OEZA 2PVMA 3ORIA 3A7HA 4G6NA 2H96A 2QO9A 5AV3A 3OW4A 2FH9A 1DI9A 4TWPA 2W1EA 3LFCA 1GNGA 5CF6A 3CTJA 1CKPA 2C47A 5E7RA 2CGXA 3GCVA 4P4CA 4II5A 2R3OA 1BLXA 3HEGA 1XH4A 3TCPA 1DAWA 2XKFA 2XP2A 4AXAA 3OFMA 3F88A 4W4WA 1W98A 4G3GA 3IO7A 4M68A 3FPQA 4K33A 2XCHA 2G01A 3PG3A 5IA4A 5E8TA 4GS6A 2WAJA 1CDKA 4D0XA 2P2IA 3EWHA 3HRFA 2F57A 4EZ7A 3QD4A 3F2RA 2KULA 3EQFA 2CNVA 4JQEA 1FOTA 1FVVA 3OXZA 5J95A 1R0PA 4BCFA 1FBNA 4XYFA 3ZFYA 3RCDA 5I0BA 1ZZLA 3PJ3A 4FTOA 4MWIA 3DXQA 4C59A 4IAKA 1U46A 1HCKA 5GZ9A 4X2NA 3IW4A 5E8SA 3RP9A 3V5LA 1Q3WA 3Q32A 4R8QA 1UV5A 4R7HA 4WO5A 5CANA 4CFWA 2R3GA 5J7BA 2BCJA 4FKPA 3I81A 3N4UA 2P2HA 3LZBA 3CP9A 4FL2A 4K2RA 3TV6A 2R3HA 5KUPA 2NRYA 2OJIA 3HDMA 5BUJA 3VAPA 2YJSA 4L3JA 3HV5A 4MAOA 5DNRA 5IA2A 3COIA 4B6LA 1WVWA 4IACA 3QRKA 3LLTA 3OWJA 4RC4A 4ERKA 3C0HA 3WYXA 3K5UA 4JS8A 5K3YA 2JKOA 3QQGA 4P5ZA 5JH6A 4F1TA 3PRFA 3Q4TA 4FTMA 4EZ3A 1UNLA 3GVUA 4XLVA 4EH9A 5HOAA 2O63A 3F5GA 3MWUA 3PY0A 4W4XA 4WT6A 4ZTMA 4GYIA 3E8DA 3PXFA 5JKGA 4DCAA 5M44A 2C5VA 5JMSA 4PPBA 3TWJA 2UVZA 3HRBA 1YXTA 3F66A 3Q04A 3LXLA 1P4OA 2OWBA 5HD7A 5K0KA 3VS3A 3W18A 2WNTA 2X2MA 3VS5A 2UW6A 5L2WA 3HUCA 5J1VA 4B99A 3RNYA 3R2BA 4ID7A 4FVRA 4ZEGA 4EOIA 3GQIA 2Q83A 2Y4PA 5AP3A 2X7FA 4BR3A 5I9WA 2UZWE 2R3MA 3ZUVA 2XK8A 1ZLTA 3LFNA 3BIZA 2R3RA 3EQIA 4XBUA 3ORKA 3C4ZA 4DAWA 4OAUC 4DGGA 4NTSA 4JQ7A 3C5IA 5LCKA 4EOPA 4YTCA 3DBFA 4JL9A 4CZUA 4EI4A 2UW4A 1IG1A 3KL8A 3Q9ZA 3FJQE 2X7OA 5AUVA 2XK9A 3GC8A 4BIBA 3OCBA 4HGTA 2E2BA 3ZH8A 3V5PA 4DFZE 5EI2A 2XNBA 3FHIA 4BCMA 3LXNA 2J5FA 4PTGA 5EDRA 2GSFA 4CT1A 4YSJA 3K54A 4IAZA 4HYSA 4IX6A 2Y7JA 3QRTA 4HCUA 1M2QA 1W82A 1YRPA 4ACHA 3ZBXA 3EIDA 2YN8A 3KVXA 5HG8A 4QP6A 2V22A 4Q9SA 3TUBA 3GT8A 3Q6UA 4GEOA 3TNHA 3ZO3A 5F1ZA 3QZIA 3NNWA 4D1ZA 3PLSA 2HZ4A 2OW3A 2ITVA 4AGUA 4W9XA 2GFSA 4EH8A 4FZ7A 5KNJA 2OXDA 3CR0A 3EQPA 4GH2A 4EH6A 4YJUA 3OP5A 3QTQA 5EW8A 3W2PA 3KC3A 4EJNA 4CQEA 5LVMA 3BHHA 2WOTA 5DWRA 1Q4LA 4G5JA 4I23A 5JQ5A 3F2NA 2E9UA 3LFBA 1ZMUA 5FTQA 2C5XA 5AEPA 4G3CA 4Q5EA 3CQEA 3HDNA 5E8VA 4A9SA 4AG8A 3BWJA 4FZFB 3PRIA 3FC2A 4RLLA 5I9XA 3DLZA 1J1CA 3LIJA 4O6LA 4WG4A 4F7JA 2GHLA 2H8HA 3VHEA 3CY3A 3AGLA 3KN5A 2PYWA 4O84A 2JEDA 2YZAA 5FUTA 3OT8A 3Q9YA 5I4NA 4U79A 3TN8A 4D4RA 1W83A 4TNDA 4IC7A 3OT3A 4O86A 3QZHA 3DCVA 4LV8A 3ITZA 4OUCA 1F0QA 3ETAA 4Y8DA 4R3PA 3C4CA 3F69A 2WU6A 4BICA 3MY0A 4R5SA 4G2FA 3CSVA 2O3PA 2GNFA 5HU3A 4NJ3A 4JG8A 5JK3A 1REKA 2UZDA 3FY2A 3HNGA 5HCYA 5FM2A 5EI8A 3U4UA 1OBDA 4U0IA 3GU7A 2EXMA 1YW2A 4PMSA 5H9BA 5D12A 1Q5KA 4TT7A 4AU8A 5CEMA 3R0TA 2ZDTA 3L1SA 2LAVA 4BTKA 3EN5A 2I7QA 3Q3BA 1IA9A 3OS3A 3LMHA 2DQ7X 1U54A 1H26A 2GQGA 4AZTA 3R9OA 5GINE 2E9PA 2R9SA 3ZLYA 4A4OA 4RJ7A 5CX9A 2Z7QA 2BUJA 2BZIB 3BYUA 3D4QA 3F3TA 4GG5A 3UIBA 4GFGA 2RFEA 2H6DA 4FEXA 5HTBA 4XRLA 2ETRA 2P33A 4GYGA 1T45A 3RMFA 2QURA 4DEHA 2JBOA 3G6GA 3GOPA 4UZDA 5AUUA 2BRHA 3MFTA 5L2QA 4ENYA 2RFNA 3HMNA 3TZMA 3W16A 4U3ZA 1R1WA 3OCTA 2QU5A 4GRBA 4CLIA 5AR7A 4QYFA 3RZFA 2A0CX 2J0KA 5GHVA 4I5MA 3VF9A 4AFJA 4D5KA 4DG0E 5AR4A 4ZMEA 3HECA 3QQHA 2EUFB 5M56A 4ZSEA 2YITA 3MTFA 3QAME 3FLZA 4X2FA 4QP9A 3OMVA 4MBJA 2C1AA 4QP1A 2YM4A 5I9ZA 5AUWA 1H25A 3U9CA 1TQIA 3LVPA 4O96A 4CKIA 4TWCA 2R7BA 2HZNA 2W1CA 4YGAA 4YPSA 3IW8A 4Q9ZA 1JLUE 3RWQA 4ZY4A 2UZUE 2J4ZA 2VX3A 3WZKA 3GFEA 3QCYA 2JIUA 4XH6A 3TV4A 4JRNA 3R7IA 4ZTHA 1IR3A 3QA0A 2PMLX 1BMKA 3VUHA 5AP2A 2XIKA 4KIPA 1WAKA 3EN9A 4FKVA 1H1SA 4AS0A 3UOHA 4FTIA 4J97A 2O2UA 5LQFA 5KE0A 5HG9A 4ASDA 3DK7A 3O7LD 3UP2A 3HMPA 4IM3A 3DPKA 4MNEA 4RA5A 5ANIA 3CQUA 4BF2A 1OVEA 3PXYA 4FK6A 2XNNA 3SDJA 3KREA 1WBSA 4UBAA 2HWOA 4XCUA 4LL5A 3RHXA 3IW7A 1MQBA 4D9TA 1KOAA 2HAKA 1YWVA 3WF5A 3DY7A 3AXWA 4O22A 2OLCA 4EHVA 4FT0A 4C37A 1IASA 5E9EA 5KMLA 3VVHA 4A9UA 4EOSA 4QO9A 5AIRA 4D1SA 3FZPA 3E3PA 4LUEA 4UWYA 4CV8A 4LOOA 3D94A 3P78A 4AAAA 5K0XA 5ANKA 4PDYA 5HX8A 1L8TA 3QUEA 4OTQA 1Y8GA 1XHAA 2YM3A 4ZTLA 3ZRLA 2XVDA 3A7JA 3W10A 2QR8A 4FE2A 3ZO1A 2R3KA 3NLBA 2R3JA 5EFQA 5FQDC 4FUXA 3VS4A 2HXLA 4QQJA 4DLJA 1PXPA 2PE2A 4G17A 3MB6A 3OZ6A 3V04A 3OOGA 4BHNA 2VX0A 4GU6A 4C4FA 4ANSA 3ERKA 5LVPA 4PX6A 2Y6MA 3C4FA 3JVSA 5LJJA 4FTTA 2DWBA 2YM6A 1UNHA 2BHEA 5T68A 4ANNA 3FXWA 3R2YA 4LUDA 5IEXA 4LGDA 4I5PA 3RCJA 3UZTA 4FICA 2W4JA 2CN8A 4O27B 1RDQE 2ZB0A 3FI3A 4P7EA 1NVQA 4DFNA 5IU2A 1Q8ZA 3LM5A 5BYLA 1G5SA 2Z8CA 4LG4A 1H27A 4NU1A 3E62A 1MP8A 1X8BA 4IDVA 4C33A 3DFCB 3NW7A 4F6WA 1HCLA 5HIDA 3NPCA 3LCKA 3U87A 1ZMVA 4JX3A 2R64A 4WHZA 4NKSA 4FIIA 3P9JA 5L6WL 4UWBA 3UO4A 1KV1A 2B55A 5E4HA 3FAAA 3EQHA 2GDOA 1SYKA 5KZ0A 4BFMA 4L43A 4IX5A 2SRCA 3DNDA 3ANRA 5C03A 5A4QA 4JG7A 2X8IA 4XV2A 3QALE 4AN3A 2IVVA 2VWBA 5KZIA 1A9UA 4GUBA 5HE0A 4AZSA 2ZJWA 4CFXA 4ZOGA 3TM0A 1U5QA 5DI1A 4LGHA 3FLQA 3VBWA 3DK3A 4IXPA 1ZYLA 3PE2A 1VR2A 4O0UA 2YDIA 4BCQA 3HKOA 2YJRA 4EJ7A 2ACXA 1OGUA 4NJDA 3PVGA 3UP7A 3W2RA 4P5QA 3ATTA 1M2RA 3QQUA 2W1GA 5JRSA 4USEA 5D11A 4U40A 3ZXZA 3PWYA 4KBKA 4BDBA 1YOJA 3GU8A 3NDMA 4OTRA 5D7VA 5HLNA 4W4VA 2QR7A 2WTIA 3TNIA 1PMUA 2VTTA 3CY2A 5B7VA 2QOIA 4L00A 1UA2A 2C5YA 