2JEDA

The crystal structure of the kinase domain of the protein kinase c theta in complex with nvp-xaa228 at 2.32a resolution.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
324
Chain Sequence
LKIEDFELHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNEFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLFADRALINSMDQNMFRNFFMNPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTEIN KINASE C THETA
publication title The Crystal Structure of the Kinase Domain of the Protein Kinase C Theta in Complex with Nvp-Xaa228
rcsb
total genus 97
structure length 324
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jedA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jedA01
4FT9A 4D2WA 3FQEA 1YXSA 3K3JA 4U79A 5JSMA 3EB0A 1KE5A 1Q3WA 3BQCA 3P23A 3I7BA 1K9AA 4ZSEA 3LKMA 3OXIA 4U81A 4CFUA 2P4IA 3W2RA 4IB0A 3CY3A 2X0GA 3LMGA 2C0TA 2X6EA 4C58A 2ETKA 5L4QA 3W32A 1XBAA 4CT1A 2BKZA 3DB8A 3F88A 4C61A 4WUAA 3CBLA 3KKVA 4I23A 3IDBA 5KZIA 5JFWA 3FLYA 2XMYA 2ITTA 4FVQA 4C35A 4I4EA 5CENA 4G5JA 2UZUE 3PRFA 4RPVA 4BGHA 1SVHA 2BCJA 4OTIA 5DI1A 1ZWSA 2WAJA 4UMTA 4EH2A 1U5RA 2ZM3A 3MGYA 4QP3A 5CEPA 3UPZA 3UZRA 4UV0A 4LUDA 1OL6A 2QLQA 5EG3A 3SXSA 4E8AA 4Y73A 1Q8UA 4B0GA 5HTIA 4AA0A 2R3IA 1P4FA 5EHYA 1ZYSA 2WEIA 2PPQA 3BU3A 4L6QA 3ZONA 4YJPA 3K3IA 5J7HA 3VRZA 5CU3A 2XM9A 2QO2A 5BYZA 2VAGA 4I92A 3VNTA 4RFZA 2DS1A 2WMWA 3DV3A 5KBRA 1ZRZA 4DFBA 2UZNA 4KBAA 2GFSA 4X6RA 4FKQA 4IVBA 2YDJA 5HEZA 5JQ8A 4YZCA 3B8QA 4H36A 4XG9A 1F5QA 4D5HA 4L42A 1KE6A 1JWHA 1YI6A 2O8YA 3BI6A 3LJ2A 3KQ7A 1HOWA 5KMNA 4BDCA 3OTVA 3H9FA 3L9PA 3MTLA 3RALA 3MPTA 3AC3A 1UNGA 2PZIA 3DZOA 4K8AA 3W2QA 4QQTA 4FEWA 3VS1A 5BPYA 2WTWA 5AIKA 1YDRE 2YJRA 3LM0A 4L53A 4DAWA 4KB8A 4YPSA 5AAGA 2IO6A 2X7FA 2E9NA 3CQUA 3G51A 3JUHA 3W2OA 4EHEA 4Z55A 4O7SA 3MH0A 3PXQA 3KXHA 3IQ7A 4ANLA 2WMSA 2X2LA 3ERKA 3PY1A 4FZ7A 3FZOA 4RIXB 2H34A 4IVAA 4F0IA 2HXLA 3ANQA 4GYGA 4QMZA 4C36A 1FVTA 2WMVA 5DT0A 5H8GA 4ZXTA 2F9GA 3QD2B 5L2IA 2Z2WA 1XHAA 4C4GA 5FXQA 4BTJA 4G5PA 4WNMA 4U3YA 3ZSGA 4ZTNA 2X7OA 5M55A 4WSYA 2JDRA 2VTIA 3QU0A 3C4FA 2PZYA 3R8LA 3NYNA 3GU6A 3NMUF 3R22A 2GNJA 3UO6A 3OXZA 3PXYA 4M13A 2J0LA 5B2LA 1SNUA 4OGRA 1R39A 4FK3A 4PMTA 2XNNA 4GT3A 4C4JA 2NP8A 3GOKA 3H9OA 1TQIA 4TPTA 4RJ5A 2EWAA 3NIEA 5CF5A 4ZSLA 1PXOA 3V8WA 3C5UA 3BE2A 3OWLA 3R7UA 4YMJA 4B7TA 4L44A 2CKOA 5L8JA 4FT7A 1JKKA 5CU6A 4XOZA 3IW5A 5AUVA 3T9IA 4EH4A 3GEQA 1MP8A 4JXFA 5L6WL 3C13A 4O86A 3PE1A 2PSQA 4RVMA 2JKMA 4XOYA 1LUFA 1PHKA 4FGBA 4X3FB 5E8TA 4C3FA 5KX8A 2WMBA 3BGZA 5AR4A 3I60A 4FNZA 4FTMA 2BILB 2VTPA 3Q4TA 3NUSA 4O27B 4QQCA 5GZ9A 3OVVA 3O8PA 2ZMCA 2RG5A 3F69A 3DB6A 4RJ6A 5CQWA 3IDCA 1Q99A 2B9FA 1P2AA 2QR8A 3CKWA 4ACGA 2XH5A 4QMVA 4P90A 2XNOA 4YHJA 2IN6A 1FQ1B 5J87A 3HA6A 4RG0A 5HVJA 2CCIA 4RJ3A 3NYVA 3ZEWA 3I7CA 4WNPA 3WZJA 4GK2A 4DCAA 3F3WA 3ZLXA 1WBOA 4BL1A 5DBXA 4E73A 1PMNA 1YOMA 3ZZWA 1GZNA 3O7LD 2HZNA 3PIXA 2DWBA 4L3PA 4A4OA 5K5XA 3QZFA 5BX0A 4Y46A 4JL9A 4RIYA 4C62A 1P14A 2IVUA 4H39A 4KS8A 2W1DA 1Q24A 3KCKA 3ORXA 4QMWA 3OXTA 4E1ZA 3UP7A 3GC8A 4QMUA 3BE9A 5E8UA 4IWPA 3T3UA 3EQDA 4Z7GA 1YDTE 2ZV2A 4GYIA 2PTKA 4PDOA 4GFOA 3FQHA 3C0GA 3O51A 1CKIA 4PWNA 4GJ3A 2UVZA 3BKBA 3LJ1A 4IAAA 3PLSA 5T3QA 5JRQA 3QA8A 3SKCA 5BYYA 2BZIB 3R7GA 5I9XA 3Q96A 2YM8A 3QYZA 4CRLA 2GS6A 5KHXA 5KZ0A 3ZRKA 2PUUA 5L8LA 4BY9E 4UXQA 4ZOGA 4E26A 1UU3A 3E92A 3FLWA 3E7VA 4RIYB 3GUBA 4IB3A 4LOOA 4D2PA 5JK3A 3ENMA 1WBNA 3FHRA 4ERWA 4P7EA 4BZOA 5CQUA 3ZH8A 4WNKA 4BBFA 4DBNA 1PRYA 2X4FA 4GEOA 1XH9A 3BYVA 4S32A 3I81A 3KC3A 4FKSA 5EYKA 2VTRA 2VWVA 3RP9A 3O17A 3C7QA 4BICA 5M57A 3ZUTA 3HDMA 4WG5A 3RTPA 5IQGA 3PXRA 4IZYA 4ZSGA 2JDOA 4BN1A 4JBPA 3TTIA 5ANDA 3IW7A 4BWPA 4QYGA 4JJRA 4HVSA 3PY3A 3Q9ZA 4KBKA 4FTJA 4D2RA 2G2IA 4KKHA 4QMQA 5CAVA 3S2PA 5KMIA 1E1XA 1BL6A 2HIWA 2W1GA 1AQ1A 2W5BA 3GP0A 2WZJA 3HNGA 3KK8A 2HK5A 4FV3A 2YM3A 4ZTHA 3ZZEA 3IPHA 5EW9A 5E4HA 3S3IA 4O7TA 2GSFA 2WGJA 4GK4A 1YQJA 4YTCA 2EU9A 3RPSA 5IA1A 2X8EA 4G16A 4G3CA 5F1ZA 2YEXA 3UOKA 1URCA 1ZAOA 5C26A 4DEEA 3D5VA 1YXXA 2ITQA 2AUHA 1Q97A 3HV5A 2XJ1A 3PXZA 4ZY5A 4DITA 4RC3A 3VW8A 4FKPA 4N57A 4BDFA 4U3ZA 4AGDA 2CKPA 2HZ4A 1JKTA 4D4YA 4PPCA 3RM6A 3D7TA 5DFPA 4FE2A 4CQEA 4JAIA 2J5EA 3EHAA 3GT8A 4V04A 5AUYA 2IVTA 2DYLA 4RVTA 3R7OA 4CCUA 3RAWA 2HW6A 4M68A 2QCSA 5EYDA 4I3ZA 3TKUA 1SMHA 4BCJA 4UWCA 4A9RA 2JBOA 2XA4A 3VVHA 4QYYA 4NH1A 4OTQA 4GK3A 2ITPA 4I6QA 4IAIA 1YRPA 3DGKA 3E8EA 3HLLA 2IVVA 4MD9E 3VJOA 2CGXA 2YAAA 3FLZA 3PZHA 3KULA 4TW9A 1S9IA 3OFMA 3VQHA 2PUNA 5AV1A 4OTDA 2XK6A 5FBNC 5K3YA 3BGPA 3HRBA 4WRSA 2C6EA 4MX9A 4GU9A 1JLUE 3Q32A 4LQMA 1UU8A 2PVNA 3F3TA 2OXDA 4MEDA 4JRVA 4A9SA 4XV1A 5A4LA 3GQIA 3WF6A 2ZDUA 4U44A 4DGOA 4IADA 4D1XA 4GSBA 1ZOHA 4XCUA 2VTNA 2OSCA 2PL0A 2VTAA 4BTKA 4IE9A 1NXKA 3C4WA 4XLIA 5BVNA 1MQBA 3I0OA 2OJFE 2QC6A 3QTIA 4Y5HA 1H8FA 4DYMA 4EK8A 4ZJVA 5CX9A 5IEXA 4LUEA 5AUWA 5EOBA 3DJ7A 5AP4A 1OBDA 4XP0A 2FSOX 5F20A 2QR7A 3KRJA 1MUOA 4UN0C 4R5SA 2JDSA 4EZ7A 4BDIA 4NM7A 3LFDA 3VUHA 3QTRA 2AC5A 3QGWA 4BIEA 4I0RA 4O81A 1YHSA 4EEVA 2LAVA 3E88A 3WILA 2W4OA 3R1YA 5JGAA 3MFUA 1O6LA 4D9UA 2HOGA 1OKWA 4LMUA 1L8TA 