5AP1A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
268
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVVKDVGVNYMPPEAIKDMSSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 268
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap1A01
3BYMA 3GP0A 5TT7A 3I1AA 4NFNA 3WIGA 1H1QA 4PP9A 4PMSA 3COKA 1GOLA 4GK3A 3VO3A 4I0SA 2VGPA 1LPUA 4K1BA 1OPLA 2YN8A 3NVKI 4C3FA 3C4WA 4TWNA 2C69A 1R1WA 4I3ZA 1GY3A 3FMMA 3QL8A 3GQIA 3A7IA 2PU8A 2QLUA 5IISA 3FZTA 4QQTA 3JR1A 3PWDA 4CFWA 4G3GA 3AC3A 1BI8A 2EU9A 4G3FA 1PW2A 4WBBB 2C6EA 3DKFA 2SRCA 5HIDA 3C4ZA 2QOKA 4QYGA 3TL8A 5JGDA 2I6LA 4WT6A 4CD0A 4H58A 1SNUA 4R1YA 4ZLOA 1J1CA 5AR2A 2BPMA 2G9XA 4LOPA 3CTQA 4DBNA 4GYGA 5ANKA 3R9NA 3V5TA 4IJ9A 3RK7A 4ANSA 5L3AA 2OSCA 3LFBA 3WBLA 2WGJA 4EH5A 3RWQA 1XHAA 2YLFA 5AP5A 3UTOA 4CNHA 5IMEA 4FV7A 4ANOA 4X6RA 2PMNX 5C4KA 5BVOA 4FSQA 3JXWA 2CKQA 5C1QB 2OZAA 2G2HA 3DLZA 3F61A 5AV1A 3R2YA 3U54A 3MH2A 4IDVA 3LXNA 4RJ8A 4NU1A 4LOQA 4D2TA 3DK6A 3PTGA 3DLSA 2VD5A 3UG1A 2DS1A 2WAJA 4XRLA 4YJTA 5HLWA 3MBLA 2OF4A 4DBXA 2PTKA 3EKNA 5D12A 1JKKA 1Y8YA 2VO0A 3IQ7A 4OBOA 4L53A 3PPZA 4CTCA 2OI4X 3UJGA 5AV2A 4Q9SA 2YZAA 4ZMFA 2O2UA 4AFJA 1BI7A 4DTKA 3ATTA 1UU7A 2R9SA 4OBPA 4UMTA 3QUPA 4BFMA 3PXZA 4UWYA 5AM6A 4D2RA 5A4LA 3KXMA 5CU0A 2C6TA 4A07A 3LOKA 4MD7E 4ZZMA 5K3YA 4EOKA 3ORLA 4PMPA 3AT2A 3CTHA 4FV1A 5TOZA 4X2JA 4K8AA 4USDA 3W2OA 2WPAA 3CGOA 3ET7A 1ZYSA 4FYNA 2W99B 3ZLXA 2XK4A 2B53A 4UEUA 2PVRA 4J7BA 3PXQA 4R3PA 4FYOA 5EI2A 3Q4ZA 5A46A 4E3CA 1J7LA 2JDTA 5FTGA 3HV3A 3ACJA 1YI6A 1OL5A 2W7XA 4JDHA 2UW0A 2IZSA 4PX6A 4DFUA 5JH6A 3KK9A 5ANGA 2KULA 3M11A 2WTDA 1YVJA 5KMLA 4XCUA 1Z5MA 4M69B 3E62A 4QMVA 3HDNA 3FYKX 4DG0E 2X6DA 3K5UA 4D55A 4EK4A 2RIOA 2C6MA 2XIRA 3OOGA 3QHWA 4ALWA 4JI9A 4Q5HA 4IIRA 5B2MA 5L2QA 2PUIA 3F2NA 3GU4A 1GIHA 2YAKA 3HGKA 3OXZA 3QD2B 4YGAA 3THBA 3ZC5A 2WB8A 2WHBA 2DQ7X 4FVQA 3F5PA 3ORPA 3DB8A 4F0GA 1K9AA 3C7QA 5BUIA 3COHA 2YDKA 4RJ5A 4PY1A 2YZLA 2JDVA 3BGQA 4OUCA 3GUBA 4CV9A 2XH5A 1IA8A 3IGOA 4B9DA 2ZB0A 5AIKA 1YXVA 5AA8A 4J52A 3RCDA 1QPJA 5DA3A 5HKMA 5KE0A 1PYEA 2QI8A 4MF0A 4QNYA 2Z8CA 4JNWA 4QP6A 1R78A 4E6DA 3KA0A 3DNEA 4L44A 2QG5A 3LM0A 2WU7A 2IN6A 4O7SA 3PJ3A 3PE1A 1GJOA 1Q3DA 2QOIA 2J9MA 4G9RA 5CSWA 4BBEA 5LVPA 1IEPA 4ZLZA 4EOPA 4YR8A 2C68A 3R0TA 5ANIA 3NNXA 3QLFA 3FKLA 3WE4A 2B9HA 3U55A 5KZ0A 3BV3A 2VTMA 2UZNA 5JZNA 2I1MA 2W1IA 2W5HA 2Z7QA 1H08A 1G8AA 2Y6MA 3U4WA 1WAKA 3ROCA 3BHHA 4GKIA 1F3MC 1YHWA 1XH9A 3SOAA 1ZRZA 3NUXA 3D4QA 1Y8GA 4X2GA 4KSQA 4DE4A 2YHVA 4FT3A 5HNIX 2WTKC 5H8GA 2QR8A 3QQUA 5IQDA 4ASDA 5L6WL 1OL6A 4MXCA 4U9AA 3LMIA 3BE9A 3G6HA 3V8SA 5JFSA 1YDRE 2BDJA 1CKJA 4FMQA 3PIXA 4KKHA 3OZ6A 4X2FA 5M4FA 5I9YA 3QZFA 4HW7A 5K0KA 4H05A 3QCXA 4RFMA 5L8KA 4EJNA 1PXOA 3KRRA 4QPSA 4XUFA 4OT5A 3OT3A 3FMKA 3ERKA 1Q8YA 3GC8A 1FGIA 4RX7A 3C4XA 3Q3BA 4DG2E 3SW4A 1YXUA 3BEAA 3OWKA 2PL0A 2G15A 3Q4UA 3Q9XA 5E1SA 3V5QA 3EQRA 5HNBA 5CT0A 2R3GA 4IMYA 3EQHA 3MWUA 4YHJA 4EC8A 3JS2A 4DT9A 3W32A 2AYPA 4FKJA 4UBAA 4EUUA 4HVHA 3FC1X 3HP5A 4C34A 3DZQA 4FKRA 2H6DA 4A7CA 5IDNA 1IR3A 1NVRA 3DFCB 5AWMA 4F63A 2JKMA 4L46A 2V5QA 3LZBA 4FEVA 3QUEA 3IDCA 2YACA 1R39A 3NNWA 5IQIA 3P9JA 5ANJA 5C4LA 5AR4A 5BMSA 4EK3A 2XNMA 3FMEA 3EN9A 2W5AA 4UYNA 5CWZA 3ZUTA 3AXWA 5HIEA 4GCJA 3Q2MA 3D94A 4GIHA 3A4PA 4G6LA 4AW1A 2PMIA 5DE2A 2XNEA 2PVNA 2UV2A 3G0EA 4JG7A 3R21A 3CE3A 4I1ZA 4J98A 2JKKA 4HGLA 4U3ZA 4W9WA 2XIKA 4XG4A 4AN2A 2UZWE 2X2MA 3LFAA 4M15A 4F1OA 3FMHA 4RC2A 3ZLSA 3H9OA 2JITA 4X3FA 3CGFA 4WSQA 4KRCA 3LFEA 4L8MA 4W4YA 4IAYA 3PG3A 3II5A 4QMZA 2JIUA 5EI6A 3ZFYA 2VU3A 3PY0A 4HPUE 4V05A 5B2LA 4RFZA 1U4DA 2JLDA 4HGSA 4MXXA 3RINA 1JBPE 5A4TA 3HL7A 2XK8A 4RWJA 4IZAA 4RIYB 4AW2A 3VUMA 3JPVA 4DN5A 1J7UA 1HOWA 3IKAA 4G1WA 4KS7A 3W2RA 2FSTX 3M1SA 2GDOA 5T3QA 5IZFA 4GIIA 2XCKA 3ZDIA 2OKRA 3WYXA 4B8LA 4FZFB 3H0YA 4DC2A 2XIZA 3G33A 3DK3A 3UP7A 5LOHA 2ZVAA 5J9LA 2X9FA 2YM4A 2VTQA 4F7SA 2CKOA 5A4EA 5J9ZA 2JC6A 4QQJA 4YURA 3MJ1A 4RSSA 5HICA 2OJGA 2YM8A 5M57A 3C4CA 2QOCA 3GC7A 3OMVA 4BWKA 3MH1A 1H26A 5AADA 3BHTA 4KB8A 2C47A 4R5SA 5TO8A 1REKA 4CXAA 5J5TA 1I44A 5LCKA 4CKRA 3RCJA 1PXLA 3EFWA 4ACCA 3OW4A 2CDZA 2YIYA 5KBRA 3QUDA 4K18A 1ZXEA 2E9PA 3E7OA 1I09A 1MP8A 4G9CA 4ONAA 2X8DA 2VGOA 3CC6A 3CP9A 3V04A 4ALUA 4IVAA 5J1WA 3LXPA 3A2CA 2W9FB 4W9XA 4JRNA 2CMWA 3R8VA 3DCVA 4X0MA 4FKIA 4OTWA 3VWAA 5AV3A 4UX9A 4BBMA 4O0VA 2EXEA 3ZXTA 3OCGA 2ITZA 4BCOA 4XG9A 4FVRA 4NFMA 3DGKA 2YCRA 3G2FA 5M08A 2W1ZA 5AUTA 1RW8A 3OCTA 3HA6A 4AX8A 3BHUA 3LFQA 2BRMA 4K9YA 4HPTE 2VUWA 4D2VA 4MXOA 3TACA 4DITA 3POZA 4PMTA 3PIZA 2GNFA 4LUEA 3DT1A 1SVEA 3EQFA 3BU6A 2ZOQA 4H1JA 5FBOA 3T9TA 2R5TA 2X8EA 4JJRA 4G3EA 4YTFA 3E8DA 5ETFA 4DGGA 4RZVA 3PFQA 2OJFE 2ITOA 4BGQA 4R5YA 3P7AA 2Y4PA 1U54A 4S32A 4OBQA 4O7RA 3UMWA 3GEQA 4DFBA 4AE9A 3E8EA 3BEGA 2YJSA 1Z9XA 3P79A 4FIEA 3VS6A 1ZZ2A 3F9NA 4ZSJA 4H1MA 2FSMX 4QQCA 4XV2A 1GAGA 1OIRA 5T68A 4YJSA 4DGNA 1PXJA 5AX9A 4RZWA 1OL7A 5DG5A 3MFUA 2B7AA 2PVMA 4XNEA 3RPYA 2VNYA 3P08A 4FSTA 4NW5A 4L9IA 3VUIA 2WTIA 3G9LX 3QX4A 3WF5A 3JY9A 2WOUA 2YJRA 2PZYA 3MA3A 5LWNA 