3ENMA 5C27A 3ZM9A 2WMUA 1M17A 3DBQA 5CU3A 1H00A 4ASXA 1RQQA 1WCCA 4ZSJA 4AUAA 3LAUA 5H8EA 3DQWA 5CAVA 3DB8A 2VZ6A 2PUNA 4QMLA 4TNBA 4J8NA 2YACA 3W2CA 4AOIA 3FWQA 2PZRA 4TRLA 3UVPA 4AX8A 4I5CA 4ZMFA 4GFMA 3FQSA 3W2OA 4GK2A 3ROCA 3L9MA 2OZAA 4GJ3A 5AV1A 4DFXE 1O9UA 1JSUA 3QCSA 3FLYA 3DKCA 5AP0A 5HCZA 4BWXA 4FT3A 4HZSA 5HO6A 4FGBA 3BELA 4ZY6A 3OC1A 4IMYA 3SGCA 3BYSA 3CBLA 5AV0A 3WZEA 4Z55A 4JX7A 4J96A 5CVHA 5KKRB 2W1ZA 1YI6A 5AV2A 5C8KA 4O0WA 3BCEA 3F61A 4HCVA 2RF9A 3R71A 2VO6A 2QHMA 4MXCA 4QQ5A 3DKGA 3W2SA 1FMOE 2J0JA 4UXQA 4CYIA 1K2PA 3LFFA 4FV1A 2V0DA 3FMKA 1JKLA 4FNWA 4EKLA 1UU7A 3RVGA 3ZUTA 2XKDA 4ZS0A 1S9JA 2VWZA 2HWPA 3FDNA 4TKSA 3TIYA 4IADA 4Y72A 3DTWA 2IPXA 2JKMA 2UZTA 2YIRA 2XCKA 3RKBA 4IM0A 2JKQA 5K4JA 4UMTA 1LPUA 4GVAA 3KRLA 3O71A 4ACGA 2XM9A 2HENA 2B1PA 1E9HA 4FKUA 4AWIA 5IQCA 3MVJA 3DU8A 5DOSA 2C0IA 5AP1A 2J51A 4KSPA 4DFYA 3TUDA 4O83A 3PA4A 5EOLA 4CV9A 4QP4A 3SAYA 4U5JA 3GCSA 3LW0A 4C34A 2C0OA 2GHMA 2WTCA 3OVVA 4K77A 4DINA 4NW6A 2YCQA 3P08A 4Y83A 4DE4A 3FQHA 2WMVA 3UGCA 3GUBA 3V8WA 4RC2A 1K3AA 4NM7A 1UU3A 4PL3A 4RSSA 5IQAA 5CSXA 4YLLA 2C68A 2Z7RA 4U44A 4C3PA 3RI1A 5E8WA 4EK3A 3RAWA 1H4LA 3TACA 3LMGA 5KMIA 2EB3A 3HYHA 3TV7A 1WMKA 2HELA 4UMUA 2IZRA 3LQ5A 3Q9XA 4HGEA 4R77A 4E7WA 4NEUA 1BKXA 3HAVA 4X3JA 3F7ZA 4M3QA 2XJ0A 5BVNA 2BPMA 4FT5A 4M14A 4RWLA 4Z16A 4JNWA 3QD2B 4WRGA 2J0LA 2P0CA 2WIPA 2XJ1A 3DB6A 1QMZA 4JLCA 5CTPA 2Z02A 4PF4A 3WF8A 4EONA 3U6JA 5DIAA 5FEDA 5I9VA 5KKRC 4HGLA 3R7UA 1UU8A 2KTYA 3F5UA 3FMMA 3ZS5A 4KS8A 5FTOA 2ONLC 4N6ZA 3Q53A 5AAFA 4TYEA 3WILA 5GJGA 5J9ZA 3D15A 3FV8A 5HZNA 1H07A 5AIKA 4NSTA 4ERWA 3BLHA 3UQFA 4NM3A 3KMWA 4KINA 2W96B 4IX3A 3RBWA 4CGAA 4D0WA 5ITAA 4AW5A 4C4EA 2QOQA 4QMZA 1ZRZA 4I0TA 4WNKA 4YZNA 2ZYBA 1H1WA 2NPQA 4I4EA 2PVRA 3IONA 4NFMA 5IQHA 4FTUA 5L2TA 5HNIX 3KXNA 3ORXA 4ZZNA 3BHTA 3IK3A 5KO1A 4H05A 2ZM1A 4JBVA 2W7XA 2JITA 2C0TA 2XMYA 4RX7A 5DGZA 4EQCA 2GS7A 3KCKA 3WOWA 3TG1A 4D4SA 2B4SB 4YZMA 2PE1A 3PVUA 4FIEA 4H1JA 4IHPA 2VUWA 2DUVA 4L7FA 1PHKA 3QYZA 4E73A 3OG7A 3CC6A 3GEQA 4KKEA 2WU7A 3GNIB 2BRGA 4LL0A 3QKLA 4AW1A 3O8PA 4EWHA 5HTIA 2ITNA 3E3BX 3Q60A 4TY1A 4BB4A 4RIXB 4MXXA 4B8LA 4O1OA 2W17A 4YNOA 2OIQA 3ID6C 4O7VA 1J1BA 3PZEA 4E26A 1OKVA 4BWKA 4I6BA 3R7GA 2WTVA 4FKSA 4IWOA 4UYAA 5AR3A 5BMSA 4AA4A 3EQBA 5BVDA 3GP0A 3D9VA 5HNBA 1SVEA 2IVSA 3MI9A 5AUTA 2WZJA 4E6CA 4BYIA 2B53A 2JGZA 2A4LA 3I7CA 3NYNA 2XIXA 3RNIA 1UNGA 3VW6A 3B8QA 1PXOA 3GC0A 4GL9A 4RJ4A 3WZDA 4EOMA 5DRDA 3SX9A 3ORTA 2IW9A 4UZHA 3NUNA 3Q52A 1Z9XA 5A6NA 4MNFA 4L52A 4F9YA 3RK7A 2G2IA 2BHHA 2BZHB 2VNYA 3E7OA 4FKLA 2ZV9A 3U4WA 4E6QA 4TL0A 3E64A 4F63A 3BI6A 4PL5A 3R8MA 3ZEWA 2CGVA 5AP7A 5LOHA 4DT9A 4F9WA 4QPMA 5LVNA 3FMJA 3UODA 4W4YA 4BBEA 3EQCA 3OHTA 5J7HA 4QTEA 2XKEA 5DG5A 4FTAA 4IVAA 4XX9A 2ZM3A 1ZMWA 4FODA 2O5KA 3A2CA 5IPJA 3G0FA 5HO7A 3LXPA 4YC6A 1H8FA 3BE2A 3R83A 5G1XA 2O65A 4DG2E 2IWIA 4FYOA 3ZLXA 3VS2A 5EKNA 4DT8A 5D7AA 1Q8WA 4DN5A 3MH3A 2XA4A 3D0EA 3R21A 1M7NA 3WZUA 5EQPA 3DBEA 2VWWA 4RVKA 2I0VA 4O0YA 4RQKA 5AMNA 4EHZA 1OI9A 4FOBA 2OIBA 3LCSA 3UOKA 2IVTA 3FL4A 4EORA 4ACCA 4YJSA 2ERZE 3ZLSA 4EZ5A 4XJ0A 3A4PA 4MYGA 4A4XA 1REJA 4YLKA 4TWNA 3VWAA 5LMBA 2WTKC 4C3RA 2BIKB 5ANDA 4D58A 4F6SA 2BILB 2VTOA 3BHVA 1ZY4A 2RGPA 3PVBA 5CXZA 3LLAA 2X39A 5A6OA 3ODZX 4RJ8A 4ZTSA 4U45A 4HGSA 4D55A 3PJ1A 3R6XA 4TYHA 5L2SA 2BZJA 3ZMMA 5DT3A 5IA3A 4FSQA 4FTJA 1YDTE 3KQ7A 3QKMA 5JSMA 3AC2A 3QA8A 5M4CA 3R9RA 1NY3A 2W06A 4K6ZA 3CXWA 5FLFA 4OGRA 4PMMA 2GTMA 4BC6A 3MW1A 2R3IA 2EWAA 2J5EA 4JVGA 3H9OA 5AUZA 5BVEA 4DFBA 4EH4A 3FLWA 3Q5IA 3SOAA 3AD4A 2VTPA 3OCSA 4BWPA 1J91A 4RX9A 4FSNA 2GHGA 3LXKA 2NP8A 3OWLA 1TQMA 4IM2A 3VO3A 4A06A 2WMWA 5IMXA 3QTXA 4RWIA 2B54A 3KVWA 4ALUA 2CLXA 3FZTA 5KMOA 2F2UA 1BI8A 3QXOA 1IAJA 2EB2A 4G31A 2PVYA 3KULA 4EOKA 5EG3A 4FTNA 5I9YA 4NM0A 2VO7A 5CY3A 4ZSGA 4FIHA 4AZVA 2HZ0A 1WBNA 3MH2A 5ETAA 2FUMA 3UVRA 4WSQA 3VN9A 1GOLA 2Z7SA 2YA9A 4O0SA 3QRJA 4EKKA 2RG6A 4CRLA 1OZ1A 3FZ1A 5E90A 3FI4A 2WTKB 3U51A 3P23A 4O82A 5IISA 4EK4A 3SG9A 4D2WA 4F7LA 2I6LA 3IOPA 4U8ZA 1H1RA 1IRKA 1F3MC 2A1AB 2BRBA 4YJPA 4E6DA 1Q8TA 5H3QA 3QQFA 4CEGA 2V55A 4FTLA 4RMZA 1R3CA 4X7QA 5FTGA 1WBWA 3W55A 4E6AA 4QMWA 5CQUA 3CKXA 3OTUA 5CU4A 4WSYA 4IZAA 4Q2AA 4ALVA 1FGKA 1XWSA 2IG7A 5FBOA 5BPYA 2WELA 3QYWA 1V0BA 2JDRA 4FG7A 1OL5A 3SQQA 2B9FA 5AM6A 4AZEA 4YURA 4M84A 1ND4A 2ESMA 4BCNA 4BCGA 4NK9A 3P4KA 4O7ZA 3T9IA 4E5WA 5CT7A 1KV2A 4GK3A 2BDFA 2RG5A 4JIAA 5D9HA 2X0GA 5HLPA 4YTIA 4RFMA 3V5QA 4DTAA 3MV5A 2YZLA 2YERA 4D2VA 4P2KA 2HCKA 4PTCA 4DGOA 2R3FA 4O21A 4EUUA 5IF1A 1CM8A 4KRCA 4XG3A 4IEBA 4BRXA 5IDPA 4IX4A 3TKIA 2QOOA 3W1FA 3TJCA 3MPTA 2W99B 3NYOA 3CJGA 4YHJA 4IB5A 1PYEA 3FQEA 3NUUA 3OWPA 1V0OA 2EXEA 4YJOA 5AJQA 3CD8A 3ZC6A 3IKAA 3ZFXA 1WBOA 1QPEA 4KSQA 3S3IA 5F9EA 2QOFA 3EB0A 4PPCA 2WMRA 5TT7A 1GIJA 1JWHA 4ZLOA 5JFSA 3G2FA 3NUYA 4A9RA 1KSWA 2QKRA 4RIYB 4E4LA 3AD5A 4FR4A 5IQEA 3NCGA 2YISA 3MS9A 4I20A 3KB7A 3BYMA 4PDPA 5KMKA 2BKKA 4S30A 1P5EA 5I3OA 4G6OA 3UPZA 4DFUA 5FRIA 2RSVA 4GKIA 