5AP1A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
268
Chain Sequence
b'FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVVKDVGVNYMPPEAIKDMSSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 268
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap1A01
2FVDA 5J87A 3ZSGA 4DTKA 3CY3A 5GIPE 1YI6A 2OF2A 4OTQA 3QC4A 4Q9SA 1BLXA 5HNIX 5M55A 5DVRA 3QRJA 4UWCA 5AR2A 1OBGA 3NS9A 4ZOGA 3BLRA 1Y8YA 3ORNA 4XMOA 3OUKA 4RZVA 1TQPA 3KRRA 4FTKA 3DKFA 3HDNA 3ZTXA 3R04A 4MWHA 2YN8A 4ANMA 3LMIA 1LEWA 3NUNA 4AZSA 2F7ZE 4QQCA 2EXMA 3KREA 4V04A 4BICA 4E3CA 1MRYA 3N4TA 3NVMB 1YI3A 3WZJA 3TKIA 3ZRKA 1FGKA 3CJGA 5AR7A 2PYWA 2X9EA 4G6NA 4XP0A 4RFMA 3Q52A 3ZS5A 2BTSA 4WBBB 1YXTA 3AT2A 2G2IA 2I0EA 4KBCA 4FT9A 2EVAA 3MSSA 4TYHA 4LUDA 3BYOA 2WELA 5FBOA 3CBLA 4BDCA 3WZUA 4M0YA 5HLNA 3A8WA 5CQWA 4M67A 2XB7A 4QP1A 3THBA 5L6PA 5M51A 4ORKA 2WMAA 3COKA 3QHRA 3UVQA 4A07A 5J1VA 3PTGA 1MQ4A 2G2FA 1PF8A 3MI9A 2PVJA 3QQJA 1CKJA 4L8MA 3MH2A 4I4EA 4DEBA 4U42A 3NNUA 4KB8A 3BPRA 2W1GA 1Q41A 5DHJA 2ITTA 4OTDA 3T9IA 4C3FA 5BUIA 4CG9A 1OKWA 4O27B 1O6LA 2OF4A 5ETFA 3VS0A 5L3AA 1H1RA 4CFFA 1A48A 2WU6A 2I7QA 3PZEA 4J96A 3A7FA 2PWLA 3BU6A 4PV0A 2W1EA 4FEVA 2OXYA 3TV7A 2PUNA 3MW1A 5B0XA 3VBWA 4MK0A 4FYOA 4FKPA 4M14A 4R5SA 3LCOA 3TV4A 3RCJA 5L6OA 4AZTA 5D9HA 3CLYA 4N6ZA 3PLAE 3H4JA 4NKSA 3G0FA 3LE6A 4O22A 4RIWA 1PXIA 2GPHA 3LQ5A 1XWSA 4M13A 4S34A 3U87A 2WXVA 4AP7A 5LQFA 4OR5A 4G3GA 1V1KA 2CGWA 3UIMA 3KFAA 2RG5A 3QF9A 3QQLA 2VUWA 1PYEA 4W8DA 3VRYA 2BFYA 4PP7A 4LQMA 4K9YA 5A6OA 4FSWA 4QRCA 4D1ZA 3QRTA 3RAKA 4FIEA 3BX5A 3QCSA 5M4FA 4D2RA 2QD9A 3EQBA 2HIWA 2IVSA 4FGBA 4EOJA 5CXHA 3FXZA 4UBAA 2BPMA 3QQGA 2F7EE 2V7AA 3DJ7A 5E8YA 4E6CA 1MRUA 4UB7A 2VU3A 3BWFA 5HTIA 4GFMA 1YXUA 2GNGA 5CAQA 4FYNA 2CKPA 4NTSA 5M56A 3UVRA 1H07A 3ACJA 1LEZA 3DB6A 3EFWA 3OMVA 3E7OA 3EFJA 4EUUA 1H24A 2CNUA 3AD6A 1DI8A 3O17A 1R1WA 1JQHA 4EORA 2XVDA 3HUBA 3KN6A 1Y6AA 2YERA 1J1BA 4GYGA 5IA5A 3QLFA 2EUFB 2BDFA 4WG5A 2PVFA 2OICA 4K1BA 4JDKA 4ASDA 2XNMA 4GU6A 2YCSA 1YXSA 3MA6A 1FINA 4QTDA 3GCUA 2XK7A 3QXPA 4CQGA 4QTEA 3DLZA 2WOTA 4FKIA 2ITXA 3D4QA 2UW9A 4MNFA 1X8BA 2C1AA 4OT6A 4NW5A 3R7OA 3EN4A 4I1ZA 2PZIA 3PVWA 1P4OA 4O7VA 2XIRA 4D0WA 3TL8A 4CZYB 4ANSA 5AP1A 3QHWA 5ICPA 3ZM9A 5AP5A 5KBQA 5FP6A 4ANLA 3OWLA 3QUDA 3TDWA 3MJ2A 1KUTA 4F1OA 4AFEA 3LLTA 2R3HA 2HXLA 2Z60A 1H8FA 5EG3A 3WYYA 5I9VA 3MY5A 4AWIA 5D7AA 4QNYA 4BTJA 5C03A 2WMQA 3JVSA 3ID6C 2V22A 1UKHA 5EOBA 4J99A 4EZ3A 5AV0A 3BCEA 4PTGA 3PE1A 3TG1A 4G2FA 4OBPA 4QP4A 2OH0E 3BGPA 4XV9A 2F4JA 3W2CA 2I0HA 4A06A 4DCEA 4OAVB 2WMBA 3E8EA 3OXIA 5FD2A 3SOCA 5M4UA 1ZYCA 1U5RA 3R00A 1IASA 3B8QA 5DT3A 3AT3A 2W1ZA 3KKVA 3A8XA 5EI2A 3ZUVA 4BDIA 4E73A 4XV3A 4EUTA 2X0GA 4E4NA 5DI1A 5EHOA 3ODYX 2W1IA 4QQ5A 4RVKA 3V8TA 1JKTA 1UVRA 4IW0A 4ACHA 3QCXA 4CCBA 3MDYA 4RT7A 4F6UA 3IK3A 4BVUA 3IS5A 4FSYA 1CTPE 2X2KA 1TQIA 1CM8A 5HI2A 2H8HA 2WQOA 1RJBA 4L67A 4NKAA 3ZFMA 4APPA 2WTCA 3QCYA 4OTHA 4R3CA 4DG3E 1H1PA 4DGMA 4DEEA 4FV7A 4BGGA 5AUTA 3CPBA 3Q3BA 2JDRA 3QKMA 1SM2A 3IONA 4IFGA 4NEUA 5AP3A 4F63A 5BMSA 4O7YA 5LWMA 2IG7A 4FOCA 4NZWB 1JSUA 2SRCA 4PNIA 4AT5A 4GIHA 5F1ZA 4KBAA 4FV3A 4TYEA 3W2PA 5EYDA 4J1RA 5FM2A 4ZZMA 1V0BA 4YJUA 5CSHA 5BVEA 3PWDA 3UGCA 1H27A 3KU2A 5E8SA 1ZWSA 1ZZ2A 4P5QA 2RFSA 3IOKA 2XK8A 4UMRA 4K11A 3GBZA 4ZTHA 4YZBA 3ZH8A 1VEBA 3UQFA 5KMLA 1PXOA 4EH4A 4KABA 1OKVA 4J7BA 1CMKE 3F2RA 4X3FB 2QURA 4RJ4A 2YWVA 3BEAA 2X6DA 4NFMA 3V04A 3MFTA 2CKOA 3COHA 4XHKB 3OD6X 5CNNA 3ORMA 5TO8A 4O7RA 4C3PA 2YIRA 3F5PA 4LGDA 3NEWA 3BZ3A 3R6XA 1U54B 3KB7A 3NRMA 4IAFA 5IMEA 3WIGA 4IWDA 4NCTC 4H1MA 4CZUA 2BCJA 3O50A 2GNHA 3TZMA 1WBNA 4K8AA 2ONLA 2V62A 2FA2A 3D5UA 3F7WA 3POOA 3W2SA 3ZXTA 3G9LX 4ENYA 3QA8A 5EI8A 4Q9ZA 3HLLA 2BKKA 4YR8A 3PJ2A 4GT4A 1DI9A 2ZV7A 3ATSA 5L2IA 4TYJA 4RC2A 3JVRA 5EW3A 2WQMA 3R7IA 1P4FA 2V5QA 3K5VA 1XO2B 3OWJA 4BF2A 2PMIA 3ULIA 5I9WA 2A27A 4WRSA 3H9RA 3TIYA 3UTOA 1S9JA 5BVKA 3CD8A 3FZSA 2XEZA 3MS9A 3OW4A 3NUUA 1QPCA 4GH2A 4AT4A 3FI3A 5I5ZA 5FG8A 3IW5A 4M12A 3P7CA 5BVDA 4QNAA 4EOIA 3V8WA 1L8TA 2XRUA 3AXWA 3EL8A 4O7WA 4I6QA 4AA5A 5CU0A 3PSCA 2WTKB 4Q2AA 3U51A 3HAMA 3OBJA 3UVPA 5DBXA 2UVYA 2RIOA 4RLLA 2YCQA 3D7ZA 3GU6A 4MD7E 3RWPA 3MH0A 4CMTA 4D5HA 4BCMA 4F0IA 5BVWA 4HZSA 5CT7A 2XK3A 3DFCB 2GNIA 1RDQE 3BBWA 1M14A 5I0BA 1H1QA 4BCPA 3F2NA 4AOTA 4HPTE 1WBWA 2QONA 4LGGA 2R3PA 4KUJA 3GQLA 4OTWA 4BN1A 1ZZLA 2VZ6A 3G9NA 3GC0A 2WTJA 4F0GA 1MRVA 4EJ7A 3K5UA 4MXZA 4ZTMA 3QTWA 3BBTB 2QR8A 4BIEA 4W4YA 4FTOA 4FKQA 4I6FA 4U3YA 4C2WA 3DOGA 4FT3A 3F61A 3FC2A 4OT5A 4FV1A 4EHVA 4EWQA 3R21A 5HLPA 1Z57A 4FTTA 5IUHA 2JEDA 4Z7GA 4O84A 4MBJA 3FE3A 4ALUA 2J5EA 3ZLYA 3UP7A 3PE2A 1YXVA 4U41A 4G3FA 1Q8YA 2ZB0A 4FVRA 4LM5A 4HPUE 4QT1A 4DH3A 4F9WA 3AC4A 4AF3A 3CR0A 4KIKA 2C6TA 4D5KA 4FIGA 3LMGA 4XV2A 1JVPP 2E2BA 2R3JA 4J52A 5CU2A 4R7BA 1OB3A 4X2FA 5HHWA 1Y6BA 4BWKA 2J9MA 2JBPA 4EH7A 5A9UA 5KMOA 1W98A 5AADA 3S2PA 2YWPA 2X7OA 4CV9A 4YZ9A 3QCQA 5KZ0A 5AP4A 3BE2A 4D2VA 4K18A 2GQGA 5LVLA 3NWWA 4FVQA 2XYNA 4ZSGA 2J7TA 4UMTA 5BYYA 4C59A 5KX8A 3RZFA 1K9AA 2BZHB 4OTGA 