4ZS4A 2BFXA 2QO9A 3R73A 5DHJA 2WFYA 2X2LA 5CS6A 5CU4A 3UG2A 4GKHA 2WMRA 3O51A 3U51A 1T46A 1GZOA 5DBXA 4WNOA 2VZ6A 1Q62A 1TKIA 4OTQA 3Q96A 3R02A 4EBWA 3KULB 1YOJA 4RX5A 1V0BA 4E6QA 4O0XA 2XBJA 4OTIA 2A2AA 2H8HA 1CMKE 3OWLA 3VN9A 3VVHA 4ASZA 1RJBA 3EFJA 4GL9A 4B7TA 2GTMA 3RHKA 4AN9A 3E92A 1EH4A 3NW6A 2XIYA 4M12A 5CVHA 3ZU7A 1FBNA 3ZMMA 1H4LA 3W2CA 2VTOA 3TZ7A 2C3IB 4W8EA 3D2KA 5DT3A 3ORKA 5L2TA 2XRUA 1H0WA 2W06A 3T3UA 4ZMEA 1BX6A 4NZWB 4PPCA 5AP7A 2IW9A 3QU0A 5BUEA 3IDBA 1M2PA 3MA6A 4FTNA 5BVKA 5HQ0A 3FQSA 4WNMA 3UQCA 3BYUA 3AT4A 4B8MA 3AOXA 3EB0A 1OPJA 1W98A 3RNIA 4M0YA 5FTQA 2ZV8A 4AT4A 4C37A 3F3ZA 3LFNA 2QOBA 2Q0BA 1PMEA 3LFCA 2BTSA 3BU3A 5CVGA 4ZAUA 4IM3A 3GI3A 3DOGA 4QQ5A 3ROYA 4R1VA 3EJ1A 4I5HA 5D41A 2F2UA 4RVLA 3V5PA 4C8BA 3GCVA 1QCFA 4H36A 4V0GA 2PVLA 3A61A 1YXTA 5BX0A 2JIIA 2UW7A 2W05A 4IAFA 4O0YA 1AQ1A 2XEYA 4WKQA 4O7NA 4YZCA 3QYWA 5LWMA 3O23A 1UU9A 4O91A 3N4TA 1B39A 5IEXA 1IASA 3EN4A 2H9VA 5AP3A 2PVKA 4N6ZA 1KOBA 3LW0A 3WZKA 3HUBA 3GU7A 3EYHA 3KEXA 5FGKA 4PDPA 3OY1A 5FDXA 4AGCA 4NKAA 3GFEA 4HGEA 4EQMA 2JDOA 3QQFA 4D2PA 4AZEA 2BCJA 4Y5QA 5AUVA 4L3PA 4ZZNA 4YP8A 3PJ8A 5LMKC 3FPMA 5EQEA 3C13A 4JVGA 4F08A 5AR3A 2O8YA 1DM2A 1KWPA 5IQGA 2X7GA 3PA3A 4F64A 2GNLA 2CCHA 4I22A 4FV5A 3VUHA 3R1SA 3O8TA 4FSZA 3G0FA 3QD3A 5FG8A 5JZJA 4BB4A 4QMYA 4PNIA 3KB7A 4FEUA 4YMJA 4D1SA 2XYNA 2HENA 3GCUA 2P2IA 2PZPA 3OTVA 4I4FA 4BTMA 4LRKA 1Y91A 2WZJA 1WVYA 2OFUA 3U6JA 1M17A 1MQ4A 3OOMA 5E8XA 5LVMA 4Y72A 2PVJA 4FGRA 1ERKA 2X7OA 5L8JA 2QD9A 1CKIA 2NRUA 4NJDA 5C8MA 4HCTA 3UO4A 4MXAA 1T45A 2X2KA 2ZJWA 3PY1A 1H1SA 1LEWA 5EW9A 4OTGA 4EYMA 3CBLA 2WMSA 1PHKA 3TIYA 4LMNA 4MCVA 1KOAA 4IB5A 5GIPE 4JR3A 1PXNA 5HO7A 3LQ5A 4XP2A 4BDDA 4U79A 4XG3A 5AMNA 4D4YA 4P90A 3CTJA 4EHVA 3ANQA 3PJ1A 2Y4IC 4XBUA 5HG8A 4ZY5A 4YJOA 4EH2A 1KSWA 1Q3WA 4GG7A 4HCUA 3VS1A 3GBZA 2ITUA 2NO3A 3QQKA 3MYGA 5AUXA 3VF9A 5BVFA 3QTZA 4BTJA 4CVAA 5JMSA 5FXQA 4BY9E 5JRQA 1CTPE 2C3KA 3TM0A 2LGCA 1WBTA 3MVHA 3UODA 4R7IA 1PYXA 3D5XA 4EK5A 4EHZA 4PRJA 3O50A 5BVWA 3MB6A 3LJ2A 3EOCA 4PTCA 5HTIA 3WILA 3IONA 3N51A 3R01A 4C0TA 3TKHA 2IWIA 2C4GA 4FV6A 2PE0A 3RPOA 3A8WA 5FWKK 3SLSA 4FEQA 3UMXA 2QCSA 3DBDA 4GFMA 2P2HA 4O1OA 1GIJA 4C2WA 2Z02A 2JD5A 2NPQA 3CLYA 4CSVA 3FEGA 4GH2A 1R0PA 5L8LA 4D9UA 4E6CA 1OUKA 3G15A 1L3RE 4IX5A 4RVMA 3Q04A 4BIBA 3F3VA 4O0RA 1WVWA 1CKPA 1Q97A 5EHLA 4CFMA 1O6LA 5E8VA 3AGLA 2HK5A 4OR5A 4M69A 3RI1A 5KMJA 4HYSA 4GJ2A 4HNFA 3CEKA 3EWHA 1Y57A 2ETKA 4DEAA 3FZRA 2XJ2A 2IG7A 5AX3A 3IOKA 2QVSE 2W1CA 3C0GA 4EHGA 1DI8A 4KAOA 4FTKA 3JUHA 3FLSA 3LHJA 4FV4A 2BKKA 3E7VA 4PUZA 4EOLA 5JFWA 4YNOA 4FK6A 3V01A 2X0GA 4J8MA 1JKSA 4FKGA 5BYZA 2GQSA 4C4IA 2PZRA 3VULA 1ZYCA 4TNDA 4FSRA 5DT4A 3ZHPC 1A9UA 3UYSA 4F65A 2GNGA 4F9CA 3H4JA 3CSVA 1U54B 5CTPA 2B9FA 4AZFA 3PPKA 3E8CA 4UZHA 4EZ3A 3MGYA 5CANA 2A1AB 2FO0A 3NIZA 4BZOA 4GUBA 3MH0A 3BBTB 4FNZA 3RPRA 2UVYA 3C9WA 3G9NA 4HZRA 5F1ZA 3EN6A 4K2RA 3UE4A 4TYJA 5IH4A 5KX8A 2ETRA 5JKGA 5M53A 2XK6A 3OFMA 4JAJA 3KU2A 2XUUA 5KMMA 3NGAA 4BDKA 2PHKA 3BIZA 2AUHA 3ZLYA 2BIYA 2O5KA 2VO6A 3PP0A 4FKOA 5ACBC 3WF9A 3WYYA 4E4MA 3QQLA 5H2UA 3NCGA 3QTSA 4DH3A 3NUSA 4KKEA 3LFFA 3FYJX 3PXKA 3GOKA 4FG7A 1M7NA 2X81A 4IZ7A 3QA8A 1ZMWA 4FV0A 2RFDA 5CAQA 4EONA 3LKMA 3G90X 3LE6A 4V04A 1H8FA 2ITTA 3F7ZA 4FV3A 2W96B 4YTCA 2R3NA 4XJ0A 2YABA 4BZDA 2C30A 1UU3A 2VWZA 3GU5A 4NTTA 3PWYA 3E5AA 4EH8A 4I0TA 4W8DA 1Y6BA 4BICA 4CFNA 5AM7A 2PUPA 3F3TA 1BL6A 4IX6A 4C4EA 2BHHA 3ENHA 2WOTA 3KGAA 3QXPA 4I94A 3ZYAA 1NXKA 3QRIA 4QMSA 3ORTA 3D5UA 3EZVA 2VX0A 3KL8A 4FIJA 4FKVA 5CQWA 3OUNB 4L52A 4FTAA 3ZSHA 4DEIA 3QAME 5HX6A 2JDSA 1H24A 3TNQB 4UZDA 3GVUA 5HIBA 4EYJA 3DY7A 1W8CA 1O9UA 1URWA 4XHKB 5CEQA 4KSPA 3AC4A 3E63A 4FTMA 5LMAA 1PMNA 4IXPA 4DEBA 3BRBA 4GVJA 4CZUA 1G8SA 3R9HA 3W33A 4GK4A 1ZY4A 4C3RA 2BMCA 5KKRC 4BIDA 4I6FA 4G2FA 2C1AA 4S34A 2I0VA 5EG3A 4DEEA 2C5XA 4O0UA 2J51A 4CT2A 4ZJIA 2GNHA 2GU8A 5E9EA 4H3QA 3CY3A 2FYSA 3UIBA 1Q8TA 4FVPA 3C5IA 4FIFA 4XBRA 3KCKA 2W9ZB 4MQ1A 4XLVA 3V5JA 2REIA 2E9OA 2QKWB 2Z7RA 3P7CA 4UYAA 4Z16A 3RWPA 3ALNA 3FLYA 5IMXA 5HBHA 2BILB 2OG8A 1E1VA 4WNKA 5C8KA 2CKEA 1J91A 2C1BA 1R0EA 3DJ7A 3D9VA 3HV6A 1HCKA 4K11A 3E87A 5EHOA 5B2KA 5G1XA 3DA6A 1NVQA 3NS9A 2WTKB 3KVXA 4FKLA 4FV9A 4NCTC 2HOGA 1Q5KA 1YDTE 4O2PA 5FQDC 5TE0A 1OL1A 4QTEA 4JDJA 4RIOA 5CSVA 3AD5A 2A4LA 4U0IA 5IH5A 4RIYA 3TV6A 4NH1A 4XV3A 5L6PA 3DDPA 3FY2A 3TUBA 2RSVA 2Y8OA 3T8OA 4YZNA 4ITHA 3DPKA 4LG4A 4E4NA 1FINA 3DB6A 3FQHA 4QP1A 1PY5A 3R7YA 3FXZA 4EH3A 3S95A 2VWBA 2QNJA 3BZ3A 3FI8A 5CF6A 5DN3A 2PVHA 4ZP5A 3L9MA 5IA5A 2HELA 3RAKA 3OF0A 1IRKA 3JYAA 4O6LA 3ZBFA 3CKWA 3QKKA 3LMGA 4ID7A 5EDPA 4BCIA 4BWXA 2ZM3A 3EQIA 1PJKA 2B1PA 4MBIA 1URCA 4M0ZA 5IPJA 4ZTRA 1H01A 2OXDA 4K33A 2RG6A 2IPXA 2OZOA 1NVSA 2UW5A 5I4NA 4G6NA 4AT3A 3NUUA 1Q4LA 3FMNA 3OVVA 4OTPA 3D7TB 3N9XA 5BUJA 4KWPA 4DCEA 1PF8A 2YDJA 2QOQA 2QOFA 2PPQA 4ITIA 5CAUA 4IAKA 4Q2AA 5BVEA 3KFAA 4AOIA 2O65A 3O8PA 3QQJA 4GW8A 3EYGA 4IAZA 3ULZA 3TV7A 5E7RA 3NUYA 3BU5A 4MVFA 3R7OA 2GFSA 3HRBA 1IA9A 1Q8ZA 4OT6A 5HE0A 3FZSA 4I92A 5KO1A 2RFEA 