2JEDA

The crystal structure of the kinase domain of the protein kinase c theta in complex with nvp-xaa228 at 2.32a resolution.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
326
structure length
324
Chain Sequence
b'LKIEDFELHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNEFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLFADRALINSMDQNMFRNFFMNPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C THETA
publication title The Crystal Structure of the Kinase Domain of the Protein Kinase C Theta in Complex with Nvp-Xaa228
rcsb
molecule tags Transferase
total genus 97
structure length 324
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jedA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jedA01
2YWPA 2YAAA 3NSZA 2C6IA 3HV3A 1F3MC 4NKAA 1DAYA 1JSTA 2OIDA 4IBMA 4ACMA 4C35A 1LR4A 3LFFA 4EH9A 3BHVA 3HAVA 4G3FA 2XB7A 4XV9A 4BCOA 3PG1A 3BGPA 4PDOA 2GMXA 5A4LA 3QCQA 2F2UA 3GFWA 5DLSA 3AD6A 3A7FA 3KEXA 3ORLA 5AAFA 2PZIA 4EJNA 3RAKA 4E5WA 4N4SA 4UMTA 2J9MA 3Q9ZA 4KSQA 3QYZA 4RGJA 4JX3A 3FI3A 4ZXTA 1J7IA 3FXXA 4RC2A 3PE1A 4ZS4A 2B52A 3FZSA 3UOKA 3LFAA 4QPSA 4B8MA 4DTAA 3RP9A 1GY3A 3ATSA 1PRYA 2ZB0A 4ZTMA 4BDEA 3V5TA 4BVUA 5HLWA 1FINA 2C5NA 3BKBA 1U4DA 3POZA 4QQTA 2YWVA 3Q9YA 1WMKA 3F82A 4OBPA 4FOBA 5ANKA 4UMUA 5JT2A 3PUPA 3SW4A 4MKCA 5HCYA 3OWKA 3N9XA 3DPKA 1K2PA 4QMWA 5HX8A 4KNBA 1B38A 5L2WA 3DQWA 4YSMA 3VF8A 3FLZA 3VS3A 3HV7A 3HUCA 4TXCA 4AZFA 4C38A 4A9TA 4CV8A 4D5HA 3FKLA 2WMSA 2QHMA 4UMPA 4W4XA 3LJ1A 3R9DA 3VC4A 5HESA 2V7AA 3ID6C 3LOKA 4ACCA 4FZFB 3IS5A 3C50A 3PWDA 4M68A 2CGUA 2OSCA 1KE5A 3QLFA 4NJ3A 3VW8A 4F6WA 2HXLA 4NWMA 3S3IA 4ZY4A 4XS2A 4FIFA 5TO8A 5E8YA 4CEGA 2XIYA 2LAVA 1REJA 3QX2A 2YZLA 3UOJA 1J7UA 3QKLA 2PE0A 3OTUA 4MAOA 5CI7A 3KRLA 4UY9A 5J9YA 3FKOA 5DRBA 1TKIA 3WF5A 2R3RA 4GK3A 1Q8UA 4FV0A 3MA3A 3Q2JA 