3FY0A 3SVVA 2F49A 1PY5A 2OG8A 3UC3A 4KNBA 4RIWB 4M0YA 3TL8A 4IBMA 4X3FC 1OIRA 4MXOA 3ORPA 3K3IA 2UW7A 3TNWA 4DBNA 1Y91A 4JBQA 2W4KA 1PXJA 2OF2A 3FKLA 3FLNC 3RALA 4E3CA 3GU5A 4TW9A 5A9UA 3FMNA 3Q6WA 1NVSA 4I94A 3ZYAA 3HMMA 4O7WA 4IVCA 4XG7A 5AUXA 2HXQA 2OFVA 4P90A 3PA3A 3TUCA 3NR9A 3LCTA 1FPUA 5BVKA 1ATPE 2PUIA 1J3HA 2QC6A 4H39A 1PKGA 3FSKA 3V6SA 4QOXA 4EL9A 3JXWA 4J8MA 1SMHA 4O2PA 5LMKC 3MVHA 4G3EA 4BCOA 2E9VA 4GIIA 3SHEA 3NYVA 3R7EA 3RJCA 3G51A 4IH8A 5CAPA 5GIPE 3PY1A 3SV0A 5CSVA 2XIZA 2RKUA 3CTQA 4E20A 5J5SA 2GCDA 4WNPA 3U6HA 1QL6A 1Y6AA 4XG8A 2BFYA 3DNEA 2WO6A 4IB1A 4U3YA 3ZO2A 4ASZA 4FG9A 4LMUA 4Y5HA 4YC8A 3A61A 1PMVA 4F9AA 4QYEA 4FEWA 1MRYA 4B4LA 4BHZA 3MIYA 1EH4A 4I24A 3CLYA 1RE8A 4FV2A 4CYJA 4FG8A 4IAYA 2BTRA 1SM2A 5CEPA 1CMKE 2PSQA 4BGHA 5BUEA 4BCKA 3MBLA 3AG9A 4JR7A 3WF6A 4ZSAA 1HOWA 4K0YA 4YJQA 3ULIA 3QTRA 3UPXA 3B8RA 4GFOA 3IQ7A 3TNPC 5DEYA 1O6KA 4IJ9A 1WBTA 2VWUA 3O0GA 3R1YA 2ZV8A 4X3FB 4YLJA 1TQPA 2R0UA 4EOQA 3FZRA 2HW6A 4FT7A 4HYHA 4NCTA 4CSVA 5FDPA 1CKJA 3QGYA 2XK6A 4FV9A 4O38A 4X2JA 2UUEA 4RPVA 3ZDIA 3ACKA 2QO2A 2XS0A 2HOGA 2DS1A 3L9NA 2Q0NA 3FZOA 3S95A 2WHBA 3TZ9A 4OTGA 5IUGA 2V7AA 5J79A 2IN6A 3EFJA 2QVSE 3SXRA 4KIOA 4HVGA 1GIHA 2IZTA 2OGVA 3G9LX 4OT6A 3E92A 3TDWA 2QKWB 2W1IA 4UEUA 3MA3A 2VTLA 3MDYA 1B38A 4MTAA 4LQMA 1BL6A 5A14A 2IZSA 4E4XA 4HNFA 3GI3A 2ITZA 3NW6A 5GIOE 2C6LA 2UW5A 3QTSA 1FVTA 2IJMA 4S32A 4DTBA 3I79A 3G90X 3SKCA 3VHKA 4EYMA 2XBAA 3EFWA 1URCA 4R1VA 5HD4A 1NW1A 4V01A 4HVDA 2F7EE 4ZZOA 5IG1A 4AGWA 5H8BA 3VF8A 2QOCA 3QUPA 4D5HA 3UG2A 2OJFE 2XUUA 5HVKA 3KRXA 1DS5A 4FC0A 4Z3VA 2ETKA 4MEDA 4X21A 3RTPA 3QLFA 1H1PA 4R7BA 1Q8UA 2GPHA 4RFZA 4E8AA 2JFMA 4JT3A 3E93A 4J53A 2A2AA 3FBVA 4IWQA 4BN1A 1URWA 5FEEA 3KXXA 4C0TA 1U4DA 3A8XA 3MTLA 3S2PA 2PVJA 4ITHA 3ZC5A 3OW3A 4GJ2A 3KA0A 5HBHA 4OLIA 3UO6A 2YIYA 4ITIA 4O0XA 3UBDA 3QRIA 2GU8A 3DBDA 1UWJA 4QMPA 4DEDA 2VX1A 4XBRA 4K18A 2BAQA 2C5NA 3G6HA 4Y85A 5DE2A 4O81A 4MD7E 5DYJA 3PE1A 2HW7A 4XV9A 4DYMA 4PMPA 5CF8A 1A06A 3I4BA 5DR6A 4GG7A 2PE0A 3E8EA 4S2ZA 3G5DA 5IA0A 3RPYA 4AE6A 3UQGA 2Y4IC 4QNYA 5AR2A 4J52A 3G33A 1XH7A 2OZOA 3N4TA 4LYNA 5EHLA 4IE9A 2OU7A 2XF0A 3EZRA 4F70A 5KHXA 2AYPA 3DQXA 3B2TA 3POZA 3RHKA 3DFAA 4MBLA 3VW8A 4TN6A 2JLDA 1YXUA 3DZQA 5DT0A 3QU0A 4Z9LA 4E5AX 5AM7A 3CEKA 3ET7A 3VIDA 3ATSA 2PVHA 4X6QC 1PKDA 2GNIA 2XNOA 5ACBC 3TEIA 1KE6A 4PMTA 3EYHA 2E9NA 3TTIA 1PXKA 4A7CA 2IZUA 1Q62A 3I6UA 3S4QA 3QRUA 5HBEA 4RIYA 5L6PA 2VTAA 3NWWA 4EH2A 2Y9QA 4AZFA 3GCQA 5CYIA 4JDHA 5C8MA 3M1SA 4HVHA 3LOKA 2ZV7A 3IGGA 1QPJA 1B6CB 4KKHA 5DHJA 3CIKA 4ANBA 3NUAA 3FI2A 2ZMCA 1Y8YA 4YTFA 4FL1A 4RZVA 4RIWA 2YCFA 2CHLA 4FNZA 2YFXA 3V6RA 3V8SA 4WG3A 3NVMB 4BY9E 5KMMA 2G15A 4EHGA 4ZLYA 1KE5A 5EHOA 3Q2MA 2QO7A 2XYNA 2X4ZA 3QBNA 1WVXA 4XOZA 4ANLA 3KF7A 4XHKB 2PVLA 4L01A 4MQ1A 1NA7A 1JQHA 4Y46A 2PVNA 3BEAA 4APPA 3VUMA 4DEAA 1SVGA 4I22A 3GU4A 2Y4IB 3R28A 3PPZA 3SA0A 2J90A 3ZO4A 1GZ8A 4FKOA 4RJ5A 1R78A 1XH5A 3BX5A 2CJMA 4ZIMA 4BDDA 3AC5A 3LQ3A 1W7HA 4C7TA 1IA8A 3P7AA 4R6VA 1GZKA 4F0GA 4EOOA 4GMYA 3DK6A 2FSMX 4FTQA 4U43A 2X9FA 5BVWA 3AMAA 2BRMA 4AP7A 1PXNA 4CQGA 3DAKA 2X6DA 4FSRA 4OTDA 5IKWA 4D2TA 1XBAA 3VUKA 4G1WA 2G2FA 4MXZA 4I5HA 4L46A 4F9CA 1YHWA 2W9ZB 1W0XC 2OH0E 3LPBA 3H3CA 1YHVA 3KKVA 5HVYA 4IZ7A 4RJ6A 3R7YA 4U9AA 3QTUA 1G8SA 5I3RA 4IAFA 1JNKA 4M12A 1PF8A 1Q61A 1UWHA 3FKOA 3ODYX 4M66A 1WVYA 2W5HA 1OM1A 3EFLA 5C26A 1SVHA 2GMXA 3MSSA 4MQ2A 3A8WA 5B2KA 4H3QA 1PXLA 3TKUA 5A4TA 3Q2JA 5I9UA 1QPCA 3BV2A 2BKZA 3VC4A 3TDVA 5IQDA 1YWNA 2QLQA 3U8WA 2OSCA 2PY3A 2UZLA 3LCOA 4FL3A 5AV4A 2AC3A 3F3ZA 2P4IA 4H58A 5ANEA 2CKQA 3T8OA 4O6EA 3KXZA 1CSNA 3TZ7A 5EOBA 3RAKA 2B9HA 3FXZA 4D4VA 4NUSA 4C02A 5HI2A 2AC5A 4IDTA 5HG7A 5J1WA 3MH0A 5HE2A 4AW2A 4D9UA 4D2RA 1PMEA 1OL2A 4S31A 3DKOA 5LVOA 4AGDA 3U6IA 3PG1A 5D10A 3BLRA 3C4WA 4I6HA 4NKAA 4XP2A 3F3UA 2XM8A 2Y0AA 2QONA 3GCPA 3BLQA 4GK4A 4OTPA 2CGWA 4CVAA 4IWPA 5TR6A 3D14A 4RGJA 5CNOA 4EC8A 3U54A 2E9OA 3F82A 4JQ8A 1WFCA 5F20A 4F1MA 2BAKA 3IDBA 4JG6A 5M57A 4FK3A 5ICPA 4NIFB 1XO2B 4XG4A 4KIQA 1PW2A 5FXQA 3UIUA 4E4NA 5E91A 1XKKA 4HYUA 3FUPA 1PXIA 5CWZA 5EW3A 2BALA 4U7ZA 5EQYA 3RWPA 2J6MA 3H9RA 4DH7A 5C8NA 5B2LA 4A9TA 4RA4A 2JAVA 3FKNA 3R8PA 2WOUA 4V05A 4YO4A 2OXXA 4XMOA 5K4IA 1JSTA 4FIJA 4YZDA 4GKHA 4NL0A 1YI4A 2GNJA 3FSFA 2VWVA 3MYGA 5BVOA 4MH7A 2WQEA 1WZYA 3HUBA 5CEOA 4FI1A 1JOWB 3EHAA 4FTCA 4FV8A 5DLSA 4FTKA 5CZIA 4BI0A 4AOTA 2W9FB 5HX6A 5M09A 5IEVA 1G3NA 4IJPA 4RVTA 4WD5A 3PIYA 1YKRA 3DGKA 4BL1A 4PL4A 1LR4A 3NUSA 5IQGA 5JN2A 4W9WA 2YDJA 4ARKA 5AAEA 4XOYA 2QG7A 4EH3A 1Z5MA 3R9HA 4IFCA 1DI8A 4L3PA 4MWHA 3QX2A 4H3BA 2ZV2A 3ZSHA 4IW0A 2C6TA 2ZDUA 4NH1A 3ZTXA 4CZYB 5EM5A 4FKIA 2FB8A 3MA6A 3PUPA 4C35A 4FA2A 3RZBA 3LMIA 4BDCA 4IZ5A 5FEQA 5IH5A 3JS2A 2C3JA 4PP9A 3V5JA 5CASA 3D7ZA 4UXLA 2P55A 5IH6A 4MD9E 2VTSA 2WEIA 2BTSA 3C7QA 3ZU7A 4MCVA 1R0EA 2X8DA 2F7ZE 1CTPE 3Q5ZA 4YSMA 2B52A 3C4XA 2BROA 5JGDA 4CD0A 3HAMA 5AA9A 4O7SA 4CTBA 5EI6A 4FEUA 3DXNA 3V5WA 3R02A 1ZYSA 3VUTA 5EYDA 5CAOA 2C6KA 4TXCA 