2UW3A 4PMMA 5C9CA 3AG9A 4IHPA 5LJJA 2CJMA 5AAGA 4RIXB 3A8XA 5AR5A 1PXIA 3SXRA 2E2BA 3V6RA 2QO7A 3AMAA 3HZTA 4BBFA 5IQBA 1KE9A 3NAXA 3DXQA 3R2BA 3HMOA 5AA9A 2I0HA 1Y6AA 4U42A 2ITPA 4IW0A 5IA4A 4ENYA 5E92A 5JFXA 3FQEA 1MQBA 2GTNA 5IQHA 1WVXA 1H1WA 4FGBA 4WHZA 3I7CA 4PQNA 5L4QA 3W18A 2YIRA 4YJRA 3A62A 2IVVA 5AR8A 2ITNA 5CEKA 4CLJA 3I6WA 1W7HA 5CI7A 4ZIMA 3UBDA 4O6EA 3EMGA 3MJ2A 1YQJA 5CEOA 5JFVA 3F82A 5CENA 5CEPA 4EOJA 4FTRA 3QZGA 5I0BA 4M97A 4Z9LA 1IG1A 2BR1A 3IO7A 4OTDA 4EZ5A 3ETAA 2UW6A 5JGAA 2VTHA 4LQMA 2JDRA 3FWQA 4BDCA 3I6UA 1ZAOA 5A3XA 2V7OA 4MNEB 3MTLA 5E90A 5HI2A 1APME 4ZY4A 1JLUE 2EB3A 3F88A 5DR9A 4CEGA 4YU2A 3SG9A 2VWWA 2R3HA 3PRFA 4BCHA 3F2RA 4FZ7A 1J3HA 1QPCA 4F6SA 4CFFA 3L1SA 3UPZA 2XM8A 4S33A 1P4FA 3S00A 4D4RA 3BE2A 3KULA 3PSCA 5D7AA 4O82A 4U45A 4HYHA 3VBQA 5DH3A 1GNGA 4LMUA 4NWMA 2XCHA 1RE8A 2F2CB 4CRLA 3UOHA 4ZY6A 3HUCA 3UC4A 3SGCA 2YEXA 2BDWA 3R1NA 2VTRA 4I20A 4J53A 2JIVA 2OXYA 4DFNA 4AQCA 2ZMDA 4OGRA 4DFLA 3L8PA 1OUYA 5ETIA 4JLCA 1OKWA 2OW3A 4N6YA 3RKBA 4QMQA 4B99A 4CQEA 5KMNA 4BR3A 4WD5A 2HWPA 3DU8A 2R7IA 4E5AX 1H25A 2HY81 2IJMA 3MPAA 3NLBA 4DF3A 5HX8A 3OXTA 3W8LA 3QGWA 3QTIA 4YC8A 2Q0NA 2P4IA 1E9HA 4WIHA 4IB1A 2VNWA 4I24A 3H9FA 2CHLA 3VBVA 3TZMA 4FEXA 4YJPA 3P86A 4YO6A 2BZJA 4M68A 3ZO1A 5GJDA 3RTPA 3ZC6A 4R7BA 5AAFA 4Z3VA 4I21A 4CLIA 5L2IA 2X39A 3I5NA 3QZIA 5CAPA 4LOOA 3LLTA 1HCLA 3OUKA 4PV0A 4I41A 3ZFMA 4D1ZA 4CCUA 3UIXA 4O21A 2W1FA 2WXVA 4D5KA 5JGBA 4J71A 5EOBA 3HYHA 3L9NA 4J1RA 3W10A 2QG7A 3C50A 2GS7A 4EKLA 3AC1A 2J0MB 3P5KA 4G3CA 3OXIA 4L00A 2YWVA 3P78A 3VQUA 4DYMA 2JGZA 5CVFA 5AP1A 1L8TA 4IEBA 3R8LA 2WEIA 3CXWA 5IU2A 3FLNC 5HZNA 2GNIA 4GMYA 2RF9A 1H00A 2PSQA 4HJOA 4FG9A 4E4XA 2UZUE 3LXLA 2PYWA 4MD9E 3MVLA 3OS3A 4JL9A 4R6VA 4C57A 5GJGA 4DG3E 4CZTA 3RPSA 5IUHA 3VS0A 2XRWA 2W4JA 3GFWA 4QYEA 4APPA 4EHEA 3COIA 2UZDA 4Q5EA 3FSFA 3OBGA 1OECA 3OWPA 4P2KA 3DTCA 4M13A 3UC3A 2R3MA 3EL8A 5DNRA 4RLKA 4E8AA 5LQFA 4LFIA 5I3OA 4KA3A 3MDYA 4EK8A 4LM5A 4N4SA 5H9BA 2IZUA 3SOCA 4USFA 2CNUA 3QYZA 5GNKA 4XOZA 5F95A 4LL0A 5HU3A 5AP0A 3SAYA 5KMKA 2E9VA 1DI9A 3ODYX 2YIXA 4TN6A 5IF1A 3VHKA 2I0EA 3FI2A 4AAAA 4I23A 3ZZWA 4D9TA 4DH1A 1H1PA 4F09A 5BVDA 4DT8A 4OTHA 4JBPA 2C5VA 3OBJA 4QP4A 3RAWA 4FZDB 1VJYA 2WO6A 4IE9A 3UOLA 4BC6A 2IZRA 5M07A 1OVEA 4AFEA 4ANMA 1PXKA 4O81A 4NIFB 2WD1A 3UIUA 4EH6A 1ATPE 1YOMA 2HW7A 5HORA 2J7TA 3QKLA 3Q5IA 2F7XE 3BYSA 3PRIA 1Q8WA 2OH4A 4LRJA 5IUGA 2QR7A 3ZRKA 3Q52A 1XH4A 2QQ7A 4A06A 4G5JA 3QRKA 5KCVA 2GNJA 2CNVA 1VR2A 2R3IA 3ORXA 1WCCA 1YXXA 3UVPA 4QOXA 2JAMA 2JKQA 4QTBA 1J1BA 4NM0A 2NP8A 5EW8A 2WQOA 4TYEA 4AGDA 4NKSA 1XQZA 3LM5A 2R3RA 4XEYA 2OFVA 5LVLA 3NUNA 4RT7A 3TJCA 4BDHA 4GFOA 2F9GA 5EYCA 5A6NA 4L42A 3RBWA 4A9RA 3O7LD 3SDJA 3BYVA 5FM2A 4OAVB 2KTYA 4P7EA 5IH6A 2RFSA 3COMA 2W17A 5FM3A 3A7GA 4WNPA 5DIAA 4FEWA 1OBDA 3QXOA 3UVQA 3GNIB 5F4NA 3QTRA 4YZBA 5CLPA 3TI1A 3DBFA 4ANQA 4FIIA 3Q6UA 4GEOA 4C62A 5LXMA 4HYUA 3SHEA 3EN5A 4AN3A 3EZRA 3Q53A 3QLGA 5F94A 5J95A 4QYHA 3FPQA 4Z7HA 2BFYA 2BIKB 4KRDA 4BKZA 2G2FA 1SVHA 2WMTA 3CQWA 4IX4A 4RG0A 2A0CX 3NW7A 2UUEA 4ZLYA 4B4LA 3ZTXA 1V0OA 2VO3A 4KBCA 4QP3A 3HEGA 3NIEA 5AP2A 3MW1A 4BTFA 2F49A 5CZHA 5CF8A 3QD0A 1SZMA 1XKKA 2F7EE 3HVCA 4KIKB 4U80A 4IFGA 4KBKA 3ZDUA 4P4CA 4IC7A 4J99A 4O86A 3LJ1A 4ZTHA 3TEIA 3ZLWA 4DFXE 3Q2JA 5DR6A 3BLRA 4BCMA 1TVOA 5D7VA 4D28A 5I9ZA 4YNEA 1Q24A 4O7YA 2Y4IB 5CSHA 5J5SA 3AMBA 5E91A 3BKBA 2I0YA 5I5ZA 2ONLC 3KXNA 3DAJA 2W0JA 3KQ7A 3EL7A 2I7QA 4QRCA 4TZRA 3VC4A 4XV9A 4D5HA 3KN6A 4RWIA 3NWWA 5DEWA 3MY0A 3FV8A 4R3RA 4JQ7A 2OWBA 3KRJA 4BDBA 2OIBA 5M4CA 4IQ6A 4J8NA 5ANEA 5B0XA 5H8EA 4KABA 5CAOA 4F1TA 1M7QA 1MRVA 5L2SA 3DFAA 1U59A 2OK1A 3H3CA 1ZOGA 4JS8A 5IA0A 2FA2A 3JVSA 4LGDA 3D15A 5EW3A 3DKOA 3OHTA 4QPAA 4IM2A 4R77A 5M09A 1KE7A 2ITXA 3I81A 2ERKA 2WTWA 3LFDA 5KNJA 4G3DA 3PVUA 4QP2A 4FTCA 4FTOA 3VBTA 3L8VA 3AQVA 4M14A 4O1PA 5B7VA 4EL9A 1Q41A 3EH9A 3N4UA 4D4SA 3HV4A 1PXPA 3R7UA 4FBXA 3IW8A 3RAHA 2IO6A 4WG4A 4U97A 3PLSA 2C3LA 2HYYA 3R8PA 1JKLA 1KE8A 2EUFB 2F7ZE 1PMVA 3FL4A 4EH4A 3D7ZA 3VIDA 3HX4A 4DFYA 4IB0A 2X6EA 3I7BA 4ITJA 4CG9A 1NW1A 3HECA 2XMYA 3RPVA 3QFVA 3TWJA 4MAOA 3W2SA 2WTCA 3TZ8A 2XF0A 4FR4A 2EWAA 3MFRA 3ZCLA 1P4OA 3IECA 3KREA 1FVVA 4FSMA 3BX5A 4BYIA 5DYJA 4FOBA 4TWOA 4YJQA 4MXZA 1DS5A 1XH6A 4ZSAA 1VYZA 2OU7A 3RAIA 4EJ7A 1OPKA 5C26A 3A4OX 2UVXA 4MWHA 4UMQA 2XNGA 2X9EA 3VUDA 5KBQA 4YJVA 5FBNC 3LLAA 4JT3A 3MS9A 2XYUA 2YA9A 4U8ZA 3V3VA 3KXHA 2X7FA 3MIAA 4M7IA 4IANA 5C8NA 1ZARA 4RLLA 5I9XA 4YJUA 3F3WA 2HXQA 1LUFA 4HGTA 3EN7A 5FP5A 4FL1A 2WTJA 5CYIA 5I9VA 3QGYA 3O17A 2P3GX 3BGZA 4U3YA 4XS2A 1OBGA 3FKOA 4FSUA 2BRNA 1XH7A 1JWHA 3H30A 4JDIA 5ITAA 4XG7A 3GC0A 3HLLA 2RKUA 3CPBA 3WOWA 3BV2A 1F5QA 3HAVA 2W1EA 4TYHB 3DBEA 4OTFA 2Z7SA 3Q5ZA 2XK7A 4BI0A 4BRXA 2LAVA 2CPKE 3ZRMA 1WBWA 3CY2A 5TF9A 4I6QA 1O6YA 4FTUA 4PDOA 4FIHA 4YLKA 3NZ0A 2GPHA 4WG5A 4FV8A 3TT0A 2BHEA 1V1KA 4JBVA 4BTKA 4M3QA 3F5XA 4U43A 1R3CA 4O0SA 1KE6A 3WIKA 3BI6A 4NM5A 5FEEA 4R8QA 4Y85A 5K5XA 5M44A 4O7ZA 2BKZA 4ZTSA 5CNNA 5TKDA 2ITQA 1JOWB 2UVZA 1O6KA 4J96A 