5K5XA 2QO7A 5DG5A 2W1FA 4AW5A 2YDIA 4YHTA 1R78A 3OW3A 1WVYA 1ZLTA 3CY3A 5CAPA 3FDNA 4WBOA 4MVFA 4WNKA 4F6SA 3E8CA 4FYOA 4ANOA 5M55A 4BTKA 3C1XA 5CXZA 4RJ5A 3QAME 4MF0A 3QBNA 2RKUA 2OF2A 4RVKA 3HMOA 4FKRA 5C03A 4QTCA 2CNVA 4FKLA 3LFNA 3E93A 4O0TA 5HIEA 2JITA 3TNQB 4RVLA 4EQUA 2QOIA 4FNXA 3QXPA 3MH1A 3K3IA 3BLQA 4JBQA 4NFMA 4NW6A 5DH3A 5EQEA 4LM5A 2HZ0A 4QYYA 5EHOA 2QR7A 4X6RA 1MQBA 2XM8A 4LRKA 4V05A 4KBAA 3AGMA 3SC1A 1PMNA 5GZAA 2Z8CA 3P5KA 4JBOA 5FEEA 4N57A 4XG6A 3S95A 2W17A 4EI4A 3P7CA 3TI1A 5KBRA 4GIIA 4DFXE 4DH8A 4XHKB 5JGAA 1OKYA 5HICA 2CGXA 4AGUA 4DINA 5EI2A 4GT4A 4BDCA 3UNKA 3UNJA 4MYGA 3UC4A 4FE2A 3QGWA 2G9XA 3IGOA 4FMQA 4LMUA 4MXAA 5F20A 4O7NA 5DI1A 3QQGA 2X6DA 3P08A 3JYAA 4BKJA 4D58A 2UZNA 1RQQA 2PK9A 5HE0A 3ODYX 3O0GA 5IA0A 3QTXA 2XNBA 4I4FA 3WE8A 3PLAE 3WF7A 3A7GA 4JRVA 2HCKA 4LL5A 4DEGA 4IE9A 3EQPA 3E8NA 4EQCA 5FEQA 5FXRA 3OCTA 4U6RA 5GIOE 1TQPA 3IO7A 3UYTA 5HORA 5LMBA 3SOCA 5IDPA 2P4IA 2Y4IC 4JG6A 4USEA 3MPTA 3NUNA 4AA5A 2B9HA 4LV8A 3R9OA 2HW6A 5CQWA 3U51A 2WB8A 2VO0A 4TZRA 3LZBA 1SYKA 4N70A 4YLLA 4C3FA 3HMPA 2EVAA 4J52A 3FC2A 1OVEA 3DK7A 2C3IB 3RM7A 1OL7A 3AMBA 2FSMX 3H30A 5IQFA 5AR2A 3EZRA 5KMLA 4JAIA 3AT3A 3VJOA 3L8PA 4U40A 4PNKA 5E91A 2DQ7X 4GMYA 4DBXA 4PMMA 2OG8A 3DAJA 4FKOA 5AP6A 3OF0A 3UZRA 3SRVB 4QP8A 3QQKA 3V5QA 2HXQA 3MH3A 5E8SA 4B9DA 4C3RA 1OZ1A 2XNEA 3PJ1A 3NUXA 4DHFA 4NL0A 4BI0A 4D2VA 4IVDA 3BELA 3O8PA 5HTBA 5J79A 2ZAZA 4TYGA 3ODZX 4M15A 1JOWB 3VN9A 3R1SA 3TZ9A 3TTJA 2YIRA 1Z57A 3LQ8A 3FUPA 4WSQA 2W1EA 3QUPA 1SVGA 3CLYA 3G90X 2OXYA 3RMFA 2XBAA 1G5SA 3PVGA 3DZQA 1J7LA 2H34A 4K9YA 2OBJA 4I41A 4AWIA 5DT4A 5IISA 4JG8A 3VS7A 4BTJA 5LVMA 2ZM1A 3SG9A 4CVAA 3EYGA 2PSQA 5IUHA 5FGKA 3F7WA 4FC0A 4KBKA 2JFLA 2VZ6A 4ZSGA 3CTQA 4CFNA 5CU0A 5AR4A 2JDSA 5LWMA 2BKZA 1KE9A 4BYJA 3S00A 2AC3A 5J87A 1ZWSA 3OC1A 3OWLA 2BZHB 