3A62A 5CU2A 1Q8YA 3QCXA 4OTWA 4RWJA 1ZXEA 3E63A 4PWNA 4L3LA 5DPVA 4DH1A 4FSWA 2YAKA 3QHWA 2A27A 3OY1A 3QGWA 4FV5A 3R1QA 4GV1A 4YUQA 2RL5A 3B2WA 1APME 4I0SA 1STCE 3D2KA 3L8PA 1SNXA 4QTAA 1MQ4A 3NX8A 4YBKA 4ZZMA 3R8LA 2YCRA 5FWKK 4CFUA 4ASEA 5AA8A 1UU9A 2XIYA 4JJRA 1VYZA 3PPJA 5TO8A 5TF9A 3NAXA 4FKJA 4J98A 3A7FA 2YIQA 4FV0A 4QMYA 5DFPA 2BDJA 5GNKA 4FIGA 4KBCA 4BCIA 3ZSGA 1YHSA 2I1MA 2Z7LA 3WE4A 5CQWA 1OPKA 4M69B 3FYKX 2ERKA 3PIZA 3K3JA 4ALWA 4BDFA 4QP7A 3I5NA 1ZARA 5DMZA 3QD0A 5JZJA 2PVFA 2XB7A 3LFAA 3QTIA 4I92A 4QTBA 4QMVA 5HIBA 5JEBA 5KBRA 4GVJA 2CCIA 4XG9A 4GCJA 2FGIA 1UKIA 3WIKA 4AN9A 4O91A 3UIMA 2WXVA 1P2AA 5M07A 3H10A 3PSCA 1KE7A 4FBXA 4O7LA 1T46A 3QC4A 4I6QA 4LGGA 1RW8A 2JAMA 3OTVA 1YQJA 3I60A 4N0SA 4O7RA 3R9DA 2QU6A 3BV3A 3GCUA 5F4NA 4DG3E 5IMEA 1OKZA 4TZRA 1BI7A 2I40A 3ORZA 5D41A 2PMOX 1PXMA 4HJOA 2CGUA 3LFSA 3H4JA 4HZRA 3O51A 4QMQA 4UMQA 2CMWA 3BYOA 2YAAA 3HLLA 5FGKA 3UNKA 5E8UA 5CI6A 2C1BA 3R73A 4BGGA 4OT5A 1M2PA 4F99A 3SD0A 2X8EA 4W8DA 5DR2A 5LCJA 3DJ7A 2VD5A 3V3VA 3FMLA 1JKTA 4LRJA 2R4BA 2BR1A 3MPAA 1Q3DA 4BCJA 2X6EA 3ELJA 3QF9A 3H0YA 4DF3A 1XR1A 3KEXA 3LFQA 3A60A 4N6YA 5TKDA 3TT0A 3LKMA 2ZB1A 3E87A 4FIFA 1J7LA 3TJDA 1I44A 3R04A 1AD5A 5IQIA 3BGZA 1FMKA 2QI8A 4KKGA 3CCNA 2QCSA 3FZSA 5HNGA 3OUNB 3QZGA 2XNPA 2VGOA 2YABA 1VEBA 4CT2A 4BDEA 2OH4A 4QMOA 4IWDA 3OXIA 3UMWA 4GU9A 4F64A 3DTCA 3HX4A 2PMNX 4EBVA 2RIOA 4ITJA 4MF1A 4XP3A 3VBVA 5TE0A 4ACMA 3AC8A 2H9VA 1OIYA 2JFLA 4DH8A 4NW5A 4PP7A 5IQFA 4C2WA 3EL8A 3NUPA 4F65A 4JR3A 1LP4A 3KMMA 3UYSA 3EQRA 1AQ1A 3POOA 3VS1A 3ALNA 3IS5A 5LWMA 1KUTA 1JSVA 1VJYA 3ALOA 5HIEA 2O0UA 4F9BA 2Y6OA 4JAJA 4D2PA 4AA5A 3OY3A 3QFVA 3UZPA 2CLQA 3TTJA 4L6QA 4YTHA 3GGFA 5K5NA 5FP5A 1SNUA 1ZY5A 2W4OA 2CNQA 2PU8A 3DAEA 4RZWA 4XNEA 2G1TA 3UZRA 4G34A 1Q99A 1JBPE 3ENHA 3KF4A 1JPAA 2YWVA 4FNYA 3QLGA 4ZS4A 5BYYA 4AACA 3EN4A 3IDCA 2VTIA 3K5VA 4JXFA 2HYYA 5GZAA 4K9YA 4KWPA 4CTCA 3R8UA 4OBPA 4LFIA 4BIDA 1BYGA 3WI6A 4MD8E 3EKNA 4FYNA 3SLSA 3COMA 2NO3A 3RAHA 3EN6A 3VBQA 4X2GA 3BU5A 4KD1A 4C4HA 3A7GA 4IVDA 4EH7A 1GY3A 2P3GX 3AT4A 3VUIA 4FOCA 3GB2A 1J7UA 4L45A 4YR8A 4MKCA 4XEYA 3C0IA 4IIRA 3ZRKA 5M4FA 2YLEA 3F7WA 5CEIA 1AGWA 4GUEA 2C6IA 3CPBA 4N4SA 2WMXA 5CI7A 2VTNA 3D83A 5DN3A 4FEQA 4FZAB 3UOLA 4ZJVA 2WFYA 4LI5A 4DEEA 3UVQA 2BMCA 1P14A 2VWIA 4DH5A 4EOLA 1VZOA 4FX3A 4L42A 4O0RA 4JAIA 2QD9A 2ITXA 2XYUA 5L4QA 3DDQA 3T3UA 1NVRA 2XK3A 2ZMDA 4K1BA 5IDNA 2NNWB 3QKKA 3SOCA 4BCHA 1OL1A 3WE8A 3IGOA 2FSTX 4QP3A 5AP5A 4CNHA 3FMDA 4PRJA 3D5VA 1WBPA 2WMTA 3N51A 4FMQA 3GBZA 2OJ9A 4TWOA 4PTEA 4B9DA 3NAYA 1H01A 4BTJA 1UKHA 3R1SA 3KCFA 1W84A 5ETIA 3ZCLA 2J0MB 3ZOSA 3I5ZA 1GIIA 3JPVA 3Q4CA 3BHUA 1XQZA 2YEXA 5HORA 5E92A 4I3ZA 4YBJA 3AMBA 4KRDA 4OTFA 4PNKA 5CLPA 4QP8A 4RQVA 5J8IA 5AX3A 1FVRA 4IFGA 2PUPA 4G9CA 3HL7A 4M69A 3SRVB 3COKA 4K8AA 3M11A 4BKYA 5E1EA 3AC4A 1JAMA 4JDKA 3CGFA 4GSBA 3N9XA 2O64A 3QL8A 1JKSA 4FKQA 4YP8A 3R22A 3ZRMA 4DEIA 2WD1A 4EQMA 4L9IA 3HA6A 4OR5A 2EVAA 5CALA 2I0YA 5DA3A 2WQBA 4CG9A 3L8SA 4FSZA 3ZSIA 2PMIA 4XV3A 3EZVA 2WMBA 5HQ0A 1U54B 3D5UA 1M52A 4Z7HA 1J7IA 2IVUA 3FXXA 3FMEA 3O96A 4FZDB 1MUOA 3V51A 1M14A 3FEGA 4C61A 5J87A 4BDJA 3NMUF 5KX8A 2PPQA 2WQNA 2VAGA 4RJ3A 4J99A 4Y95A 4ZLZA 3HMOA 4V0GB 3NSZA 4RFYA 4LOPA 2JC6A 2YHVA 4GT4A 4IVBA 2VTJA 4QMNA 5LARA 4WUAA 2B9IA 2QOBA 3LJ0A 3MVLA 4R3CA 5EH0A 3KXGA 5CSHA 4F7SA 5IZFA 4FVPA 3M42A 5ANOA 3QTZA 2AUHA 2YM5A 2R3PA 1B39A 4QMUA 1YOMA 3I7BA 4FV3A 5HVJA 2WQOA 2X81A 3DJ5A 3R7VA 2XK4A 4U97A 4O7TA 5CAQA 2PULA 1BUHA 2BDWA 3PXQA 4RIXA 3QHRA 2YM7A 3BQCA 3OBJA 4QD6A 4DH3A 2CPKE 1H24A 3DLSA 4J71A 3FMHA 4I0RA 4Z7GA 4YHTA 1JKKA 3VBTA 1LUFA 3ZFMA 3GU6A 4C62A 4N70A 4DITA 5J9LA 3TI1A 4ZP5A 3MIAA 4Y5QA 2V5QA 3NEWA 1XBCA 2C6EA 3DV3A 2ONLA 2ZAZA 3NGAA 3NIZA 4LOQA 4UMPA 5DH3A 3RAIA 5E8ZA 1V1KA 3BGQA 2WGJA 3PYYA 3BBTB 5LVLA 2W5AA 2PK9A 3FPMA 4PUZA 5CU6A 3WF7A 4MNEB 1OKWA 3T3VA 3PXRA 4WNOA 3RGFA 2QODA 4UMRA 3KXMA 4CFNA 2Y8OA 3BHYA 5CZHA 3C0GA 4QRCA 3UC4A 1OUKA 4UB7A 1GAGA 2R7IA 3O2MA 5C9CA 3LQ8A 3NRMA 3LJ1A 2XNGA 3UMXA 3ZUUA 2IO6A 2CKPA 4RX8A 4R78A 4ZTNA 4TYJA 5M51A 5JFWA 4MF0A 4O0VA 2BVAA 2ITQA 3CKWA 3QWKA 4GT5A 1LEWA 4KAOA 3F5XA 4QYHA 5JFVA 2XEZA 1SZMA 3R63A 4CFVA 1A48A 4DBXA 3I6WA 3PXKA 3DS6A 3LFEA 1OL7A 3EN7A 2VTHA 4EYJA 1FINA 3C4EA 4K11A 3MESA 1QPDA 1I09A 3BGPA 3EQDA 4QYYA 2QHNA 2B7AA 4RX5A 3I1AA 1OPJA 4WRSA 5HHWA 4DC2A 4O1PA 3JY9A 5FP6A 2ITWA 5LMAA 4CKJA 3PJ8A 3UDBA 4ZTRA 4QQTA 4EWQA 3KN6A 3MVMA 4XG6A 1DAYA 1JVPP 3A4OX 3MY5A 2GQSA 4U81A 3AQVA 3OEFX 1ERKA 2I0HA 2VO3A 4FVQA 3RPSA 4J1RA 1KE8A 5KCVA 4E1ZA 2VNWA 4JBPA 4BTFA 4F6UA 1OPLA 1CKIA 2FYSA 3DBCA 3OOMA 4MBIA 3R00A 3UIXA 2OICA 1OL6A 4I21A 5HICA 4C2VA 3U55A 1ZOEA 3OCGA 4BIEA 2HY0A 4C58A 2OI4X 4R5YA 5BNJA 4G9RA 1WBVA 3WZJA 4CCUA 4O7YA 3GXLA 3QCQA 2J9MA 5EQEA 2FSLX 5AP4A 3W2QA 3C5UA 2PZ5A 4B8MA 4C38A 4CFMA 4CRSA 5L3AA 3ROYA 4EC9A 2WMSA 4BKJA 4LM5A 5CU0A 3F3WA 3PXZA 5AWMA 2QG5A 3WBLA 3HP2A 2GS6A 3PZHA 4UY9A 5CXHA 5B0XA 2VN9A 3C1XA 2GQRA 2XRWA 4YZBA 4LRKA 4QTCA 