2WQMA 4QMUA 4HVSA 3QCSA 3PY3A 5J7HA 3R9OA 4DGLC 2WIPA 3QTXA 3LVPA 4EEVA 2XNOA 4EOSA 3OT8A 4BKJA 5AJQA 4QPMA 3Q6WA 4YSJA 5J87A 4BIEA 5IA2A 3S1HA 1JAMA 3DZOA 3LFSA 5JEBA 4IB3A 2WQNA 3IG7A 1UNLA 3I0OA 4CFVA 3GB2A 5HCYA 5JQ8A 4DINA 2G01A 2ERZE 3D7TA 4H39A 5FRIA 3F3UA 5I9UA 4JBOA 2YIWA 5IA1A 1UWHA 2WQEA 4N57A 4XRJA 5AUWA 5GIOE 5KKRB 4HYIA 3ZFXA 5BMMA 3QTWA 3DK7A 4GK2A 4HNIA 2C0OA 4BHZA 3RP9A 5K5NA 5HO8A 2QOOA 1FMKA 3M2WA 3VS4A 2OJIA 4QMPA 1H1RA 5DMZA 4G31A 3MV5A 2VWYA 3WF8A 1ND4A 2VTAA 4C58A 3NVMB 5BVNA 3EQCA 5EYMA 3VNTA 4JIKA 3W8QA 1M14A 1RQQA 3FLZA 3ZEWA 4RIXA 5DRDA 4C36A 4FKSA 2XNNA 4GS6A 2OIQA 4NSTA 4L68A 5I3RA 3F6XA 5BYLA 1WFCA 3HV7A 2BRGA 4X3JA 3WZUA 3C51A 3EFLA 3ZEPA 3OCBA 4FKTA 5M51A 4I5CA 4GV1A 1ZY5A 3RGFA 3WARA 4HOKA 1YHVA 1DAYA 4YBKA 4BDIA 4C4FA 5K4JA 2P0CA 3ULIA 3MSSA 3F66A 4JXFA 1U5QA 1BUHA 4ZOGA 4UMPA 3UO6A 3MVJA 5HO6A 5AR7A 1P14A 3ZOSA 3FC2A 3TNPC 1WBNA 3QC4A 4IVDA 4EK6A 3ZUUA 5JQ5A 4MXYA 1M2RA 2W4OA 4BKYA 4QMXA 5CI6A 3BWFA 2HW6A 3R04A 1QPEA 2O64A 4PWNA 3AC2A 2UZOA 3VUTA 4KNBA 4MNEA 4BCQA 3LCOA 2C5NA 2GQGA 1P2AA 2J6MA 3CKXA 3DQXA 4U6RA 2OICA 4YUQA 2YM6A 2Z60A 1H27A 3ODZX 3UQGA 3FE3A 3PXRA 4BZNA 3HAMA 3FMJA 4L67A 3GU6A 3NAYA 3CPCA 1JQHA 3I60A 4YHFA 5EKOA 2YISA 5C01A 4PL4A 2JBPA 2ITWA 3CQEA 4FKUA 3S2PA 4PNKA 2JKOA 3EIDA 4K0YA 5CF4A 2YFXA 4OW8A 4RQVA 2FGIA 2WMQA 4ZTQA 4YC6A 4QP7A 1UA2A 4BL1A 4D4VA 2JEDA 3TNWA 2BZIB 2IZTA 5FTOA 3VUKA 4DH8A 1FPUA 4I4EA 5EM7A 1LP4A 4LL5A 4HVIA 5J7BA 2ZDTA 1KV2A 4K77A 5IUIA 2E9NA 2DUVA 4L6QA 1ZYLA 3FZPA 3ALOA 4LUDA 3DDQA 3VS5A 2XA4A 1JPAA 1YWVA 1YI4A 3SX9A 2UZTA 1G3NA 3DAEA 3ZONA 4C35A 4E1ZA 1FVRA 2C5YA 3Q4CA 3TUDA 3HMIA 3LQ8A 5E4HA 2VWXA 1SM2A 4O7LA 3I0QA 3FSKA 3IPHA 3DXNA 1XO2B 4GVAA 5E8ZA 3CIKA 4FTIA 4YTHA 3ITZA 4PPBA 4O22A 1CSNA 1BMKA 2W1GA 4QTDA 4O0WA 2IW8A 3TTIA 5HTBA 1KUTA 5KMOA 1XR1A 2XBAA 5GZAA 3MB7A 1A48A 2ZDUA 1LEZA 2ONLA 2PMOX 1YDSE 5HCXA 3FBVA 4EWHA 2QHMA 1FMOE 1BLXA 2ZMCA 3EHAA 4GRBA 4Y83A 3E88A 3LCDA 4QP9A 3NSZA 3U4UA 3C5UA 3SVVA 3MY1A 3VJOA 3G5DA 4C4GA 2OF2A 4JAIA 4DCAA 3QWKA 5CQUA 2PULA 4FX3A 4X3FC 2VAGA 4F0IA 4DEGA 5DT0A 5AUUA 3R1QA 3ZM9A 2FB8A 3GOPA 4FT9A 1OGUA 3DV3A 2R4BA 3EQPA 5GHVA 2R0IA 3GCQA 3H10A 1A06A 4IWPA 3TV4A 4DGOA 4A9TA 3E8NA 4GU6A 4ASXA 3U6HA 4F9BA 2CN5A 4A4OA 2C6IA 4EUTA 5AV4A 4NYEA 3R28A 3W55A 5JRSA 1WBVA 2UW4A 4RGJA 2VRXA 3PXFA 3RJCA 3WE8A 3OTUA 2C0IA 4IWOA 4IBMA 3LQ3A 3IK3A 2WELA 4FL3A 5HOAA 4F70A 3KMMA 5HLPA 4U81A 3QCYA 3W2QA 1YKRA 4KUJA 4M84A 5AEPA 3PXYA 3HP2A 4C33A 1YWRA 4CKJA 5HESA 5HVYA 4L3JA 2X4ZA 5AV0A 4DAWA 5K4IA 4CGAA 2FSLX 3UOJA 3PVGA 5H3QA 3A7HA 5HVKA 3UZTA 2Z7LA 2PMLX 4HVGA 2PK9A 3MVMA 4KBAA 4AS0A 5A9UA 3M42A 3FJQE 2HWOA 4RWLA 4WUAA 5CT7A 5CU2A 4F9AA 2B52A 1YI3A 4USEA 2YWPA 3I4BA 1K3AA 4NW6A 2VV9A 3S3IA 5CXZA 3ATSA 2UW9A 2BROA 4IZYA 3MESA 2YITA 3UNZA 3E3BX 5L6OA 3GCPA 3TNHA 4E93A 2HAKA 1GIIA 4GUEA 4NIFA 2HY0A 5CEIA 2RGPA 2VTLA 4FC0A 4C61A 3MIYA 3KXZA 4ORKA 2QLQA 1Q8UA 3AD6A 4MWIA 4H3PA 2VTPA 5ICPA 3V8WA 2WEVA 4AZSA 4PDYA 5D1JA 3WZDA 4AE6A 4O7VA 3JVRA 5HE1A 4UB7A 2EVAA 3CD8A 3R7IA 3POOA 5CU3A 1FVTA 2GFCA 3UGCA 3WZEA 3MH3A 5LMKA 5AUYA 2GHLA 3MI9A 4MTAA 4R78A 4QNAA 5HLNA 3L8XA 4C7TA 1B6CB 2BVAA 4WSYA 5AIRA 5ETCA 3NPCA 2H96A 3A60A 4ASEA 1UWJA 4J97A 4AGUA 1OIQA 1OKVA 3C4EA 2ESMA 3KRLA 4NM3A 3PA4A 5D10A 4AUAA 3PSDA 4KIPA 3QRJA 2RL5A 2ZB1A 4DFZE 4BCKA 2IW6A 5JN2A 4WRGA 3ZXZA 3TNIA 4A4XA 2ZM1A 3PJ2A 1OITA 5A4QA 1YHSA 1YXSA 1VEBA 4ACMA 3IS5A 3DJ6A 5T6KA 5DWRA 3DBCA 4FKWA 4IVBA 3QRTA 1PMUA 3GXLA 2WIHA 1GZKA 2G2IA 4APCA 4FUYA 2A19B 4KIKA 2VX3A 4L3LA 2BAQA 3LCTA 4CV8A 3QQGA 3L9LA 3QTUA 1BYGA 2XKEA 4QYFA 4OAUC 3O96A 2B4SB 3D14A 3RM7A 4ZSEA 3UPXA 4F6WA 3UQFA 2YLEA 2VN9A 4FTLA 4CMUA 3GGFA 4FTTA 4MKCA 4E6AA 3ENMA 4UMUA 5F9EA 4C3PA 2V22A 5HBEA 1BKXA 4AXAA 3FZOA 4DGMA 3QALE 4E73A 1ZYJA 3ZO3A 4NT4A 4KKGA 2XKDA 3E93A 2B54A 4S31A 4RWKA 5J79A 5ANDA 4BDGA 5HHWA 2PE1A 3FMLA 5KZIA 4ENXA 3OEFX 4AACA 2PVFA 4EZ7A 3FI4A 5LCJA 3Q4TA 3QQHA 1UKHA 1SYKA 1FGKA 3OD6X 3SQQA 2WKMA 3K54A 4O7WA 4CYIA 1GZNA 3GC9A 4RJ4A 3KC3A 4I5PA 5CX9A 4EQUA 5IQCA 4F1MA 1XH8A 4L7SA 3VW6A 3GT8A 4ZTLA 4ACHA 4WUNA 1F0QA 3BWJA 5E8SA 2QOHA 3IW7A 3HMNA 1ZMUA 3HA8A 4X6QC 3PG1A 4U44A 4YHTA 4M66A 3NCZA 3ZRLA 1OB3A 3ZSGA 4ANNA 5FUTA 3PA5A 5CASA 4MH7A 1ZOHA 2XK3A 3SXFA 3PLAE 4QYYA 2J50A 2J5EA 3NEWA 4LRMA 4CKIA 4L45A 3ORZA 2EXCX 4BCNA 2QODA 4XH6A 4TPTA 2XKFA 4AOTA 4JDKA 5GINE 2BDFA 3KVWA 3B2WA 2XKCA 4D0XA 4RPVA 4FSYA 4BDEA 3LPBA 4A9YA 1OM1A 4ARKA 4DA5A 3GENA 2BALA 4RQKA 2V0DA 4I5MA 4DEDA 1WBSA 3O2MA 2OJ9A 4AA0A 1UU8A 3K3JA 4I0RA 4IZ5A 3KN5A 2Y6OA 4IAAA 5JT2A 3RZFA 5TR6A 5DI1A 4Z55A 4GT4A 1OI9A 5M4UA 3PP1A 2ZV9A 2FH9A 4RC4A 3ZSIA 2WMUA 1G5SA 1OL2A 1YW2A 4BYJA 4E26A 4R7HA 3WF6A 3ZUVA 4U7ZA 4RJ6A 2GS6A 2W1DA 4JRVA 5EI8A 2CGXA 4ZTNA 5HEZA 3BCEA 4WRSA 4XOYA 3V5WA 4CG8A 3QX2A 4FT0A 2B0QA 4RJ7A 2BAKA 3UZPA 4D2SA 3DKGA 1K2PA 3Q32A 3FLQA 4N0SA 4RIWB 4CT1A 4FNYA 2OBJA 4YPDA 1DAWA 1WBPA 4UN0C 3IOPA 3K5VA 4UMRA 4ZSLA 4YPSA 1U46A 2XNPA 4MD8E 4WBOA 5AAEA 3ELJA 3KMWA 1OIUA 3DXPA 4MF1A 4IWQA 4MK0A 