4BCQA 4ERKA 4ZK5A 4CFUA 3FLSA 3WARA 3BLQA 3VS7A 3VBQA 2UZEA 5HZNA 4KINA 4KD1A 5K9IA 2H34A 4X3JA 2JDVA 5DGZA 5FWKK 1IRKA 3MY0A 4GFGA 3L8SA 5HNGA 4O0RA 1Q3DA 3QD2B 5ANEA 5IQGA 3ZMMA 3ITZA 1V0PA 5GNKA 3QQUA 2Z7SA 3DXNA 3FZTA 3LCTA 4F1MA 3M42A 4FC0A 4TWCA 3UIXA 4Y8DA 3DZOA 2R2PA 2PY3A 3DBEA 4FT7A 5L2TA 2Y4PA 2PE1A 4H39A 3KL8A 4U7ZA 5HG9A 3LXLA 4Z9LA 4NT4A 5HIDA 1XBCA 1NXKA 2X2MA 2WZJA 3PP1A 1IG1A 4BDJA 1E9HA 5A4CA 1ZXEA 3LZBA 4KKGA 3EOCA 3PXZA 4WO5A 3S1HA 3F3WA 5FDXA 1KSWA 2PUPA 1E1VA 5E91A 3KY2A 3GGFA 4F9AA 4FOBA 2R7IA 4IAAA 2X81A 2Z7LA 4PF4A 4ENXA 3FLNC 4J98A 1L3RE 1OUKA 2W1DA 2OFUA 2ZDTA 4D9UA 4IANA 3LCDA 4QMZA 3QA0A 4WIHA 4OTIA 4G5PA 5HOAA 2QHNA 4AOIA 3TWJA 5H8EA 5LXMA 1TKIA 3BQCA 2R9SA 3FLWA 4S30A 3R8LA 5HVYA 2UV2A 2XCHA 3SRVA 3Q2JA 4IEBA 4PMTA 3RINA 4ALWA 4FIJA 3ZLSA 4RG0A 4XP2A 4XLIA 4GJ3A 2DQ7X 2IZSA 1U54A 5LMAA 1ZYDA 2DWBA 3GENA 5EKOA 2GFSA 4KWPA 2BRHA 2O3PA 4AZWA 2J6MA 3IW6A 1OI9A 2UZWE 4GRBA 3BU5A 2JFLA 4FV8A 3V5JA 4AGCA 3DAJA 3UJGA 3BRBA 3CJFA 1OMWA 4EZ7A 5CF6A 3FYJX 1F3MC 3FDNA 4H58A 4KRCA 2W05A 2WMSA 1YI4A 4I23A 3F5UA 4BCKA 3ULZA 3V5WA 2QNJA 5KE0A 2QOQA 3VW6A 1JWHA 5JN2A 5GJGA 3SAYA 4CYIA 4IX6A 3NSZA 2WQBA 3KN5A 3Q6WA 2R3LA 3JS2A 4C35A 5K4JA 4X2KA 4XG4A 4JOAA 5EH0A 5HG8A 4FGRA 1F5QA 5IQEA 1UU9A 3V3VA 4AZFA 1FPUA 2FSTX 3R63A 4N57A 2ITWA 3MPMA 1P14A 5HU9A 3MPTA 3VHEA 3M1SA 4AW0A 2ITPA 3H9FA 4K2RA 2PMOX 2NRUA 5EW8A 2X7GA 2C5XA 2ETRA 4JS8A 3C0IA 3OCTA 2XEYA 3QD4A 4MF1A 5AV3A 5FXSA 3I81A 5IPJA 3HGKA 3HZTA 4DH1A 1XH8A 2BRBA 3KVWA 3AD4A 3RAWA 2BAQA 2OJ9A 3ZXZA 2UW8A 3SG8A 3LFBA 3WZEA 2C6MA 3EQIA 4CFNA 3RPOA 2F2UA 2OIQA 3HRBA 4AZEA 5HX8A 3C4XA 3LM5A 2CMWA 3LXPA 5AX3A 3V8SA 1QPDA 2I6LA 2R3KA 4L3LA 4XJ0A 2HXQA 3QXOA 3HMOA 4AW2A 3W8QA 3AC8A 5AAEA 4BCHA 4BCIA 2GMXA 4L53A 4N4SA 4YZCA 4BDGA 2PULA 1PYXA 3MV5A 3FMJA 3IKAA 2PVHA 4I6HA 3OC1A 5LMBA 4OTRA 4YC8A 4CSVA 4ITHA 4CKIA 2ZV2A 2QCSA 4MX9A 3UPXA 4F9CA 4ZSAA 5KNJA 5ANJA 4CG8A 4AGUA 3UIUA 3DK3A 4GL9A 4NJDA 3RHKA 4QTBA 1UU8A 1R39A 3R1SA 2BILB 2QU6A 3T9TA 1H1SA 2W06A 4C4HA 4E93A 4FZFB 4FEWA 4R7IA 3ORTA 3UC4A 5EQEA 5ETIA 4C37A 4P90A 4MQ2A 4EH3A 5M4CA 2G01A 5EDPA 5C4KA 2C6IA 4IM0A 3K3IA 3NNXA 5HTBA 2QG5A 4XRLA 4WUNA 3VS2A 2P2IA 3U55A 2BIKB 5I4NA 4JDJA 4DH8A 4MD8E 1J7IA 3IQ7A 4L00A 2XNOA 3QQHA 4FNYA 4IADA 4NU1A 5TT7A 4WSYA 3TDVA 2F2CB 4GG7A 3RI1A 3GOPA 4G9CA 4E6AA 3OHTA 2CCHA 3KVXA 4IB5A 4X6QC 3ZO1A 5FXQA 3F3UA 4JX3A 3P0MA 1W82A 2R0IA 3VJOA 3KEXA 1H0VA 4X2JA 4DCAA 3EQGA 3F2AA 3U9NA 4ZTQA 3DFAA 3IG7A 3VC4A 1KE5A 3AGLA 3UYTA 2XA4A 2WPAA 3LFSA 1W84A 4JIAA 2PZYA 5J7HA 4O7ZA 4YJPA 5JQ8A 2JD5A 4FSMA 4L43A 3V5QA 5G6VA 1HOWA 4I0TA 1LUFA 4AT3A 2WKMA 5AX9A 3A7GA 3MH3A 1WZYA 4AOJA 2XNEA 4C8BA 4I3ZA 4C7TA 4EK6A 5C1QB 4CGAA 2O0UA 3S0OA 2YACA 4XRJA 2GSFA 1KE8A 4DH7A 1A9UA 3DDPA 5AM7A 5IF1A 5FTGA 4BDHA 4JRNA 4QP7A 4O0VA 3VW8A 4CXAA 2WTKC 3FYKX 4DFUA 2YA9A 1OGUA 4FEUA 3NYVA 3D94A 2VX1A 2ERKA 2W5AA 2LGCA 5HU3A 4YJSA 4MXCA 4PWNA 4DTBA 2JIUA 3EN7A 3C4CA 4DINA 4PPCA 3FHRA 4CT2A 4Z55A 3W55A 3R9RA 3LCSA 3QC9A 3ZEPA 4C3RA 3HMIA 2HYYA 3R1QA 4M97A 1UU3A 3R73A 4CYJA 3NW5A 3ZDUA 4ANBA 3BHVA 1QPEA 2REIA 3QTSA 5DG5A 5CSPA 5J1WA 5I9UA 5J9YA 5K4IA 4M68A 5H8BA 2C0IA 4RJ5A 5KHXA 3OXTA 1FVRA 5JH6A 3BV3A 4L3PA 4QTCA 4TRLA 1LPUA 3B8RA 4Y72A 4B8MA 4A4XA 4L42A 4ZMEA 5KMKA 3DDQA 3SVVA 3UG2A 4AE9A 3QTXA 1REKA 1JOWB 2CCIA 2QG7A 4M0ZA 4ZS4A 3AMYA 3HDMA 1DAWA 3CE3A 3NCZA 4D4VA 3WIKA 5CASA 5EYMA 2BKZA 3HL7A 4K77A 3LVPA 4JBVA 3W16A 1OL6A 3DQWA 4C61A 5FRIA 1M2RA 4RIYB 4NH1A 2F7XE 2F9GA 4R1YA 4ACGA 1OZ1A 2PPQA 1Q5KA 4O1OA 2WU7A 4WD5A 5CSWA 4O7NA 3BKBA 3T8OA 2XS0A 4UALA 3MFSA 3PXYA 1IAHA 1UA2A 1T46A 5HICA 4GVAA 2W17A 1XKKA 4O2PA 4BL1A 5ANGA 4BIDA 2OG8A 3DPKA 1GOLA 4U79A 3ZBXA 1H4LA 4O81A 5EM7A 1AGWA 1J91A 2PVMA 5EM6A 4ZZOA 1JNKA 3PUPA 3PDTA 4QP9A 5H3QA 5AR8A 3IW7A 4Y85A 2YAKA 4L01A 2XBJA 3O51A 1CSNA 2W1CA 3KXNA 2ZV8A 1Q8ZA 3RZBA 3SXRA 2BAKA 3KRJA 4FIIA 2EU9A 1K3AA 1YDTE 3OP5A 4OLIA 3FY2A 4BWPA 4UV0A 1FMKA 1PJKA 2ZDUA 3V01A 2QHMA 5EI6A 4EI4A 4CCUA 2QODA 1UV5A 3E62A 3I5NA 3OT8A 3OTVA 4ZZNA 3QD0A 3JPVA 5J9LA 2C6OA 5HE1A 4BZOA 2P33A 1M7QA 3QRKA 4S2ZA 4BHNA 4C38A 2CSNA 4AGWA 2OI4X 3O7LB 1A06A 4LMUA 1YXXA 5J79A 2UW4A 5GHVA 3AC3A 4D1SA 4DT8A 3LLAA 5FLFA 4BI1A 3B2WA 3DY7A 4YPSA 3QX4A 2ZJWA 1YQJA 3PP0A 5G1XA 4BZNA 4IC8A 1H1WA 5E1SA 4GFOA 4PTCA 3F5GA 3BI6A 3EQHA 3MYGA 3P7AA 3PXFA 4F1TA 4NYEA 3WI6A 3NCGA 3KF7A 4O96A 2HY0A 1KV2A 3NDMA 5BYLA 5HG5A 2B7AA 3DLSA 3QFVA 4DG2E 4JT3A 5LMKC 2AYPA 3UG1A 1GIHA 3F3ZA 4P4CA 4UXQA 3RBWA 4A4LA 5DN3A 3ANRA 5IA4A 4YBJA 5C01A 5CAPA 2RSVA 3OT3A 4I21A 3WF9A 4B0GA 2DYLA 2PMNX 3PIYA 2O5KA 3HRCA 3E92A 1H0WA 4DYMA 5IDPA 1WBPA 3C9WA 4HCVA 3A4PA 4RWIA 4G31A 2ITNA 5HE2A 4C34A 4DEGA 4F7NA 3TKUA 5KHWA 3Q4UA 3PVGA 3CS9A 4QMXA 4O7SA 1ZYLA 3UOHA 3P5KA 2FB8A 3QLGA 2VTPA 2HCKA 2J90A 4U40A 3L8VA 5B2LA 3ZRMA 3WF8A 3MIYA 5HBEA 4UEUA 5AP2A 3TUDA 1YOLA 3Q04A 4EYJA 4HVHA 5CQUA 2VTRA 4HNIA 2YCRA 4M69B 3GFWA 3ORXA 4FTLA 2BZIB 3MBLA 3UMWA 2FSOX 3KULA 3ORPA 3RCDA 5IISA 4P5ZA 1XBAA 2A19B 2YZLA 4TZRA 5ITAA 3DJ6A 3I7BA 