5EM8A 3KY2A 2XZSA 5L8LA 3DT1A 1G8AA 4J7BA 1U59A 3VS7A 3HVCA 1DM2A 2RFSA 4BBMA 4Q5HA 4O2ZA 3ZLWA 4M8TA 3NYXA 2WB8A 5EYKA 2VWYA 3PP1A 4KS7A 4RWKA 4TYIA 4JI9A 2UW9A 4NT4A 3SRVA 1YDRE 4I93A 1R39A 5EK7A 4R1YA 5KHWA 5AAGA 4PQNA 1YI3A 3ZEPA 3SXFA 2ITPA 4GIHA 3JYAA 3OROA 4WKQA 3KRJA 4FSTA 5AP6A 2VWXA 1PMNA 4TTHB 5EYCA 3VRZA 4BDGA 1XH9A 3MY1A 3PIXA 3R01A 5GJDA 3VNTA 3F9NA 4BI2A 5L8JA 4C3FA 3PSBA 2X9EA 3UE4A 3DOGA 5M08A 4HVIA 3VJNA 4FSMA 2JDTA 4YJRA 3MB7A 4JDIA 3KK8A 1OITA 3REPA 5EDQA 5BQ0A 2FA2A 2VTQA 3BZ3A 4IB3A 4BCPA 5ETFA 2YM8A 2OJJA 4ONAA 3MJ2A 3NS9A 3E7VA 4V0GA 4YPDA 4G5PA 2C6DA 4XS2A 3W8QA 5CAUA 4G3FA 3E8NA 1XJDA 4YJTA 4M0ZA 1QCFA 3RINA 2OZAB 5IUIA 3JR1A 4RT7A 1OMWA 3O8TA 3CQWA 3TIZA 5I5ZA 3EMGA 1OIQA 2WEVA 2WQMA 4FTRA 4AA0A 4BI1A 5K9IA 4ANQA 4APCA 2R5TA 2JBPA 5FBNC 3VBXA 3R30A 4FUYA 1XH6A 5F94A 5IUHA 3CS9A 4WUNA 5AR8A 3QC9A 4HNIA 3G15A 2VU3A 2RFDA 4HVSA 4QP2A 3P1AA 3UNJA 3II5A 5M06A 3AT3A 3PA5A 4G16A 4J95A 4YHFA 5M55A 5CNNA 5JGAA 3L8XA 4MXYA 3VJOA 3HRCA 4MX9A 4DCEA 3IPHA 5T3QA 2W5BA 3VS0A 5E8YA 4AOJA 2PUUA 2GS2A 4QNAA 4YMJA 3PLAE 2XNEA 4DEGA 3OUKA 1L3RE 3JUHA 4I41A 3VULA 4RBLA 1RJBA 2PVKA 5HEZA 2IW8A 2JDSA 3CGOA 2F7XE 4KBAA 3E8CA 1Q97A 4BZOA 5IQBA 2UV2A 2VTRA 3MH1A 4MXAA 2UVYA 4DGMA 5JQ8A 2UZNA 5JZNA 4CXAA 5FXSA 4RRVA 4A9YA 2CSNA 3KGAA 4JOAA 4ZK5A 4ANOA 4D4YA 3T9TA 1Q41A 4IAAA 3RPVA 4C4GA 4FV7A 2OFUA 3IDPA 3FC1X 4USDA 3RM6A 5A46A 2W1DA 3BPRA 3NUXA 4OTIA 5DVRA 4E4MA 2JKKA 5C4LA 1GZNA 1O6YA 3HZTA 2QOLA 3PTGA 2ITYA 3FI8A 4IANA 4KIKB 3P0MA 3PPKA 4NYEA 2XJ2A 4AZWA 3R8VA 1H28A 3DAJA 5M53A 4C4IA 4E5BA 1BX6A 4RVMA 2R3NA 4U41A 2X1NA 5HE3A 1ZYCA 5L8KA 4C8BA 3NNXA 5EM6A 3RM7A 1UVRA 4RVLA 1E1VA 4DFLA 5BUIA 2XH5A 1GJOA 2GFCA 2FO0A 4I1ZA 3NCZA 3TXOA 4KB8A 3DXPA 1MRUA 3ACJA 3C9WA 3ZXTA 5HU9A 4RLKA 4MHAA 5F95A 3H9FA 2B0QA 3GFWA 4H1MA 4BDIA 5JRQA 3FLSA 2F9GA 3KK9A 3L8VA 4F0FA 5M4UA 3BYVA 1ZZ2A 4S33A 4FF8A 3Q4UA 4L68A 2O8YA 3O23A 5KMJA 3UO5A 1E1XA 3OBGA 4WIHA 5D1JA 4AGCA 4HCTA 3ZM4A 1ZWSA 3HV4A 3KRRA 4HPUE 5C4KA 5CENA 3AOXA 2Z60A 4X3FA 5LXMA 4M67A 4CLJA 2BAJA 5HG5A 4RIOA 2YDKA 1YXVA 3I0QA 2OK1A 3I0OA 2YIXA 1H0WA 4BBFA 4YJVA 2YLFA 3PSDA 1F5QA 4FZ6A 1OECA 4QMSA 3VUGA 1YXXA 1IEPA 4PPAA 4ENXA 1YVJA 4OBOA 4AT3A 3QQJA 4DTKA 4FKGA 3PP0A 4F1OA 2OF4A 5J9YA 5LMKA 4G6LA 2BFXA 2C6MA 3BEGA 4F08A 2YWPA 3SW7A 3P5KA 2F2CB 2WKMA 4D1XA 5AX9A 3W32A 2WMQA 2BIYA 4YJNA 2JDOA 5IA1A 3ZZEA 3Q96A 2B9JA 3QWJA 4HOKA 5H8GA 3VQUA 4L7SA 4NFNA 2W0JA 4X6RA 4XP0A 3VBYA 3ANQA 4YZCA 2I0EA 3WF9A 3CJFA 3ZONA 4UALA 4OW8A 1NT2A 3GC7A 3BE9A 2DYLA 5IA5A 4WBBB 1Q24A 3A7IA 3LE6A 1MRVA 5H2UA 3EFKA 4LMNA 4WNMA 3NW5A 1H1QA 4WG5A 4RG0A 2XIRA 5CT0A 2C30A 1OKYA 1U5RA 2OO8X 4BYJA 4L67A 3MPMA 4KA3A 2FSOX 3WIGA 4QYGA 3W8LA 3FHRA 2G9XA 5BVFA 4BDKA 1PYXA 5HCXA 4F4PA 4UX9A 3EKKA 2VTMA 2W1FA 1OB3A 4OTHA 2C4GA 2GNLA 3F3VA 3PVWA 5HTCA 3RK9A 3Q9WA 5G6VA 4EOJA 4YNEA 4QPSA 1TVOA 2PWLA 4I6FA 1Y6BA 4D2SA 4USFA 3VUDA 5BX0A 1M7QA 3ZDUA 5CF5A 3ULZA 2C3IB 3UTOA 4C57A 2C3KA 4XRJA 4CCBA 4R3RA 3LFDA 2YCSA 3H30A 4NM5A 4NZWB 5A3XA 1YXSA 4FKRA 5EDPA 4DHFA 3EH9A 2Z2WA 5C01A 2JIIA 4ZJIA 3S0OA 4LV5A 2WTJA 5B2MA 2EXCX 3MFRA 5GJFA 2UZVA 3HV3A 3JVRA 4BTMA 2XKCA 4BGQA 2ETMA 2WMAA 4ZY5A 3AGMA 3P86A 3C50A 3IW5A 3DKFA 3V5TA 3VRYA 5FG8A 4PV0A 3C51A 3O7LB 5HGIA 3TKHA 3QX4A 5DBXA 2ZOQA 5ANGA 3K2LA 5DR9A 4PDSA 2UZOA 5ANJA 1KWPA 5ACKA 3VQHA 2WTWA 4JBOA 4CFFA 4DLIA 5AADA 4Y73A 3HV7A 4FKTA 3EQGA 4AW0A 5C1QB 1TKIA 2FVDA 4M13A 4XV1A 3Q4ZA 4H3PA 4YZ9A 2X4FA 3CE3A 2IW6A 3CTHA 4F0IA 4C4JA 3H0ZA 3PJ2A 4GW8A 3BKBA 3HA8A 4HYIA 5GZ8A 4EQUA 2ITTA 2QNJA 4OBQA 3QD3A 4ZTQA 3N4VA 3ORMA 4XLIA 1ZOGA 4OAVB 4ZXTA 2JD5A 1OIUA 2CDZA 4TYHB 3D7TB 5EM7A 3WYYA 4AF3A 4U80A 4BDHA 4IB0A 4UYNA 4EBWA 1ZYJA 3COHA 4RC3A 3CD3A 2QQ7A 3UOJA 2ZVAA 4W8EA 4EHEA 2XRUA 3NNVA 1YDSE 4IQ6A 5BMMA 3GC9A 3JY0A 2J7TA 3KFAA 3QQKA 5CEKA 3MJ1A 3QQLA 3NVKI 4B7TA 2R3QA 4PY1A 1ZAOA 4AT5A 3D2IA 4KIKA 1KOBA 5HLWA 3O8UA 2LGCA 2HZIA 2WTDA 3ZHPC 5BYZA 4EK6A 3SG8A 3MFUA 2PZIA 2G2HA 4UWCA 4I4FA 5E1SA 4QMXA 4WOVA 4BZDA 3KULB 4FV4A 4XUFA 3FE3A 1FGIA 4M15A 4BDAA 1XBBA 5AFVA 2XEYA 3F5PA 5K5XA 4G3DA 4HW7A 5A54A 4DA5A 4N57A 5EW9A 3V8TA 3R9NA 3PWDA 1KE9A 3EJ1A 3MFSA 4CMUA 3O17A 3QTWA 4L8MA 2C5OA 3AD6A 4BZNA 2UW3A 3SW4A 2GTNA 5CVFA 3BQRA 2VO0A 2OJGA 1FQ1B 3NZ0A 1Z57A 2YIWA 3EYGA 3SC1A 5A4EA 2UZBA 3U9NA 3PJCA 2GNHA 4M7IA 4ZAUA 1ZYDA 5HE1A 5A4LA 3R1NA 4D28A 4CG8A 1V0PA 3TZ8A 1NXKA 3D5WA 4L53A 4BVUA 3O50A 3FYJX 3E5AA 2X2LA 4FT9A 2BRNA 2C69A 2ITUA 3QZFA 4F7NA 2GNGA 3WARA 4LRMA 3KXHA 5EYMA 4TYGA 4AN2A 3BU6A 3BU3A 3HGKA 3TNQB 3V01A 3QUDA 1OBGA 2C3LA 1O6LA 3AT2A 2HY81 4DEBA 3GOKA 2OIDA 3MN3A 1YOLA 3AMYA 4JRVA 4ORKA 3C13A 3HP5A 4CMTA 1LEZA 2CN5A 2ITOA 5L6OA 2UW0A 4EH5A 5ETCA 4AQCA 2J0IA 1OUYA 2VGPA 4U42A 4EUTA 4UV0A 5HESA 4IZYA 4EK8A 2JDVA 5HBJA 2C6OA 5DEWA 2QLUA 3OD6X 4MK0A 3P79A 3E88A 3M2WA 2CNUA 5HO8A 4CMOA 2J50A 4GT3A 4O0TA 5A4CA 2QOHA 2PL0A 4TPTA 4NIFA 5CSPA 4F09A 4WBOA 5CF4A 4V04A 2J2IB 3UYTA 5KBQA 2X7GA 2X2KA 4EK5A 3FL5A 1S9IA 3LJ2A 