1RDQE 5AP6A 1XH5A 2PZ5A 3KF4A 5ACKA 4AF3A 4NK9A 2IVUA 3HMPA 4RX8A 3I79A 3VBXA 3HRFA 4G34A 4GFGA 4QMOA 1SVGA 3EQBA 4FNWA 4TNBA 5M06A 3FDNA 2PZIA 4F0FA 4PDSA 4TYHA 5CEMA 3LCSA 3REPA 4RA4A 5EQYA 3O71A 4FT7A 4GU9A 3ZBXA 2R0UA 4UY9A 4ZZOA 2UW8A 4L43A 4V01A 2HZ0A 3MPTA 2RG5A 4FSNA 5KHWA 4C38A 4XG2A 2VX1A 5EKNA 2GHGA 2QO2A 1Q99A 4KS8A 3VW8A 4TWPA 5FEQA 3CJGA 4BI1A 2WU6A 2QHNA 4WA9A 5FD2A 4TY1A 4X7QA 3V5LA 4AT5A 4PPAA 5ANOA 3H0ZA 5HGIA 4BCFA 4F9WA 5BQ0A 2BRHA 2HZNA 4G5PA 2E9UA 4QMWA 5HCZA 3HDMA 1M2QA 2PVYA 3DQWA 2J5FA 2VWVA 3R7VA 3CQUA 3KXXA 3TKIA 4AG8A 3K3IA 2ZAZA 2ZYBA 1JSVA 3N4VA 4CRSA 5AFVA 4BDFA 3SRVB 2GQRA 2WQBA 3KK8A 3SA0A 3LCKA 4QMTA 5EQPA 3R63A 4AOJA 4F7LA 5L2WA 4YJNA 3HKOA 4P5ZA 1TQMA 4CYJA 3DJ5A 5CZIA 3WZJA 3W1FA 3ORMA 3PE2A 3RALA 5LARA 2WMAA 2IVSA 3KMUA 1P5EA 5CALA 2JFLA 5J9YA 1XBAA 4DHFA 5EM8A 4AU8A 3KXGA 5DEYA 3F5UA 3OC1A 1S9IA 4UXQA 4XLIA 4EWQA 2IVTA 2O63A 4FIGA 2CLXA 4KIOA 5E8WA 4ERWA 3VBWA 3ZH8A 5HBJA 3ACKA 4FK3A 2YM3A 3B2TA 4FKQA 3P23A 4IACA 3V51A 3NYOA 2UZEA 3RM6A 4ZK5A 1B38A 1FQ1B 5EH0A 2R64A 2P55A 4D0WA 4DTBA 3R9DA 2ITVA 5CSXA 2AC3A 4O84A 4I93A 2J4ZA 1CDKA 2QONA 4Y46A 3UYTA 4JQEA 2XP2A 4IX3A 2PY3A 1Q61A 4TXCA 4NCTA 5M55A 5EM5A 5GZ9A 4S2ZA 4E5BA 4ZXTA 3Q60A 3UNKA 3ORNA 1ZWSA 4CQGA 3FLWA 5CNOA 5DFPA 4DLIA 5A6OA 3KKVA 3G6GA 4TW9A 2FUMA 3KF7A 3QC9A 4FZAB 5J1VA 1JKTA 4PTEA 5HD7A 2OXXA 1AGWA 4ZEGA 3C0HA 1UNHA 2G1TA 2GS2A 2OZAB 4L01A 2PWLA 4QP8A 3NYVA 4BHNA 1W82A 4II5A 4QMNA 3GCSA 3VS3A 2DYLA 2VO7A 3IGGA 5IG1A 5IQFA 2HZIA 3G51A 1PKDA 4EBVA 3OROA 2I40A 3WI6A 4XP3A 2HZ4A 4BGHA 4ZJVA 4W4XA 3QKMA 5KUPA 3SXSA 2C0TA 2F4JA 3CD3A 4RRVA 1UVRA 3OWJA 3R8UA 2C5OA 3LAUA 2O3PA 5EYKA 2R3FA 4D2WA 3D0EA 3MFSA 3UNJA 4A9SA 3P7BA 4TT7A 4EOOA 4FODA 2XM9A 1QPDA 2VTSA 4JOAA 3U8WA 4LV5A 4ACDA 4DLJA 5KHXA 1OKZA 4PL3A 5A4CA 4RBLA 1ZLTA 5FLFA 2C6OA 3NW5A 2XZSA 4NTSA 1KV1A 3TXOA 3FUPA 1ZOEA 4AA4A 3C1XA 2A27A 3SG8A 4C4JA 4O38A 5HD4A 4U5JA 5A14A 4YZ9A 3VHEA 1OIYA 2X4FA 2OO8X 4ANLA 3MY5A 2ZV2A 1ZYDA 1MRYA 4X2NA 5FXRA 5K0XA 4JG8A 2C6DA 3BHVA 3RHXA 3KCFA 1JNKA 4FNXA 2GHMA 2XIXA 2Q83A 2J0KA 3FY0A 4MBLA 1H07A 3ANRA 1IAJA 2H34A 4P5QA 4BI2A 2W5BA 3DKCA 3OG7A 2JBOA 4C02A 2VTTA 4F7JA 4FKPA 5AP4A 1OMWA 5HG7A 4F4PA 2QC6A 3LMHA 2UZVA 3QD4A 1E1XA 1XBCA 3R6XA 3RZBA 2QOLA 2YDIA 3LIJA 2R3JA 3WF7A 4AA5A 3ZS5A 4CFXA 2WMWA 3V8TA 4WO5A 2ACXA 5C27A 2BZKB 3EKKA 3R1YA 4KIQA 4AW0A 2C6KA 3MTFA 3BELA 1FOTA 3H9RA 2BTRA 3U87A 4D1XA 4HVDA 4EH9A 5CSPA 3R7EA 4FV2A 2EXMA 5FEDA 5IKWA 4YSMA 3NYNA 1YOLA 2CLQA 3SV0A 2QU6A 3R83A 2J0JA 3FHIA 5E1EA 3R9RA 4MYGA 1X8BA 2YM5A 4XX9A 3VS7A 3ZO4A 2V62A 2WTVA 2X1NA 3HNGA 4PP7A 2WNTA 5CU6A 2CCIA 4CMTA 3Q9YA 1GZ8A 3NX8A 3VS2A 5EM6A 2YERA 3BLQA 1LR4A 3NRMA 4MX9A 2WMXA 4QTCA 2Z2WA 2HXLA 3PZEA 1CM8A 2EB2A 5FXSA 5CY3A 3DS6A 2R3QA 4FF8A 5DPVA 2P33A 1MRUA 2V55A 2XEZA 3QF9A 4G16A 4B0GA 4DTAA 3UO5A 3RNYA 3ID6C 4Q9ZA 3OP5A 3NNVA 4RMZA 2CGUA 3SD0A 3DBQA 3NNUA 4UWCA 5J8IA 3KRWA 4PTGA 4YZMA 3BYOA 3SKCA 3HV5A 3F5GA 3O7LB 2B55A 4NM7A 4PF4A 1SNXA 2VWIA 3MFTA 4G17A 4OTRA 4R3CA 2CSNA 3U9CA 4F99A 4M8TA 4AW5A 1OKYA 2C6LA 3TUCA 1ZMVA 2CGVA 2OIDA 4EH7A 2QU5A 2VWUA 5K9IA 2WMBA 3FXWA 4IDTA 4MBJA 4MQ2A 4E5WA 2VTNA 3OY3A 2R3OA 3T3VA 4UXLA 3BLHA 4MHAA 3FKNA 5E8UA 4OLIA 3VF8A 3HRCA 3NR9A 4TTHB 5CF5A 5IEVA 3W16A 3CCNA 3HMMA 4CCBA 3F2AA 2J0LA 3OEZA 3A7FA 4GSBA 3AD4A 1QMZA 3GQLA 4FICA 1VYWA 3QBNA 3VJNA 2B9IA 4EOMA 2F57A 3BGPA 2R2PA 3L8SA 2XJ0A 3PUPA 2YAAA 4L7FA 1SMHA 4BDJA 5HNGA 4JX7A 1H0VA 3RK5A 4FT5A 5HG9A 3UP2A 4N70A 1W83A 4XG8A 4AWIA 3RK9A 3MPMA 3FL5A 3TKUA 4BWPA 3K2LA 3QCQA 4JG6A 4XV1A 5DRBA 2HIWA 2Y0AA 4YLLA 4W4WA 2ITYA 4FG8A 4FUXA 4X2KA 2R3PA 4LGHA 5DOSA 1PXMA 4YTIA 5LVNA 3A7JA 3VBYA 4FTJA 4EOIA 3R8MA 3FHRA 3QZHA 4CTBA 3S0OA 3NYXA 1ZZLA 1UV5A 1U5RA 1M52A 4FSWA 1TQPA 4KD1A 3DTWA 4EI4A 4X3FB 4DEHA 4AZWA 3D5VA 3BQCA 1KE5A 1PRYA 2XK9A 4WOVA 5EDQA 4BVUA 3D2IA 2NNWB 4O7TA 4RVTA 2CNQA 2PUUA 3CS9A 4RJ3A 3DNDA 4AGWA 4YC3A 4LYNA 2QKRA 3UDBA 3U6IA 4E20A 4QMMA 3UOKA 4C2VA 3R30A 3FAAA 4O96A 2GMXA 3T9IA 1MUOA 2O0UA 2YCQA 3EFKA 4JX3A 3NUAA 2HCKA 5GZ8A 2ETMA 5HE2A 3UVRA 5IQEA 3D5WA 3KRXA 4JQ8A 1W0XC 5BPYA 4G6OA 2BZHB 4FTQA 4LI5A 4Y95A 3CJFA 3FI3A 4IJPA 4YBJA 3TZ9A 4BGGA 4FI1A 5JK3A 3AMYA 1WZYA 2XVDA 3RMFA 3VRZA 3F69A 4FA2A 1WBOA 3BBWA 3QTQA 4MNFA 4U40A 3L9PA 4I6HA 2J90A 3IW6A 3Q9WA 4BCPA 2RFNA 5E8TA 4Y8DA 1XJDA 4O27B 4ANBA 3A99A 3BHYA 3PPJA 1JSTA 4LGGA 3TTJA 2YM7A 2UZBA 4JR7A 3Q9ZA 2QURA 2YCFA 2DWBA 3KY2A 4ACGA 4ERKA 5CXHA 2XS0A 5IQAA 3O0GA 2BUJA 4EORA 3FZ1A 3UIMA 4AZTA 3TG1A 4AZVA 1NA7A 4XYFA 3ZO2A 2CGWA 5EFQA 3D83A 5C03A 3ORIA 3SC1A 2JFMA 3FMDA 3VRYA 4ALVA 4TYGA 3R7GA 4Z7GA 2J0IA 3P0MA 4GT5A 4BCJA 3VQHA 2J2IB 5BYYA 4ZTMA 3BQRA 3GU8A 4RC3A 5A54A 5DVRA 4S30A 2VTJA 4JBQA 3B8RA 1UNGA 5ETAA 2Y7JA 2YCSA 4IM0A 1V0PA 5BNJA 3LXKA 4A9UA 2CN8A 4B6LA 3S4QA 3E64A 4KINA 3TIZA 4FL2A 3BPRA 4TRLA 4UV0A 1J7IA 4X21A 2W4KA 1YWNA 3AGMA 5EK7A 4ZS0A 5FDPA 5KMIA 5HG5A 1Z57A 3IW5A 4GJ3A 4M67A 1W84A 4Y5HA 4F7NA 3PJCA 3PVWA 3QA0A 5HE3A 4GG5A 4CMOA 5JSMA 4C59A 4UWBA 2XB7A 1PKGA 4YO4A 2FVDA 