1WMKA 3QTIA 4NW6A 5K0XA 5IQDA 4MYGA 2Z2WA 3LFEA 3B2TA 5AV4A 3DXPA 1EH4A 5CU6A 4NSTA 4YHTA 4B4LA 2QC6A 2GQRA 1WFCA 4FL3A 3OCBA 1YRPA 3EZVA 3F66A 4JBOA 2R4BA 4BBMA 4FSNA 1IA9A 3PJ3A 3NX8A 2C3JA 3KMUA 5CU3A 3MWUA 5FGKA 3R02A 1VZOA 1XBBA 4PDOA 5DT4A 2OLCA 4BCGA 3BHTA 1BKXA 4DAWA 3BE9A 3RALA 4JL9A 2X7FA 4RA4A 4I41A 2R3GA 5DFPA 2A2AA 5JZNA 5L8JA 2VWUA 1XH7A 2ZVAA 2C5OA 2GS7A 3GOKA 4MCVA 4DG0E 3CQUA 2OXDA 1OL2A 1XH6A 2VNWA 5LARA 3ZC6A 3C4WA 4JDIA 1NVSA 3SKCA 4BI0A 5DYJA 3TNPC 3SW4A 1YDSE 1ATPE 1P5EA 2PVYA 3OWPA 5BX0A 1H25A 4O0WA 2YISA 2UZOA 2J4ZA 2J5FA 2WMRA 3CTJA 3HX4A 4BYIA 4IHPA 5AUWA 2C3LA 4NCTA 3FLQA 3DTCA 4C36A 3CXWA 4AZVA 4YJRA 1OKZA 4PMPA 4ZJIA 4C58A 3W18A 2XK4A 4F6WA 4IX5A 4IWQA 4KIQA 2ITYA 3LQ8A 3PZHA 4KSQA 3W10A 2VTOA 4XNEA 5BVFA 5LCJA 1IEPA 5IH5A 4E4XA 3VS4A 1YHVA 2R3NA 4X7QA 4ASZA 2VWZA 2QU5A 1ZLTA 3QRIA 3ACKA 2JKOA 3FMHA 3H9OA 3Q2MA 4BCFA 3FPMA 3PLSA 1TVOA 4XBRA 1REJA 3E87A 3I4BA 1GZKA 5EW9A 3E5AA 1YHSA 3G90X 1GAGA 2WTDA 2I1MA 1UU7A 1PRYA 4RPVA 4U45A 4FE2A 3LMHA 4N6YA 3KRLA 4EJNA 4FEXA 3TUCA 3C13A 5DOSA 3MJ1A 2V0DA 4HYUA 4FKSA 2Q0BA 4D4YA 4EQMA 1I44A 3ALOA 3WF7A 3KGAA 4BY9E 5EM8A 2UVZA 5DIAA 1Z5MA 4PL4A 3F69A 3E64A 5CENA 5JK3A 4PMMA 3FI8A 1WVWA 3C1XA 3ELJA 4NM0A 4L6QA 4BTFA 1XH5A 4DGGA 4ZJVA 4HVGA 2WMUA 3VWAA 2X1NA 5EDRA 3SC1A 2VWYA 1JKSA 4J8NA 4S33A 1E1XA 4KSPA 4WUAA 3MVJA 1T45A 4I4FA 4TT7A 5C4LA 4EH2A 3L9PA 3V5PA 3GEQA 5K0KA 3F6XA 4YJNA 4CFVA 1XQZA 2JKMA 4MAOA 3R8PA 3RNYA 4L46A 4EKLA 3QKLA 3CC6A 2EXEA 2VTTA 4IQ6A 2EB2A 4QMQA 3OW3A 5ACBC 1WBOA 2PL0A 2EB3A 3AC2A 3R8ZA 3RJCA 4BDEA 5HLWA 3VUGA 1G3NA 2VTNA 3COIA 3N51A 3QYWA 4FL2A 2LAVA 1SNXA 3SG9A 3DBCA 2E9OA 4EEVA 1ZARA 2CKEA 2FSLX 2YM7A 5IH6A 5CVGA 2XKFA 3BEGA 3VUHA 3ZC5A 2VGOA 4Y83A 2PVKA 4ZS0A 3AMAA 5E8TA 4UMPA 2WTVA 5BPYA 3EQPA 3FZ1A 2FUMA 5AR4A 4BR3A 4DGNA 3MB7A 4FODA 4IACA 3NAYA 2W9ZB 4OBQA 3ROCA 3U8WA 5IA2A 3SA0A 3LCKA 3UO4A 3SLSA 5KKRC 3BU3A 4FTUA 1WCCA 3E63A 4YPDA 3EQCA 4FV0A 3MTLA 4UYAA 2VGPA 4FV9A 4ZTRA 4AA0A 5KUPA 4YJOA 3DKOA 4BKYA 1BI7A 2X8IA 3A7JA 3HV3A 4FG7A 2XYUA 4OTFA 4HVDA 3O7LD 5C9CA 4BDKA 4RQKA 4TWNA 4XOYA 3WOWA 3HRFA 4CRSA 1FOTA 3NIZA 4IM2A 2QLUA 4RVTA 5FM3A 4EK4A 3KCKA 5L2QA 2OU7A 3O23A 4FX3A 5AUZA 4MNEB 4BGQA 4QMVA 3OFMA 1DAYA 1PXMA 4V0GB 4QQTA 3FZPA 3HA8A 4FIHA 2E9NA 4GMYA 5IQCA 4TYGA 3R01A 4XG8A 3VNTA 3PJ8A 4EOKA 1MQBA 3C4EA 1CDKA 2C5YA 3NUPA 4BBEA 4DE4A 2BDWA 2G1TA 2QOIA 4KNBA 4L3JA 2HZIA 3GCPA 2WFYA 4U44A 3C4FA 1KE7A 1R78A 2FSMX 3FZRA 4IVAA 3UPZA 3D5XA 5L4QA 2KULA 3KXMA 2XKDA 5HESA 5TE0A 3AMBA 4ZAUA 5BVNA 4A9TA 4HNFA 2GTMA 2HWOA 2UVXA 4PMSA 4XH6A 3U6HA 4KIOA 3OUNB 4FZ7A 4QTAA 2QOKA 5M4IA 2W4KA 3ZFYA 2E9PA 3TZ7A 3F82A 4QMUA 3A99A 4F0FA 4G1WA 2HK5A 1GZOA 2WEIA 4U43A 3I6WA 4YZDA 3EFKA 1Q24A 2IJMA 3C7QA 5CU4A 5KMJA 5M57A 5M06A 2BRGA 4IZYA 4H05A 2GNJA 4ZTLA 2XH5A 5HBHA 4ASEA 3FC1X 4QMYA 3KQ7A 4DEIA 3OOMA 4JG7A 1FGIA 1TQMA 4F65A 1Q62A 1WBTA 3JXWA 3JYAA 4WNMA 3FL4A 4TYIA 2X6EA 4DHFA 4O0XA 4UWBA 2EWAA 3OZ6A 4RIOA 2YLFA 1PKGA 4IZ5A 2QOFA 2YIXA 2W7XA 4U3ZA 5JFWA 5L8LA 4FV6A 1RQQA 4HYSA 3QQFA 4MKCA 3UOLA 4FF8A 3OY1A 5JT2A 4FR4A 5CZIA 3UBDA 3MVLA 5CYIA 4D4SA 1GY3A 2GCDA 3UQGA 4EBWA 2OZAB 2EXCX 5AFVA 3FZOA 4WHZA 3FUPA 3OBGA 4XUFA 5EFQA 5JRSA 4E26A 2VTAA 5HO7A 2HENA 4W4WA 3Q4TA 5EYKA 4AFJA 2F57A 4MXXA 4U5JA 2W4JA 3EIDA 3QL8A 4W9WA 4KRDA 4NIFB 4EC8A 4UX9A 2ITZA 2P4IA 3PIZA 3PIXA 3Q4ZA 5IZFA 2OGVA 5AV1A 4FL1A 2R7BA 3P78A 3TEIA 3E3BX 3LHJA 4WOVA 4MBLA 3EKKA 4OBOA 2IW9A 5IA3A 1U5QA 2BRNA 2PE0A 1GIJA 3GVUA 3V6SA 4CFMA 4U81A 3GQIA 3FXXA 2JKKA 4DLIA 2CLQA 4IIRA 3TJCA 3FAAA 4A9YA 4YTIA 3PXKA 4RC3A 2VWWA 4O83A 5F95A 3FV8A 3W8LA 3P4KA 2XM9A 2CJMA 3EB0A 5TR6A 1UWJA 3IECA 3TV6A 4RC4A 1OIUA 2XJ0A 4USDA 2PU8A 3R7GA 1DM2A 2XJ2A 4OW8A 3TI1A 4L7FA 4WNOA 2YHVA 3RM6A 4D2SA 1RW8A 2CGVA 4JX7A 3QUEA 4I0RA 4DEAA 3H0ZA 3MPAA 4YU2A 1QL6A 4D2PA 3Q9ZA 5JRQA 3IPHA 4U80A 4EHGA 3BHHA 4ZY6A 4DN5A 2GS6A 3R7EA 3FI4A 2VO7A 1PXJA 2C69A 3AT4A 3IDBA 1B39A 4FKWA 4JNWA 3UDBA 4AN2A 2CDZA 4HCUA 4G3DA 5AP7A 4FTRA 2JGZA 4TW9A 3TM0A 3POZA 3LFCA 4DITA 2YJRA 3DGKA 2XRWA 3R30A 1J7LA 3K2LA 4FSQA 4FV2A 4IDVA 4YHJA 2YFXA 3LFQA 4TXCA 3TIZA 3ZHPC 4PNKA 3R1NA 4LI5A 3K3JA 4V05A 4X3FA 4RLKA 3L9MA 3MFUA 3A2CA 2GHGA 4LRKA 5CS6A 3Q6UA 1XHAA 2Z8CA 4BHZA 5A4LA 4C4GA 5CEKA 3E7VA 2R64A 5LVPA 2CNVA 4DA5A 4QMSA 1PMUA 3VS1A 2XNBA 4IB3A 4O0SA 3FEGA 3REPA 3PPZA 3JY9A 2QI8A 2JKQA 1W8CA 4JR7A 4O6EA 4QYYA 3ZFXA 5CAOA 3HMPA 4GK4A 5CI6A 5HQ0A 4EK8A 1BUHA 1XH4A 1Y91A 4IE9A 4B8LA 1GJOA 5D11A 3VUIA 3F5XA 4FNWA 4YJTA 3EYGA 4FSZA 1ZYSA 2ETMA 3A7IA 4ZEGA 3E3PA 4H3QA 4WG3A 4YLJA 2OSCA 3PG3A 1R0EA 5L2WA 3QTRA 4G34A 2X4FA 2VNYA 4PY1A 4QO9A 4II5A 2CHLA 4U6RA 4LL0A 4V0GA 4QP2A 4ERWA 4YMJA 3H3CA 3FJQE 2G9XA 1KE6A 3BIZA 4CNHA 4APCA 3M2WA 3P08A 3PXQA 2IPXA 3S3IA 2ESMA 1URWA 2OJIA 2WB8A 4FV4A 3ZM4A 4E5AX 4FTIA 3OCGA 4CLJA 3RK5A 1R0PA 3L1SA 3WZDA 5I3RA 3QGWA 2R3OA 5HCYA 3JY0A 3OCSA 3LKMA 4QYGA 2RF9A 3ZCLA 3L9NA 1I09A 4IWOA 4G6OA 4XG9A 3R9DA 4XBUA 2Q83A 5IQBA 2V7OA 2XIXA 4EH5A 2BUJA 5B2KA 4P7EA 3HV5A 4PQNA 2JLDA 1SYKA 