5J95A 4QOXA 4PTGA 2WMRA 3QC4A 2VX1A 3FL4A 4LG4A 3GENA 5E92A 5C8KA 2PYWA 3UQFA 2ITOA 4FNYA 4NCTC 4YLKA 2VV9A 2XF0A 4DTBA 3BE2A 4HCVA 4PUZA 5LOHA 2J0IA 3BHHA 5IF1A 4YJQA 4EZ5A 3QRTA 4B6LA 4IAFA 4CLJA 1YKRA 1QL6A 3ULZA 3FZRA 1UWHA 2BMCA 4A9SA 2ZVAA 1B6CB 2WU6A 3HDMA 3VRZA 5HG9A 4RLLA 2R0UA 2GDOA 4EH7A 3BYSA 4O38A 3LMIA 4KRCA 5L2QA 5L3AA 2UW8A 3RM6A 5B2KA 2V7OA 4YC8A 4X3FA 5AP1A 2Z7SA 3F3TA 3R7VA 4DFUA 4BCFA 3R8ZA 2E9OA 4EZ3A 4OTFA 1UNGA 3LQ5A 5CAQA 1H28A 5ETFA 3ZFMA 4J99A 4KABA 3SKCA 3VVHA 3NW5A 2RFSA 1YXSA 2Y6MA 3UP7A 3OS3A 4IAZA 1H4LA 5L8JA 3VS0A 4F9BA 2PVJA 3F66A 3ZBXA 3U87A 4L01A 1FVTA 2VTOA 5FTGA 3ACJA 4FYNA 1ZYCA 1TQMA 3QQLA 3Q9XA 3KGAA 4ZSAA 4WG5A 2DS1A 3IG7A 3G15A 5JK3A 3R04A 3GOPA 5H9BA 2O0UA 3L9LA 4OT5A 2VTAA 3M11A 4DH5A 3GB2A 4U97A 3VULA 4C59A 2I1MA 2JIUA 5EW9A 4YZNA 4QP7A 5KMMA 5AIRA 2UZBA 1Q97A 4M0YA 3EQFA 3PVWA 4L6QA 3TZ7A 4BDBA 4QP3A 3VBXA 4WKQA 5D10A 1ZRZA 3NZ0A 3MIYA 4DFYA 3DU8A 4FEWA 3FSKA 2R5TA 2CKPA 4H3QA 3PJ2A 2W4JA 1OI9A 2NRUA 2W1GA 3PPJA 3QD2B 4L3JA 5CEKA 3DBFA 3QX4A 1QPCA 5DIAA 4JQ7A 4UZDA 4BWPA 1OPJA 4M69A 2VTTA 4Q5EA 2J0JA 3FQHA 2E9NA 4FTMA 3JXWA 4I4EA 5CNOA 4YSJA 2X4ZA 2PWLA 2XNMA 3COIA 2I0VA 3ORMA 2O65A 4WG4A 5D41A 5D7AA 4C57A 3LFBA 5IDNA 5TOZA 3PRIA 4A06A 3C4WA 4Y5QA 4AU8A 3PSDA 4YUQA 1UNLA 2AUHA 3F3UA 3OFMA 4XP3A 3ZUTA 4C2WA 4CFMA 5HG7A 4FL1A 4FNWA 4EWHA 1ZYJA 2J90A 4H1JA 4LRMA 4FTLA 1P14A 4GU9A 4GU6A 3TZMA 2O3PA 4DF3A 2QOKA 3KB7A 4MQ2A 3R28A 4XG2A 4WUNA 5CLPA 5HVKA 2ETKA 3QGYA 2XK9A 3BQRA 3GCUA 4LOPA 1OIRA 3WOWA 5LVNA 3UIXA 4FTAA 3I60A 4FSMA 2ZYBA 1DI8A 4EBWA 5EG3A 5EK7A 4AE9A 1O9UA 3G0FA 4FTIA 1M7NA 4S34A 4C58A 2BAQA 3K3JA 2WMQA 1U5RA 4RX7A 4CFWA 3WF8A 4XRJA 1JPAA 4E93A 4DEAA 4H1MA 2OGVA 3DQXA 2JKMA 3PTGA 2JC6A 4YTHA 4BGQA 2QKWB 3RGFA 1WBVA 4JDKA 2YJSA 3GUBA 4O81A 1YWNA 3V5JA 4LV5A 5A4CA 2BTSA 5IA2A 2GQGA 