3TDWA 3C0IA 4H3BA 2GSFA 2BRBA 2R3LA 4IH8A 4NEUA 4WG3A 4J95A 3TN8A 4MEDA 3NUPA 4BN1A 2CKPA 3QRUA 5DGZA 4YLJA 2R7BA 5EOLA 5E8YA 4PL5A 3IW4A 5H8BA 3OW3A 2W1HA 1XWSA 4A4LA 2OJJA 3SW7A 1S9JA 1NT2A 4FZ6A 1QL6A 4QO9A 3B8QA 4Y73A 4E7WA 2XNBA 1VZOA 1NY3A 3PVBA 4NUSA 3AC8A 3PYYA 4RFYA 2JAVA 3F7WA 3R22A 1YRPA 4LV8A 3RVGA 5I9WA 5EHYA 2X8IA 4QTAA 3R8ZA 4IADA 3VUGA 1IAHA 3PSBA 3R00A 4QMLA 2Y9QA 3EQDA 4JIAA 3NMUF 3MN3A 4GT3A 4IFCA 3P1AA 4RX9A 4EQCA 3NDMA 4BDAA 4XP0A 3VAPA 1WMKA 4NJ3A 3JY0A 4FOCA 5F20A 5EYDA 3PZHA 1JVPP 5D9HA 3QWJA 1OZ1A 2YIQA 4BF2A 5IEYA 1H28A 3OCSA 2PE2A 3R71A 3QHRA 4E4LA 3PIYA 5FP6A 3W2PA 4TYIA 4YZDA 3FXXA 2UZLA 2AC5A 4EC9A 4O2ZA 2ZM4A 3AC5A 4W4VA 4RIWA 1BL7A 5M4IA 3DAKA 5CAVA 5LMBA 5G6VA 4D58A 2C3JA 3I5ZA 3P4KA 3LJ0A 4QT1A 4UALA 2BAJA 2XJ1A 3ZM4A 4TL0A 4FE2A 2ZV7A 5EDRA 3ZZEA 3O8UA 4AP7A 4C4HA 5HVJA 4U41A 4XG6A 3TJDA 1TQIA 5D11A 5HTCA 4IVCA 4QD6A 2FSOX 2OLCA 4HCVA 2OH0E 4IWDA 3V6SA 5HU9A 4O0TA 3CR0A 5M56A 4IAIA 5DR2A 2NRYA 4NL0A 3C4FA 4XMOA 4ZSGA 4EKKA 4RA5A 3TDVA 4GYIA 4V0GB 5AUZA 2PUNA 4CFUA 3E3PA 4DH5A 3UZRA 2VTIA 4HZSA 1JSUA 2B9JA 3EQGA 2GCDA 5GJFA 5LVOA 4F6UA 4BCGA 2R3KA 4K6ZA 3AT3A 4TWCA 1UKIA 1STCE 5IA3A 3PDTA 4DH7A 4O83A 4ZJJA 3SRVA 5DLSA 3TCPA 4EOQA 4CZYB 2WMVA 4TKSA 1AD5A 5IDPA 2V7AA 4I6BA 4F9YA 3IDPA 1REJA 4RVKA 1XBBA 4IC8A 2OGVA 3U9NA
chains in the Genus database with same CATH superfamily
3BYMA 3GP0A 5TT7A 3I1AA 4NFNA 3WIGA 1H1QA 4PP9A 4PMSA 3COKA 1GOLA 4GK3A 3VO3A 4I0SA 2VGPA 1LPUA 4K1BA 1OPLA 2YN8A 3NVKI 4C3FA 3C4WA 4TWNA 2C69A 1R1WA 4I3ZA 1GY3A 3FMMA 3QL8A 3GQIA 3A7IA 2PU8A 2QLUA 5IISA 3FZTA 4QQTA 3JR1A 3PWDA 4CFWA 4G3GA 3AC3A 1BI8A 2EU9A 4G3FA 1PW2A 4WBBB 2C6EA 3DKFA 2SRCA 5HIDA 3C4ZA 2QOKA 4QYGA 3TL8A 5JGDA 2I6LA 4WT6A 4CD0A 4H58A 1SNUA 4R1YA 4ZLOA 1J1CA 5AR2A 2BPMA 2G9XA 4LOPA 3CTQA 4DBNA 4GYGA 5ANKA 3R9NA 3V5TA 4IJ9A 3RK7A 4ANSA 5L3AA 2OSCA 3LFBA 3WBLA 2WGJA 4EH5A 3RWQA 1XHAA 2YLFA 5AP5A 3UTOA 4CNHA 5IMEA 4FV7A 4ANOA 4X6RA 2PMNX 5C4KA 5BVOA 4FSQA 3JXWA 2CKQA 5C1QB 2OZAA 2G2HA 3DLZA 3F61A 5AV1A 3R2YA 3U54A 3MH2A 4IDVA 3LXNA 4RJ8A 4NU1A 4LOQA 4D2TA 3DK6A 3PTGA 3DLSA 2VD5A 3UG1A 2DS1A 2WAJA 4XRLA 4YJTA 5HLWA 3MBLA 2OF4A 4DBXA 2PTKA 3EKNA 5D12A 1JKKA 1Y8YA 2VO0A 3IQ7A 4OBOA 4L53A 3PPZA 4CTCA 2OI4X 3UJGA 5AV2A 4Q9SA 2YZAA 4ZMFA 2O2UA 4AFJA 1BI7A 4DTKA 3ATTA 1UU7A 2R9SA 4OBPA 4UMTA 3QUPA 4BFMA 3PXZA 4UWYA 5AM6A 4D2RA 5A4LA 3KXMA 5CU0A 2XAOA 2C6TA 4A07A 3LOKA 4MD7E 4ZZMA 5K3YA 4EOKA 3ORLA 4PMPA 3AT2A 3CTHA 4FV1A 5TOZA 4X2JA 4K8AA 4USDA 3W2OA 2WPAA 4DHZA 3CGOA 3ET7A 1ZYSA 4FYNA 2W99B 3ZLXA 2XK4A 2B53A 4UEUA 2PVRA 4J7BA 3PXQA 4R3PA 4FYOA 5EI2A 3Q4ZA 5A46A 4E3CA 1J7LA 2JDTA 5FTGA 3HV3A 3ACJA 1YI6A 1OL5A 2W7XA 4JDHA 2UW0A 2IZSA 4PX6A 4DFUA 5JH6A 3KK9A 5ANGA 2KULA 3M11A 2WTDA 1YVJA 5KMLA 4XCUA 1Z5MA 4M69B 3E62A 4QMVA 3HDNA 3FYKX 4DG0E 2X6DA 3K5UA 4D55A 4EK4A 2RIOA 2C6MA 2XIRA 3OOGA 3QHWA 4ALWA 4JI9A 4Q5HA 4IIRA 4FJVA 5B2MA 5L2QA 2PUIA 3F2NA 3GU4A 1GIHA 2YAKA 3HGKA 3OXZA 3QD2B 4YGAA 3THBA 3ZC5A 2WB8A 2WHBA 2DQ7X 4FVQA 3F5PA 3ORPA 3DB8A 4F0GA 1K9AA 3C7QA 5BUIA 3COHA 2YDKA 4RJ5A 4PY1A 2YZLA 2JDVA 3BGQA 4OUCA 3GUBA 4CV9A 2XH5A 1IA8A 3W0SA 3IGOA 4B9DA 2ZB0A 5AIKA 1YXVA 5AA8A 4J52A 3RCDA 1QPJA 5DA3A 5HKMA 5KE0A 1PYEA 2QI8A 4MF0A 4QNYA 2Z8CA 4JNWA 4QP6A 1R78A 4E6DA 3KA0A 3DNEA 4L44A 2QG5A 3LM0A 2WU7A 2IN6A 4O7SA 3PJ3A 3PE1A 1GJOA 1Q3DA 2QOIA 2J9MA 4G9RA 5CSWA 4BBEA 5LVPA 1IEPA 4ZLZA 4EOPA 4YR8A 2C68A 3R0TA 5ANIA 3NNXA 3QLFA 3FKLA 3WE4A 2B9HA 3U55A 5KZ0A 3BV3A 2VTMA 2UZNA 5JZNA 2I1MA 2W1IA 2W5HA 2Z7QA 1H08A 1G8AA 2Y6MA 3U4WA 1WAKA 3ROCA 3BHHA 4GKIA 1F3MC 1YHWA 1XH9A 3SOAA 1ZRZA 3NUXA 3D4QA 1Y8GA 4X2GA 4KSQA 4DE4A 2YHVA 4FT3A 5HNIX 2WTKC 5H8GA 2QR8A 3QQUA 5IQDA 4ASDA 5L6WL 1OL6A 4MXCA 4U9AA 3LMIA 3BE9A 3G6HA 3V8SA 5JFSA 1YDRE 2BDJA 1CKJA 4FMQA 3PIXA 4KKHA 3OZ6A 4X2FA 5M4FA 5I9YA 3QZFA 4HW7A 5K0KA 4H05A 5BV3A 3QCXA 4RFMA 5L8KA 3UDTA 4EJNA 1PXOA 3KRRA 4QPSA 4XUFA 4OT5A 3OT3A 3FMKA 3ERKA 1Q8YA 3P5JC 3GC8A 1FGIA 4RX7A 3C4XA 3Q3BA 4DG2E 3SW4A 1YXUA 3BEAA 3OWKA 2PL0A 2G15A 3Q4UA 3Q9XA 5E1SA 3V5QA 3EQRA 5HNBA 4FRFA 5CT0A 2R3GA 4IMYA 3EQHA 3MWUA 4YHJA 4EC8A 3JS2A 4DT9A 3W32A 2AYPA 4FKJA 4UBAA 4EUUA 4HVHA 3FC1X 3HP5A 4C34A 3DZQA 4FKRA 2H6DA 4A7CA 5IDNA 1IR3A 1NVRA 3DFCB 5AWMA 4F63A 2JKMA 4L46A 2V5QA 3LZBA 4FEVA 3QUEA 3IDCA 2YACA 1R39A 3NNWA 5IQIA 3P9JA 5ANJA 5C4LA 5AR4A 5BMSA 4EK3A 2XNMA 3FMEA 3EN9A 2W5AA 4UYNA 5CWZA 3ZUTA 3AXWA 5HIEA 4GCJA 3Q2MA 3D94A 4GIHA 3A4PA 4G6LA 4AW1A 2PMIA 5DE2A 2XNEA 2PVNA 2UV2A 3G0EA 4JG7A 3R21A 3CE3A 4I1ZA 4J98A 2JKKA 4HGLA 4U3ZA 4W9WA 2XIKA 4XG4A 4AN2A 2UZWE 2X2MA 3LFAA 4M15A 4F1OA 3FMHA 4RC2A 3ZLSA 3H9OA 2JITA 4X3FA 3CGFA 4WSQA 4KRCA 3LFEA 4L8MA 4W4YA 4IAYA 3PG3A 3II5A 4QMZA 2JIUA 5EI6A 3ZFYA 2VU3A 3PY0A 4HPUE 4V05A 5B2LA 4O4CA 4RFZA 1U4DA 2JLDA 4HGSA 4MXXA 3RINA 1JBPE 5A4TA 3HL7A 2XK8A 4RWJA 4IZAA 4RIYB 4AW2A 3VUMA 3JPVA 4DN5A 1J7UA 1HOWA 3IKAA 4G1WA 4KS7A 3W2RA 2FSTX 3M1SA 2GDOA 5T3QA 5IZFA 4GIIA 2XCKA 3ZDIA 2OKRA 3WYXA 4B8LA 4FZFB 3H0YA 4DC2A 2XIZA 3G33A 3DK3A 3UP7A 