2GHMA 3LJ2A 1JKKA 1ZOGA 4O38A 1ZY5A 2QO9A 3K54A 4LOQA 4AAAA 1Q8UA 5E8VA 5EOLA 3VS3A 4CD0A 3PY3A 4E6QA 3DT1A 3FQSA 2PUIA 1Q8TA 1JLUE 4E4MA 5AUUA 3ZOSA 4JRVA 5AIKA 4JG8A 2UZVA 4I22A 3IDPA 1STCE 3CPCA 4FKGA 3KC3A 3FI2A 3PJCA 4W4XA 5IKWA 3UZPA 3BLHA 1NY3A 3QGYA 4R3PA 4GYIA 5JFXA 3UC3A 2C6DA 2VWXA 2X8DA 3EKNA 4MBIA 4L7SA 3M11A 3KXHA 4E5BA 1BMKA 1YW2A 3D7TB 4B9DA 4Q5HA 1OPLA 5EYCA 5E7RA 4ALVA 4FZAB 4LOOA 4TNBA 5B2MA 2QLQA 1NVRA 5CAUA 1UNLA 2JC6A 2VTJA 4RRVA 4RIXB 1XR1A 3QZGA 3O8PA 3S00A 2JAMA 2C30A 4WKQA 5J8IA 3H30A 4BC6A 5EQPA 4BKJA 5CALA 5F94A 2PTKA 2C5NA 5FP5A 2Y7JA 4KIPA 4XEYA 4TNDA 4XYFA 4B6LA 5IA1A 1W0XC 3R8MA 4GK3A 4CEGA 4H3BA 2GU8A 3QALE 5I9YA 2YM8A 4JVGA 1OIRA 4QD6A 4WA9A 1YVJA 5H2UA 3LOKA 1YWNA 4EH8A 3CCNA 2Y6OA 3KCFA 5BQ0A 3LJ1A 5IUGA 3RPYA 5E8WA 3GC9A 5LWNA 3PYYA 4RVLA 4EYMA 2O64A 1KWPA 4JI9A 2BHEA 2CPKE 3C5UA 3O71A 3NUYA 4HCTA 4BCNA 4RJ3A 1M7NA 4EH9A 3V5LA 2X4ZA 4JDHA 3Q9YA 1APME 3UYSA 5M08A 4FA2A 1JSVA 5E8UA 3EMGA 4RSSA 4YZMA 4BDBA 4D1XA 3LXKA 2R3IA 4NJ3A 3RM7A 4CFXA 5GJDA 4L44A 4ACMA 2BAJA 4EOPA 1PXKA 2ACXA 2IZUA 1FVVA 5TKDA 1OPKA 2XIZA 4UYNA 5KBRA 4FV5A 3SQQA 3WBLA 3WZKA 4FSUA 2UW0A 2JDSA 5A4TA 5AUVA 3CTHA 4M3QA 4RX8A 4CVAA 1JAMA 3WILA 5CTPA 5CX9A 2JDTA 5K3YA 4S31A 5DWRA 2O2UA 5E92A 2GDOA 2GNLA 5AAGA 4C0TA 3UNZA 3OWKA 2CNQA 1NA7A 4R7HA 3SDJA 1Y57A 4IVBA 2NNWB 4PDYA 1OPJA 2KTYA 4LOPA 4KS7A 2C3KA 5HE3A 2BALA 4I5CA 4DFZE 4AN9A 4ZLZA 3I1AA 4QMPA 2W5HA 3FPQA 3W33A 4D58A 3ZZEA 2BVAA 1W7HA 4YBKA 3GCSA 4G17A 4USFA 3WE4A 2Y8OA 2WMXA 3VBVA 3II5A 1FMOE 1KOAA 4YTCA 4FK3A 5DR9A 4X0MA 4G9RA 4FKOA 5AM6A 4K6ZA 4KKEA 3TACA 1XH9A 4BB4A 3EN5A 3MN3A 3D5WA 4ZSLA 2XKCA 2GNFA 4AG8A 1Q8WA 5HIEA 4HYIA 3TTJA 4W8EA 3JR1A 2VO6A 3OXZA 1OVEA 3AD5A 4HGTA 5DPVA 4FKTA 3WE8A 2OKRA 3ZSHA 4C4JA 4ZTSA 2O63A 3SXFA 3E88A 1OBDA 4BGHA 2RFNA 4DGLC 5KKRB 3O0GA 4DBNA 5CI7A 2HW6A 5ETCA 2VTQA 3VBYA 1BX6A 3QZFA 4DBXA 3AC1A 4M66A 3HV6A 5HORA 4ZSJA 5LVNA 3PPKA 4EOMA 2W1HA 5CEIA 2YJSA 2ZB1A 2OBJA 3KMWA 4U0IA 4PDPA 4U8ZA 4FMQA 4ACDA 4EHEA 4MEDA 1PMNA 3R2YA 4IDTA 3P9JA 4F99A 5CEQA 2BHHA 4XCUA 4E6DA 5JSMA 1SVHA 2HAKA 5C27A 3IGOA 3RAIA 2JDOA 5F4NA 3VQHA 4RJ7A 4RWLA 4UN0C 2RFEA 5CVFA 4ZY5A 4OTPA 2HZ4A 3S4QA 3DJ5A 2XNNA 5D12A 2YDJA 3ZLXA 4F08A 1SNUA 1GNGA 3GT8A 3BHYA 1GZNA 1SMHA 3DAEA 3DK6A 2H9VA 4Y5HA 1J3HA 2X8EA 1GIIA 3BYMA 2OXXA 4PRJA 5L8KA 3BYUA 2WQEA 4F6SA 2J50A 4CLIA 3U4UA 4RQVA 4IJPA 4AW5A 1ZOEA 4BIBA 4C4EA 5HEZA 1DS5A 3PVUA 4I5PA 4AACA 3V51A 2W5BA 3RHXA 2P55A 4R78A 4QOXA 4IC7A 4LRMA 4LG4A 3NIEA 2UW5A 1UNGA 4RWJA 3LFFA 5AMNA 3ORKA 4JG6A 4F64A 3NNWA 5CEOA 3Q53A 2VO0A 1Z9XA 4WT6A 2GS2A 4RIXA 4IB1A 3A60A 2WTIA 3DB8A 1YWRA 4MD9E 5AUYA 3S95A 2Q0NA 1IAJA 2H6DA 5E9EA 3ALNA 3D5VA 3R7YA 2QOOA 3FMEA 4PL3A 5BYZA 3QKKA 3ZO3A 2WIPA 2QOHA 2XK9A 3ORIA 4ZIMA 4DH5A 4R6VA 3C5IA 4ZLYA 4Y5QA 1PHKA 4BCJA 3C0HA 4QMOA 5ANOA 2IZRA 4HGSA 2W9FB 1V0OA 4MQ1A 2XKEA 2VTIA 4PUZA 4HGLA 3NUAA 4L45A 3ZEWA 2IN6A 4PPAA 5IMXA 3OEZA 4FK6A 3G6HA 3FMNA 5DR6A 2Y6MA 2HWPA 4G16A 3DBQA 3SHEA 2E9UA 5IG1A 4H3PA 1ZY4A 1JSTA 3EN6A 4XG6A 3T3VA 3TNQB 3VBXA 4G5JA 4F7JA 3GU5A 5FTQA 4YLLA 5EQYA 5FBNC 4NWMA 4FEQA 2WHBA 4FKLA 4Y73A 4KKHA 3BELA 5ANDA 2UZUE 4MXYA 4J97A 3FMKA 4EK5A 5BUEA 4NUSA 1NT2A 3I5ZA 3NR9A 3CD3A 4MXAA 4QYHA 5A6NA 1U4DA 4MTAA 2UW6A 2YM3A 4CRLA 2FO0A 2WIHA 3LFDA 4Z7HA 1QPJA 2WNTA 2HOGA 4EOQA 4CKJA 5TF9A 5JQ5A 3ZUTA 5CSVA 2JFMA 2VTHA 2YZAA 4IMYA 3D83A 3I79A 5A3XA 3TZ9A 4LV5A 2R3MA 4ANNA 2R0UA 4HVSA 2CGXA 5FXRA 1Y8GA 3I7CA 4ZMFA 5AAFA 4C4IA 3ATTA 4YJQA 1ZMWA 3E8CA 4FG9A 4EC9A 3FY0A 5AR3A 2VAGA 3GXLA 3R9OA 4E20A 3CQEA 4Z16A 5HTCA 4BFMA 4PL5A 2DS1A 3PA4A 3UODA 3ZONA 3TNIA 5IU2A 4HGEA 3W2RA 5HIBA 3SXSA 4BCOA 2ZOQA 2VN9A 3GCQA 2VWIA 5CANA 1H01A 5IQFA 5H8GA 3CP9A 4TTHB 3U54A 1XJDA 5IUIA 3HP2A 2ZM4A 3KRXA 5JZJA 3CKXA 2B54A 3KK8A 3R83A 4O86A 4RWKA 1OIQA 4EKKA 1JKLA 4DFYA 4FI1A 3ZBFA 3RKBA 3C51A 1LP4A 3AOXA 2B52A 1PXPA 2BROA 3LM0A 4J71A 4TPTA 4E1ZA 3GU4A 4AN3A 3F7ZA 1M2PA 2B53A 3PA3A 4FKJA 1WBVA 4QPMA 3CQWA 2B9IA 1PW2A 2XK6A 2A1AB 4YGAA 3RK7A 4F9BA 3RWQA 5C8KA 5L2SA 2W4OA 4K33A 2QOBA 4RIYA 3DCVA 3VF9A 1IA8A 5BUJA 5FUTA 3UOJA 2UZLA 2WTWA 3QZIA 5M09A 4LRJA 4R1VA 3NVKI 5F9EA 1ERKA 4ID7A 3DQXA 4YZNA 1ZOHA 4O1PA 3DNDA 4EOLA 4GIIA 1HCKA 5E90A 4IBMA 3ZUUA 3ENMA 2HY81 3AG9A 1VYZA 4YC3A 4I5MA 2Y9QA 3OY3A 4H36A 4GUEA 4I5HA 2BIYA 5HG7A 4DLJA 5GZ8A 3UQCA 4OGRA 2XUUA 5FTOA 3QYZA 2A0CX 5E4HA 4JBQA 4QP6A 3NUSA 5AP6A 1NW1A 3E93A 2OIBA 1GZ8A 5A14A 4HW7A 2ZMDA 3CY2A 3FMLA 4D2TA 4R3RA 1ND4A 3FKLA 3ZO4A 3R71A 4FT5A 1BYGA 4I94A 2Z02A 3H0YA 4GS6A 4GUBA 4ONAA 5D10A 3RPRA 3DAKA 3QZHA 2RKUA 4O7TA 4D55A 3GU8A 4AU8A 2QVSE 1ZMVA 4EQUA 3LAUA 4KIKB 5KMNA 3O8UA 3BYSA 4IX4A 5HX6A 2VTLA 4EHZA 3HEGA 4MF0A 3UE4A 4C4FA 2BDJA 5D1JA 1QCFA 3GCVA 3GB2A 4FICA 3WF6A 4DFNA 3Q32A 4ZY4A 2YLEA 1FBNA 2QKRA 1HCLA 3VUDA 2G15A 1OL7A 4QPAA 3WYXA 1H26A 4YUQA 4FNXA 2GHLA 3DV3A 3ZYAA 4XOZA 4IAZA 3ERKA 3OG7A 4GT5A 4CMOA 4FIFA 2HZ0A 1U46A 3HYHA 4FZ6A 5EM5A 4CZTA 3MTFA 3GFEA 4XLVA 1W83A 3AQVA 3QUPA 5HKMA 4DGOA 5IH4A 3U6IA 4E7WA 3P1AA 2IW8A 4DT9A 