5JZJA 5IUIA 3O23A 1FPUA 4FTUA 4FIIA 4HPUE 5CNNA 4S31A 2YZAA 2YIYA 2X81A 3F6XA 3TKIA 2VX3A 2WU7A 5EHLA 1YKRA 3CD3A 4ENYA 2VTHA 3G15A 4MF0A 1QCFA 2RKUA 3I0QA 4J96A 4QYFA 4EWHA 3WOWA 5TR6A 1JOWB 4GFMA 2JKKA 3NYXA 3F66A 4Y95A 4ACDA 5HQ0A 2BRBA 3OT3A 5FWKK 3VS6A 2ZMDA 3SW7A 4RX7A 1W7HA 3FWQA 5CAPA 2C5YA 3FC2A 2XK4A 3KXZA 2RFDA 5IH4A 2X8IA 4I20A 1G3NA 3FZ1A 5DH3A 4U5JA 2B9HA 3ZO1A 2C6MA 4Y72A 5CASA 3V3VA 1W83A 3TL8A 4BBMA 4FZAB 4X2FA 3P78A 3EFJA 4TYIA 5L2TA 1G8SA 3PYYA 3WYYA 3LXKA 2I40A 3QRIA 1ZY5A 3H3CA 4NSTA 5IKWA 5E8YA 5CZIA 5HE1A 4EH6A 4C2WA 3PUPA 2BPMA 2P55A 3MH3A 3R04A 4RRVA 4CFXA 3PE2A 1OVEA 2Y7JA 3IO7A 4L67A 5CEIA 1OBGA 1APME 2RL5A 2Z60A 3GXLA 4DH1A 1XJDA 3AG9A 1H1RA 1REJA 4NEUA 2WEVA 4CKJA 2OJGA 3GVUA 3PA4A 2XB7A 3FQSA 4JQ8A 4F9CA 5BVKA 2RFSA 3OT8A 3P9JA 2JFLA 4S33A 5DE2A 4IB1A 3DBEA 1Y8GA 4PX6A 3UPXA 3NVMB 3TDVA 4MXCA 3PY0A 4CFFA 2BRHA 3G5DA 2F7ZE 2ZB0A 3NNVA 3TUCA 1P4OA 3NUUA 3O7LB 5LMKC 3QXOA 2IG7A 4KNBA 5HO6A 3VWAA 4O82A 1FMKA 4G3DA 4NJ3A 3TNIA 4CSVA 2VWYA 2F49A 2NRYA 3D5WA 4U7ZA 4FI1A 3ZSHA 2XKDA 5J1VA 4L43A 5LMAA 4Z7HA 1UWHA 1YI4A 5LWNA 5BVWA 3CC6A 3DJ5A 5EK7A 4JOAA 2XIZA 3NS9A 4ALUA 4O21A 5HIEA 2X2KA 3QQHA 3TACA 3PXKA 1WBPA 3AC4A 4HZRA 4TTHB 3A8WA 5DOSA 5JEBA 3U9NA 2VGPA 3VUKA 2IJMA 5LVMA 2YCSA 3OUKA 2KULA 4X2NA 5FBOA 3UNJA 2J5FA 3FXXA 3SGCA 4NIFA 3GC7A 3IS5A 3NW7A 3TM0A 3E63A 4NL0A 2OU7A 2QI8A 4MBLA 4ZIMA 4M84A 4RJ8A 3BBTB 1XH4A 5J9YA 4J99A 4C8BA 4EH9A 2ITYA 3L8SA 3CTJA 3V8TA 4EI4A 1KOBA 2WO6A 1H24A 4AZEA 3L1SA 4PMMA 5EQYA 4OTGA 3QF9A 3OF0A 2PVKA 3UODA 3ZLYA 4TY1A 2VNWA 3SW4A 3TTJA 3DZQA 3VF8A 4AQCA 4N6ZA 4HVHA 3DXQA 2YACA 3E3BX 4ENXA 3Q60A 3A62A 3LFCA 4I5CA 2YCFA 3VN9A 2X9FA 4IM3A 4D55A 2UW9A 3CGOA 4IACA 2BTRA 4ZTQA 3P79A 5FTQA 4X3FC 3VS3A 1P5EA 4F63A 2ZDTA 4NIFB 5AAEA 3DBQA 4IWQA 5I5ZA 3NCGA 1PW2A 1G5SA 4OW8A 3BZ3A 3UZPA 4L3LA 5D1JA 3LHJA 2XK8A 2QO9A 3C0HA 5FGKA 3RVGA 3TXOA 4DGGA 5L6OA 4QMTA 3VC4A 5EQEA 2YA9A 3GQLA 2OZAA 4D4RA 2J0JA 3N9XA 3QRJA 2R9SA 4MCVA 2CLXA 3FEGA 3RGFA 4BCNA 2XP2A 4RLKA 4I0TA 5KMMA 5IG1A 4PDPA 3CJGA 5BVDA 1E1VA 1Q62A 2ONLA 3PIYA 4XBUA 4ZZMA 3QD4A 3QZIA 3VW6A 5M44A 1BI7A 5DYJA 2BR1A 4UALA 1JSVA 4AU8A 1JNKA 3D4QA 3R9NA 5EM6A 4K2RA 1PF8A 2RG6A 5FTGA 4FOBA 4PL4A 3UP2A 5CI7A 3V8SA 3H0ZA 2WIHA 3MA6A 2KTYA 5IZFA 1OIYA 3V01A 2JLDA 3Q2JA 4YJRA 1JKLA 3LCOA 1ATPE 1XR1A 2CGUA 4C4HA 3MB6A 5K0KA 3DCVA 3FJQE 3A7IA 4IHPA 4OBPA 4XH6A 1Z9XA 3ACKA 4GT5A 2XYUA 4EYJA 4GKIA 2V5QA 2X7GA 3DT1A 3K54A 2OZAB 4N70A 2HZIA 3EWHA 4NCTA 4R6VA 3A60A 4GIHA 3S00A 3KRXA 5HIBA 5A4QA 2EB2A 4H3PA 4E4MA 3IGGA 2R3MA 4PNKA 5CANA 4BYIA 3MN3A 2PYWA 1UU7A 2ITNA 4FV6A 2FH9A 4OBOA 3KCFA 3CD8A 5JGDA 1QL6A 3G9LX 3HECA 3MVJA 1YWRA 3E87A 4BKYA 4UEUA 4IAZA 3LIJA 3RINA 3BHUA 2XEZA 3GCQA 3CPCA 2JITA 2B52A 4AGCA 5AA8A 4DTAA 4CV9A 5C8NA 5LVLA 2YDIA 4K9YA 5HTBA 3OCSA 3NPCA 3FAAA 4NTTA 4Z16A 4G6NA 2A4LA 2BVAA 5AP2A 5HKMA 3WF7A 1A48A 2XNMA 5J79A 3RAHA 2BZHB 1IAHA 1H07A 3ANRA 4R3RA 1V0BA 4PPBA 3NCZA 5M4UA 2YIXA 3COMA 3DDPA 4O7NA 5KCVA 1BX6A 2ERZE 1OPKA 2ZV9A 3ZMMA 3VUGA 1Q8ZA 4JBVA 4DT9A 3HP5A 3PJ2A 5AEPA 5EYCA 1O6YA 4DEDA 2I0VA 4RT7A 4GV1A 4RX9A 2VWUA 4FEUA 2GTNA 2UVXA 4Y83A 4GKHA 4FV2A 4CGAA 3BLHA 2CPKE 5ETCA 2EUFB 1H26A 4N6YA 4E6DA 5JFXA 2PULA 3U6IA 2C6TA 3EQHA 1NA7A 5AP6A 3VQUA 4D2SA 3FMKA 5H9BA 1UU9A 5HI2A 4AP7A 4APCA 4RFMA 2QU5A 3BRBA 3TN8A 3A61A 1R0EA 4MXYA 1R0PA 4YSJA 3PDTA 3AT2A 3UQFA 5IA0A 3MPAA 3DNEA 5CEQA 1PXNA 4IXPA 1ZYCA 3IW8A 3HYHA 4YSMA 4HZSA 3DK7A 5AP5A 4Q9SA 5KMLA 2PVRA 2PHKA 2ZB1A 4EKLA 3F3ZA 4EOQA 4QMNA 4NWMA 5DEYA 4ZTMA 4DEGA 3ET7A 2Y6MA 3COHA 4WG4A 4B9DA 4I4FA 1LPUA 3KXMA 4GVAA 4H58A 1CKPA 2V22A 4PL3A 4ERKA 3A7JA 5JFVA 3F3VA 3AMYA 3V6SA 2HAKA 4L3JA 3ULZA 4OBQA 1F0QA 5EM8A 3HDNA 4AW0A 2VV9A 4XV2A 4HYSA 2F2UA 1B38A 3R63A 4C4FA 4O6EA 3JVSA 4E7WA 4AT5A 4K77A 5K0XA 2BFYA 4CG8A 3QUEA 4XG8A 4A06A 4YHTA 1NVRA 4YPDA 1EH4A 3OS3A 2RFNA 4F1MA 2B53A 2GNHA 2GNFA 2JGZA 2OH4A 2W05A 5E8SA 3RJCA 3UC4A 4FNYA 5A4CA 5A4TA 3KL8A 2PVLA 1LP4A 3DA6A 3CSVA 1QPDA 3OWPA 3P0MA 4XRLA 3EQPA 4YNEA 4WT6A 2OXXA 5AV2A 4X2KA 3R8PA 4EOKA 4RZWA 2BHEA 2HWOA 3MIYA 4RIWA 4AG8A 1J1CA 3U55A 3IW6A 3FDNA 4FZDB 4IW0A 3HP2A 4O0YA 4TWOA 1ZYLA 4BDEA 5A46A 2XIXA 3EQBA 4EHVA 4R78A 2VZ6A 1Z5MA 4FL1A 3N4TA 3KRRA 1R3CA 4Y85A 5IUHA 2VWZA 3QTSA 2P33A 1H01A 3F2NA 4M3QA 5IA5A 5IUGA 3E5AA 2G2HA 5HBHA 3SOAA 3FMMA 4MWHA 2XVDA 3PWDA 3GNIB 4DG3E 3NW5A 4DTKA 5HU9A 2C5OA 3FKLA 2WQBA 5J8IA 3TZ8A 4HVIA 4BDJA 1S9JA 3Q9YA 3O50A 2C5NA 4HYUA 2I1MA 2EVAA 3WARA 2HYYA 4GW8A 4JG7A 4UY9A 4AE6A 2OJ9A 2QOLA 3BYSA 4RIWB 2XIKA 1M2PA 4F99A 4EWQA 1JVPP 2PZ5A 3BX5A 4ZY6A 3ZUUA 2BDJA 4MXOA 4EK4A 4MYGA 3QLFA 4M14A 3HAVA 3SLSA 4BZNA 3BV2A 4O0RA 3TZ9A 4F9YA 2YN8A 3DTWA 3PPZA 4YGAA 3U4UA 5JGBA 4FZFB 4LOPA 3RAKA 2OFUA 3I5NA 3BWJA 1M7QA 4FTKA 5CTPA 3R8VA 4ZTSA 1GZOA 1J7IA 2RFEA 3E7OA 1IRKA 3NUPA 4IWOA 2HXQA 3DBDA 1DAYA 4RQVA 5CS6A 3ZYAA 4KIQA 2J6MA 4GVJA 2BUJA 3DAJA 2QG5A 3PVGA 4ZS0A 4AGWA 3LXPA 5LVOA 3KF4A 4QTEA 4FX3A 4FOCA 3UQCA 4WO5A 4FKJA 1OITA 2CNVA 3II5A 4LL5A 4YTIA 3VBVA 4IANA 3GOPA 2DUVA 4WA9A 2ZM4A 5AV3A 4RMZA 3TI1A 3VUMA 3MH2A 2ZV7A 3D15A 