1SM2A 5CSVA 3RWPA 4YBKA 4XV1A 4CSVA 3Q6UA 4EC8A 1OL1A 4C8BA 4HPUE 3QQHA 4XH6A 4ZSEA 2VX3A 4NYEA 2B1PA 5EDPA 4IX5A 4HVIA 1VZOA 1Q99A 1JSVA 2XUUA 2PVRA 3FAAA 4KINA 2OKRA 4RC4A 1NT2A 2BDFA 1XH6A 2XNGA 4ID7A 4GCJA 4J96A 5I3OA 5JRSA 4DG0E 3TKUA 4Z7HA 4WRSA 3MYGA 3PVUA 4PQNA 4HGLA 5E90A 1JNKA 4C4JA 5JFXA 3UO5A 1FBNA 3BHYA 2OH4A 3ACKA 4X2GA 4ZTLA 1PXLA 1H1PA 1UNHA 2ERZE 2HELA 2QD9A 3F5XA 2EXCX 3O2MA 1PXMA 5CVFA 4F09A 3PXQA 3QKMA 3DBCA 3LFCA 3O8UA 1KOAA 4FKWA 5JRQA 4X2FA 4ERKA 2I7QA 2Z02A 3V5PA 3CJGA 2VGPA 4YZMA 4QMQA 4ZY6A 1WCCA 4CFXA 4CCUA 4XMOA 4YJVA 4YJUA 2WAJA 3WARA 4Z3VA 4J97A 4U5JA 2UW5A 5FTOA 2AYPA 5LCJA 4OTHA 3R8MA 3P9JA 4AQCA 3ERKA 3GXLA 3VNTA 4RIYB 3R02A 4C4IA 4ALVA 4RJ7A 3DY7A 3Q96A 4K8AA 2VTMA 5IKWA 4MNEB 2EB2A 3PA5A 2YCRA 3R71A 4CKRA 5IZFA 4DGGA 3QQUA 3QD0A 5JFWA 4EWQA 4AS0A 2OXXA 2YIXA 3GU6A 3JS2A 4ENYA 3T8OA 5EDRA 3RPYA 3H0YA 2CCIA 2PVMA 3F9NA 3ZONA 3U6HA 3F88A 2CNUA 2F9GA 4CTCA 3SLSA 1PW2A 4FL2A 3LCDA 3MV5A 4U80A 5J9LA 2BPMA 4ACDA 3BWFA 2OZAA 4CG9A 3BU6A 2X0GA 3I0QA 5IA3A 3QHRA 1BI8A 1WBPA 3OP5A 5CENA 2ITZA 2W4OA 2JKOA 4XG7A 3TL8A 4R7IA 3LM5A 4I0RA 4GIHA 5ANDA 3DK3A 3LFQA 4FSNA 1QPEA 4IANA 4NIFA 4ASZA 4CLIA 2J5FA 5HBEA 3W1FA 1ZAOA 4JBVA 1H08A 1UKHA 3AGLA 2ZJWA 3RCJA 3BYOA 4GW8A 1SNXA 4O96A 4EC9A 5BYYA 4B4LA 1Q8ZA 4FGBA 4JR7A 4LGHA 4CCBA 5BNJA 4PP9A 4BZOA 3RTPA 3U9NA 2CPKE 2OU7A 2WZJA 4WD5A 2W1CA 3W2CA 4O6LA 3DXNA 5K4JA 4QQJA 3D5WA 5AUZA 4F9YA 2EUFB 2ITVA 1P2AA 3C4ZA 4BI1A 2WOUA 4BY9E 2IG7A 1J91A 2GFSA 5CI6A 3L9MA 3QZGA 4IZ7A 1GNGA 3EN4A 3GC7A 4DT9A 3R00A 3QA0A 3OUKA 4A07A 3VRYA 3QRKA 3O50A 2VTQA 3EQGA 3R9RA 3V3VA 5FWKK 4DH1A 3VHKA 4UZHA 4BTFA 3GT8A 3QFVA 4D0WA 4DLIA 3PZEA 3ZCLA 4IVCA 1PKGA 3DJ7A 4NT4A 3ZM9A 3W8LA 2IW8A 3KVWA 3F61A 3DB8A 3GVUA 5EOBA 4DITA 2W7XA 5TR6A 2EWAA 4NJDA 4XNEA 5BQ0A 1H0VA 5DOSA 5KZIA 3PZHA 4PPAA 