4NM5A 2ETKA 3BHUA 3QD3A 3W2OA 4XG3A 4YSMA 2UZNA 2B4SB 4PDSA 5BMMA 3R7VA 5HCXA 4EQCA 4NTTA 3GNIB 2PZRA 1AQ1A 2OJGA 2PZPA 4IX3A 3VULA 4QMNA 4BWXA 4F70A 4IM3A 3N4VA 2QQ7A 4IJ9A 3FQEA 1YDRE 3V5TA 5C26A 4CKRA 3MB6A 3MVHA 4O0TA 3Q5ZA 2BTRA 3VIDA 4S32A 3G2FA 3SW7A 1YWVA 5T68A 4QYFA 4MHAA 4EL9A 2J0IA 3DS6A 3FSKA 3ZRLA 3LIJA 5DEWA 2ITVA 4L52A 3A4OX 5CWZA 3R7UA 4TY1A 3F3VA 4EWHA 5DLSA 4V01A 4R5YA 3Q60A 3PA5A 5HVJA 1P2AA 2CN8A 3VUTA 3CGFA 4MH7A 1OIYA 5LCKA 2Y4IC 3PXRA 4RFZA 3N4UA 4XP3A 1BL7A 3DK7A 3DZQA 2CGUA 2WO6A 2J0MB 2C1BA 3VBTA 1U59A 5DRBA 1URCA 2OZOA 4CTBA 3SGCA 4A7CA 1G8SA 4DEHA 2XM8A 3UP2A 2VWVA 3ODZX 5AA9A 1WAKA 4FTQA 5GJFA 3SRVB 1OECA 3W2QA 3BYVA 3QBNA 3EWHA 1PKDA 2H96A 1Q99A 3TCPA 5KMIA 3CTQA 3L8PA 4UMQA 2XNGA 4U97A 4IAYA 1JBPE 3LFNA 3TJDA 4M69A 4UY9A 3BQRA 5C8NA 2ZMCA 3C50A 3MA3A 4M15A 3OTUA 3FLYA 2XP2A 5AV2A 2IVVA 3DXQA 1PY5A 3L9LA 4GEOA 3KK9A 4J8MA 4L68A 4FTMA 3NPCA 1RE8A 4TWOA 4IZAA 2VV9A 3VS5A 3VVHA 5JGDA 5CAVA 4NFNA 2HELA 3HV4A 5KO1A 3MH1A 3TKHA 4UMUA 5AUXA 5A46A 4I20A 2C4GA 3PVBA 3LFAA 4IH8A 3W32A 4ZLOA 4GG5A 4RBLA 4PPBA 4BI2A 4WBOA 4ZXTA 1LR4A 3QTQA 5EHYA 5CT0A 5BVOA 4WSQA 4QP3A 5HE0A 4LYNA 3GC7A 4F7LA 2XMYA 3QTZA 1G8AA 4TKSA 3PFQA 4C33A 4D2WA 2OW3A 3E8NA 3HVCA 3HUCA 4AW1A 5LJJA 4PP9A 2J0KA 3IW4A 2P0CA 3EL7A 4L9IA 4UZDA 5HGIA 3BV2A 3VQUA 3DKCA 2WMTA 4WNPA 4ZP5A 4BYJA 4J95A 5D7VA 5AWMA 2B9HA 3RAHA 2I40A 2VTMA 4GJ2A 2ITUA 5DA3A 4YSJA 4O82A 2CN5A 3NUXA 1ZRZA 4JR3A 4U9AA 3GI3A 3DBDA 4H1JA 4JAIA 3DKGA 1MP8A 2WMVA 3QWKA 3TZ8A 2YEXA 4B7TA 4AA4A 2C6LA 1ZMUA 4IVCA 4AX8A 3VS6A 1KE9A 3TUBA 1BI8A 2NPQA 1PMVA 2O8YA 3PY1A 5KCVA 2ERZE 2YAAA 2PVRA 5CEMA 1ZAOA 3CIKA 1K2PA 2W0JA 4O21A 5JGBA 5J9ZA 2JBOA 3SX9A 3D9VA 4HYHA 5HO6A 2GFCA 4MWIA 1KOBA 2OK1A 3NW6A 3Q9WA 4USEA 2RG6A 3H10A 3VN9A 2PZ5A 4X2GA 5ACKA 4BTMA 2Z7QA 2RL5A 3CKWA 4GKIA 4G6LA 4D0XA 1WVYA 2FYSA 5JFVA 1YOJA 3MIAA 2XZSA 2BZKB 1JPAA 2JAVA 4XX9A 3TXOA 3G33A 4YTHA 4TWPA 2AUHA 3HMMA 1CKIA 3I0QA 3D14A 1M52A 2UZTA 4FTJA 3ENHA 4G3CA 4CFWA 1KV1A 1WBSA 4A9UA 4CMUA 4LFIA 5J95A 2OWBA 4RX5A 2CKQA 4RFYA 5JFSA 3JUHA 2PVNA 3DU8A 2VX0A 4XS2A 5FDPA 5IQAA 5L6WL 2I0VA 4DFBA 5BNJA 3EHAA 2YITA 1OITA 3EQFA 2WAJA 3FHIA 5E8ZA 5CXZA 5M07A 3Q96A 4EOOA 4M8TA 5FEQA 2ONLC 2PE2A 2OO8X 2UUEA 3TTIA 3DNEA 2NO3A 3Q4CA 1OUYA 3A61A 2AC5A 1FQ1B 3IW8A 4QMTA 3RPSA 4TN6A 4FSRA 4QMMA 4RMZA 4FT0A 3I60A 3TNHA 4BBFA 3NAXA 1O9UA 2R3RA 4FKUA 4MVFA 4ZTNA 2XJ1A 4KAOA 4WNKA 4E4LA 3D0EA 5B7VA 3ZDIA 5CF8A 1M17A 5HD4A 4ITIA 3MY1A 3SV0A 3U6JA 4A9RA 3PJ1A 1H08A 3PG1A 3UIBA 3ZZWA 4FZDB 4Y46A 3WF5A 2GQSA 2P3GX 3OF0A 1CKPA 3G0EA 3SOAA 5CSXA 4EONA 4O0YA 3EH9A 4HZRA 4F9YA 5IQHA 4F4PA 3KXGA 3P86A 3QX2A 4A9SA 3RGFA 2O65A 4JXFA 3ROYA 2B55A 4FBXA 2QOCA 5EDQA 3ZO2A 3UNKA 3HV7A 3VHKA 1YHWA 4W4VA 2PHKA 2XIYA 4P2KA 4QP8A 2UW7A 5EK7A 4E8AA 2PSQA 2YM5A 5IA0A 4EBVA 5J5TA 5FQDC 3NW7A 4UZHA 5ETAA 3VAPA 4BTKA 5M53A 5EKNA 3G15A 3FMMA 1BL6A 5CLPA 2OJFE 5DT0A 1PXNA 1WVXA 2E9VA 2VWBA 3CEKA 4O2ZA 3I0OA 3NGAA 4MNEA 4FTNA 4RA5A 5E1EA 4AXAA 4EOSA 4ANOA 4YP8A 3EQRA 4JAJA 3ZSIA 4KA3A 3DA6A 2JITA 5HCZA 3EJ1A 1YKRA 2PVLA 3GC8A 4FUXA 2B1PA 3LJ0A 3UZTA 3KA0A 2I0YA 5LVMA 4NL0A 2C68A 4YNOA 2WOUA 2HZNA 1QMZA 2BR1A 2BRMA 5E8XA 3UZRA 3F3TA 3TT0A 3R1YA 4N0SA 4ANQA 3V6RA 3ZU7A 3QTUA 4Y95A 2JIIA 4QQJA 5ANIA 5IQIA 4XG7A 2AC3A 3GU7A 1O6KA 2J0JA 3P23A 3PY0A 4GV1A 3HNGA 2ZM3A 3ORZA 4FTAA 4IAIA 5HD7A 5AIRA 5AJQA 3R9HA 5I3OA 2A4LA 3LPBA 4X2NA 4ITJA 2ZYBA 4JLCA 4GK2A 4DC2A 3GUBA 3G6GA 1NVQA 3IO7A 2XNPA 3N9XA 4JQEA 5LOHA 4C02A 2ZM1A 1IR3A 5DNRA 3BGZA 2CLXA 3RNIA 4AE6A 1OL1A 3NMUF 4BZDA 3RPVA 5K5XA 4N70A 3HECA 4FKVA 3KXXA 4RVMA 4CTCA 4I6BA 1VJYA 3D2IA 4C2VA 4CT1A 2OIDA 3EN9A 2HW7A 3VRZA 4BRXA 4TL0A 4RGJA 3PPJA 3R0TA 3R9NA 4GCJA 2YM6A 4YO4A 3PSBA 4LMNA 1Q61A 2YIQA 2ITOA 3COMA 4K0YA 1VR2A 2XIKA 3BGQA 3ORLA 4UWYA 5TOZA 3OEFX 4GU9A 4DTAA 4I0SA 3I6UA 2W1FA 3OVVA 2V55A 5T3QA 4I93A 1O6YA 5A54A 3OOGA 2VD5A 4C57A 3O2MA 1SVEA 4YC6A 1J7UA 2NRYA 4M7IA 5HVKA 2OZAA 3EZRA 4O0UA 2RFDA 4CQEA 3FMDA 2BFXA 3L8XA 2VX3A 3PRIA 2RGPA 5AP0A 4O6LA 4C62A 2X2LA 2B0QA 4NIFA 3ET7A 4YHFA 2X39A 2UW3A 4JQ7A 4NM3A 4UXLA 4ZJJA 3VF8A 2Z7RA 4KS8A 3A62A 3UOKA 3VJNA 1H00A 2G2HA 3T3UA 1UWHA 2IWIA 4JJRA 5KZIA 5M44A 2OH4A 2B9JA 5LVOA 4X3FC 5IEXA 2C0TA 5K5NA 2FH9A 2J2IB 4A4OA 3C0GA 4AQCA 3BWJA 3D15A 3RP9A 4R8QA 5H9BA 4JBPA 3RVGA 3KRWA 4YNEA 2VTSA 2WD1A 4WRGA 5DE2A 3VUMA 3D2KA 4BKZA 4QPSA 4F7SA 4XG2A 1R3CA 3KXZA 5EHLA 4BDDA 3IDCA 3O96A 4TYHB 4IAKA 4XV1A 4M84A 3NNVA 3HP5A 3PWYA 4ACCA 3TN8A 4PX6A 5I9ZA 5CF4A 3MGYA 3TNWA 3ETAA 4JIKA 2C47A 4Z3VA 3MFRA 2YM4A 5DRDA 4DFLA 5HO8A 3F88A 3CGOA 3FKOA 3E8DA 3VO3A 3VUKA 2UZDA 4D28A 5IEVA 3DBFA 3UNJA 5IDNA 1PMEA 3EYHA 3U9CA 4FG8A 4LUEA 2QO2A 4FUYA 5CNOA 4OUCA 4YTFA 3FBVA 2WEVA 3FLZA 3FSFA 5JGAA 5C8MA 4IZ7A 4Q5EA 3LQ3A 5FEDA 1G5SA 3HMNA 4YURA 2VRXA 4LGHA 1UNHA 3KMMA 3R22A 4CV8A 4G3EA 4E5WA 5DMZA 4RX9A 5AA8A 3FKNA 3F9NA 4DFXE 2QKWB 2NP8A 3LXNA 4GSBA 5FEEA 2C0OA 4IWPA 4X21A 2ZV9A 2IVUA 2YABA 3EFLA 3FQHA 4RIWB 1ZYJA 5J7BA 1H28A 5I9XA 4RJ8A 3AC5A 3KULB 4NM7A 4EH6A 