4MD7E 2C6LA 4RWLA 5IMXA 4KABA 3FLNC 2PVJA 4ACHA 3KVWA 4BTFA 4YUQA 3QAME 2WOUA 4KS7A 4RLLA 4TYJA 3TNWA 1W98A 3COIA 4F65A 3FMNA 3SDJA 5EI6A 2OW3A 4EHZA 3WIGA 4DLIA 2GDOA 3HVCA 4XV9A 5IEYA 2C1BA 5EHOA 4IFCA 4ASDA 5CF6A 4G3FA 3SC1A 4IFGA 4Q5EA 3DY7A 4BHNA 3AC8A 5BVFA 4UX9A 2UZWE 3A4OX 3MY0A 4JQ7A 2OK1A 3BV3A 4FBXA 3ZRLA 2PMLX 3LQ3A 2W96B 5ITAA 4FKUA 5AM6A 2J50A 2J0KA 3Q2MA 2PVHA 4GCJA 3QL8A 3NIZA 5HHWA 2G2FA 5CT7A 4YZNA 5AX3A 4EC8A 4ZSJA 4GG7A 3ZO3A 2F7EE 5J5TA 1H1SA 4V0GA 1QPJA 5JZNA 4J52A 3BQRA 5HIDA 1PMVA 4QO9A 3BYMA 3UQGA 5AFVA 2JDVA 4G6OA 1PYXA 5GJGA 2XUUA 3ENHA 5DR2A 1OM1A 2VTMA 5IQIA 4JDJA 3R00A 3AQVA 3RZFA 4II5A 3ZBFA 3ZHPC 3ZM4A 2C3LA 4DH5A 4YC6A 2EXEA 5KBQA 2BDWA 3V5PA 4I22A 2GNLA 1SM2A 1WFCA 3PSBA 5TE0A 2R4BA 3KEXA 4ZTLA 2GTMA 4A7CA 4F6UA 4D9TA 4QTCA 5BYLA 4LRMA 4EHGA 4MXXA 5A9UA 3E8NA 3QKLA 3KRLA 3UIXA 4AOJA 3FY2A 3RZBA 2WQNA 4NK9A 4OTPA 5DEWA 4W8DA 2R3GA 3UOHA 4F09A 5IQHA 3QD3A 1UA2A 2HW7A 4QRCA 2OBJA 2BROA 1URWA 1KWPA 3E8DA 2A2AA 4BRXA 4DE4A 3R0TA 4V0GB 5HNGA 3MIAA 4WHZA 1YHVA 4XEYA 4AACA 5EI2A 4AA5A 4WKQA 4ALVA 2VO3A 1UKHA 4TNDA 5H3QA 4EOOA 1FVVA 2WPAA 3EMGA 3P7CA 4L45A 3VAPA 3R21A 3NUAA 4ORKA 2O0UA 4CT2A 5BMSA 5I0BA 2BALA 2FGIA 4NUSA 3DS6A 5AIRA 3ZCLA 3FSKA 3ZFYA 3MW1A 1JKSA 5EQPA 3WF9A 3FBVA 3CEKA 2ESMA 4TYEA 2PMOX 3U51A 5ANIA 3LZBA 4TYHA 4K1BA 4DG2E 5CAOA 2OXYA 4LGDA 1PKDA 2YAKA 1GNGA 3FMDA 4AOIA 4ZLYA 3QXPA 4J53A 2CKQA 4S34A 5FEEA 2W5HA 5I9WA 3NLBA 4PDYA 4QMYA 4KKGA 4IB5A 3GGFA 2GS7A 3BHTA 4EQCA 3QALE 5J9LA 4UXLA 2XZSA 4TZRA 4DFLA 3NUXA 3CTHA 4O0UA 4U41A 3KXNA 4IVCA 4ZZNA 1H0WA 2W9FB 2R3FA 2WTIA 4KRCA 3UVPA 4TNBA 4BYJA 2UZVA 4JS8A 5AAFA 1QMZA 2IPXA 3FI4A 3DDQA 1CM8A 2P0CA 3BEAA 3MS9A 4UYNA 2XRUA 2QOHA 1CSNA 3DLSA 3FLQA 3PXFA 4NM3A 2PWLA 3VO3A 4DGMA 2G9XA 1UWJA 3ROYA 4RWIA 4EQUA 3JY0A 1H1WA 3G90X 3I4BA 2F4JA 4LRJA 4H3QA 1B6CB 1JAMA 1OI9A 2VTJA 2WMUA 3UVQA 2E9VA 4CLJA 1G8AA 2GQSA 4J97A 5EOLA 3T8OA 3R02A 2R3JA 3GU8A 4KD1A 3FXWA 4R8QA 4BWXA 3G6GA 3KVXA 3M42A 4OTHA 4CFNA 5AP3A 4CXAA 2OF4A 4WIHA 5CI6A 2WTCA 3A7HA 4PTCA 3R9RA 2W1FA 4YBJA 5I9ZA 1XWSA 5FRIA 4FKIA 1KV1A 3HGKA 5L2QA 3EL7A 1GY3A 4QTAA 3RHXA 2BHHA 2CHLA 3TZ7A 4FTCA 3DOGA 1GOLA 4I0SA 4XRJA 5TOZA 4LGGA 2IZTA 4QMMA 5L2WA 2UW6A 4YR8A 3SVVA 3Q3BA 3GFEA 3A8XA 3GU7A 5FD2A 4F1TA 3IG7A 4QD6A 4IZ7A 2YM5A 4PTEA 2Y6OA 2GHLA 1PXJA 4AFEA 2QG7A 2V62A 3UNZA 3PWYA 3A99A 4DH7A 4RZVA 2YABA 1XO2B 3R8ZA 3GFWA 5GZAA 4MQ2A 5AR7A 5HOAA 4FT3A 4HCUA 2OKRA 4CLIA 2O3PA 4CZTA 5AV4A 5IQFA 2IWIA 3QWJA 4PRJA 4FL3A 3P4KA 4QTDA 3VS0A 3KXGA 3F3UA 4DFUA 1Q41A 5IQDA 5B2MA 1ZOGA 3PJ1A 5HNIX 4JAJA 3DKCA 3QUPA 4F9WA 2C0OA 4M8TA 4FV8A 4X21A 3UTOA 5TF9A 4QQJA 2VN9A 4LG4A 4WBBB 1GJOA 2WIPA 4V01A 4FNXA 4ITHA 4ITJA 2YIRA 4OTFA 4YJUA 3G9NA 1A06A 3HMMA 4GMYA 2BIYA 2FSLX 2JIIA 4D2TA 3NX8A 4X3JA 4A9TA 1QPCA 4C2VA 2GS2A 3ORPA 3R71A 4MH7A 3VHKA 4CTCA 2R0IA 4YC3A 5ACKA 3W10A 5BMMA 3OBGA 4JR3A 2FSMX 2P2IA 5C8KA 1RW8A 2WOTA 2Z7QA 4UMQA 5IEVA 4C34A 4BCPA 4DLJA 3VS5A 2B0QA 2X4ZA 2CGVA 2BAKA 3PTGA 4WBOA 5DGZA 3LFQA 4BDDA 4QNAA 3KF7A 4QMOA 4BCOA 3L9LA 4I21A 4FSMA 4IJPA 2FB8A 4K6ZA 4YBKA 4LL0A 3IECA 5DRDA 3RK9A 5A6NA 5M09A 4DA5A 1WBVA 3D7TB 5E7RA 3ZRMA 1RDQE 2YZLA 1OPJA 4LI5A 3BPRA 2BFXA 4DGLC 3GC0A 2X6DA 3UIMA 1DM2A 3FZTA 4U45A 3JY9A 1UV5A 2C30A 4ZLOA 3PVWA 4YJSA 2FA2A 2XBJA 4EQMA 5IQCA 1HCKA 4GS6A 5CWZA 4EH7A 2OIQA 1Q8YA 4H05A 4ANSA 5DR6A 3MY1A 5HTCA 1FINA 3U6HA 2CGWA 4B99A 3KULB 2H8HA 2VO0A 4EBVA 3ZM9A 1MRUA 2X9EA 2UW5A 3OOMA 5BUEA 4FIFA 4XS2A 2PUIA 3C5IA 4BTMA 2UZOA 4JNWA 3AT4A 3M2WA 4O2PA 3TV7A 5IDNA 5M56A 3F9NA 4XG6A 4K11A 5H2UA 3VUTA 2YM4A 1BL7A 3R30A 2Y4PA 3QD0A 5E8VA 2W1EA 2AYPA 3FLSA 3IK3A 3KY2A 4BBEA 3BLQA 2A19B 3MFRA 3ZFXA 4TWPA 1BLXA 1PMEA 4BF2A 4DCEA 5LOHA 4U0IA 3UBDA 3ZXTA 3PG1A 4USFA 4QYEA 1H08A 4YJVA 1OKVA 3M1SA 5TT7A 2PE0A 5AX9A 4USDA 3LFFA 1KUTA 3QCYA 4HCVA 5AMNA 1SYKA 5GJDA 4AS0A 4EUUA 2O64A 3T9TA 2BRNA 3QQUA 5GNKA 3JPVA 2WQEA 2VUWA 2ETMA 2QOQA 3R9HA 4R77A 2YITA 5CVFA 4XX9A 2QOKA 2W17A 3CKXA 4KIKA 2QLUA 4RA5A 1REKA 1Y8YA 3GB2A 5F4NA 5I3RA 2B9JA 4S30A 2XCHA 3LLAA 3HMIA 3QHWA 2NNWB 1H0VA 3RI1A 4YTFA 3WZUA 2OO8X 3S95A 4B8LA 1M2RA 5B7VA 4LRKA 3EQIA 3QCXA 1HCLA 3QRTA 4MVFA 5GINE 4IX6A 1JQHA 2PY3A 3PSCA 4J1RA 3ELJA 5DR9A 4R1YA 3RPRA 4C3RA 3R6XA 1OZ1A 4HPTE 4JI9A 5AM7A 2R5TA 4FG7A 1T46A 2H96A 3JYAA 5HVYA 4PTGA 4DEAA 4FIEA 5DWRA 4D0WA 1PMUA 4QPMA 4F08A 4JVGA 1VZOA 2X39A 4I41A 2PMNX 2XBAA 2XNEA 2XK9A 1IG1A 3C4CA 4R3CA 4USEA 3CIKA 5EFQA 1FOTA 5AR5A 2JIUA 3BCEA 3TZMA 1DI8A 1YDSE 4QQ5A 4BVUA 4BZDA 3QQJA 4KIKB 1GAGA 3QQLA 5JQ5A 3AD6A 1F3MC 4IC8A 3FL5A 3CY2A 5KUPA 4YLLA 4FNWA 4EK3A 5IDPA 5C4KA 1VEBA 4ASXA 4ZAUA 2E9PA 2ONLC 3R1SA 2R0UA 3AT3A 4EOIA 5C03A 2GQRA 1CTPE 4KIOA 4F4PA 5LARA 5M06A 4QYHA 3OCBA 3U4WA 4EH8A 1AGWA 3FSFA 4FG8A 2ZV8A 3ATTA 4FSRA 4OTWA 5AUZA 3O71A 2O65A 3I6WA 4RJ7A 4F7NA 5TKDA 4ZJJA 4I5PA 2J51A 4IIRA 5I3OA 4W4VA 3SXRA 5KHWA 4QOXA 2OICA 3R1QA 4CCBA 4MK0A 2VGOA 4J95A 4YHFA 1PXKA 1XQZA 3DQXA 3F2AA 1JSUA 3DTCA 1MRYA 3PRIA 4A9YA 3KRWA 4NCTC 4HVGA 2XIRA 3K2LA 4M69A 4DBXA 2CLQA 3W18A 2JD5A 3IOPA 1Q8WA 4YJNA 2JEDA 2UZLA 2YISA 