5LOHA 2ZVAA 5J9LA 2X9FA 2YM4A 2VTQA 4F7SA 2CKOA 5A4EA 5J9ZA 2JC6A 4QQJA 1VLRA 4YURA 3MJ1A 4RSSA 5HICA 2OJGA 2YM8A 5M57A 3C4CA 2QOCA 3GC7A 3OMVA 4BWKA 3MH1A 1H26A 5AADA 3BHTA 4KB8A 2C47A 4R5SA 5TO8A 1REKA 4CXAA 5J5TA 1I44A 5LCKA 4CKRA 3RCJA 1PXLA 3EFWA 4ACCA 3OW4A 2CDZA 2YIYA 5KBRA 3QUDA 4K18A 1ZXEA 2E9PA 3E7OA 1I09A 1MP8A 4G9CA 4ONAA 2X8DA 2VGOA 3CC6A 3CP9A 3V04A 4ALUA 4IVAA 5J1WA 3LXPA 3A2CA 2W9FB 4W9XA 4JRNA 2CMWA 3R8VA 3DCVA 4X0MA 4FKIA 4OTWA 3VWAA 5AV3A 4UX9A 4BBMA 4O0VA 2EXEA 3ZXTA 3OCGA 2ITZA 4BCOA 4XG9A 4FVRA 4NFMA 3DGKA 2YCRA 3G2FA 5M08A 1ST0A 2W1ZA 5AUTA 1RW8A 3OCTA 3HA6A 4AX8A 3BHUA 3LFQA 2BRMA 4K9YA 4HPTE 2VUWA 4D2VA 4MXOA 3TACA 4DITA 3POZA 4PMTA 3PIZA 2GNFA 4LUEA 3DT1A 1SVEA 3EQFA 3BU6A 2ZOQA 4H1JA 5FBOA 3T9TA 2R5TA 2X8EA 4JJRA 4G3EA 1W2CA 4YTFA 3E8DA 5ETFA 4DGGA 4RZVA 3PFQA 2OJFE 2ITOA 4BGQA 4R5YA 3P7AA 2Y4PA 1U54A 4S32A 4OBQA 4O7RA 3UMWA 3GEQA 4DFBA 4AE9A 3E8EA 3BEGA 2YJSA 1Z9XA 3P79A 4FIEA 3TMOA 3VS6A 1ZZ2A 3F9NA 4ZSJA 4H1MA 2FSMX 4QQCA 4XV2A 1GAGA 1OIRA 5T68A 4YJSA 4DGNA 4O4DA 1PXJA 5AX9A 4RZWA 1OL7A 4AXCA 5DG5A 3MFUA 2B7AA 2PVMA 4XNEA 3RPYA 2VNYA 3P08A 4FSTA 4NW5A 4L9IA 3VUIA 2WTIA 3G9LX 3QX4A 3WF5A 3JY9A 2WOUA 2YJRA 2PZYA 3MA3A 5LWNA 3VONA 4ZS4A 2BFXA 2QO9A 3R73A 5DHJA 2WFYA 2X2LA 5CS6A 5CU4A 3UG2A 4GKHA 2WMRA 3O51A 3U51A 1T46A 1GZOA 5DBXA 4WNOA 2VZ6A 1Q62A 1TKIA 4OTQA 3Q96A 3R02A 4EBWA 3KULB 1YOJA 4RX5A 1V0BA 4E6QA 4O0XA 2XBJA 4OTIA 2A2AA 2H8HA 1CMKE 3OWLA 3VN9A 3VVHA 4ASZA 1RJBA 3EFJA 4GL9A 4B7TA 2GTMA 3RHKA 4AN9A 3E92A 1EH4A 3NW6A 2XIYA 4M12A 5CVHA 3ZU7A 1FBNA 3ZMMA 1H4LA 3W2CA 2VTOA 3TZ7A 2C3IB 4W8EA 3D2KA 5DT3A 3ORKA 5L2TA 2XRUA 1H0WA 2W06A 3T3UA 4ZMEA 1BX6A 4NZWB 4PPCA 5AP7A 2IW9A 3QU0A 5BUEA 3IDBA 1M2PA 3MA6A 4FTNA 5BVKA 5HQ0A 3FQSA 4WNMA 3UQCA 3BYUA 3AT4A 4B8MA 3AOXA 3EB0A 1OPJA 1W98A 3RNIA 4M0YA 5FTQA 2ZV8A 4AT4A 4C37A 3F3ZA 3LFNA 2QOBA 2Q0BA 1PMEA 3LFCA 4QEBA 2BTSA 3BU3A 5CVGA 4ZAUA 4IM3A 3GI3A 3DOGA 4QQ5A 3ROYA 4R1VA 3EJ1A 4I5HA 5D41A 2F2UA 4RVLA 3V5PA 4C8BA 3GCVA 1QCFA 4H36A 4V0GA 2PVLA 3A61A 1YXTA 5BX0A 2JIIA 2UW7A 2W05A 4IAFA 4O0YA 1AQ1A 2XEYA 4WKQA 4O7NA 4YZCA 3QYWA 5LWMA 3O23A 1UU9A 4O91A 3N4TA 1B39A 5IEXA 1IASA 3EN4A 2H9VA 5AP3A 2PVKA 4N6ZA 1KOBA 3LW0A 3WZKA 3HUBA 3GU7A 3EYHA 3KEXA 5FGKA 4PDPA 3OY1A 5FDXA 4AGCA 4NKAA 3GFEA 4HGEA 4EQMA 2JDOA 3QQFA 4D2PA 4AZEA 2BCJA 4Y5QA 5AUVA 4L3PA 4ZZNA 4YP8A 3PJ8A 5LMKC 3FPMA 5EQEA 3NFFB 3C13A 4JVGA 4F08A 5AR3A 2O8YA 1DM2A 1KWPA 5IQGA 2X7GA 3PA3A 4F64A 2GNLA 2CCHA 4I22A 4FV5A 3VUHA 3R1SA 3O8TA 4FSZA 3G0FA 3QD3A 5FG8A 5JZJA 4BB4A 4QMYA 2XAMA 4O4BB 4PNIA 3KB7A 4FEUA 4YMJA 4D1SA 2XYNA 2HENA 3GCUA 2P2IA 2PZPA 3OTVA 4I4FA 4BTMA 4LRKA 1Y91A 2WZJA 1WVYA 2OFUA 3U6JA 1M17A 1MQ4A 3OOMA 5E8XA 5LVMA 4Y72A 2PVJA 4FGRA 1ERKA 2X7OA 5L8JA 2QD9A 1CKIA 2NRUA 4NJDA 5C8MA 4HCTA 3UO4A 4MXAA 1T45A 2X2KA 2ZJWA 3PY1A 1H1SA 1LEWA 5EW9A 4OTGA 4EYMA 3CBLA 2WMSA 1PHKA 3TIYA 4LMNA 4MCVA 1KOAA 4IB5A 5GIPE 4JR3A 1PXNA 5HO7A 3LQ5A 4XP2A 4BDDA 4U79A 4XG3A 5AMNA 4D4YA 4P90A 3CTJA 4EHVA 3ANQA 1G8KA 3PJ1A 2Y4IC 4XBUA 5HG8A 4ZY5A 4YJOA 4EH2A 1KSWA 1Q3WA 4GG7A 4HCUA 3VS1A 3GBZA 2ITUA 2NO3A 3QQKA 3MYGA 5AUXA 3VF9A 5BVFA 3QTZA 4BTJA 4CVAA 5JMSA 5FXQA 4BY9E 5JRQA 1CTPE 2C3KA 3TM0A 2LGCA 1WBTA 3MVHA 3UODA 4R7IA 1PYXA 3D5XA 4EK5A 4EHZA 4PRJA 3ML1A 3O50A 5BVWA 3MB6A 3LJ2A 3EOCA 4PTCA 5HTIA 3WILA 3IONA 3N51A 3R01A 4C0TA 3TKHA 2IWIA 2C4GA 4FV6A 2PE0A 3RPOA 3A8WA 5FWKK 3SLSA 4FEQA 3UMXA 2QCSA 3DBDA 4GFMA 2P2HA 4O1OA 1GIJA 4C2WA 2Z02A 2JD5A 2NPQA 3CLYA 4CSVA 3FEGA 3W0QA 4GH2A 1R0PA 5L8LA 2IF8A 4D9UA 4E6CA 3PFYA 1OUKA 3G15A 4LDTA 1L3RE 4IX5A 4RVMA 3Q04A 4BIBA 3F3VA 4O0RA 1WVWA 1CKPA 1Q97A 5EHLA 4CFMA 1O6LA 5E8VA 3AGLA 2HK5A 4OR5A 4M69A 3RI1A 5KMJA 4HYSA 4GJ2A 4HNFA 3CEKA 3W0NA 3EWHA 1Y57A 2ETKA 4DEAA 3FZRA 2XJ2A 2IG7A 5AX3A 3IOKA 2QVSE 2W1CA 3C0GA 4EHGA 1DI8A 4KAOA 4FTKA 3JUHA 3FLSA 3LHJA 4FV4A 2BKKA 3E7VA 4PUZA 4EOLA 5JFWA 4YNOA 4FK6A 3V01A 2X0GA 4J8MA 1JKSA 4FKGA 5BYZA 2GQSA 4C4IA 2PZRA 3VULA 1ZYCA 4TNDA 4FSRA 5DT4A 3ZHPC 1A9UA 3UYSA 4F65A 2GNGA 4F9CA 3H4JA 3CSVA 1U54B 5CTPA 2B9FA 4AZFA 3PPKA 3E8CA 4UZHA 4EZ3A 3MGYA 5CANA 2A1AB 2FO0A 3NIZA 4BZOA 4GUBA 3MH0A 1W2DA 3BBTB 4FNZA 3RPRA 2UVYA 3C9WA 3G9NA 4HZRA 5F1ZA 3EN6A 4K2RA 3UE4A 4TYJA 5IH4A 5KX8A 2ETRA 5JKGA 5M53A 2XK6A 3OFMA 4JAJA 3KU2A 2XUUA 5KMMA 4BJJB 3NGAA 4BDKA 2PHKA 3BIZA 2AUHA 3ZLYA 2BIYA 2O5KA 2VO6A 3PP0A 4FKOA 5ACBC 3WF9A 3WYYA 4E4MA 3QQLA 5H2UA 3NCGA 3QTSA 4DH3A 3NUSA 4KKEA 3LFFA 3FYJX 3PXKA 3GOKA 4FG7A 1M7NA 2X81A 4IZ7A 3QA8A 1ZMWA 4FV0A 2RFDA 5CAQA 4EONA 3LKMA 3G90X 3LE6A 4V04A 1H8FA 2ITTA 3F7ZA 4FV3A 2W96B 4YTCA 2R3NA 4XJ0A 2YABA 4BZDA 2C30A 1UU3A 2VWZA 3GU5A 4NTTA 3PWYA 3E5AA 4EH8A 4I0TA 4W8DA 1Y6BA 4BICA 4CFNA 5AM7A 2PUPA 3F3TA 1BL6A 4IX6A 4C4EA 2BHHA 3ENHA 2WOTA 3KGAA 3QXPA 4I94A 3ZYAA 1NXKA 3QRIA 4QMSA 3ORTA 3D5UA 3EZVA 2VX0A 3KL8A 4FIJA 4FKVA 5CQWA 3OUNB 4L52A 4FTAA 3ZSHA 4DEIA 3QAME 5HX6A 2JDSA 1H24A 3TNQB 4UZDA 3GVUA 5HIBA 4EYJA 3DY7A 1O9UA 1W8CA 1URWA 4XHKB 3AKKA 5CEQA 4KSPA 3AC4A 2AQXA 3E63A 4FTMA 1OGYA 5LMAA 