4NTTA 5J5TA 2V62A 2CKEA 3HV6A 4YO6A 3DZOA 4PNIA 2HIWA 4YC3A 5AUYA 3BWFA 3KMUA 3RK5A 5IEYA 3UJGA 2NRUA 3P7CA 4CKRA 2XNMA 3CPCA 3OF0A 2CCHA 3G0EA 3PY3A 4S34A 3RPRA 2Q0BA 4FV6A 3NIEA 5CVGA 4C36A 4ACDA 1BL7A 2QOKA 2VV9A 5FXRA 5CSWA 3F2AA 3R8ZA 4MVFA 3L9PA 2VRXA 5DT4A 5JFXA 4FGRA 4KUJA 4O7NA 2UVXA 2OBJA 2EU9A 3ORLA 4FSYA 3IOKA 3UNZA 4QPAA 5LWNA 2F4JA 3OXTA 2XBJA 3R7OA 4JIKA 5HKMA 4CZTA 5IH4A 2WPAA 1K9AA 5KMNA 4FEVA 4NCTC 2OKRA 3BBWA 3EL7A 2BZKB 4DGNA 5FM3A 3THBA 2W1HA 2REIA 3RPOA 3IG7A 5AR5A 5L2IA 1VYWA 2R3LA 3LCDA 3NNUA 5EHYA 4X0MA 4H36A 2V7OA 3D5XA 1PJKA 4JDJA 3W33A 4QMTA 2JIVA 3EOCA 3KU2A 5FD2A 4X2KA 5CEQA 2PZYA 3L9LA 4QTDA 3UQCA 4FNXA 3DDPA 2A19B 1P4FA 3IW6A 4HPTE 3UG1A 3BRBA 2R2PA 3AC1A 2UW8A 3MGYA 4FSUA 1ZOHA 5CS6A 3ZBFA 5JT2A 4L44A 1PRYA 4UN0C 4QMMA 4E93A 3GENA 3VS6A 1XH8A 4FKWA 4QQCA 3LM0A 2UZEA 3P7BA 4A07A 2PZPA 3PDTA 2ZM4A 3AC3A 5DRBA 4M97A 3F6XA 4A4LA 2PTKA 1GZOA 2WIHA 4R7IA 3LHJA 1H0VA 4DGLC 4U6RA 3DJ6A 2W05A 4AFEA 3HMIA 4PDOA 3KRWA 4KABA 5E8XA 5T6KA 5M4IA 2R0IA 3DA6A 1YWRA 3A99A 3OWKA 4NWMA 5EKOA 4QT1A 4ANMA 2PHKA 3G9NA 3PFQA 4ZSLA 4BKZA 3S00A 2CKOA 3ORNA 4IAIA 5FDXA 3S1HA 3IECA 4AE9A 3GQLA 3D7TA 4EEVA 1W8CA
chains in the Genus database with same CATH superfamily
5JGBA 4XG2A 4B0GA 2OXYA 4AT4A 1H08A 4YU2A 1Y57A 2HK5A 4WA9A 3ZZWA 4IC8A 2H34A 3QXPA 1IAHA 3SXSA 2XK7A 4ZJJA 5TOZA 3OEZA 2PVMA 3ORIA 3A7HA 4G6NA 2H96A 2QO9A 5AV3A 3OW4A 2FH9A 1DI9A 4TWPA 2W1EA 3LFCA 1GNGA 5CF6A 3CTJA 1CKPA 2ZFYA 2C47A 5E7RA 2CGXA 3GCVA 4P4CA 4II5A 2R3OA 1BLXA 3HEGA 1XH4A 3TCPA 1DAWA 2XKFA 2XP2A 4AXAA 3OFMA 3F88A 4W4WA 2NYAA 1W98A 4G3GA 3IO7A 4M68A 3FPQA 4K33A 2XCHA 2G01A 3PG3A 5IA4A 5E8TA 4GS6A 2WAJA 1CDKA 4D0XA 2P2IA 3EWHA 3HRFA 2F57A 4DDIA 4EZ7A 3QD4A 3F2RA 2KULA 3EQFA 2CNVA 4JQEA 1FOTA 1FVVA 3OXZA 5J95A 1R0PA 4BCFA 1FBNA 4XYFA 3ZFYA 3RCDA 5I0BA 1ZZLA 3PJ3A 4FTOA 4MWIA 3DXQA 4C59A 4IAKA 1U46A 1HCKA 5GZ9A 4X2NA 3IW4A 5E8SA 3RP9A 3V5LA 1Q3WA 3Q32A 4R8QA 1UV5A 4R7HA 4WO5A 5CANA 4CFWA 2R3GA 5J7BA 2BCJA 4FKPA 3I81A 3N4UA 2P2HA 3LZBA 3CP9A 4FL2A 4K2RA 3TV6A 2R3HA 5KUPA 2NRYA 2OJIA 3HDMA 5BUJA 3VAPA 3SG9A 2YJSA 4L3JA 3HV5A 4MAOA 5DNRA 5IA2A 3COIA 4B6LA 1WVWA 4IACA 3QRKA 3LLTA 3OWJA 4RC4A 4ERKA 3C0HA 3WYXA 3K5UA 4JS8A 5K3YA 2JKOA 3QQGA 4P5ZA 5JH6A 4F1TA 3PRFA 3Q4TA 4FTMA 4EZ3A 1UNLA 3GVUA 4XLVA 4EH9A 5HOAA 2O63A 3F5GA 3MWUA 3PY0A 4QEBA 4W4XA 4WT6A 4ZTMA 4GYIA 3E8DA 3PXFA 5JKGA 4DCAA 5M44A 2C5VA 5JMSA 4PPBA 3TWJA 2UVZA 3HRBA 1YXTA 3F66A 3Q04A 3LXLA 1P4OA 2OWBA 5HD7A 5K0KA 3VS3A 3W18A 2WNTA 2X2MA 3VS5A 2UW6A 5L2WA 3HUCA 5J1VA 4B99A 3RNYA 3R2BA 4ID7A 4FVRA 4ZEGA 4EOIA 3GQIA 2Q83A 2Y4PA 5AP3A 2X7FA 4BR3A 5I9WA 2UZWE 2R3MA 3ZUVA 2XK8A 1ZLTA 3LFNA 3BIZA 2R3RA 3EQIA 4XBUA 3ORKA 3C4ZA 4DAWA 4OAUC 4DGGA 4NTSA 4JQ7A 3C5IA 5LCKA 4EOPA 4YTCA 3DBFA 4JL9A 4CZUA 4EI4A 2UW4A 1IG1A 3KL8A 3Q9ZA 3FJQE 2X7OA 5AUVA 2XK9A 3GC8A 4BIBA 3OCBA 4HGTA 2E2BA 3ZH8A 3V5PA 4DFZE 5EI2A 2XNBA 3FHIA 4BCMA 3LXNA 2J5FA 4PTGA 5EDRA 2GSFA 4CT1A 4YSJA 3K54A 4IAZA 2X0PA 4HYSA 4IX6A 2Y7JA 3QRTA 4HCUA 1M2QA 1W82A 1YRPA 4ACHA 3ZBXA 3EIDA 2YN8A 3KVXA 5HG8A 4QP6A 2V22A 4Q9SA 3TUBA 3GT8A 3Q6UA 4GEOA 3TNHA 3ZO3A 5F1ZA 3QZIA 3NNWA 4D1ZA 3PLSA 2HZ4A 4MUQA 2OW3A 2ITVA 4AGUA 4W9XA 2GFSA 4EH8A 4FZ7A 5KNJA 2OXDA 3CR0A 3EQPA 4GH2A 4EH6A 4YJUA 3OP5A 3QTQA 5EW8A 3W2PA 3KC3A 4EJNA 4CQEA 5LVMA 3BHHA 2WOTA 5DWRA 1Q4LA 4G5JA 4I23A 5JQ5A 3F2NA 2E9UA 3LFBA 1ZMUA 5FTQA 2C5XA 5AEPA 4G3CA 4Q5EA 3CQEA 3HDNA 5E8VA 4A9SA 4AG8A 3BWJA 4FZFB 3PRIA 3FC2A 4RLLA 5I9XA 3DLZA 1J1CA 3LIJA 4O6LA 4WG4A 4F7JA 3PFYA 2GHLA 2H8HA 3VHEA 3CY3A 3AGLA 3KN5A 2PYWA 4O84A 2JEDA 2YZAA 5FUTA 3OT8A 3Q9YA 5I4NA 4U79A 3TN8A 4D4RA 1W83A 4TNDA 4IC7A 3OT3A 4O86A 3QZHA 4F78A 3DCVA 4LV8A 3ITZA 4OUCA 1F0QA 3ETAA 4Y8DA 4R3PA 3C4CA 3F69A 2WU6A 4BICA 3MY0A 4R5SA 4G2FA 3CSVA 2O3PA 2GNFA 5HU3A 4NJ3A 4I6LA 4JG8A 5JK3A 1REKA 2UZDA 3FY2A 3HNGA 5HCYA 5FM2A 5EI8A 3U4UA 1OBDA 4U0IA 3GU7A 2EXMA 1YW2A 4PMSA 5H9BA 5D12A 1Q5KA 4TT7A 4AU8A 5CEMA 3R0TA 2ZDTA 3L1SA 2LAVA 4BTKA 3EN5A 2I7QA 3Q3BA 1IA9A 3OS3A 3LMHA 2DQ7X 1U54A 1H26A 2GQGA 4AZTA 3R9OA 5GINE 2E9PA 2R9SA 3ZLYA 4A4OA 4RJ7A 5CX9A 2Z7QA 2BUJA 2BZIB 3BYUA 3D4QA 3F3TA 4GG5A 3UIBA 4GFGA 2RFEA 2H6DA 4FEXA 5HTBA 4XRLA 2ETRA 2P33A 4GYGA 1T45A 3RMFA 2QURA 4DEHA 2JBOA 3G6GA 3GOPA 4UZDA 5AUUA 2BRHA 3MFTA 5L2QA 4ENYA 2RFNA 3HMNA 3TZMA 3W16A 4U3ZA 1R1WA 3OCTA 2QU5A 4GRBA 4CLIA 5AR7A 4QYFA 3RZFA 2A0CX 2J0KA 5GHVA 4I5MA 3VF9A 4AFJA 4D5KA 4DG0E 5AR4A 4ZMEA 3HECA 3QQHA 2EUFB 5M56A 4ZSEA 2YITA 3MTFA 3QAME 3FLZA 4X2FA 4QP9A 3OMVA 4LDTA 4MBJA 2C1AA 4QP1A 2YM4A 5I9ZA 5AUWA 1H25A 3U9CA 1TQIA 3LVPA 4O96A 4CKIA 4TWCA 2R7BA 2HZNA 2W1CA 4YGAA 4YPSA 3IW8A 4Q9ZA 1JLUE 3RWQA 4ZY4A 2UZUE 2J4ZA 2VX3A 3WZKA 3GFEA 3QCYA 2JIUA 4XH6A 3TV4A 4JRNA 3R7IA 4ZTHA 1IR3A 3QA0A 2PMLX 1BMKA 3VUHA 5AP2A 2XIKA 4KIPA 1WAKA 3EN9A 4FKVA 1H1SA 4AS0A 3UOHA 4FTIA 2XALA 4J97A 2O2UA 5LQFA 5KE0A 5HG9A 4ASDA 3DK7A 3O7LD 3UP2A 3HMPA 4IM3A 3DPKA 4MNEA 4RA5A 5ANIA 3CQUA 4BF2A 1OVEA 3PXYA 4FK6A 