4YNOA 5E1EA 4E5WA 5L6PA 5L2SA 1LEWA 3BHVA 3MV5A 5HG5A 3R8MA 5HNBA 5IQBA 3I79A 2W4KA 3EZRA 4RJ4A 3DU8A 5G1XA 2C0IA 3JXWA 3SHEA 3MFSA 3Q9XA 3FL4A 1AD5A 4NJDA 5FP6A 3W2PA 4JG8A 4DH3A 4EJNA 2RF9A 5E8XA 4MAOA 1BKXA 2ITVA 4OR5A 2ITUA 1PY5A 3A4PA 1JPAA 3L8PA 2Y4IB 4GL9A 4JX3A 4FSQA 4LV8A 2BAQA 4BDAA 4OT6A 4CNHA 3T3VA 2W7XA 3DNDA 2Z8CA 4KWPA 4FV0A 2R3KA 4ALWA 5M4IA 3GU5A 1M17A 3AGMA 3NZ0A 3MJ2A 4M69B 4P2KA 3WYXA 5ANOA 4CYIA 4AX8A 4QT1A 4Z9LA 4EC9A 3LCKA 5DMZA 4FTTA 3UVRA 2C68A 3GCUA 5EKOA 4A9UA 3ZXZA 3WBLA 3KFAA 5D7VA 3FYKX 4NZWB 3VS7A 4DTBA 2PVFA 4EOLA 4PUZA 4AZWA 3EL8A 2WMTA 2NO3A 1VJYA 3QLGA 4UMRA 4TWCA 4PY1A 4TYGA 5LCJA 2P2HA 4FKWA 2CMWA 2HY81 5DA3A 3H10A 4U80A 3EQCA 4AF3A 4XG2A 3SG9A 1ZMUA 2I0HA 1NT2A 4F64A 4W4XA 2R3PA 2WQMA 3E8CA 4I1ZA 2C1AA 4MF1A 5J9ZA 4BGGA 4FSNA 5LVPA 2R3HA 1ZY4A 3U6JA 4KUJA 4EOMA 2J0MB 4RX8A 5CSHA 3ZO4A 2FUMA 3ORIA 2GCDA 4ID7A 2YWVA 3R28A 4KBCA 2C6DA 3RCJA 3QC9A 4LMNA 3MWUA 5AP0A 4DFXE 2IW6A 2BZKB 2GPHA 3RMFA 3GBZA 4CKRA 1YVJA 4UZDA 4JDKA 2CNQA 5CSWA 3IONA 4RQKA 4W4WA 4IWDA 4AN9A 4O7VA 4AWIA 5M53A 3OP5A 3RNIA 4YO6A 3AXWA 2W06A 3Q4ZA 5CVHA 3GI3A 3VBQA 5HX6A 2JKQA 1IA8A 4YZBA 4GRBA 3MDYA 5L3AA 1OL7A 3OOGA 4QMLA 4X2JA 2F7XE 5HCXA 4BI2A 4DFNA 1OB3A 2I6LA 3G2FA 3LQ8A 3EZVA 2W9ZB 2ZYBA 3CCNA 3EN4A 3R2BA 1OECA 1UKIA 4HJOA 4UMPA 5AADA 2VTSA 4IBMA 3P86A 3QCSA 4F70A 3UOJA 2VWXA 1YHWA 1I44A 2JAVA 4CD0A 3FPMA 5HD4A 4M7IA 2C6OA 3QBNA 2BDFA 4FVPA 4O7WA 3C50A 3LXLA 1W8CA 3U87A 3BIZA 1RJBA 3NW6A 4GU6A 5EI8A 1WAKA 3EH9A 5A54A 3NRMA 4P5QA 3ORKA 4MXZA 4F1OA 1WMKA 4HVDA 1U4DA 3QC4A 3SX9A 5CNOA 2VWWA 3CPBA 3PFQA 4UZHA 3A7FA 3SQQA 4DEIA 5FM3A 4BDGA 3ODYX 5D7AA 3AD5A 1Y57A 2PMIA 2C3KA 2VX1A 4IX4A 3ORMA 3H30A 3QA0A 3CTQA 3TEIA 5GHVA 2NRUA 4C57A 4G3EA 4ONAA 1KE9A 3BHYA 4DG0E 3UIUA 4FTAA 4PL5A 5E8ZA 2YIWA 3EN5A 3RPYA 4FIGA 5HORA 1VR2A 1CKJA 4PP9A 4JBOA 4NKAA 4CZYB 2HWPA 4HNFA 5DT3A 4H3BA 4IM2A 2UW8A 4EKKA 2WQOA 3MI9A 5CAQA 4YTHA 2G15A 3LCSA 4XV3A 1E9HA 3EFKA 4YZMA 5DG5A 4AZVA 1DI9A 5CEKA 2QO7A 3DPKA 4AFJA 5EW8A 3TKHA 4BI1A 4AN2A 2ITXA 2VTOA 2W99B 3IKAA 4YZ9A 1WZYA 2WKMA 2C6IA 3R7IA 4D4SA 1RQQA 4Q5HA 2SRCA 4QP1A 3NNUA 5BVOA 2VWIA 4H1JA 1KOAA 3HV4A 2CCHA 3LJ0A 3QUDA 4MXAA 3RKBA 4A4LA 2Y9QA 4D58A 2YFXA 3AD4A 4LV5A 5EM5A 1Y6AA 5CAUA 4FKVA 5CF8A 1YOLA 3POOA 2Z02A 4RC2A 4BCMA 4D5KA 5JFSA 5HVKA 3E64A 1NVSA 4LFIA 4NM5A 3UDBA 3AC1A 4RIOA 4V05A 5HE2A 3VBWA 4X2GA 2WHBA 5KMOA 4E5BA 5FG8A 3DAEA 4G3GA 5ANJA 3DKGA 1IA9A 4O7LA 3DJ6A 3QKMA 4HGTA 4ANMA 5HE0A 3H0YA 5GZ8A 2XRWA 5AR8A 3RAIA 1YWVA 3NR9A 1M14A 2E9UA 3WIKA 4CFMA 4DC2A 5IA2A 4U97A 4ZY4A 3KMWA 3W2SA 3ORZA 3POZA 4C38A 4DINA 1Z57A 5HLWA 1BMKA 4FT0A 4XJ0A 5AA9A 2CDZA 4LGHA 4ZLZA 5GIPE 3OD6X 3R73A 1H25A 1U54A 1ZMVA 1XH8A 4XP2A 2RSVA 3SD0A 3WZKA 5M07A 2LGCA 5FLFA 1R78A 3ATSA 4QP8A 3V5JA 5KE0A 3UC3A 2X2MA 1UNHA 2Z7RA 4DGNA 2JKOA 2V7AA 4CFWA 3DFCB 3QX4A 3KMUA 2G1TA 2J7TA 4APPA 3RCDA 3L9NA 3LFAA 3DQWA 3NAYA 3O0GA 3OROA 4RX5A 3C51A 2DQ7X 3QWKA 3FI3A 3MB7A 4FF8A 2WTVA 4CFVA 5IU2A 5BUIA 2JDTA 5JN2A 2ITZA 3RHKA 3QCQA 4DEBA 2ACXA 2ZOQA 4BDHA 1L3RE 4AGUA 4CRSA 3D2KA 2XNGA 4UMUA 3MY5A 2ERKA 3ZTXA 1IAJA 5CU2A 1XH5A 5C27A 4TRLA 3BLRA 4XBRA 2XS0A 5FDPA 3OZ6A 5D11A 5BVEA 2YM6A 3NNXA 1U54B 2JBPA 2RIOA 3FZPA 4HYHA 5E92A 3EYHA 4DH8A 2XJ0A 4OAVB 2XKEA 1ND4A 5M4CA 3IW4A 3CXWA 4FSUA 3AMAA 2EB3A 2CJMA 3OWJA 4YLJA 4BHZA 4DFYA 4NYEA 1WVWA 3GC9A 3OG7A 2W0JA 4YURA 2UW4A 2QQ7A 4KSQA 1CDKA 2WTJA 4PP7A 5DRBA 4M12A 5HG7A 5C01A 1Y6BA 4FKLA 2BAJA 3OW4A 2IW8A 3MVHA 3UGCA 5ACBC 3PJCA 3QQKA 2OGVA 3LMHA 2BMCA 2R3RA 4M66A 4XP3A 2PVMA 3BELA 2OJJA 3HV6A 4ZZOA 4MBIA 2PUPA 3S0OA 4FKOA 3C0IA 3D0EA 4FEVA 5KMKA 4IEBA 4EYMA 2R2PA 5CVGA 5CU0A 4E4NA 3VBXA 4BB4A 4BCKA 3R7VA 1FGKA 5EH0A 2QODA 4FKRA 5HO8A 4FR4A 4E3CA 1OL5A 2BRMA 2C3IB 1TVOA 4QP9A 3ZSIA 2R7BA 3VUIA 3UJGA 2UZDA 3MYGA 5FXSA 3Q5ZA 4FTRA 5KNJA 1OKYA 5LQFA 3TDWA 4AZTA 1PXPA 2HELA 5HE3A 4L01A 3W8QA 5DNRA 2G01A 3ZO2A 3COKA 3NSZA 4O7RA 4E4XA 3KXXA 3U54A 5FQDC 4FYOA 4Y5QA 4O0SA 4KSPA 4RVKA 4F9AA 2ITWA 5J5SA 3NDMA 3OUNB 4E4LA 2FO0A 5JRSA 3FZSA 4WRGA 4MTAA 3BWFA 4JDHA 4Y8DA 2C6KA 3TV6A 4PMPA 4C33A 4ASZA 4D0XA 3U9CA 4RIXA 4B4LA 1ZYJA 5IQAA 2AC3A 2OH0E 4CMTA 5EDPA 5C8MA 2QKWB 3AC5A 3C9WA 3HUCA 4S2ZA 4EJ7A 4JQEA 2UVYA 3LOKA 2I0EA 1Y91A 4O91A 1R1WA 2VO6A 1J3HA 4KKEA 4O7YA 2W1HA 3A2CA 1M52A 1U46A 2B54A 4YJTA 4MBJA 1RE8A 2XKCA 4XMOA 4PV0A 3ODZX 4ZSAA 5HO7A 5CT0A 2C5VA 2CN8A 4OLIA 3LPBA 1QPEA 4C3PA 3EIDA 3R2YA 5CXZA 4I93A 5AUXA 2OLCA 3QQGA 3AGLA 2EXMA 5E90A 2W5AA 3QZHA 3OMVA 2J4ZA 4J8MA 5M4FA 4JIKA 4MKCA 4ZMFA 1ZXEA 2J90A 4F7LA 4G17A 4FIHA 5JMSA 3D2IA 2QVSE 5FDXA 5IMEA 3IDPA 3UMWA 4YU2A 5A6OA 2WTKC 3V5QA 4X3FA 5DN3A 4PQNA 3BEGA 3NUNA 4DT8A 4QMXA 4UB7A 5ANGA 4JT3A 3DLZA 4QPAA 5EKNA 1GIJA 1H4LA 3Q04A 4AT3A 5CSXA 3FMJA 3VF9A 2OI4X 4PF4A 3UIBA 4TT7A 3PIZA 3FHIA 2PE2A 4RGJA 4IZAA 2C3JA 3FKOA 1DAWA 1YXTA 3RPOA 1UNLA 2UZEA 4EORA 3CR0A 3FMHA 3MA3A 4O38A 4R7HA 1GZKA 3NYOA 4AUAA 1OGUA 1SZMA 3QFVA 5IISA 2QD9A 3QKKA 3CQWA 5D10A 2PU8A 2J9MA 4G34A 5KO1A 2B4SB 5HBEA 2CNUA 4D1SA 4CKIA 4QMPA 3H4JA 4C59A 4EZ3A 4F6WA 3Q6WA 2W4JA 4FK6A 2V0DA 