1PMNA 4IXPA 4DEBA 3BRBA 4GVJA 4CZUA 1G8SA 3R9HA 3W33A 4GK4A 1ZY4A 4C3RA 2BMCA 5KKRC 4BIDA 4I6FA 4G2FA 2C1AA 4S34A 2I0VA 5EG3A 4DEEA 2C5XA 4O0UA 2J51A 4CT2A 4ZJIA 2GNHA 2GU8A 5E9EA 4H3QA 3CY3A 2FYSA 3UIBA 1Q8TA 4FVPA 3C5IA 4FIFA 4XBRA 3KCKA 2W9ZB 4MQ1A 4XLVA 3V5JA 2REIA 2E9OA 2QKWB 2Z7RA 3P7CA 4UYAA 4Z16A 3RWPA 3ALNA 3FLYA 5IMXA 5HBHA 2XANA 2BILB 2OG8A 1E1VA 4WNKA 5C8KA 2CKEA 1J91A 2C1BA 1R0EA 3DJ7A 3D9VA 3HV6A 1HCKA 4K11A 3E87A 5EHOA 5B2KA 5G1XA 3DA6A 1NVQA 3NS9A 2WTKB 3KVXA 4FKLA 4FV9A 4NCTC 2HOGA 1Q5KA 1YDTE 4O2PA 5FQDC 5TE0A 1OL1A 4QTEA 4JDJA 4RIOA 5CSVA 3AD5A 2A4LA 4U0IA 5IH5A 4RIYA 3TV6A 4NH1A 4XV3A 5L6PA 3DDPA 3FY2A 3TUBA 2RSVA 2Y8OA 3T8OA 4YZNA 4ITHA 3DPKA 4LG4A 4E4NA 1FINA 3DB6A 3FQHA 4QP1A 1PY5A 4I6LA 3R7YA 3FXZA 4EH3A 3S95A 2VWBA 2QNJA 3BZ3A 3FI8A 5CF6A 5DN3A 2PVHA 4ZP5A 3L9MA 5IA5A 2HELA 3RAKA 3OF0A 1IRKA 3JYAA 4O6LA 3ZBFA 3CKWA 3QKKA 3LMGA 4ID7A 5EDPA 4BCIA 4BWXA 2ZM3A 3EQIA 1PJKA 2B1PA 4MBIA 1URCA 4M0ZA 5IPJA 4ZTRA 1H01A 2OXDA 4K33A 2RG6A 2IPXA 2OZOA 1NVSA 2UW5A 5I4NA 4G6NA 4AT3A 3NUUA 1Q4LA 3FMNA 3OVVA 4OTPA 3D7TB 3N9XA 5BUJA 4KWPA 4DCEA 1PF8A 2YDJA 2QOQA 2QOFA 2PPQA 4ITIA 5CAUA 4IAKA 4Q2AA 5BVEA 3UDZA 3KFAA 4AOIA 2O65A 3O8PA 3QQJA 4GW8A 3EYGA 4IAZA 3ULZA 3TV7A 5E7RA 3NUYA 3BU5A 4MVFA 3R7OA 2GFSA 3HRBA 1IA9A 1Q8ZA 4OT6A 5HE0A 3FZSA 4DDIA 4I92A 5KO1A 2RFEA 2UW3A 4PMMA 5C9CA 3AG9A 4IHPA 5LJJA 2CJMA 5AAGA 4RIXB 3A8XA 5AR5A 1PXIA 3SXRA 2E2BA 3V6RA 2QO7A 3AMAA 3HZTA 4BBFA 5IQBA 1KE9A 3NAXA 3DXQA 3R2BA 3HMOA 5AA9A 2I0HA 1Y6AA 4U42A 2ITPA 4IW0A 5IA4A 4ENYA 5E92A 5JFXA 3FQEA 1MQBA 2GTNA 5IQHA 1WVXA 1H1WA 4FGBA 4WHZA 3I7CA 4PQNA 5L4QA 3W18A 2YIRA 4YJRA 3A62A 2IVVA 5AR8A 2ITNA 5CEKA 4CLJA 3I6WA 1W7HA 5CI7A 4ZIMA 3UBDA 4O6EA 3EMGA 3MJ2A 1YQJA 5CEOA 5JFVA 3F82A 5CENA 5CEPA 4EOJA 4FTRA 3QZGA 5I0BA 4M97A 4Z9LA 1IG1A 2BR1A 3IO7A 4OTDA 4EZ5A 3ETAA 2UW6A 5JGAA 2VTHA 4LQMA 2JDRA 3FWQA 4BDCA 3I6UA 1ZAOA 5A3XA 2V7OA 4MNEB 3MTLA 5E90A 5HI2A 1APME 4ZY4A 1JLUE 2EB3A 3F88A 5DR9A 4CEGA 4YU2A 3SG9A 2VWWA 2R3HA 3PRFA 4BCHA 3F2RA 4FZ7A 1J3HA 1QPCA 4F6SA 4CFFA 3L1SA 4O4FA 3UPZA 2XM8A 4S33A 1P4FA 3S00A 4D4RA 3BE2A 3KULA 3PSCA 5D7AA 4O82A 4U45A 4HYHA 3VBQA 5DH3A 1GNGA 4LMUA 4NWMA 2XCHA 1RE8A 2F2CB 4CRLA 3UOHA 4ZY6A 3HUCA 3UC4A 3SGCA 2YEXA 2BDWA 3R1NA 2VTRA 4I20A 4J53A 2JIVA 2OXYA 4DFNA 4AQCA 2ZMDA 4OGRA 4DFLA 3L8PA 1OUYA 5ETIA 4JLCA 1OKWA 2OW3A 4N6YA 3RKBA 4QMQA 4B99A 4CQEA 5KMNA 4BR3A 4WD5A 2HWPA 3DU8A 2R7IA 4E5AX 1H25A 2HY81 2IJMA 3MPAA 3NLBA 4DF3A 3W0OA 5HX8A 3OXTA 3W8LA 3QGWA 3QTIA 4YC8A 2Q0NA 2P4IA 1E9HA 4WIHA 4IB1A 2VNWA 4I24A 3H9FA 2CHLA 3VBVA 3TZMA 4FEXA 4YJPA 3TYKA 3P86A 4YO6A 2BZJA 4M68A 3ZO1A 5GJDA 3RTPA 3ZC6A 4R7BA 5AAFA 4Z3VA 4I21A 4CLIA 5L2IA 2X39A 3I5NA 3QZIA 5CAPA 4LOOA 3LLTA 1HCLA 3OUKA 4PV0A 4I41A 3ZFMA 4D1ZA 4CCUA 3UIXA 4O21A 2W1FA 2WXVA 4D5KA 5JGBA 1TZDA 4J71A 5EOBA 1TFFA 3HYHA 3L9NA 4J1RA 3W10A 2QG7A 3C50A 2GS7A 4EKLA 3AC1A 2J0MB 3P5KA 4G3CA 3OXIA 4L00A 2YWVA 3P78A 3VQUA 4DYMA 2JGZA 5CVFA 5AP1A 1L8TA 4IEBA 3R8LA 2WEIA 3CXWA 5IU2A 3FLNC 5HZNA 2GNIA 4GMYA 2RF9A 1H00A 2PSQA 4HJOA 4FG9A 4E4XA 2UZUE 3LXLA 2PYWA 4MD9E 3MVLA 3OS3A 4JL9A 4R6VA 4C57A 5GJGA 4DG3E 4CZTA 3RPSA 5IUHA 3VS0A 2XRWA 2W4JA 3GFWA 4QYEA 4APPA 4EHEA 3COIA 2UZDA 4Q5EA 3FSFA 3OBGA 1OECA 3OWPA 4P2KA 3DTCA 4M13A 3UC3A 2R3MA 3EL8A 5DNRA 4RLKA 4E8AA 5LQFA 4LFIA 5I3OA 4KA3A 3MDYA 4EK8A 4LM5A 4N4SA 5H9BA 2IZUA 3SOCA 4USFA 2CNUA 3QYZA 5GNKA 4XOZA 5F95A 4LL0A 5HU3A 5AP0A 3SAYA 5KMKA 2E9VA 1DI9A 3ODYX 2YIXA 4TN6A 5IF1A 3VHKA 2I0EA 3FI2A 4AAAA 4I23A 3ZZWA 4D9TA 4DH1A 1H1PA 4F09A 5BVDA 4DT8A 4OTHA 4JBPA 2C5VA 3OBJA 4QP4A 3RAWA 4FZDB 1VJYA 2WO6A 4IE9A 3UOLA 4BC6A 2IZRA 5M07A 1OVEA 4AFEA 4ANMA 1PXKA 3AKLA 4O81A 4NIFB 2WD1A 3UIUA 4EH6A 1ATPE 1YOMA 2HW7A 5HORA 2J7TA 3QKLA 3Q5IA 2F7XE 3BYSA 3PRIA 1Q8WA 2OH4A 4LRJA 5IUGA 2QR7A 3ZRKA 3Q52A 1XH4A 2QQ7A 4A06A 4G5JA 3QRKA 5KCVA 2GNJA 2CNVA 1VR2A 2R3IA 3ORXA 1WCCA 1YXXA 3UVPA 4QOXA 2JAMA 2JKQA 2AEGA 4QTBA 1J1BA 4NM0A 2NP8A 5EW8A 2WQOA 4TYEA 4AGDA 4NKSA 1XQZA 3LM5A 2R3RA 4XEYA 2OFVA 5LVLA 3NUNA 4RT7A 3TJCA 4BDHA 4GFOA 2F9GA 5EYCA 5A6NA 4L42A 3RBWA 4A9RA 3O7LD 3SDJA 3BYVA 5FM2A 4OAVB 2KTYA 4P7EA 5IH6A 2RFSA 3COMA 2W17A 5FM3A 3A7GA 4WNPA 5DIAA 4FEWA 1OBDA 3QXOA 3UVQA 3GNIB 5F4NA 3QTRA 4YZBA 5CLPA 3TI1A 3DBFA 4ANQA 4FIIA 3Q6UA 4GEOA 4C62A 5LXMA 4HYUA 3SHEA 3EN5A 4AN3A 3EZRA 3Q53A 3QLGA 5F94A 5J95A 4QYHA 3FPQA 4Z7HA 2BFYA 2BIKB 4KRDA 4BKZA 2G2FA 1SVHA 2WMTA 3CQWA 4IX4A 4RG0A 2A0CX 3NW7A 2UUEA 4ZLYA 4B4LA 3ZTXA 1V0OA 2VO3A 4KBCA 4QP3A 3HEGA 3NIEA 5AP2A 3MW1A 4BTFA 2F49A 5CZHA 5CF8A 3QD0A 1SZMA 1XKKA 2F7EE 3HVCA 4KIKB 4U80A 4IFGA 4KBKA 3ZDUA 4P4CA 4IC7A 4J99A 4O86A 3LJ1A 4ZTHA 3TEIA 3ZLWA 4DFXE 3Q2JA 5DR6A 3BLRA 4BCMA 1TVOA 5D7VA 4D28A 5I9ZA 4AQKA 4YNEA 1Q24A 4O7YA 2Y4IB 5CSHA 5J5SA 3AMBA 5E91A 3BKBA 2I0YA 5I5ZA 2ONLC 3KXNA 3DAJA 2W0JA 3KQ7A 3EL7A 2I7QA 4QRCA 4TZRA 3VC4A 4XV9A 4D5HA 3KN6A 4RWIA 1W2FA 3NWWA 5DEWA 3MY0A 3FV8A 4R3RA 4JQ7A 2OWBA 3KRJA 4BDBA 2OIBA 5M4CA 4IQ6A 4BJJA 4J8NA 5ANEA 5B0XA 5H8EA 4KABA 5CAOA