5GINE 3QRUA 2J51A 4RZWA 3IOPA 4QMWA 2J0LA 2C3IB 2WGJA 4J53A 4QYEA 3IGGA 5LMKA 4OAUC 4D9TA 2WQNA 3NYOA 1SZMA 2R3QA 4IVDA 5T6KA 1AD5A 2YIWA 3DTWA 5ANKA 3R2BA 3U4WA 2C6EA 1UKIA 4W9XA 3G51A 3QAME 3KF4A 3R8UA 5GZAA 5CZHA 3OROA 1PXLA 4ARKA 4FVPA 2IZTA 3A7HA 2R5TA 3R28A 2BZJA 3GP0A 4GVJA 4O91A 3HAVA 3G5DA 2ITQA 2Y4IB 4QMLA 2OJJA 2GTNA 1OL5A 4FSTA 1J1CA 2R3FA 4IFCA 5J5SA 4B99A 4HVIA 3RK9A 4GKHA 2BMCA 2DUVA 2YIYA 3AGMA 4FKRA 2ZAZA 1OKYA 4LV8A 3NYXA 4HOKA 4YLKA 4EK3A 1OM1A 3RMFA 1Q3WA 2B9FA 3Q9XA 2XBAA 4IB0A 4X6RA 5JKGA 3EQDA 5HNBA 4LL5A 3NLBA 1F0QA 2PUUA 1VYWA 3C4ZA 5A4QA 4RX7A 5JMSA 2XCKA 5CEPA 4ASXA 3UO6A 4BDAA 2QO7A 2QR7A 2IO6A 3PRFA 4WG4A 3UMXA 4FNZA 4GW8A 5A4EA 3O8TA 1B38A 2PK9A 1S9IA 3NYNA 4I92A 2F49A 4KBKA 4IXPA 3MVMA 4PTEA 5CVHA 5CY3A 3ZLWA 2VO3A 2X9FA 2YCFA 4AGDA 3SD0A 5DR2A 3P7BA 2W99B 5JEBA 2P2HA 2W96B 5IEYA 2Y0AA 2C6KA 4JQ8A 5F20A 3R8VA 5KMMA 5HBJA 3FXWA 5DH3A 3CSVA 4MXOA 3W1FA 1SVGA 4I24A 1FVTA 2XF0A 3D7TA 4F09A 5CF5A 4DEDA 1Q97A 4O7LA 2WMWA 3Q5IA 4DF3A 2QOLA 3PSDA 4R77A 3MESA 2UZBA 3HKOA 2IVTA 4NK9A 4ZSEA 5AR5A 4BDFA 3HA6A 4HJOA 2JIVA 3QWJA 5GZ9A 2YDKA 3NZ0A 3FL5A 3OS3A 4GT3A 4YO6A 1MUOA 3ANQA 4D4RA 5GIOE 4RJ6A 3QU0A 2YDIA 3UO5A 2C5VA 4YJVA 4EZ5A 1M2QA 5DEYA 4AS0A 4AUAA 1Q4LA 3QQKA 2PMLX 5D41A 3LW0A 3RTPA 2IW6A 4FTCA 1YOMA 3P79A 2OFVA 5AEPA 1B6CB 3FWQA 2FGIA
chains in the Genus database with same CATH superfamily
2FVDA 3UDZA 5J87A 3ZSGA 4DTKA 3CY3A 5GIPE 1YI6A 2OF2A 4OTQA 3QC4A 4Q9SA 1BLXA 5HNIX 5M55A 3KIOC 5DVRA 3QRJA 4UWCA 5AR2A 1OBGA 3NS9A 4ZOGA 3BLRA 1Y8YA 3ORNA 4XMOA 3OUKA 4RZVA 1TQPA 3KRRA 4FTKA 3DKFA 3HDNA 3ZTXA 3R04A 4MWHA 2YN8A 4ANMA 3LMIA 1LEWA 3NUNA 4AZSA 3BLAA 2F7ZE 4QQCA 2EXMA 3KREA 4V04A 4BICA 4E3CA 1MRYA 3N4TA 3NVMB 1YI3A 3WZJA 3TKIA 3ZRKA 1FGKA 3CJGA 5AR7A 2PYWA 2X9EA 4G6NA 4XP0A 4RFMA 3Q52A 3ZS5A 2BTSA 4WBBB 1YXTA 3AT2A 2G2IA 3W0NA 2I0EA 4KBCA 4FT9A 2EVAA 3MSSA 4TYHA 4LUDA 3BYOA 2WELA 5FBOA 3CBLA 4BDCA 3WZUA 4M0YA 5HLNA 3A8WA 5CQWA 4M67A 2XB7A 4QP1A 3THBA 5L6PA 5M51A 4ORKA 2WMAA 3COKA 3QHRA 3UVQA 4A07A 5J1VA 3PTGA 1MQ4A 2G2FA 1PF8A 3MI9A 2PVJA 3QQJA 1CKJA 4L8MA 3MH2A 4I4EA 4DEBA 4U42A 3NNUA 4KB8A 3BPRA 2W1GA 1Q41A 5DHJA 2ITTA 4OTDA 3T9IA 4C3FA 5BUIA 4CG9A 1OKWA 4O27B 1O6LA 2OF4A 5ETFA 3VS0A 5L3AA 1H1RA 4CFFA 1A48A 2WU6A 2I7QA 3PZEA 4J96A 3A7FA 2PWLA 3BU6A 4PV0A 2W1EA 4FEVA 2OXYA 3TV7A 2PUNA 3MW1A 5B0XA 3VBWA 4MK0A 4FYOA 4FKPA 4M14A 4R5SA 3LCOA 3TV4A 3RCJA 5L6OA 4AZTA 5D9HA 3CLYA 4N6ZA 3PLAE 3H4JA 4NKSA 3G0FA 3LE6A 4O22A 4RIWA 1PXIA 2GPHA 3LQ5A 1XWSA 4M13A 4S34A 3U87A 2WXVA 4AP7A 5LQFA 4OR5A 4G3GA 1V1KA 2CGWA 3UIMA 3KFAA 2RG5A 3QF9A 3QQLA 2VUWA 1PYEA 4W8DA 3VRYA 2BFYA 4PP7A 4LQMA 4K9YA 5A6OA 4FSWA 4QRCA 4D1ZA 3QRTA 3RAKA 4FIEA 3BX5A 3QCSA 5M4FA 4D2RA 2QD9A 3EQBA 2HIWA 2IVSA 4FGBA 4EOJA 5CXHA 3FXZA 4UBAA 2BPMA 3QQGA 2F7EE 2V7AA 3DJ7A 5E8YA 4E6CA 1MRUA 4UB7A 2VU3A 3BWFA 5HTIA 4GFMA 1YXUA 2GNGA 5CAQA 4FYNA 2CKPA 4NTSA 5M56A 3UVRA 1H07A 3ACJA 1LEZA 3DB6A 3EFWA 3OMVA 3E7OA 3EFJA 4EUUA 1H24A 2CNUA 3AD6A 1DI8A 3O17A 1R1WA 2XALA 1JQHA 4EORA 2XVDA 3HUBA 3KN6A 1Y6AA 2YERA 1J1BA 4GYGA 5IA5A 3QLFA 2EUFB 2BDFA 4WG5A 2PVFA 2OICA 4K1BA 4JDKA 4ASDA 2XNMA 4GU6A 2YCSA 1YXSA 3MA6A 1FINA 4QTDA 3GCUA 2XK7A 3PUFC 3QXPA 4CQGA 4QTEA 3DLZA 2WOTA 4FKIA 2ITXA 3D4QA 2UW9A 4MNFA 1X8BA 2C1AA 4OT6A 4NW5A 3R7OA 3EN4A 4I1ZA 2PZIA 3PVWA 1P4OA 4O7VA 3UDSA 2XIRA 4D0WA 3TL8A 4CZYB 4ANSA 5AP1A 3QHWA 5ICPA 3ZM9A 5AP5A 5KBQA 5FP6A 4ANLA 3OWLA 3QUDA 3TDWA 3MJ2A 1KUTA 4F1OA 4AFEA 3LLTA 2R3HA 2HXLA 2Z60A 1H8FA 5EG3A 3WYYA 5I9VA 3MY5A 4AWIA 5D7AA 4QNYA 4BTJA 5C03A 2WMQA 3JVSA 3ID6C 2V22A 1UKHA 5EOBA 4J99A 4EZ3A 5AV0A 3BCEA 4PTGA 3PE1A 3TG1A 4G2FA 4OBPA 4QP4A 2OH0E 3BGPA 4XV9A 2F4JA 3W2CA 2I0HA 4A06A 4DCEA 4OAVB 2WMBA 3E8EA 3OXIA 5FD2A 3SOCA 5M4UA 1ZYCA 1U5RA 3R00A 4AXCA 1IASA 3B8QA 5DT3A 3AT3A 2W1ZA 3KKVA 3A8XA 5EI2A 3ZUVA 4BDIA 4E73A 4XV3A 4EUTA 2X0GA 4E4NA 5DI1A 5EHOA 3ODYX 2W1IA 4QQ5A 4RVKA 3V8TA 3AKLA 1JKTA 1UVRA 4IW0A 4ACHA 3QCXA 4CCBA 3MDYA 4RT7A 4F6UA 3IK3A 4BVUA 3IS5A 4FSYA 1CTPE 2X2KA 1TQIA 1CM8A 5HI2A 2H8HA 2WQOA 1RJBA 4L67A 4NKAA 3ZFMA 4APPA 2WTCA 3QCYA 4OTHA 4R3CA 4DG3E 1H1PA 4DGMA 4DEEA 4FV7A 4BGGA 5AUTA 3CPBA 3Q3BA 2JDRA 3QKMA 1SM2A 4FRFA 3IONA 4IFGA 4NEUA 5AP3A 4F63A 5BMSA 4O7YA 5LWMA 2IG7A 4FOCA 4NZWB 1JSUA 2SRCA 4PNIA 4AT5A 4GIHA 5F1ZA 4KBAA 4FV3A 4TYEA 3W2PA 5EYDA 4J1RA 5FM2A 4ZZMA 1V0BA 4YJUA 5CSHA 5BVEA 3PWDA 3UGCA 1H27A 3KU2A 5E8SA 1ZWSA 1ZZ2A 4P5QA 2RFSA 3IOKA 2XK8A 4UMRA 4K11A 3GBZA 4ZTHA 4YZBA 3ZH8A 1VEBA 3UQFA 5KMLA 1PXOA 4EH4A 4KABA 1OKVA 4J7BA 1CMKE 3F2RA 4X3FB 2QURA 4RJ4A 2YWVA 4AXEA 3BEAA 2X6DA 4NFMA 3V04A 3MFTA 2CKOA 3COHA 4XHKB 3OD6X 5CNNA 3ORMA 5TO8A 4O7RA 4C3PA 2YIRA 3F5PA 4LGDA 3NEWA 3BZ3A 3R6XA 1U54B 3KB7A 3NRMA 4IAFA 5IMEA 3WIGA 4IWDA 4NCTC 4H1MA 2XAMA 4CZUA 2BCJA 3O50A 2GNHA 3TZMA 1WBNA 4K8AA 2ONLA 2V62A 2FA2A 3D5UA 3F7WA 3POOA 3W2SA 3ZXTA 3G9LX 4ENYA 3QA8A 5EI8A 4Q9ZA 3HLLA 2BKKA 4YR8A 3PJ2A 4DHIB 4GT4A 1DI9A 2ZV7A 3ATSA 5L2IA 4TYJA 4RC2A 3JVRA 5EW3A 2WQMA 3R7IA 1P4FA 2V5QA 3K5VA 1XO2B 3OWJA 