3G33A 4A4XA 3HMPA 1ZYDA 2BTSA 2QOOA 4O96A 5AP1A 3TT0A 3RWPA 3NVKI 5M51A 4XYFA 4BR3A 1WBTA 2W1IA 4K0YA 3F5GA 3U8WA 4EZ5A 1YW2A 2GNGA 4MNFA 3LFBA 3M11A 4RSSA 2QHMA 5M08A 1JSTA 2J2IB 4XLVA 4CEGA 3N4UA 2NPQA 5AR3A 1DS5A 4BKJA 1YXUA 3I6UA 2VWBA 3P7BA 4AZFA 5I9YA 5T6KA 4EK5A 4HW7A 3FE3A 3WE4A 3TNQB 4YP8A 3TUBA 4CV8A 1H27A 3GCPA 1OL2A 2OZOA 4AOTA 5D9HA 4ANBA 3KN5A 2QONA 3LVPA 3O8UA 3ROCA 1BI8A 2YCRA 3UO5A 1TQPA 2XIYA 2VO7A 4IAKA 3O2MA 3R7EA 3DBFA 3IGOA 3R01A 3LFSA 4TYHB 4DEHA 3OW3A 4BC6A 4CG9A 5D41A 3MPMA 3CQEA 4WSQA 3TJDA 4L68A 1I09A 3OCTA 4XG3A 3Q4CA 3SV0A 3QGYA 3W55A 2YERA 5BQ0A 4MWIA 4IQ6A 4C02A 4HGEA 1ZZ2A 4ZP5A 1PXMA 2JFMA 4FV5A 3UE4A 4J98A 5CSVA 3TIZA 3Q4UA 1GZ8A 4TWNA 2YDKA 4ZJIA 3ORLA 3QYWA 5CF4A 3UNKA 3NWWA 5LWMA 3F82A 2R64A 4FEQA 4EOPA 2W1CA 4F6SA 3TWJA 3ZLWA 2GU8A 4IJ9A 4WD5A 1JBPE 3Q53A 4FUXA 2UZTA 2W1ZA 3NUYA 3VHEA 3PP1A 2YLFA 3Q52A 3BYUA 4QPSA 2VD5A 2C47A 3VBTA 1XBCA 4BCFA 5B2KA 2R3OA 4FTIA 3PA5A 3OCGA 5HCYA 1J7LA 2IZRA 3W8LA 1KV2A 3HUBA 4ZK5A 4FKGA 4FSZA 4GT4A 2OJIA 3WI6A 3UZTA 3DK3A 2VX0A 4J71A 4YZDA 4I24A 4E5AX 2XK3A 3F5XA 3FV8A 2QOCA 4JIAA 4JX7A 4X0MA 3VS2A 3NEWA 5K5NA 3ZBXA 3PPKA 2BZJA 4EH5A 3FMEA 3EN9A 4FYNA 3UYTA 4NFMA 4CTBA 3FUPA 4ZMEA 2C69A 2UW0A 3ULIA 3VJNA 3V5WA 4C37A 3ZLSA 4HGLA 5E8WA 3F61A 4FIJA 4W9WA 3F7ZA 4WNOA 3K5VA 4RVLA 3AC2A 4C7TA 2IZSA 2OIDA 3GENA 2GFCA 1PJKA 3FKNA 3W16A 1FVRA 3D14A 4U6RA 1FGIA 3PZEA 5TO8A 4CZUA 5AJQA 2OIBA 2HCKA 2WTKB 1OUKA 3MTFA 4N0SA 1ZZLA 3MFTA 3D5UA 2ZM1A 3D83A 3E93A 4GH2A 4EOJA 2YCQA 4Q9ZA 4CVAA 5IF1A 3QTWA 5EDRA 2QOIA 3HX4A 5IPJA 4ACCA 3DKOA 4I5MA 4KINA 3N4VA 5ETAA 3HV7A 4G31A 5CEMA 3MESA 4L00A 4FTOA 5CEOA 2XNBA 5T68A 4OUCA 3OWKA 4ANOA 5HD7A 3KB7A 5D12A 4FKTA 3EQRA 3TNPC 4GJ2A 5C1QB 3ALNA 3UYSA 2Y4IC 4TXCA 3L8VA 2HY0A 4P5ZA 5GJFA 4DFZE 3ORNA 5H8BA 4R3PA 4OAUC 1V0OA 2ZVAA 4GUEA 4FTNA 4UBAA 3HMOA 5E9EA 4O1PA 3ZDUA 3H9RA 5HLNA 3B2WA 5HU3A 3TIYA 3EN6A 1W82A 3R8UA 4BDBA 3EOCA 1OIQA 2PVYA 3LXNA 4FV9A 3JR1A 3MVLA 4O7ZA 1XH7A 4MNEA 4E20A 3IOKA 3DAKA 5GIOE 4DHFA 2WFYA 1Q4LA 1V0PA 2GHMA 3V5LA 3HV3A 4KRDA 4RFYA 5EW3A 3AOXA 2XYNA 4ACMA 1OMWA 3SA0A 4UWYA 2A27A 4IM0A 4BIDA 5CXHA 2Q0NA 4QP7A 4GIIA 4OTRA 4BI0A 1PXLA 4HNIA 3O8TA 1KE8A 4IX3A 4NTSA 3FI2A 3DXNA 5DT4A 2FYSA 4U8ZA 1GIIA 2XKFA 2WNTA 3KMMA 4O1OA 4B8MA 4F0GA 3F2RA 2R3LA 2VNYA 1BYGA 3HRFA 1M7NA 4HOKA 3NGAA 4IAYA 4EL9A 4AA4A 5K4IA 4KAOA 3QRUA 2GHGA 5IA3A 2WELA 3V04A 4M67A 3GCVA 5ETFA 3GCSA 3Q6UA 4ZEGA 3EFWA 4MNEB 3R9OA 1WVYA 1GIHA 1LEZA 2R3QA 4FG9A 4FV4A 3TV4A 5L8KA 1YWNA 3PG3A 4CYJA 1MQ4A 5K9IA 4MD8E 3RNYA 4X6QC 2VU3A 4FSWA 5CLPA 4E6CA 3VBYA 4FA2A 3WE8A 4EONA 3LE6A 3UO4A 1ERKA 3C4XA 4I6BA 4W9XA 1SVEA 3EFLA 4O0VA 2A1AB 2BKKA 4E6AA 2Q0BA 4FC0A 4I5HA 4CQGA 2WU6A 4G6LA 1IR3A 3SOCA 5FEDA 3RK7A 5HX8A 5K4JA 3UG1A 5LVNA 4L52A 3SRVA 1H1QA 3ORTA 3W2CA 2VTLA 1SVGA 3K5UA 2C5XA 3DFAA 4R7BA 2WB8A 3R83A 1XH6A 4D1ZA 3OHTA 3P5KA 3THBA 4BCQA 4YJOA 1NY3A 1STCE 3P08A 3Q9WA 4JRNA 4UYAA 1Q61A 3VUDA 3JVRA 3DXPA 4O0TA 2R3NA 3C4ZA 3ETAA 4YO4A 3DKFA 5JKGA 1M2QA 3QTXA 5EDQA 3BGQA 2RGPA 3NNWA 4L7FA 5AP7A 3EQGA 1WVXA 4L8MA 3V51A 4F0FA 3C1XA 3EYGA 1TQMA 4HYIA 3L8XA 3SRVB 3E3PA 4AW5A 5JT2A 2BIKB 2B1PA 2QURA 4ZTRA 1J7UA 4ARKA 4J8NA 2JC6A 4G2FA 2YIQA 1KE7A 3MH1A 4PPAA 4EBWA 3EKNA 4NM0A 5ICPA 4KIPA 2WXVA 3TJCA 2GQGA 4LM5A 3FZRA 3OY1A 3QTUA 4Q2AA 3LQ5A 4FVRA 4RC4A 5A3XA 2I7QA 4BKZA 3F5PA 2A0CX 2JAMA 2WD1A 5KKRC 3KU2A 5B0XA 4M15A 4AW2A 5FP5A 1XKKA 3W1FA 5A14A 3V5TA 1Q5KA 3FY0A 4NW5A 3VULA 3CJFA 4L46A 4AAAA 4NT4A 1YOJA 3RWQA 5LXMA 2VTQA 4FICA 2E2BA 4H1MA 2UW3A 1OKZA 3BU6A 4O84A 4QTBA 4EK6A 4AN3A 4A07A 3TUDA 4ANNA 5C9CA 1IEPA 5CU4A 5HG8A 4F7SA 1T45A 3CGFA 3HEGA 3FXZA 2Z7LA 4BDKA 5AUUA 3FC1X 2J0IA 4JBQA 4PMSA 4JG6A 2JIVA 3W33A 3MSSA 5DIAA 2QU6A 2P3GX 3FPQA 1PKGA 4RWJA 1LR4A 4XNEA 5ANEA 3ZOSA 2XEYA 3FI8A 4FL2A 4KA3A 1H1PA 3WZEA 4IDVA 2UW7A 5HBJA 5IA4A 1O9UA 1XBBA 1FBNA 2H9VA 5FUTA 3OY3A 4NFNA 4BWKA 2HENA 4E93A 4K18A 3QQFA 4IH8A 1X8BA 3E62A 3QHRA 5HLPA 4BGQA 4FGRA 2O2UA 4ZS4A 2XJ2A 4FUYA 4C4EA 2F57A 2CKEA 3OBJA 1ZARA 3G0EA 1VYWA 3ZS5A 2PK9A 3RK5A 5KMJA 4D4VA 3ZEPA 1PYEA 3CE3A 2Z7SA 1U5QA 2V55A 4FTLA 5AR2A 1OUYA 4AXAA 4BCIA 4BCHA 2OG8A 5DHJA 4FV1A 5H8EA 3QZGA 5J95A 4L9IA 3ZUVA 2WMQA 1K3AA 3F5UA 3HMNA 5EM7A 4TL0A 5I9UA 4G9RA 2UZBA 1VYZA 2C4GA 4Z3VA 4DN5A 4B6LA 4RWKA 4EUTA 3BBWA 2B7AA 4OT5A 3EQFA 4FMQA 4I6FA 3S4QA 3PSDA 3WF8A 5HCZA 3VS4A 2YWPA 3LW0A 3HA8A 2PZPA 3PP0A 4BIBA 5FEQA 2XM8A 4LOQA 4QP2A 5I9VA 4O0XA 3D5XA 4L7SA 2PZRA 3C4EA 5LJJA 3FYJX 3RPVA 5FTOA 4N4SA 1K2PA 3CS9A 1W84A 1W0XC 4NKSA 2QNJA 5HG9A 3D9VA 2IW9A 3RBWA 2OWBA 1BUHA 4G1WA 4I6HA 4I94A 5LMBA 2Y8OA 4FSYA 4BFMA 4FEXA 3KREA 4XG4A 4W4YA 3SAYA 1YXVA 3LCTA 2HZ0A 3EJ1A 4O2ZA 5CYIA 5F94A 4IMYA 1TKIA 4FSTA 2IVSA 1ZMWA 4UWBA 4AE9A 4K33A 1OPLA 4F9BA 3WF5A 3RM7A 2YLEA 4IX5A 1J91A 2XF0A 4AW1A 3TG1A 2Q83A 3B2TA 2F2CB 2GNIA 3MBLA 1NVQA 2E9OA 1FMOE 4LYNA 3P1AA 3KA0A 1CMKE 2YHVA 4P4CA 3KGAA 3TNHA 3BHHA 4R1VA 3QTQA 5LMKA 5C4LA 1OIUA 4QP4A 2VTTA 3BYOA 3I5ZA 4JR7A 3VRYA 4M97A 5DLSA 1NW1A 3ACJA 4MHAA 1U59A 4CMUA 4QNYA 3PVUA 4AZSA 3AMBA 1SNXA 4FT5A 2EXCX 3PPJA 