2XNNA 3SDJA 3KREA 1WBSA 4UBAA 2HWOA 4XCUA 4LL5A 3RHXA 3IW7A 1MQBA 4D9TA 1KOAA 2HAKA 1YWVA 3WF5A 3DY7A 3AXWA 4O22A 2OLCA 4EHVA 4FT0A 4C37A 1IASA 5E9EA 5KMLA 3VVHA 4A9UA 4EOSA 4QO9A 5AIRA 4D1SA 3FZPA 3E3PA 1W2CA 4LUEA 4UWYA 4CV8A 4LOOA 4AAYA 3D94A 3P78A 4AAAA 5K0XA 5ANKA 4PDYA 5HX8A 1L8TA 3QUEA 4OTQA 1Y8GA 1XHAA 2YM3A 4ZTLA 3ZRLA 2XVDA 3A7JA 3W10A 2QR8A 4FE2A 3ZO1A 2R3KA 3NLBA 2R3JA 5EFQA 5FQDC 4FUXA 3VS4A 3W0RA 2HXLA 4QQJA 4DLJA 1PXPA 2PE2A 4G17A 3MB6A 3OZ6A 3V04A 3OOGA 4BHNA 2VX0A 4GU6A 4C4FA 4ANSA 3ERKA 5LVPA 4PX6A 2Y6MA 3C4FA 3JVSA 5LJJA 4FTTA 2DWBA 2YM6A 1UNHA 2BHEA 5T68A 4ANNA 3FXWA 3R2YA 4LUDA 5IEXA 4LGDA 4I5PA 3RCJA 3UZTA 4FICA 2W4JA 2CN8A 4O27B 1RDQE 2ZB0A 3FI3A 4P7EA 1NVQA 4DFNA 5IU2A 1Q8ZA 3LM5A 5BYLA 1G5SA 2Z8CA 4LG4A 1H27A 4NU1A 3E62A 1MP8A 1X8BA 4IDVA 4C33A 3DFCB 3NW7A 4F6WA 1HCLA 5HIDA 3NPCA 3LCKA 3U87A 1ZMVA 4JX3A 2R64A 4WHZA 4NKSA 4FIIA 3P9JA 5L6WL 4UWBA 4QDVA 3UO4A 1KV1A 2B55A 4JMQA 3FAAA 3EQHA 2GDOA 1SYKA 5KZ0A 5E4HA 4BFMA 4L43A 4IX5A 2SRCA 3DNDA 3ANRA 5C03A 5A4QA 4JG7A 2X8IA 4XV2A 3QALE 4AN3A 2IVVA 2VWBA 5KZIA 1A9UA 4GUBA 5HE0A 4AZSA 2ZJWA 4CFXA 4ZOGA 3TM0A 1U5QA 5DI1A 4LGHA 3FLQA 3VBWA 3DK3A 4IXPA 1ZYLA 3PE2A 1VR2A 4O0UA 2YDIA 4BCQA 3HKOA 2YJRA 4EJ7A 2ACXA 1OGUA 4NJDA 3PVGA 3UP7A 3W2RA 4P5QA 3ATTA 1M2RA 3QQUA 2W1GA 5JRSA 4USEA 5D11A 4U40A 3ZXZA 3PWYA 4KBKA 4BDBA 3TYKA 1YOJA 3GU8A 3NDMA 4OTRA 5D7VA 5HLNA 4W4VA 2QR7A 2WTIA 3TNIA 1PMUA 2VTTA 3CY2A 5B7VA 2QOIA 4L00A 1UA2A 2C5YA 3ENMA 5C27A 3ZM9A 2WMUA 1M17A 3DBQA 5CU3A 1H00A 4ASXA 1RQQA 1WCCA 4ZSJA 4AUAA 3LAUA 5H8EA 3DQWA 5CAVA 3DB8A 2VZ6A 2PUNA 4QMLA 4TNBA 4J8NA 2YACA 3W2CA 4AOIA 3FWQA 2PZRA 4TRLA 3UVPA 4AX8A 4I5CA 4ZMFA 4GFMA 3FQSA 3W2OA 4GK2A 3ROCA 3L9MA 2OZAA 4GJ3A 5AV1A 4DFXE 1O9UA 1JSUA 3QCSA 3FLYA 3DKCA 5AP0A 5HCZA 4BWXA 4O4BB 4FT3A 4HZSA 5HO6A 2XAOA 4FGBA 3BELA 4ZY6A 3OC1A 4IMYA 3SGCA 3BYSA 3CBLA 5AV0A 3WZEA 4Z55A 4JX7A 4J96A 5CVHA 5KKRB 2W1ZA 1YI6A 5AV2A 5C8KA 4O0WA 3BCEA 3F61A 4HCVA 2RF9A 3R71A 2VO6A 2QHMA 4MXCA 1W2FA 4QQ5A 3DKGA 3W2SA 1FMOE 2J0JA 4UXQA 4CYIA 1K2PA 3LFFA 4FV1A 2V0DA 3FMKA 1JKLA 4FNWA 4EKLA 1UU7A 3RVGA 3ZUTA 2XKDA 4ZS0A 1S9JA 2VWZA 2HWPA 3FDNA 4TKSA 3TIYA 4IADA 4Y72A 3DTWA 2IPXA 2JKMA 2UZTA 2YIRA 2XCKA 3RKBA 4IM0A 2JKQA 5K4JA 4UMTA 1LPUA 4GVAA 3KRLA 3O71A 4ACGA 2XM9A 2HENA 2B1PA 1E9HA 4FKUA 4AWIA 5IQCA 3MVJA 3DU8A 5DOSA 1TZDA 2C0IA 5AP1A 2J51A 4KSPA 4DFYA 3TUDA 4O83A 3PA4A 5EOLA 4CV9A 4QP4A 3SAYA 4U5JA 3GCSA 3LW0A 4C34A 2C0OA 2GHMA 2WTCA 3OVVA 4K77A 4DINA 4NW6A 2YCQA 3P08A 4DDGA 4Y83A 4DE4A 3FQHA 2WMVA 3UGCA 3GUBA 3V8WA 4RC2A 1K3AA 3ML1A 4NM7A 1UU3A 4PL3A 4RSSA 5IQAA 5CSXA 4YLLA 2C68A 2Z7RA 4U44A 4C3PA 3RI1A 5E8WA 4EK3A 3RAWA 4AQKA 1H4LA 3TACA 3LMGA 5KMIA 2EB3A 3HYHA 3TV7A 1WMKA 4O4DA 2HELA 4UMUA 2IZRA 3LQ5A 3Q9XA 4HGEA 4R77A 4E7WA 4NEUA 2XARA 1BKXA 3HAVA 4X3JA 3F7ZA 4M3QA 2XJ0A 5BVNA 2BPMA 4FT5A 4M14A 4RWLA 4Z16A 4JNWA 3QD2B 4WRGA 2J0LA 2P0CA 2WIPA 2XJ1A 3DB6A 1QMZA 4JLCA 5CTPA 2Z02A 4PF4A 3WF8A 4EONA 3U6JA 5DIAA 5FEDA 5I9VA 5KKRC 4HGLA 3R7UA 1UU8A 2KTYA 3F5UA 3FMMA 3ZS5A 4KS8A 5FTOA 2ONLC 4N6ZA 3Q53A 5AAFA 4TYEA 3WILA 5GJGA 5J9ZA 3UDSA 3D15A 3FV8A 5HZNA 1H07A 5AIKA 4NSTA 4ERWA 3BLHA 3UQFA 4NM3A 3KMWA 4KINA 2W96B 4IX3A 3RBWA 4CGAA 4D0WA 5ITAA 4AW5A 4C4EA 2QOQA 4QMZA 1ZRZA 4I0TA 4WNKA 4YZNA 2ZYBA 1H1WA 2NPQA 4I4EA 2PVRA 3IONA 4NFMA 5IQHA 4FTUA 5L2TA 5HNIX 3KXNA 3ORXA 4ZZNA 3BHTA 3IK3A 5KO1A 4H05A 2ZM1A 4JBVA 2W7XA 2JITA 2C0TA 2XMYA 4RX7A 5DGZA 4EQCA 1XMMA 2GS7A 3KCKA 3WOWA 3TG1A 4D4SA 2B4SB 4YZMA 2PE1A 3PVUA 4FIEA 4H1JA 4IHPA 2VUWA 2DUVA 4L7FA 1PHKA 3QYZA 4E73A 3OG7A 3CC6A 3GEQA 4KKEA 2WU7A 3GNIB 2BRGA 4LL0A 3QKLA 4AW1A 3O8PA 4EWHA 5HTIA 2ITNA 3E3BX 3Q60A 4TY1A 4BB4A 3NFGB 4RIXB 4MXXA 4B8LA 4O1OA 2W17A 4YNOA 2OIQA 3ID6C 4O7VA 1J1BA 3PZEA 4E26A 1OKVA 4BWKA 4I6BA 3R7GA 2WTVA 4FKSA 4IWOA 4UYAA 5AR3A 5BMSA 4AA4A 3EQBA 5BVDA 3GP0A 3D9VA 5HNBA 1SVEA 2IVSA 3MI9A 5AUTA 2WZJA 4E6CA 4BYIA 2B53A 2JGZA 2A4LA 3I7CA 3NYNA 2XIXA 3RNIA 1UNGA 3VW6A 3B8QA 1PXOA 3GC0A 4GL9A 4RJ4A 3WZDA 4EOMA 5DRDA 3SX9A 3ORTA 2IW9A 4UZHA 3NUNA 3Q52A 1Z9XA 5A6NA 4MNFA 4L52A 4F9YA 3RK7A 2G2IA 2BHHA 2BZHB 2VNYA 3E7OA 4FKLA 2ZV9A 3U4WA 4E6QA 4TL0A 3E64A 4F63A 3BI6A 4PL5A 3R8MA 3ZEWA 2CGVA 5AP7A 5LOHA 4DT9A 4F9WA 4QPMA 5LVNA 3FMJA 3UODA 4W4YA 4BBEA 3EQCA 3OHTA 2XAMA 5J7HA 4QTEA 2XKEA 5DG5A 4FTAA 4IVAA 4XX9A 2ZM3A 1ZMWA 4FODA 2O5KA 3A2CA 5IPJA 3G0FA 5HO7A 3LXPA 4YC6A 1H8FA 3BE2A 3R83A 5G1XA 2O65A 4DG2E 2IWIA 4FYOA 3ZLXA 3VS2A 5EKNA 4DT8A 5D7AA 1Q8WA 4DN5A 3MH3A 2XA4A 3D0EA 3R21A 1M7NA 3WZUA 5EQPA 3DBEA 2VWWA 4RVKA 2I0VA 4O0YA 4RQKA 5AMNA 4EHZA 1OI9A 4FOBA 2OIBA 3LCSA 3UOKA 2IVTA 3FL4A 4EORA 4ACCA 4YJSA 2ERZE 3ZLSA 4EZ5A 4XJ0A 3A4PA 4MYGA 4A4XA 1REJA 4YLKA 4TWNA 3VWAA 5LMBA 3W0QA 2WTKC 4C3RA 2BIKB 5ANDA 4D58A 4F6SA 2BILB 2VTOA 3BHVA 1ZY4A 2RGPA 3PVBA 5CXZA 3LLAA 2X39A 5A6OA 3ODZX 4RJ8A 4ZTSA 4U45A 4HGSA 4D55A 3PJ1A 3R6XA 4TYHA 5L2SA 2BZJA 3ZMMA 5DT3A 5IA3A 4FSQA 4FTJA 1YDTE 3KQ7A 3QKMA 5JSMA 3AC2A 3QA8A 