4BF2A 2PMIA 3ULIA 5I9WA 2A27A 4WRSA 3H9RA 3TIYA 3UTOA 1S9JA 5BVKA 3CD8A 3FZSA 2XEZA 3MS9A 3OW4A 3NUUA 1QPCA 4GH2A 4AT4A 3FI3A 5I5ZA 5FG8A 3IW5A 4M12A 3P7CA 5BVDA 4QNAA 4EOIA 3V8WA 1L8TA 2XRUA 3AXWA 3EL8A 4O7WA 4I6QA 4AA5A 5CU0A 3PSCA 2WTKB 4Q2AA 3U51A 3HAMA 3OBJA 3UVPA 5DBXA 2UVYA 2RIOA 4RLLA 2YCQA 3D7ZA 3GU6A 4MD7E 3RWPA 3PFYA 3MH0A 4CMTA 4D5HA 4BCMA 4F0IA 5BVWA 3BL9A 4HZSA 5CT7A 2XK3A 3DFCB 2GNIA 1RDQE 3BBWA 1M14A 5I0BA 1H1QA 4BCPA 3F2NA 4AOTA 4HPTE 1WBWA 2QONA 4LGGA 2R3PA 4KUJA 3GQLA 4OTWA 4BN1A 1ZZLA 2VZ6A 3G9NA 3GC0A 2WTJA 4F0GA 1MRVA 4EJ7A 3K5UA 4MXZA 4ZTMA 3QTWA 3BBTB 2QR8A 4BIEA 4W4YA 4FTOA 4FKQA 4I6FA 4U3YA 4C2WA 3DOGA 4FT3A 3F61A 3FC2A 4OT5A 4FV1A 4EHVA 4EWQA 3R21A 5HLPA 1Z57A 4FTTA 5IUHA 2JEDA 4Z7GA 4O84A 4MBJA 3FE3A 4ALUA 2J5EA 3ZLYA 3UP7A 3PE2A 1YXVA 4U41A 4G3FA 1Q8YA 2ZB0A 4FVRA 4LM5A 4HPUE 4QT1A 4DH3A 4F9WA 3AC4A 4AF3A 3CR0A 4KIKA 2C6TA 4D5KA 4FIGA 3LMGA 4XV2A 1JVPP 2E2BA 2R3JA 4J52A 5CU2A 4R7BA 1OB3A 4X2FA 5HHWA 1Y6BA 4BWKA 2J9MA 2JBPA 4EH7A 5A9UA 5KMOA 1W98A 5AADA 3S2PA 2YWPA 2X7OA 4CV9A 4YZ9A 3QCQA 5KZ0A 5AP4A 3BE2A 4D2VA 4K18A 2GQGA 5LVLA 3NWWA 4FVQA 2XYNA 4ZSGA 2J7TA 4UMTA 5BYYA 4C59A 5KX8A 3RZFA 1K9AA 2BZHB 4OTGA 4BCQA 4ERKA 4ZK5A 4CFUA 3FLSA 3WARA 3BLQA 3VS7A 3VBQA 2UZEA 5HZNA 4KINA 4KD1A 5K9IA 2H34A 4X3JA 2JDVA 5DGZA 5FWKK 1IRKA 3MY0A 4GFGA 3L8SA 5HNGA 4O0RA 1Q3DA 3QD2B 5ANEA 5IQGA 3ZMMA 3ITZA 1V0PA 5GNKA 3QQUA 2Z7SA 3DXNA 3FZTA 3LCTA 4F1MA 3M42A 4FC0A 4TWCA 3UIXA 4Y8DA 3DZOA 2R2PA 2PY3A 3DBEA 4FT7A 5L2TA 2Y4PA 2PE1A 4H39A 3KL8A 4U7ZA 5HG9A 3LXLA 4Z9LA 4NT4A 5HIDA 1XBCA 1NXKA 2X2MA 2WZJA 3PP1A 1IG1A 4BDJA 1E9HA 5A4CA 4AXFA 1ZXEA 3LZBA 4KKGA 3EOCA 3PXZA 4WO5A 3S1HA 3F3WA 5FDXA 1KSWA 2PUPA 1E1VA 5E91A 3KY2A 3GGFA 4F9AA 4FOBA 2R7IA 4IAAA 2X81A 2Z7LA 4PF4A 4ENXA 3FLNC 4J98A 1L3RE 1OUKA 2W1DA 2OFUA 2ZDTA 4D9UA 4IANA 3LCDA 4AXDA 4QMZA 3QA0A 4WIHA 4OTIA 4G5PA 5HOAA 2QHNA 4AOIA 3TWJA 5H8EA 5LXMA 1TKIA 3BQCA 2R9SA 3FLWA 4S30A 3R8LA 5HVYA 2UV2A 2XCHA 3SRVA 3Q2JA 4IEBA 4PMTA 3NFFB 3RINA 4ALWA 4FIJA 3ZLSA 4RG0A 4XP2A 4XLIA 4GJ3A 2DQ7X 2IZSA 1U54A 5LMAA 1ZYDA 2DWBA 3GENA 5EKOA 2GFSA 4KWPA 2BRHA 2O3PA 4AZWA 2J6MA 3IW6A 1OI9A 2UZWE 4GRBA 3BU5A 2JFLA 4FV8A 3V5JA 4AGCA 3DAJA 3UJGA 3BRBA 3CJFA 1OMWA 4EZ7A 5CF6A 3FYJX 1F3MC 3FDNA 4H58A 4KRCA 2W05A 2WMSA 1YI4A 4I23A 3F5UA 4BCKA 3ULZA 3V5WA 2QNJA 5KE0A 2QOQA 3VW6A 1JWHA 5JN2A 5GJGA 3SAYA 4CYIA 4IX6A 3NSZA 2WQBA 3KN5A 3Q6WA 2R3LA 3JS2A 4C35A 5K4JA 4X2KA 4XG4A 4JOAA 5EH0A 5HG8A 4FGRA 1F5QA 5IQEA 1UU9A 3V3VA 4AZFA 1FPUA 2FSTX 3R63A 4N57A 2ITWA 3MPMA 1P14A 5HU9A 3MPTA 3VHEA 3M1SA 4AW0A 2ITPA 3H9FA 4K2RA 2PMOX 2NRUA 5EW8A 2X7GA 2C5XA 2ETRA 4JS8A 3C0IA 3OCTA 2XEYA 3QD4A 4MF1A 5AV3A 5FXSA 3I81A 5IPJA 3HGKA 3HZTA 4DH1A 1XH8A 2BRBA 3KVWA 3AD4A 3RAWA 2BAQA 2OJ9A 3ZXZA 2UW8A 3SG8A 3LFBA 3WZEA 2C6MA 3EQIA 4CFNA 3RPOA 2F2UA 2OIQA 3HRBA 4AZEA 5HX8A 3C4XA 3LM5A 2CMWA 4LDTA 3LXPA 5AX3A 3V8SA 1QPDA 2I6LA 2R3KA 4L3LA 4XJ0A 2HXQA 3QXOA 3HMOA 4AW2A 3W8QA 4O4DA 3AC8A 5AAEA 4BCHA 4BCIA 2GMXA 4L53A 4N4SA 4YZCA 4BDGA 2PULA 1PYXA 3MV5A 3FMJA 3IKAA 2PVHA 4I6HA 3OC1A 5LMBA 4OTRA 4YC8A 4CSVA 4ITHA 4CKIA 2ZV2A 2QCSA 4MX9A 3UPXA 4F9CA 4ZSAA 5KNJA 5ANJA 4CG8A 4AGUA 3UIUA 3DK3A 4GL9A 4NJDA 3RHKA 4QTBA 1UU8A 1R39A 3R1SA 2BILB 2QU6A 3T9TA 1H1SA 2W06A 4C4HA 4E93A 4FZFB 4FEWA 4R7IA 3ORTA 3UC4A 5EQEA 4O4BB 5ETIA 4C37A 4P90A 4MQ2A 4EH3A 5M4CA 2G01A 5EDPA 5C4KA 2C6IA 4IM0A 3K3IA 3NNXA 5HTBA 2QG5A 4XRLA 4WUNA 3VS2A 2P2IA 3U55A 2BIKB 5I4NA 4JDJA 4DH8A 4MD8E 1J7IA 3IQ7A 4L00A 2XNOA 3QQHA 4FNYA 4IADA 4NU1A 5TT7A 4WSYA 3TDVA 2F2CB 4GG7A 3RI1A 3GOPA 4G9CA 4E6AA 3OHTA 2CCHA 3KVXA 4IB5A 4X6QC 3ZO1A 5FXQA 3F3UA 4JX3A 3P0MA 1W82A 2R0IA 3VJOA 3KEXA 1H0VA 4X2JA 3ML1A 3EQGA 3F2AA 3U9NA 4ZTQA 4DCAA 3DFAA 3IG7A 3VC4A 1KE5A 3AGLA 3UYTA 2XA4A 2WPAA 3LFSA 1W84A 4JIAA 2PZYA 5J7HA 4O7ZA 4YJPA 5JQ8A 2JD5A 4FSMA 4L43A 3V5QA 5G6VA 1HOWA 4I0TA 1LUFA 4AT3A 2WKMA 5AX9A 3A7GA 3MH3A 1WZYA 4AOJA 2XNEA 4C8BA 4I3ZA 4C7TA 4EK6A 5C1QB 4CGAA 2O0UA 3S0OA 2YACA 4XRJA 2GSFA 1KE8A 4DH7A 1A9UA 3DDPA 5AM7A 5IF1A 5FTGA 4BDHA 4JRNA 4QP7A 4O0VA 3VW8A 4CXAA 2WTKC 3FYKX 4DFUA 2YA9A 1OGUA 4FEUA 3NYVA 3D94A 3W0PA 2VX1A 2ERKA 2W5AA 2LGCA 5HU3A 4YJSA 4MXCA 4PWNA 4DTBA 2JIUA 3EN7A 3C4CA 4DINA 4PPCA 3FHRA 4CT2A 4Z55A 1W2CA 3W55A 3R9RA 3LCSA 3QC9A 3ZEPA 4C3RA 3HMIA 2HYYA 3R1QA 4M97A 1UU3A 3R73A 4CYJA 3NW5A 3ZDUA 4ANBA 3BHVA 1QPEA 2REIA 3QTSA 5DG5A 5CSPA 5J1WA 5I9UA 5J9YA 5K4IA 4M68A 5H8BA 2C0IA 4RJ5A 5KHXA 3OXTA 1FVRA 5JH6A 3BV3A 4L3PA 4QTCA 4TRLA 1LPUA 3B8RA 4Y72A 4B8MA 4A4XA 4L42A 4ZMEA 5KMKA 3DDQA 3SVVA 3UG2A 4AE9A 3QTXA 1REKA 1JOWB 4O4FA 2CCIA 2QG7A 4M0ZA 4ZS4A 3AMYA 3HDMA 1DAWA 3CE3A 3NCZA 4D4VA 3WIKA 5CASA 5EYMA 2BKZA 3HL7A 4K77A 3LVPA 4JBVA 3W16A 1OL6A 3DQWA 4C61A 5FRIA 1M2RA 4RIYB 4NH1A 2F7XE 2F9GA 4R1YA 4ACGA 1OZ1A 2PPQA 1Q5KA 4O1OA 2WU7A 4WD5A 5CSWA 4O7NA 3BKBA 3T8OA 2XS0A 4UALA 3MFSA 3PXYA 1IAHA 1UA2A 1T46A 5HICA 4GVAA 2W17A 1XKKA 4O2PA 4BL1A 5ANGA 4BIDA 2OG8A 3DPKA 1GOLA 4U79A 3ZBXA 1H4LA 4O81A 5EM7A 1AGWA 1J91A 2PVMA 5EM6A 