4X7QA 5FXRA 3V6RA 4O0WA 3REPA 5I4NA 4WUNA 5FM2A 1H28A 5EYMA 2ZAZA 4O6LA 4R5YA 5JH6A 1YI3A 3ID6C 5IH5A 4D28A 2R7IA 5HZNA 4BCGA 3CP9A 5HICA 3UMXA 5HGIA 4R7IA 1WCCA 3Q5IA 4NU1A 1MRVA 3I1AA 4YC8A 3G0FA 3HRCA 5CSPA 4QP6A 4WG3A 3D94A 5KKRB 2QKRA 3R1NA 4JDIA 1Q3DA 3HL7A 2WMRA 2Y0AA 1IASA 4U43A 3N51A 5CZHA 4IVDA 2X1NA 2ZJWA 3L9MA 5DPVA 5CALA 4EH3A 5AWMA 2ETRA 4GFGA 1J1BA 5AUTA 1H00A 2XK7A 1WBWA 4WOVA 2PE1A 3OTUA 3ZU7A 3S1HA 4O83A 3F7WA 4RBLA 4AT4A 5F9EA 3P7AA 5ETIA 2UUEA 4D2VA 2GMXA 3LMIA 3R7YA 2REIA 2B9IA 3LLTA 1OL1A 3UG2A 3LM5A 3QTZA 4U42A 3OC1A 4FODA 3BU5A 3DK6A 1OIRA 4RA4A 4YJQA 3LFEA 4M0YA 1UVRA 5F95A 2H6DA 4W8EA 4JLCA 2I0YA 4ANQA 4TKSA 4TN6A 1V1KA 4FTQA 2ITOA 1PXIA 4QMSA 4YLKA 4G9CA 4MQ1A 5ANKA 4EOSA 4XG7A 4IZ5A 5AV0A 2FVDA 3KN6A 5E1SA 2WMXA 3DBCA 3JS2A 3LFNA 3PLAE 2XCKA 3EKKA 3ITZA 3GU4A 2B55A 1ZOEA 3VIDA 1WBSA 4DF3A 3HAMA 1Q8TA 1B39A 2QOFA 3PJ3A 2FSTX 4M0ZA 3SXFA 3PJ8A 4FV7A 3ZC5A 4GUBA 2QOBA 3SG8A 4XHKB 2O63A 4ITIA 2YM7A 3G6HA 2BRGA 3EN7A 3QRKA 4J7BA 3OEFX 3ZFMA 5A4EA 5BUJA 1KSWA 2QHNA 3D7ZA 3ALOA 2OFVA 2IZUA 3O96A 2WMAA 3TCPA 4C4IA 1O6KA 2WTDA 5E91A 4GG5A 4F7JA 5IQEA 3HZTA 3PA3A 1A9UA 4XUFA 5CY3A 5HESA 3ZC6A 2XNPA 4NW6A 3UOLA 3OEZA 4U40A 2O5KA 2UV2A 3HKOA 4IAFA 4C0TA 4CMOA 3NAXA 3PVBA 3LCDA 3CLYA 3MVMA 2CSNA 4HCTA 4IDTA 3LAUA 3B8RA 3KK9A 2CN5A 4U9AA 4E6QA 5J1WA 4IC7A 5G6VA 3A7GA 2V7OA 4PDSA 5J7BA 3QX2A 2X8DA 2VRXA 5BNJA 4HGSA 4O22A 1ZLTA 3FMLA 5IH6A 2OF2A 2YJSA 3MJ1A 5LCKA 3R9DA 4FZ6A 3WZDA 3ZDIA 4ASEA 4PNIA 5DVRA
chains in the Genus database with same CATH superfamily
4FT9A 4D2WA 3FQEA 1YXSA 3K3JA 4U79A 5JSMA 3EB0A 1KE5A 1Q3WA 3BQCA 3P23A 3I7BA 1K9AA 4ZSEA 3LKMA 3OXIA 4U81A 4CFUA 3ML1A 2P4IA 3W2RA 4IB0A 3CY3A 2X0GA 3LMGA 2C0TA 2X6EA 4C58A 2ETKA 5L4QA 3W32A 1XBAA 1VLRA 4CT1A 2BKZA 3DB8A 3F88A 4C61A 4WUAA 3CBLA 3KKVA 4I23A 3IDBA 5KZIA 5JFWA 3FLYA 2XMYA 2ITTA 4FVQA 4C35A 4I4EA 5CENA 4G5JA 2UZUE 3PRFA 4RPVA 4BGHA 1SVHA 2BCJA 4OTIA 5DI1A 1ZWSA 2WAJA 4UMTA 4EH2A 1U5RA 2ZM3A 3MGYA 4QP3A 5CEPA 3UPZA 3UZRA 4UV0A 4LUDA 1OL6A 2QLQA 5EG3A 3SXSA 4E8AA 4Y73A 1Q8UA 4B0GA 5HTIA 4AA0A 2R3IA 1P4FA 5EHYA 1ZYSA 2WEIA 2PPQA 3BU3A 4L6QA 3ZONA 4YJPA 3K3IA 5J7HA 3VRZA 5CU3A 2XM9A 2QO2A 5BYZA 2VAGA 4I92A 3VNTA 4DHJA 4RFZA 2DS1A 2WMWA 3DV3A 5KBRA 1ZRZA 4DFBA 2UZNA 3W0QA 4KBAA 2GFSA 4X6RA 4FKQA 4IVBA 2YDJA 5HEZA 5JQ8A 4YZCA 3B8QA 4H36A 4XG9A 1F5QA 4D5HA 4L42A 1KE6A 1JWHA 1YI6A 2O8YA 3BI6A 3LJ2A 3KQ7A 1HOWA 5KMNA 4BDCA 3OTVA 3H9FA 3L9PA 3MTLA 3RALA 3MPTA 3AC3A 1UNGA 2PZIA 3DZOA 4K8AA 3W2QA 4QQTA 4FEWA 3VS1A 5BPYA 2WTWA 5AIKA 1YDRE 2YJRA 3LM0A 4L53A 4DAWA 4KB8A 4YPSA 5AAGA 2IO6A 2X7FA 2E9NA 3CQUA 3G51A 3JUHA 3W2OA 4EHEA 4Z55A 4O7SA 3MH0A 3PXQA 3KXHA 3IQ7A 4ANLA 4DDGA 2WMSA 2X2LA 3ERKA 3PY1A 4FZ7A 3FZOA 4RIXB 2H34A 4IVAA 4F0IA 2HXLA 3ANQA 4GYGA 4QMZA 4C36A 1FVTA 2WMVA 5DT0A 5H8GA 4ZXTA 2F9GA 3QD2B 5L2IA 2Z2WA 1XHAA 4C4GA 5FXQA 4BTJA 4G5PA 4WNMA 4U3YA 3ZSGA 4ZTNA 2X7OA 5M55A 4WSYA 2JDRA 2VTIA 3QU0A 3C4FA 2PZYA 3R8LA 3NYNA 3GU6A 3NMUF 3R22A 2GNJA 3UO6A 3OXZA 3PXYA 4M13A 2J0LA 5B2LA 1SNUA 4OGRA 1R39A 4FK3A 4PMTA 2XNNA 4GT3A 4C4JA 2NP8A 3GOKA 3H9OA 1TQIA 4TPTA 4RJ5A 2EWAA 3NIEA 5CF5A 4ZSLA 1PXOA 3V8WA 3C5UA 3UDTA 3BE2A 3OWLA 3R7UA 4YMJA 4B7TA 4L44A 2CKOA 5L8JA 4FT7A 1JKKA 5CU6A 4XOZA 3IW5A 5AUVA 3T9IA 4EH4A 3GEQA 1TFFA 1MP8A 4JXFA 5L6WL 3C13A 4O86A 3PE1A 4BJJA 2PSQA 4RVMA 2JKMA 4XOYA 1LUFA 1PHKA 4FGBA 4X3FB 5E8TA 4C3FA 5KX8A 2WMBA 3BGZA 5AR4A 3I60A 4FNZA 4FTMA 2BILB 2VTPA 3Q4TA 3NUSA 4O27B 4QQCA 5GZ9A 3OVVA 3O8PA 2ZMCA 2RG5A 3F69A 3DB6A 4RJ6A 5CQWA 3IDCA 1Q99A 2B9FA 1P2AA 2QR8A 3CKWA 4ACGA 2XH5A 4QMVA 4P90A 2XNOA 4YHJA 2IN6A 1FQ1B 5J87A 3HA6A 4RG0A 5HVJA 2CCIA 4RJ3A 3NYVA 3ZEWA 3I7CA 4WNPA 3WZJA 4GK2A 4DCAA 3F3WA 3ZLXA 1WBOA 4BL1A 5DBXA 4E73A 1PMNA 1YOMA 3ZZWA 1GZNA 3O7LD 2HZNA 3PIXA 2DWBA 4L3PA 4A4OA 3AKJA 5K5XA 3QZFA 5BX0A 4Y46A 4JL9A 4RIYA 4C62A 1P14A 2IVUA 4H39A 4KS8A 2W1DA 1Q24A 3KCKA 3ORXA 4QMWA 3OXTA 4E1ZA 3UP7A 3GC8A 4QMUA 3BE9A 5E8UA 4IWPA 3T3UA 3EQDA 4Z7GA 1YDTE 2ZV2A 4GYIA 2PTKA 4PDOA 4GFOA 3FQHA 3C0GA 3O51A 1CKIA 4PWNA 4GJ3A 2UVZA 3BKBA 3LJ1A 4IAAA 3PLSA 5T3QA 5JRQA 3QA8A 3SKCA 5BYYA 2BZIB 3R7GA 5I9XA 3Q96A 2YM8A 3QYZA 4CRLA 2GS6A 5KHXA 5KZ0A 4AAYA 3ZRKA 2PUUA 5L8LA 4BY9E 4UXQA 4ZOGA 4E26A 1UU3A 3E92A 3FLWA 3E7VA 4RIYB 3GUBA 4IB3A 4LOOA 4D2PA 5JK3A 3ENMA 1WBNA 3FHRA 4ERWA 4P7EA 4BZOA 5CQUA 3ZH8A 4WNKA 4BBFA 4DBNA 1PRYA 2X4FA 4GEOA 1XH9A 3BYVA 4S32A 3I81A 3KC3A 4FKSA 5EYKA 2VTRA 2VWVA 3RP9A 3O17A 3C7QA 4BICA 5M57A 3ZUTA 3HDMA 4WG5A 3RTPA 5IQGA 3PXRA 4IZYA 4ZSGA 2JDOA 4BN1A 4JBPA 3TTIA 5ANDA 3IW7A 4BWPA 4QYGA 4JJRA 4HVSA 3PY3A 3Q9ZA 4KBKA 4FTJA 4D2RA 2G2IA 4KKHA 4QMQA 5CAVA 3S2PA 5KMIA 1E1XA 1BL6A 2HIWA 2W1GA 1AQ1A 2W5BA 3GP0A 2WZJA 3HNGA 3KK8A 2HK5A 4FV3A 2YM3A 4ZTHA 3ZZEA 3IPHA 5EW9A 5E4HA 3S3IA 4O7TA 2GSFA 2WGJA 4GK4A 1YQJA 4YTCA 2EU9A 3RPSA 5IA1A 2X8EA 4G16A 4G3CA 5F1ZA 2YEXA 3UOKA 1URCA 1ZAOA 5C26A 4DEEA 3D5VA 1YXXA 2ITQA 2AUHA 1Q97A 3HV5A 2XJ1A 3PXZA 4ZY5A 4DITA 4RC3A 3VW8A 4FKPA 4N57A 4BDFA 4U3ZA 4AGDA 2CKPA 2HZ4A 1JKTA 4D4YA 4PPCA 3RM6A 3D7TA 5DFPA 4FE2A 4CQEA 1G8JA 