3UDBA 1H1QA 3G9NA 3AD5A 4FZ6A 1TQIA 3EN9A 4FV9A 4M14A 2ZOQA 5JKGA 3A60A 2YERA 1DM2A 3QALE 4KAOA 5EM5A 4O86A 2W99B 4X2JA 3CKXA 1YW2A 4KKHA 3T3UA 4AZWA 3BX5A 3OXZA 3ZLYA 3OROA 1TVOA 5HO8A 3IKAA 4G16A 4UWYA 3R7EA 3HL7A 5HU9A 3ET7A 4RJ6A 4E4NA 4NUSA 4GG5A 4AW1A 1HCKA 3C9WA 4LYNA 4NSTA 3RK9A 1YDSE 3PXKA 3FSFA 4E8AA 1K9AA 2C1AA 5EM6A 4I6QA 4NM3A 2ZDTA 4RFYA 4FSZA 2HK5A 2WO6A 4FV5A 4IAAA 5AX9A 5E9EA 4I5CA 1H0WA 5HCXA 2JAVA 3UBDA 4AGWA 3O96A 4UX9A 4CV9A 4GUBA 5CEIA 4O2ZA 4FT0A 4E6DA 5CF6A 3BEAA 1U5QA 3PJCA 2OLCA 3ZRMA 1ZZ2A 1OKVA 3HMIA 4TWOA 5KE0A 5IQGA 4FIHA 4EYJA 4G2FA 4E26A 4F4PA 3EWHA 4OTGA 3RHXA 4F70A 2GNFA 4D2PA 2YAKA 3AC2A 5A9UA 5B7VA 3PYYA 4FG7A 3DDPA 4CT2A 4Y5HA 4MK0A 3VBQA 5HNIX 2GQRA 4RT7A 4XBRA 3DBEA 3KF4A 5CF5A 3GC9A 5CSWA 2GQSA 4RIOA 4CKJA 1SZMA 3LCSA 4RA4A 5C8MA 1Y6AA 5HKMA 5BX0A 4FTKA 4DN5A 5I9VA 2WQMA 4ZJJA 2PE1A 2WTVA 2ZV2A 3DAEA 4IJ9A 3UIBA 4F6UA 2BVAA 4PL3A 4QYHA 5TE0A 3FI8A 3DV3A 2CLXA 3V5WA 3WE4A 3LHJA 5T6KA 2BALA 4YTIA 4DG3E 4BYIA 2GHGA 3VUTA 2I0EA 3UMXA 2V0DA 1JKTA 2UZEA 3HECA 4IWPA 4Z55A 5FRIA 2R3MA 3NUSA 5CU6A 1WBWA 5DA3A 3D5VA 5EYMA 4O7LA 4Y46A 2YM3A 4I22A 2J0MB 2VO3A 4K18A 5DT0A 4CFFA 4I6BA 5A54A 2PVFA 4Q9ZA 5BMSA 3HLLA 1XO2B 5AP2A 3EN6A 4LGGA 2NRYA 1LUFA 1SNUA 2XJ0A 4AN9A 3TIZA 4D2WA 4TWCA 2OFVA 3H0ZA 4UYNA 4AN2A 2YCFA 2Y8OA 4BICA 5FBNC 4MF1A 3R6XA 4IMYA 4HJOA 4P4CA 4QMTA 3BLHA 5ANOA 2GNGA 4W9WA 5BVDA 3H9OA 4PPBA 2A19B 2JFMA 3BYMA 4FG9A 3SGCA 3LMHA 2RFNA 5C1QB 2I0HA 3TDWA 4FTQA 2BZJA 3GEQA 1KOBA 4FTRA 4IXPA 3DBDA 4XG4A 4YU2A 4O0XA 3DJ5A 3OTVA 5FP5A 5HI2A 3TNIA 3DKGA 2PE2A 5LVLA 4EL9A 3O7LD 4HYHA 4OTQA 2P33A 3DK6A 3TACA 4O21A 3MWUA 1OGUA 4YP8A 3IW8A 4A4XA 3L8VA 4AXAA 3MSSA 1NW1A 5IUGA 5M06A 3OCSA 4E6AA 2OJJA 2DWBA 2KULA 2QC6A 2VWYA 4DGMA 2XH5A 3HYHA 4O2PA 5M08A 3UO4A 4R3CA 3BLRA 5AA9A 2IVUA 3LXKA 1UU7A 2H9VA 