4ZZOA 1JNKA 3PUPA 3PDTA 4QP9A 5H3QA 5AR8A 3IW7A 4Y85A 2YAKA 4L01A 2XBJA 3O51A 1CSNA 2W1CA 3KXNA 2ZV8A 1Q8ZA 3RZBA 3SXRA 2BAKA 3KRJA 4FIIA 2EU9A 1K3AA 1YDTE 3OP5A 4OLIA 3FY2A 4BWPA 4UV0A 1FMKA 1PJKA 2ZDUA 3V01A 2QHMA 5EI6A 4EI4A 4CCUA 2QODA 1UV5A 3E62A 3I5NA 3OT8A 3OTVA 4ZZNA 3QD0A 3JPVA 5J9LA 2C6OA 5HE1A 4BZOA 2P33A 1M7QA 3QRKA 4S2ZA 4BHNA 4C38A 2CSNA 4AGWA 2OI4X 4DHJA 3O7LB 1A06A 4LMUA 1YXXA 5J79A 2UW4A 5GHVA 3AC3A 4D1SA 4DT8A 3LLAA 5FLFA 4BI1A 3B2WA 3DY7A 4YPSA 3QX4A 2ZJWA 1YQJA 3PP0A 5G1XA 4BZNA 4IC8A 1H1WA 5E1SA 4GFOA 4PTCA 3F5GA 3BI6A 3EQHA 3MYGA 3P7AA 3PXFA 4F1TA 4NYEA 3WI6A 3NCGA 3KF7A 4O96A 2HY0A 1KV2A 3NDMA 5BYLA 5HG5A 2B7AA 3DLSA 3QFVA 4DG2E 4JT3A 5LMKC 3W0MA 2AYPA 3UG1A 1GIHA 3F3ZA 4P4CA 4UXQA 3RBWA 4A4LA 5DN3A 3ANRA 5IA4A 4YBJA 5C01A 5CAPA 2RSVA 3OT3A 4I21A 3WF9A 4B0GA 2DYLA 2PMNX 3PIYA 2O5KA 3HRCA 3E92A 1H0WA 4DYMA 5IDPA 1WBPA 3C9WA 4HCVA 3A4PA 4RWIA 4G31A 2ITNA 5HE2A 4C34A 4DEGA 4F7NA 3TKUA 5KHWA 3Q4UA 3PVGA 3CS9A 4QMXA 4O7SA 1ZYLA 4FJVA 3UOHA 3P5KA 2FB8A 3QLGA 2VTPA 2HCKA 2J90A 4U40A 3L8VA 5B2LA 3ZRMA 3WF8A 3MIYA 5HBEA 4UEUA 5AP2A 3TUDA 3AKKA 1YOLA 3Q04A 4EYJA 4HVHA 5CQUA 2VTRA 4HNIA 1G8JA 2YCRA 4M69B 3GFWA 3ORXA 4FTLA 2BZIB 3MBLA 3UMWA 2FSOX 3KULA 3ORPA 3RCDA 5IISA 4P5ZA 1XBAA 2A19B 2YZLA 4TZRA 5ITAA 3DJ6A 3I7BA 1WMKA 3QTIA 4NW6A 5K0XA 5IQDA 4MYGA 2Z2WA 3LFEA 3B2TA 5AV4A 3DXPA 1EH4A 5CU6A 4NSTA 4YHTA 4B4LA 2QC6A 2GQRA 1WFCA 4FL3A 3OCBA 1YRPA 3EZVA 3F66A 4JBOA 2R4BA 4BBMA 4FSNA 1IA9A 3PJ3A 3NX8A 2C3JA 3KMUA 5CU3A 3MWUA 5FGKA 3R02A 1VZOA 1XBBA 4PDOA 5DT4A 2OLCA 4BCGA 3BHTA 1BKXA 4DAWA 3BE9A 3RALA 4JL9A 2X7FA 4RA4A 4I41A 2R3GA 5DFPA 2A2AA 5JZNA 5L8JA 2VWUA 1XH7A 2ZVAA 2C5OA 2GS7A 3GOKA 4MCVA 4DG0E 3CQUA 2OXDA 1OL2A 1XH6A 2VNWA 5LARA 3ZC6A 3TYKA 3C4WA 4JDIA 3NFGB 1NVSA 3SKCA 4BI0A 5DYJA 3TNPC 3SW4A 1YDSE 1ATPE 1P5EA 2PVYA 3OWPA 5BX0A 1H25A 4O0WA 2YISA 2UZOA 2J4ZA 2J5FA 2WMRA 3CTJA 3HX4A 4BYIA 2X0OA 4IHPA 5AUWA 2C3LA 4NCTA 3FLQA 3DTCA 4C36A 3CXWA 4AZVA 4YJRA 1OKZA 4PMPA 4ZJIA 4C58A 3W18A 2XK4A 4F6WA 4IX5A 4IWQA 4KIQA 2ITYA 3LQ8A 3PZHA 4KSQA 3W10A 2VTOA 4XNEA 5BVFA 5LCJA 1IEPA 5IH5A 4E4XA 3VS4A 1YHVA 2R3NA 4X7QA 4ASZA 2VWZA 2QU5A 1ZLTA 3QRIA 3ACKA 2JKOA 3FMHA 3H9OA 3Q2MA 4BCFA 3FPMA 3PLSA 1TVOA 4XBRA 1REJA 3E87A 3I4BA 1GZKA 5EW9A 3E5AA 1YHSA 3G90X 1GAGA 2WTDA 2I1MA 1UU7A 1PRYA 4RPVA 4U45A 4FE2A 3LMHA 4N6YA 3KRLA 4EJNA 4FEXA 3TUCA 3C13A 5DOSA 3MJ1A 2V0DA 4HYUA 4FKSA 2Q0BA 4D4YA 4EQMA 1I44A 3ALOA 3WF7A 3KGAA 4BY9E 5EM8A 2UVZA 5DIAA 1Z5MA 4PL4A 3F69A 3E64A 5CENA 5JK3A 4PMMA 3FI8A 1WVWA 3C1XA 3ELJA 4NM0A 4L6QA 4BTFA 1XH5A 4DGGA 4ZJVA 4HVGA 2WMUA 3VWAA 2X1NA 5EDRA 3SC1A 2VWYA 1JKSA 4J8NA 4S33A 1E1XA 4KSPA 4WUAA 3MVJA 1T45A 4I4FA 4TT7A 5C4LA 4EH2A 3L9PA 3V5PA 3GEQA 5K0KA 3F6XA 1W2DA 4YJNA 4BJJB 4CFVA 1XQZA 2JKMA 4MAOA 3R8PA 3RNYA 4L46A 4EKLA 3QKLA 3CC6A 2EXEA 2VTTA 4IQ6A 2EB2A 4QMQA 3OW3A 5ACBC 1WBOA 2PL0A 2EB3A 3AC2A 3R8ZA 3RJCA 4BDEA 5HLWA 3VUGA 1G3NA 2VTNA 3COIA 3N51A 3QYWA 4FL2A 2LAVA 1SNXA 3SG9A 3DBCA 2E9OA 4EEVA 1ZARA 2CKEA 2FSLX 2YM7A 5IH6A 5CVGA 2XKFA 3BEGA 3VUHA 3ZC5A 2VGOA 4Y83A 2PVKA 4ZS0A 3AMAA 5E8TA 4UMPA 2WTVA 5BPYA 3EQPA 3FZ1A 2FUMA 5AR4A 4DHZA 4BR3A 4DGNA 3MB7A 4FODA 4IACA 3NAYA 2W9ZB 4OBQA 3ROCA 3U8WA 5IA2A 3SA0A 3LCKA 3UO4A 3SLSA 5KKRC 3BU3A 4FTUA 1WCCA 3E63A 4YPDA 3EQCA 4FV0A 3MTLA 4UYAA 2VGPA 4FV9A 4ZTRA 4AA0A 5KUPA 4YJOA 3DKOA 4BKYA 1BI7A 2X8IA 3A7JA 3HV3A 4FG7A 2XYUA 4OTFA 2IEWA 3O7LD 5C9CA 4HVDA 4BDKA 4RQKA 4TWNA 4XOYA 3WOWA 3HRFA 4CRSA 1FOTA 3NIZA 4IM2A 2QLUA 4RVTA 5FM3A 4EK4A 3KCKA 5L2QA 2OU7A 3O23A 4FX3A 5AUZA 4MNEB 4BGQA 4QMVA 3OFMA 1DAYA 1PXMA 4V0GB 4QQTA 3FZPA 3HA8A 4FIHA 2E9NA 4GMYA 5IQCA 4TYGA 3R01A 4XG8A 3VNTA 3PJ8A 4EOKA 1MQBA 3C4EA 1CDKA 2C5YA 3NUPA 4BBEA 4DE4A 2BDWA 2G1TA 2QOIA 4KNBA 4L3JA 2HZIA 3GCPA 2WFYA 4U44A 3C4FA 1KE7A 1R78A 2FSMX 3FZRA 4IVAA 3UPZA 3D5XA 5L4QA 2KULA 3KXMA 2XARA 2XKDA 5HESA 5TE0A 3AMBA 4ZAUA 5BVNA 4A9TA 4HNFA 2GTMA 2HWOA 2UVXA 4PMSA 4XH6A 3U6HA 4KIOA 3OUNB 4FZ7A 4QTAA 2QOKA 5M4IA 2W4KA 3ZFYA 2E9PA 3TZ7A 3F82A 4QMUA 3A99A 4F0FA 4G1WA 2HK5A 1GZOA 2WEIA 4U43A 3I6WA 4YZDA 3EFKA 1Q24A 2IJMA 3C7QA 5CU4A 5KMJA 5M57A 5M06A 2BRGA 4IZYA 4H05A 2GNJA 4ZTLA 2XH5A 5HBHA 4ASEA 3FC1X 4QMYA 3KQ7A 4DEIA 3OOMA 4JG7A 1FGIA 1TQMA 4F65A 1Q62A 1WBTA 3JXWA 3JYAA 3BL7A 4WNMA 3FL4A 4TYIA 2X6EA 4DHFA 4O0XA 4UWBA 2EWAA 3OZ6A 4RIOA 2YLFA 1PKGA 4IZ5A 2QOFA 2YIXA 2W7XA 4U3ZA 5JFWA 5L8LA 4FV6A 1RQQA 4HYSA 3QQFA 4MKCA 3UOLA 4FF8A 3OY1A 5JT2A 4FR4A 5CZIA 3UBDA 3MVLA 5CYIA 4D4SA 2NYAA 1GY3A 2GCDA 3UQGA 4EBWA 2OZAB 2EXCX 5AFVA 4AAYA 3FZOA 4WHZA 3FUPA 3OBGA 4XUFA 5EFQA 5JRSA 4E26A 2VTAA 5HO7A 2HENA 4W4WA 3Q4TA 5EYKA 4AFJA 2F57A 4MXXA 4U5JA 2W4JA 3EIDA 3QL8A 4W9WA 4KRDA 4NIFB 4EC8A 4UX9A 2ITZA 2P4IA 3PIZA 3PIXA 3Q4ZA 5IZFA 2OGVA 5AV1A 4FL1A 2R7BA 3P78A 3TEIA 3E3BX 3LHJA 4WOVA 4MBLA 3EKKA 4OBOA 2IW9A 5IA3A 1U5QA 2BRNA 2PE0A 1GIJA 3GVUA 3V6SA 4CFMA 4U81A 3GQIA 3FXXA 2JKKA 4DLIA 2CLQA 4IIRA 3TJCA 3FAAA 4A9YA 4YTIA 3PXKA 4RC3A 2VWWA 4O83A 1OGYA 5F95A 3FV8A 3W8LA 3P4KA 2XM9A 2CJMA 3EB0A