4JAIA 2J5EA 3EHAA 3GT8A 4V04A 5AUYA 2IVTA 2DYLA 4RVTA 3R7OA 4CCUA 3RAWA 2HW6A 4M68A 2QCSA 5EYDA 4I3ZA 3TKUA 1SMHA 4BCJA 4UWCA 4A9RA 2JBOA 2XA4A 3VVHA 4QYYA 4NH1A 4OTQA 4GK3A 2ITPA 4I6QA 4IAIA 1YRPA 3DGKA 3E8EA 3HLLA 2IVVA 4MD9E 3VJOA 2CGXA 2YAAA 3FLZA 3PZHA 3KULA 4TW9A 1S9IA 3OFMA 3TMOA 3VQHA 2PUNA 5AV1A 4OTDA 4JMQA 2XK6A 5FBNC 5K3YA 3BGPA 3HRBA 4WRSA 2C6EA 4MX9A 4GU9A 1JLUE 3Q32A 4LQMA 1UU8A 2PVNA 3F3TA 2OXDA 4MEDA 4JRVA 4A9SA 4XV1A 5A4LA 3GQIA 3WF6A 2ZDUA 4U44A 4DGOA 4IADA 4D1XA 4GSBA 1ZOHA 4XCUA 2VTNA 2OSCA 2PL0A 2VTAA 4BTKA 4IE9A 1NXKA 3C4WA 4XLIA 5BVNA 1MQBA 3I0OA 2OJFE 2QC6A 3QTIA 4Y5HA 1H8FA 4DYMA 4EK8A 4ZJVA 5CX9A 5IEXA 4LUEA 5AUWA 5EOBA 3DJ7A 5AP4A 1OBDA 4XP0A 2FSOX 5F20A 2QR7A 3KRJA 1MUOA 4UN0C 4R5SA 2JDSA 4EZ7A 4BDIA 4NM7A 3LFDA 3VUHA 3QTRA 2AC5A 3QGWA 4BIEA 4I0RA 4O81A 1YHSA 4EEVA 2LAVA 3E88A 3WILA 2W4OA 3R1YA 5JGAA 3MFUA 1O6LA 4D9UA 2HOGA 4AXCA 4QDVA 1OKWA 4LMUA 1L8TA 5JZJA 5IUIA 3O23A 1FPUA 4FTUA 4FIIA 4HPUE 5CNNA 4S31A 2YZAA 2YIYA 2X81A 3F6XA 3TKIA 2VX3A 2WU7A 5EHLA 1YKRA 3CD3A 4ENYA 2VTHA 3G15A 4MF0A 1QCFA 2RKUA 3I0QA 4J96A 4QYFA 4EWHA 3WOWA 5TR6A 1JOWB 4GFMA 2JKKA 3NYXA 3F66A 4Y95A 4ACDA 5HQ0A 3O5AA 2BRBA 3OT3A 5FWKK 3VS6A 2ZMDA 3SW7A 4RX7A 1W7HA 3FWQA 5CAPA 2C5YA 3FC2A 2XK4A 3KXZA 2RFDA 5IH4A 2X8IA 4I20A 1G3NA 3FZ1A 5DH3A 4U5JA 2B9HA 3ZO1A 2C6MA 4Y72A 5CASA 3V3VA 1W83A 3TL8A 4BBMA 4FZAB 4X2FA 3P78A 3EFJA 4TYIA 5L2TA 1G8SA 3PYYA 3WYYA 3LXKA 2I40A 3QRIA 1ZY5A 3H3CA 4NSTA 5IKWA 5E8YA 5CZIA 5HE1A 4EH6A 4C2WA 3PUPA 2BPMA 2P55A 3MH3A 3R04A 4RRVA 4CFXA 3PE2A 1OVEA 2Y7JA 3IO7A 4L67A 5CEIA 1OBGA 1APME 2RL5A 2Z60A 3GXLA 4DH1A 1XJDA 3AG9A 1H1RA 4DHZA 1REJA 4NEUA 2WEVA 4CKJA 2OJGA 3GVUA 3PA4A 2XB7A 3FQSA 4JQ8A 4F9CA 5BVKA 2RFSA 3OT8A 3P9JA 2JFLA 4S33A 5DE2A 4IB1A 3DBEA 1Y8GA 4PX6A 3UPXA 3NVMB 3TDVA 4MXCA 3PY0A 4CFFA 3W0SA 2BRHA 3G5DA 2F7ZE 2ZB0A 3NNVA 3TUCA 1P4OA 3NUUA 3O7LB 5LMKC 3QXOA 2IG7A 4KNBA 5HO6A 3VWAA 4O82A 1FMKA 4G3DA 4NJ3A 3TNIA 4CSVA 2VWYA 2F49A 2NRYA 3D5WA 4U7ZA 4FI1A 3ZSHA 2XKDA 5J1VA 4L43A 5LMAA 4Z7HA 1UWHA 1YI4A 5LWNA 5BVWA 3CC6A 3DJ5A 5EK7A 4JOAA 2XIZA 3NS9A 4O4FA 4ALUA 4O21A 5HIEA 4O4CA 2X2KA 3QQHA 3TACA 3PXKA 1WBPA 3AC4A 4HZRA 4TTHB 3A8WA 5DOSA 5JEBA 3U9NA 2VGPA 3VUKA 2IJMA 5LVMA 2YCSA 3OUKA 2KULA 4X2NA 5FBOA 3UNJA 2J5FA 3FXXA 3SGCA 4NIFA 3GC7A 3IS5A 3NW7A 3TM0A 3E63A 4NL0A 2OU7A 2QI8A 4MBLA 4ZIMA 4M84A 4RJ8A 3BBTB 1XH4A 5J9YA 4J99A 4C8BA 4EH9A 2ITYA 3L8SA 3CTJA 3V8TA 4EI4A 1KOBA 2WO6A 1H24A 4AZEA 3L1SA 4PMMA 5EQYA 4OTGA 3QF9A 3OF0A 2PVKA 3UODA 3ZLYA 4TY1A 2VNWA 3SW4A 3TTJA 3DZQA 3VF8A 4AQCA 4N6ZA 4HVHA 3DXQA 2YACA 3E3BX 4ENXA 3Q60A 3A62A 3LFCA 4I5CA 2YCFA 3VN9A 2X9FA 4IM3A 4D55A 2UW9A 3CGOA 4IACA 2BTRA 4ZTQA 3P79A 5FTQA 4X3FC 3VS3A 1P5EA 4F63A 2ZDTA 4NIFB 5AAEA 3DBQA 4IWQA 5I5ZA 3NCGA 1PW2A 1G5SA 4OW8A 3BZ3A 3UZPA 4L3LA 4LV7A 5D1JA 3LHJA 2XK8A 2QO9A 3C0HA 5FGKA 3RVGA 3TXOA 4DGGA 5L6OA 4QMTA 3VC4A 5EQEA 2YA9A 3GQLA 2OZAA 4D4RA 2J0JA 3N9XA 3QRJA 2R9SA 4MCVA 2CLXA 3FEGA 3RGFA 4BCNA 2XP2A 4RLKA 4I0TA 5KMMA 5IG1A 4PDPA 3CJGA 5BVDA 1E1VA 1Q62A 2ONLA 3PIYA 4XBUA 4ZZMA 3QD4A 3QZIA 3VW6A 5M44A 1BI7A 5DYJA 2BR1A 4UALA 1JSVA 4AU8A 1JNKA 3D4QA 3R9NA 5EM6A 4K2RA 1PF8A 2RG6A 5FTGA 4FOBA 2XALA 4PL4A 3UP2A 5CI7A 3V8SA 3H0ZA 2WIHA 3MA6A 2KTYA 5IZFA 1OIYA 3V01A 2JLDA 3Q2JA 4YJRA 1JKLA 3LCOA 1ATPE 1XR1A 2CGUA 4C4HA 3MB6A 5K0KA 3DCVA 3FJQE 3A7IA 4IHPA 4OBPA 4XH6A 1Z9XA 3ACKA 4GT5A 2XYUA 4EYJA 4GKIA 2V5QA 2X7GA 3DT1A 3K54A 2OZAB 4N70A 2HZIA 3EWHA 4NCTA 4R6VA 3A60A 4GIHA 3S00A 3KRXA 5HIBA 5A4QA 2EB2A 4H3PA 4E4MA 3IGGA 2R3MA 4PNKA 5CANA 3VONA 4BYIA 3MN3A 2PYWA 1UU7A 2ITNA 4FV6A 2FH9A 4OBOA 3KCFA 3CD8A 5JGDA 1QL6A 3G9LX 3HECA 3MVJA 1YWRA 3E87A 4BKYA 4UEUA 4IAZA 3LIJA 3RINA 3BHUA 2XEZA 3GCQA 3CPCA 2JITA 2B52A 4AGCA 5AA8A 4DTAA 4CV9A 5C8NA 5LVLA 2YDIA 4K9YA 5HTBA 3OCSA 3NPCA 3FAAA 4NTTA 4Z16A 4G6NA 2A4LA 2BVAA 5AP2A 5HKMA 3WF7A 1A48A 2XNMA 5J79A 3RAHA 2BZHB 1IAHA 1H07A 3ANRA 4R3RA 1V0BA 4PPBA 3NCZA 5M4UA 2YIXA 3COMA 3DDPA 4O7NA 5KCVA 1BX6A 2ERZE 1OPKA 2ZV9A 3ZMMA 3VUGA 1Q8ZA 4JBVA 4DT9A 3HP5A 3PJ2A 5AEPA 5EYCA 1O6YA 4DEDA 2I0VA 4RT7A 4GV1A 4RX9A 2VWUA 2IEWA 4FEUA 2GTNA 2UVXA 4Y83A 4GKHA 4FV2A 4CGAA 3BLHA 2CPKE 5ETCA 2EUFB 1H26A 4N6YA 4E6DA 5JFXA 2PULA 3U6IA 2C6TA 3EQHA 1NA7A 5AP6A 3VQUA 4D2SA 3FMKA 5H9BA 1UU9A 5HI2A 4AP7A 4APCA 4RFMA 2QU5A 3BRBA 3TN8A 3A61A 1R0EA 4MXYA 1R0PA 4YSJA 3PDTA 3AT2A 3UQFA 5IA0A 3MPAA 3DNEA 5CEQA 1PXNA 4IXPA 1ZYCA 3IW8A 3HYHA 4YSMA 4HZSA 3DK7A 5AP5A 4Q9SA 5KMLA 2PVRA 2PHKA 2ZB1A 4EKLA 3F3ZA 4EOQA 4QMNA 4NWMA 5DEYA 4ZTMA 4DEGA 3ET7A 2Y6MA 3COHA 4WG4A 4B9DA 4I4FA 1LPUA 3KXMA 4GVAA 4H58A 1CKPA 2V22A 4PL3A 4ERKA 3A7JA 5JFVA 3F3VA 3AMYA 3V6SA 2HAKA 4L3JA 3ULZA 4OBQA 1F0QA 5BV3A 5EM8A 3HDNA 4AW0A 2VV9A 4XV2A 4HYSA 2F2UA 3W0MA 1B38A 3R63A 4C4FA 4O6EA 3JVSA 4E7WA 4AT5A 4K77A 5K0XA 2BFYA 4CG8A 3QUEA 4XG8A 4A06A 4YHTA 1NVRA 4YPDA 1EH4A 3OS3A 2RFNA 4F1MA 2B53A 2GNHA 2GNFA 2JGZA 2OH4A 2W05A 5E8SA 3RJCA 3UC4A 4FNYA 5A4CA 5A4TA 3KL8A 2PVLA 1LP4A 3DA6A 3CSVA 1QPDA 1W2CA 3OWPA 3P0MA 4XRLA 3EQPA 4YNEA 4WT6A 2OXXA 5AV2A 4X2KA 3R8PA 4EOKA 4RZWA 2BHEA 