4K33A 4D1ZA 1H00A 2PUUA 5LJJA 3D2IA 2UV2A 2XIKA 5GHVA 3DXQA 2JKKA 2YZAA 2J0LA 4X2KA 3ZLWA 4FKUA 1Q8TA 3IQ7A 4QTEA 3O23A 4FKSA 3R9HA 3ULIA 4J8MA 3NGAA 3FPQA 3GC8A 4ONAA 4RPVA 5JMSA 3TV7A 4EKLA 2PZYA 4L8MA 5A6OA 4D2RA 1NXKA 2X9EA 4AAAA 3CC6A 5ICPA 5HHWA 2FSTX 4HGTA 3LLTA 3OT3A 3AMAA 3PP0A 2R3NA 3U9CA 4AFJA 4G17A 3QA8A 4PX6A 3TNWA 2I6LA 2J2IB 3FMNA 2RL5A 4HVDA 4O7RA 4S2ZA 5M4IA 5LVPA 4OR5A 1W0XC 3ORZA 4FZAB 3TUCA 1OUYA 1Y8GA 2GU8A 3DJ6A 4D5KA 5AR8A 2UW9A 3OBJA 1PHKA 2UZLA 3T9IA 3A61A 4FEQA 4QPMA 2C6OA 1M17A 3RI1A 4Y85A 5CF4A 3KC3A 5FXQA 3TDVA 2BZIB 5EKNA 3ZO2A 5HGIA 3PRFA 4FSTA 3E7VA 4E4LA 2GPHA 2F7EE 1XQZA 3LCTA 3UP2A 2X8IA 4D2SA 4CZUA 5AV2A 3ZUUA 2JEDA 4I21A 5EQYA 2UW3A 1BL7A 1KE6A 5IH5A 2PVYA 3QUDA 4EHZA 2Z7RA 4D1SA 4AT4A 5KMNA 4GK4A 4HZRA 3GU4A 3EKKA 5CVGA 3NUAA 2XEYA 2FSLX 1ZYDA 2VNWA 3ZLXA 1ZOEA 3FI2A 4K2RA 3FLNC 3QHWA 4AT3A 2W1ZA 2YN8A 4TYHA 3AXWA 5E1EA 3SXSA 3C0HA 3G33A 2HW7A 3P79A 4QMOA 4I92A 1V0BA 3O51A 3ZYAA 2PTKA 4H3BA 4NCTA 2PHKA 2QONA 5TKDA 4F65A 2BKKA 4JDHA 1YHWA 3MFRA 2X2KA 3B8QA 2AC5A 3LXNA 1I09A 2Y0AA 3TV4A 4F7JA 2OJGA 3A4PA 3NW7A 4PPCA 1EH4A 3F3WA 4I3ZA 5DR6A 1KE8A 1OIYA 5JQ5A 3GU8A 1W84A 2B9FA 3FXWA 4MCVA 1J3HA 4EJ7A 1KE7A 1Y57A 3QCXA 1OIQA 4X3FB 3VS5A 5A46A 4R78A 1ZYSA 4U8ZA 5BVKA 3VUGA 1FPUA 1HCLA 5DR9A 5CSPA 1PMEA 1ZZLA 2IVVA 3KK8A 1IAHA 1YHSA 2BAJA 2W0JA 3HMNA 3OWPA 4IHPA 4IQ6A 3R63A 3LLAA 2VWZA 5KUPA 5E8XA 2BILB 4HYSA 3WF9A 2C5YA 3IDCA 3PSCA 3N4TA 4DH3A 3FL5A 5HTIA 4RG0A 5HVYA 4RMZA 3HV6A 3QRJA 5CSHA 5EYDA 4PMPA 1OL5A 2XJ2A 3QQJA 3SAYA 4TYEA 4AN3A 3E92A 4TWPA 4V0GA 4H36A 3QRUA 4ZS0A 2BR1A 3QTUA 4YHJA 4PDPA 5HX6A 2H8HA 4AACA 4CMTA 1H1WA 3I6UA 1ZARA 3DDQA 3OBGA 5LMAA 5E8ZA 3VF9A 2VU3A 1DAWA 3AD4A 3WZJA 2VX0A 4QQCA 5AP4A 5T68A 4BDDA 4WNPA 2X9FA 4GL9A 5LXMA 1O6KA 3W8QA 5L8KA 1LEZA 5AA8A 3NR9A 4R7HA 4FICA 1U46A 3OWJA 