5M4CA 3R9RA 1NY3A 2W06A 4K6ZA 3CXWA 5FLFA 4OGRA 4PMMA 2GTMA 4BC6A 3MW1A 2R3IA 2EWAA 2J5EA 4JVGA 3H9OA 5AUZA 5BVEA 4DFBA 4EH4A 3FLWA 3Q5IA 3SOAA 3AD4A 2VTPA 3OCSA 4BWPA 1J91A 4RX9A 4FSNA 2GHGA 3LXKA 2NP8A 3OWLA 1TQMA 4IM2A 3VO3A 4A06A 2WMWA 5IMXA 3AKJA 3QTXA 4RWIA 2B54A 3KVWA 4ALUA 2CLXA 3FZTA 5KMOA 2F2UA 1BI8A 3QXOA 1IAJA 2EB2A 4G31A 2PVYA 3KULA 4EOKA 5EG3A 4FTNA 5I9YA 4NM0A 2VO7A 5CY3A 4ZSGA 4FIHA 4AZVA 2HZ0A 1WBNA 3MH2A 5ETAA 2FUMA 1W2DA 3UVRA 4WSQA 3VN9A 1GOLA 2Z7SA 2YA9A 4O0SA 3QRJA 4EKKA 2RG6A 4CRLA 1OZ1A 3FZ1A 5E90A 3FI4A 2WTKB 3U51A 3P23A 4LV7A 5IISA 4EK4A 4O82A 4D2WA 4F7LA 2I6LA 3IOPA 4U8ZA 1H1RA 1IRKA 1F3MC 2A1AB 2BRBA 4YJPA 4E6DA 1Q8TA 5H3QA 3QQFA 4CEGA 2V55A 4FTLA 4RMZA 1R3CA 4X7QA 5FTGA 1WBWA 3W55A 4E6AA 4QMWA 5CQUA 3CKXA 3OTUA 5CU4A 4WSYA 4IZAA 4Q2AA 4ALVA 1FGKA 1XWSA 2IG7A 5FBOA 5BPYA 2WELA 3QYWA 1V0BA 2JDRA 4FG7A 1OL5A 3SQQA 2B9FA 5AM6A 4AZEA 4YURA 4M84A 1ND4A 2ESMA 4BCNA 4BCGA 4NK9A 3P4KA 4O7ZA 3T9IA 4E5WA 5CT7A 1KV2A 4GK3A 2BDFA 2RG5A 4JIAA 5D9HA 2X0GA 5HLPA 4YTIA 4RFMA 3V5QA 4DTAA 3MV5A 2YZLA 2YERA 4D2VA 4P2KA 2HCKA 4PTCA 4DGOA 2R3FA 4O21A 4EUUA 5IF1A 1CM8A 4KRCA 4XG3A 4IEBA 4BRXA 5IDPA 4IX4A 3TKIA 2QOOA 3W1FA 3TJCA 3MPTA 2W99B 3NYOA 3CJGA 4YHJA 4IB5A 1PYEA 3FQEA 3NUUA 3OWPA 1V0OA 2EXEA 4YJOA 5AJQA 3CD8A 3ZC6A 3IKAA 3ZFXA 1WBOA 1QPEA 4KSQA 3S3IA 5F9EA 2QOFA 3EB0A 4PPCA 2WMRA 5TT7A 1GIJA 1JWHA 4ZLOA 5JFSA 3G2FA 3NUYA 4A9RA 1KSWA 2QKRA 4RIYB 4E4LA 3AD5A 4FR4A 5IQEA 3NCGA 2YISA 3MS9A 4I20A 3KB7A 3BYMA 4PDPA 5KMKA 2BKKA 4S30A 1P5EA 5I3OA 4G6OA 3UPZA 4DFUA 3KIOC 5FRIA 2RSVA 4GKIA 3FY0A 3SVVA 2F49A 1PY5A 2OG8A 3UC3A 4KNBA 4RIWB 4M0YA 3TL8A 4IBMA 4X3FC 1OIRA 4MXOA 3ORPA 3K3IA 2UW7A 3TNWA 4DBNA 1Y91A 4JBQA 2W4KA 1PXJA 2OF2A 3FKLA 3FLNC 3RALA 4E3CA 3GU5A 4TW9A 5A9UA 3FMNA 3Q6WA 1NVSA 4I94A 3ZYAA 3HMMA 4O7WA 4IVCA 4XG7A 5AUXA 2HXQA 2OFVA 4P90A 3PA3A 3TUCA 3NR9A 3LCTA 1FPUA 5BVKA 1ATPE 2PUIA 1J3HA 2QC6A 4H39A 1PKGA 3FSKA 3V6SA 4QOXA 4EL9A 2IEWA 3JXWA 4J8MA 1SMHA 4O2PA 5LMKC 3MVHA 4G3EA 4BCOA 2E9VA 4GIIA 3SHEA 3NYVA 3R7EA 3RJCA 3G51A 4IH8A 5CAPA 5GIPE 3PY1A 3SV0A 5CSVA 2XIZA 2RKUA 3CTQA 4E20A 5J5SA 2GCDA 4WNPA 3U6HA 1QL6A 1Y6AA 4XG8A 2BFYA 3DNEA 2WO6A 4IB1A 4U3YA 3ZO2A 4ASZA 4FG9A 4LMUA 4Y5HA 4YC8A 3A61A 1PMVA 4F9AA 4QYEA 4FEWA 1MRYA 4B4LA 4BHZA 3MIYA 1EH4A 4I24A 3CLYA 1RE8A 4FV2A 4CYJA 4FG8A 4IAYA 2BTRA 1SM2A 5CEPA 1CMKE 2PSQA 4BGHA 5BUEA 4BCKA 3MBLA 3AG9A 4JR7A 3WF6A 4ZSAA 1HOWA 4K0YA 4YJQA 3ULIA 3QTRA 3UPXA 3B8RA 4GFOA 3IQ7A 3TNPC 5DEYA 1O6KA 4IJ9A 1WBTA 2VWUA 3O0GA 3R1YA 2ZV8A 4X3FB 4YLJA 1TQPA 2R0UA 4EOQA 3FZRA 2HW6A 4FT7A 4HYHA 4NCTA 4CSVA 5FDPA 1CKJA 3QGYA 2XK6A 4FV9A 4O38A 4X2JA 2UUEA 4RPVA 3ZDIA 3ACKA 2QO2A 2XS0A 2HOGA 2DS1A 3L9NA 2Q0NA 3FZOA 3S95A 2WHBA 3TZ9A 4OTGA 5IUGA 2V7AA 5J79A 2IN6A 3EFJA 2QVSE 3SXRA 4KIOA 4HVGA 1GIHA 2IZTA 2OGVA 3G9LX 4OT6A 3E92A 3TDWA 2QKWB 2W1IA 4UEUA 3MA3A 2VTLA 3MDYA 1B38A 4MTAA 4LQMA 1BL6A 5A14A 2IZSA 4E4XA 4HNFA 3GI3A 2ITZA 3NW6A 5GIOE 2C6LA 2UW5A 3QTSA 1FVTA 2IJMA 4S32A 4DTBA 3I79A 3G90X 3SKCA 3VHKA 4EYMA 2XBAA 3EFWA 1URCA 4R1VA 5HD4A 1NW1A 4V01A 4HVDA 2F7EE 4ZZOA 5IG1A 4AGWA 5H8BA 3VF8A 2QOCA 2X0QA 3QUPA 4D5HA 3UG2A 2OJFE 2XUUA 5HVKA 3KRXA 1DS5A 4FC0A 4Z3VA 2ETKA 4MEDA 4X21A 3RTPA 3QLFA 1H1PA 2AEGA 4R7BA 1Q8UA 2GPHA 4RFZA 4E8AA 2JFMA 4JT3A 3E93A 4J53A 4O4EA 2A2AA 3FBVA 4IWQA 4BN1A 1URWA 5FEEA 3KXXA 4C0TA 1U4DA 3A8XA 3MTLA 3S2PA 2PVJA 4ITHA 3ZC5A 3OW3A 4GJ2A 3KA0A 5HBHA 4OLIA 3UO6A 2YIYA 4ITIA 4O0XA 3UBDA 3QRIA 2GU8A 3DBDA 1UWJA 4QMPA 4DEDA 2VX1A 4XBRA 4K18A 2BAQA 2C5NA 3G6HA 4Y85A 5DE2A 4O81A 4MD7E 5DYJA 3PE1A 2HW7A 4XV9A 4DYMA 4PMPA 5CF8A 1A06A 3I4BA 5DR6A 4GG7A 2PE0A 3E8EA 4S2ZA 3G5DA 5IA0A 3RPYA 4AE6A 3UQGA 2Y4IC 4QNYA 5AR2A 4J52A 3G33A 1XH7A 2OZOA 3N4TA 4LYNA 5EHLA 4IE9A 2OU7A 2XF0A 3EZRA 4F70A 5KHXA 2AYPA 3DQXA 3B2TA 3POZA 3RHKA 3DFAA 4MBLA 3VW8A 4TN6A 2JLDA 1YXUA 3DZQA 5DT0A 3QU0A 4Z9LA 4E5AX 5AM7A 3CEKA 3ET7A 3VIDA 3ATSA 2PVHA 4X6QC 1PKDA 2GNIA 2XNOA 5ACBC 3TEIA 1KE6A 4PMTA 3EYHA 2E9NA 3TTIA 1PXKA 4A7CA 2IZUA 1ST4A 1Q62A 3I6UA 3S4QA 3QRUA 5HBEA 4RIYA 5L6PA 2VTAA 3NWWA 4EH2A 2Y9QA 4AZFA 3GCQA 5CYIA 4JDHA 5C8MA 3M1SA 4HVHA 3LOKA 2ZV7A 3IGGA 1QPJA 1B6CB 4KKHA 5DHJA 3CIKA 4ANBA 3NUAA 3FI2A 2ZMCA 1Y8YA 4YTFA 4FL1A 4RZVA 4AXFA 4RIWA 2YCFA 2CHLA 4FNZA 2YFXA 3V6RA 3V8SA 4WG3A 3NVMB 4BY9E 5KMMA 2G15A 4EHGA 4ZLYA 1KE5A 5EHOA 3Q2MA 2QO7A 2XYNA 2X4ZA 3QBNA 1WVXA 4XOZA 4ANLA 3KF7A 4XHKB 2PVLA 4L01A 3AKKA 4MQ1A 1NA7A 1JQHA 4Y46A 2PVNA 3BEAA 4APPA 3VUMA 4DEAA 1SVGA 4I22A 3GU4A 2Y4IB 3R28A 3PPZA 3SA0A 2J90A 3ZO4A 1GZ8A 4FKOA 4RJ5A 1R78A 1XH5A 3BX5A 2CJMA 4ZIMA 4BDDA 3AC5A 3LQ3A 1W7HA 4C7TA 1IA8A 3P7AA 4R6VA 1GZKA 4F0GA 4EOOA 4GMYA 3DK6A 2FSMX 4FTQA 4U43A 2X9FA 5BVWA 3AMAA 2BRMA 4AP7A 1PXNA 4CQGA 3DAKA 2X6DA 4FSRA 4OTDA 5IKWA 4D2TA 1XBAA 3VUKA 4G1WA 2G2FA 4MXZA 4I5HA 4L46A 4F9CA 1YHWA 2W9ZB 1W0XC 2AQXA 2OH0E 3LPBA 3H3CA 1YHVA 3KKVA 5HVYA 4IZ7A 4RJ6A 3R7YA 4U9AA 3QTUA 1G8SA 5I3RA 4IAFA 1JNKA 4M12A 3AKLA 1PF8A 1Q61A 1UWHA