2HWOA 3MIYA 4RIWA 4AG8A 1J1CA 3U55A 3IW6A 3FDNA 4FZDB 4IW0A 3HP2A 4O0YA 4TWOA 1ZYLA 4BDEA 5A46A 2XIXA 3EQBA 4EHVA 4R78A 2VZ6A 1Z5MA 4FL1A 3N4TA 3KRRA 1R3CA 4Y85A 5IUHA 2VWZA 3QTSA 2P33A 1H01A 3F2NA 4M3QA 5IA5A 5IUGA 3E5AA 2G2HA 5HBHA 3SOAA 3FMMA 4MWHA 2XVDA 3PWDA 3GNIB 4DG3E 3NW5A 4DTKA 5HU9A 2C5OA 3FKLA 2WQBA 5J8IA 3TZ8A 4HVIA 4BDJA 1S9JA 3Q9YA 3O50A 2C5NA 4HYUA 2I1MA 2EVAA 3WARA 2HYYA 4GW8A 4JG7A 4UY9A 4AE6A 2OJ9A 2QOLA 3BYSA 4RIWB 2XIKA 1M2PA 4F99A 4EWQA 1JVPP 2PZ5A 3BX5A 4ZY6A 3ZUUA 2BDJA 4MXOA 4EK4A 4MYGA 3QLFA 4M14A 3HAVA 3SLSA 4BZNA 3BV2A 4AXDA 4O0RA 3TZ9A 4F9YA 2YN8A 3DTWA 3PPZA 4YGAA 3U4UA 5JGBA 4FZFB 4LOPA 3RAKA 2OFUA 3I5NA 3BWJA 1M7QA 4FTKA 5CTPA 3R8VA 4ZTSA 1GZOA 1J7IA 2RFEA 3E7OA 1IRKA 3NUPA 4IWOA 2HXQA 3DBDA 1DAYA 4RQVA 5CS6A 3ZYAA 4KIQA 2J6MA 4GVJA 2BUJA 3DAJA 2QG5A 3PVGA 4ZS0A 4AGWA 3LXPA 5LVOA 3KF4A 4QTEA 4FX3A 4FOCA 3UQCA 4WO5A 4FKJA 1OITA 2CNVA 3NFGB 3II5A 4LL5A 4YTIA 3VBVA 4IANA 3GOPA 2DUVA 4WA9A 2ZM4A 2XAMA 5AV3A 4RMZA 3TI1A 3VUMA 3MH2A 2ZV7A 3D15A 4MD7E 2C6LA 4RWLA 5IMXA 4KABA 3FLNC 2PVJA 4ACHA 3KVWA 4BTFA 4YUQA 3QAME 2WOUA 4KS7A 4RLLA 4TYJA 3TNWA 1W98A 3COIA 4F65A 3FMNA 3SDJA 5EI6A 2OW3A 4EHZA 3WIGA 4DLIA 2GDOA 3HVCA 4XV9A 5IEYA 2C1BA 5EHOA 4IFCA 4ASDA 5CF6A 4G3FA 3SC1A 4IFGA 4Q5EA 3DY7A 4BHNA 3AC8A 5BVFA 4UX9A 2UZWE 3A4OX 3MY0A 4JQ7A 2OK1A 3BV3A 4FBXA 3ZRLA 2PMLX 3LQ3A 2W96B 5ITAA 4FKUA 5AM6A 2J50A 2J0KA 3Q2MA 2PVHA 2AEGA 4GCJA 3QL8A 3NIZA 5HHWA 2G2FA 5CT7A 4YZNA 5AX3A 4EC8A 4ZSJA 4GG7A 3ZO3A 2F7EE 5J5TA 1H1SA 4V0GA 1QPJA 5JZNA 4J52A 3BQRA 5HIDA 1PMVA 4QO9A 3BYMA 3UQGA 5AFVA 2JDVA 4G6OA 1PYXA 5GJGA 2XUUA 3ENHA 5DR2A 1OM1A 2VTMA 5IQIA 4JDJA 3R00A 3AQVA 3RZFA 4II5A 3ZBFA 3ZHPC 3ZM4A 2C3LA 4DH5A 4YC6A 2EXEA 5KBQA 2BDWA 3V5PA 4I22A 2GNLA 1SM2A 1WFCA 3PSBA 5TE0A 2R4BA 3KEXA 4ZTLA 2GTMA 4A7CA 4F6UA 4D9TA 4QTCA 5BYLA 4LRMA 4EHGA 4MXXA 5A9UA 3E8NA 3QKLA 3KRLA 3UIXA 4AOJA 3FY2A 3RZBA 2WQNA 4NK9A 4OTPA 5DEWA 4W8DA 2R3GA 3UOHA 4F09A 5IQHA 3QD3A 1UA2A 2HW7A 4QRCA 2OBJA 2BROA 1URWA 1KWPA 3E8DA 2A2AA 4BRXA 4DE4A 3R0TA 4V0GB 5HNGA 3MIAA 4WHZA 1YHVA 4XEYA 4AACA 5EI2A 4AA5A 4WKQA 4ALVA 2VO3A 1UKHA 4TNDA 5H3QA 4EOOA 1FVVA 2WPAA 3EMGA 3P7CA 4L45A 3VAPA 3R21A 3NUAA 4ORKA 2O0UA 4CT2A 5BMSA 5I0BA 2BALA 2FGIA 4NUSA 3DS6A 5AIRA 3ZCLA 3FSKA 3ZFYA 3MW1A 1JKSA 5EQPA 3WF9A 3FBVA 3CEKA 2ESMA 4TYEA 2PMOX 3U51A 5ANIA 3LZBA 4TYHA 4K1BA 4DG2E 5CAOA 4BJJB 2OXYA 4LGDA 1PKDA 2YAKA 1GNGA 3FMDA 4AOIA 4ZLYA 3QXPA 4J53A 2CKQA 4S34A 5FEEA 2W5HA 5I9WA 3NLBA 4PDYA 4QMYA 4KKGA 4IB5A 3GGFA 2GS7A 3BHTA 4EQCA 3QALE 5J9LA 4UXLA 2XZSA 4TZRA 4DFLA 3NUXA 3CTHA 4O0UA 4U41A 3PUFC 3KXNA 4IVCA 4ZZNA 1H0WA 2W9FB 2R3FA 2WTIA 4KRCA 3UVPA 4TNBA 4BYJA 2UZVA 4JS8A 5AAFA 1QMZA 2IPXA 3FI4A 3DDQA 1CM8A 2P0CA 3BEAA 3PFYA 3MS9A 4UYNA 2XRUA 2QOHA 1CSNA 1W2DA 3DLSA 3FLQA 3PXFA 2PWLA 4NM3A 3VO3A 2G9XA 1UWJA 3ROYA 4DGMA 4RWIA 4EQUA 3JY0A 1H1WA 3G90X 3I4BA 2F4JA 4LRJA 4H3QA 1B6CB 1JAMA 1OI9A 2VTJA 2WMUA 3UVQA 2E9VA 4CLJA 1G8AA 2GQSA 4J97A 5EOLA 3T8OA 3R02A 1TZDA 2R3JA 3GU8A 4KD1A 3FXWA 4R8QA 4BWXA 3G6GA 3KVXA 3M42A 4OTHA 4CFNA 5AP3A 4CXAA 2OF4A 4WIHA 5CI6A 2WTCA 3A7HA 4PTCA 3AKLA 3R9RA 2W1FA 4YBJA 5I9ZA 1XWSA 5FRIA 4FKIA 1KV1A 3HGKA 5L2QA 3EL7A 1GY3A 4QTAA 3RHXA 2BHHA 2CHLA 3TZ7A 4FTCA 3DOGA 1GOLA 4I0SA 4XRJA 5TOZA 4LGGA 2IZTA 4QMMA 5L2WA 2UW6A 4YR8A 3SVVA 3Q3BA 3GFEA 3A8XA 3GU7A 5FD2A 4F1TA 3IG7A 4QD6A 4IZ7A 2YM5A 4PTEA 2Y6OA 2GHLA 1PXJA 4AFEA 2QG7A 2V62A 3UNZA 3PWYA 3A99A 4DH7A 4RZVA 2YABA 1XO2B 3R8ZA 3GFWA 5GZAA 4MQ2A 5AR7A 5HOAA 4FT3A 4HCUA 2OKRA 4CLIA 2O3PA 4CZTA 5AV4A 5IQFA 2IWIA 3QWJA 4PRJA 4FL3A 3P4KA 4QTDA 3VS0A 3KXGA 3F3UA 4DFUA 1Q41A 5IQDA 5B2MA 1ZOGA 3PJ1A 5HNIX 4JAJA 3DKCA 3QUPA 4F9WA 2C0OA 4M8TA 4FV8A 4X21A 3UTOA 5TF9A 4QQJA 2VN9A 4LG4A 4WBBB 1GJOA 2WIPA 4V01A 4FNXA 4ITHA 4ITJA 2YIRA 4OTFA 4YJUA 3G9NA 1A06A 3HMMA 4GMYA 2BIYA 2FSLX 2JIIA 4D2TA 3NX8A 4X3JA 4A9TA 1QPCA 3W0OA 4C2VA 2GS2A 3ORPA 3R71A 4MH7A 3VHKA 4CTCA 2R0IA 4YC3A 5ACKA 3W10A 5BMMA 3OBGA 4JR3A 2FSMX 2P2IA 5C8KA 1RW8A 2WOTA 2Z7QA 4UMQA 5IEVA 4C34A 4BCPA 3BL9A 4DLJA 3VS5A 2B0QA 2X4ZA 2CGVA 2BAKA 3PTGA 4WBOA 5DGZA 3LFQA 4BDDA 4QNAA 3KF7A 4QMOA 4BCOA 3L9LA 4I21A 4FSMA 4IJPA 2FB8A 4K6ZA 4YBKA 4LL0A 3IECA 5DRDA 3RK9A 5A6NA 5M09A 4DA5A 1WBVA 3D7TB 5E7RA 3ZRMA 1RDQE 2YZLA 1OPJA 4LI5A 3BPRA 2BFXA 4DGLC 3GC0A 2X6DA 3UIMA 1DM2A 3FZTA 2X0OA 4U45A 3JY9A 1UV5A 2C30A 4ZLOA 2NYAA 3PVWA 4YJSA 2FA2A 2XBJA 4EQMA 5IQCA 1HCKA 4GS6A 5CWZA 4EH7A 2OIQA 1Q8YA 4H05A 4ANSA 5DR6A 3MY1A 5HTCA 1FINA 3U6HA 2CGWA 4B99A 3KULB 2H8HA 2VO0A 4EBVA 3ZM9A 4F78A 1MRUA 2X9EA 2UW5A 3OOMA 5BUEA 4FIFA 4XS2A 2PUIA 3C5IA 4BTMA 2UZOA 4JNWA 3AT4A 3M2WA 4O2PA 3TV7A 5IDNA 5M56A 3F9NA 4XG6A 4K11A 5H2UA 3VUTA 2YM4A 1BL7A 3R30A 2Y4PA 3QD0A 5E8VA 2W1EA 2AYPA 3FLSA 3IK3A 3KY2A 4BBEA 4FJVA 3BLQA 2A19B 3MFRA 3ZFXA 4TWPA 1BLXA 1PMEA 4BF2A 4DCEA 5LOHA 4U0IA 3UBDA 3ZXTA 3PG1A 4USFA 4QYEA 1H08A 4YJVA 1OKVA 3M1SA 5TT7A 2PE0A 5AX9A 4USDA 3LFFA 1KUTA 3QCYA 4HCVA 5AMNA 1SYKA 5GJDA 4AS0A 4EUUA 2O64A 3T9TA 2BRNA 3QQUA 5GNKA 3JPVA 2WQEA 2VUWA 2ETMA 2QOQA 3R9HA 4R77A 2YITA 5CVFA 4XX9A 2QOKA