3W2PA 3UQGA 4BGGA 3KK9A 1CSNA 3MTLA 3R8VA 1VJYA 4R5YA 4M69B 2CDZA 3KQ7A 1SMHA 4HCUA 4X7QA 5GZ9A 4DTKA 4R1VA 5AJQA 4G3CA 4QTDA 4X21A 5KBQA 3FLYA 4C2VA 5JGBA 2CN5A 3MY5A 4FUXA 4ZAUA 5GJDA 2RGPA 4BCKA 4DEDA 5B2LA 3F2RA 3LCKA 5E1SA 4L45A 4UWCA 1XWSA 4FTNA 2X39A 5H8EA 2QOCA 4Y95A 2A0CX 5HO6A 4DCAA 4DA5A 3V8SA 2OO8X 3CKWA 1LP4A 2X4FA 1BL6A 2YACA 3TXOA 3EFKA 3GCPA 2W05A 4XBUA 1Q24A 5IEXA 3UG1A 5M4CA 4L7FA 3HEGA 3FE3A 1G8AA 2IZTA 4CKIA 5HE1A 4EH8A 4K6ZA 4F7NA 1FVVA 2BCJA 2R7BA 2HY0A 4FKPA 4NM7A 1MRVA 3G5DA 3NVMB 3RK5A 1U59A 3R9NA 3DA6A 2OW3A 5HG8A 1H24A 5CEOA 4CMOA 1MQ4A 2Y4PA 3PSBA 3EIDA 3P23A 2QOFA 4USDA 3NUYA 2XMYA 3D9VA 4KSPA 3W33A 5BMMA 2B54A 5HTCA 3C13A 3W2OA 3AMYA 2OI4X 1IRKA 5AFVA 2YLFA 4QRCA 5BVWA 3Q4ZA 4FG8A 2WFYA 2RG6A 5D9HA 3SVVA 3D94A 1K3AA 3MTFA 4OTDA 2PMLX 2WEIA 5AM6A 3VBYA 4D2TA 5IQHA 5D11A 4EOSA 2GS2A 3ZXTA 4XG8A 1ND4A 1PXOA 2ZDUA 4M7IA 5HNBA 5C26A 3ANRA 3MDYA 4ASDA 3FY2A 3W2RA 4DCEA 1A48A 2YEXA 4TL0A 4D1XA 5IMEA 5DGZA 2I40A 3H9RA 4FA2A 1Q8WA 5M07A 4GT3A 4FODA 5H3QA 3LXLA 3IPHA 4ZJVA 4YNEA 5GZ8A 2C6TA 4OUCA 4MHAA 4WO5A 3PVBA 1XBAA 3N4VA 5J1WA 3QTZA 1BLXA 5HOAA 3PXRA 3FHRA 5FUTA 2RG5A 3TCPA 2JDVA 4ASEA 3FKNA 4JT3A 2UUEA 4W4WA 4EKKA 3ZZWA 4KS8A 5AV0A 4R5SA 3R7UA 4A9YA 3T3VA 5M44A 2C3KA 2W1IA 2BAKA 3EMGA 2VTLA 5ANGA 4EHEA 3MVLA 4EH2A 2BRNA 2VNYA 3B8RA 1FMKA 2RIOA 3MGYA 2IN6A 3NNVA 3CTJA 5EOLA 5C01A 3W10A 2JDRA 4DGNA 4IACA 4O7SA 1IA8A 4HCTA 3C4EA 3EN5A 1XR1A 2ITTA 2F49A 2XM9A 3HA8A 1XJDA 3FWQA 2P2HA 3NWWA 4O27B 3RAWA 3WF6A 4R77A 2OZAB 3ORKA 5ITAA 2WELA 2Z7LA 2IPXA 3HV5A 4FTOA 4DEBA 3Q6WA 3S2PA 3FLWA 1KV1A 2F4JA 2QOOA 3R1NA 5AM7A 4IJPA 2BRGA 4LMNA 5CF8A 1LPUA 3AC1A 2CJMA 1UV5A 2R7IA 4MD7E 4NIFB 1J1BA 3UJGA 1QPJA 2W5AA 4PMTA 3EFJA 4OAVB 1YOMA 2PMOX 3DCVA 3POOA 4YC3A 5AUXA 2BHEA 2PZPA 3BPRA 5HCZA 1I44A 5AUYA 3JY0A 3AQVA 1PJKA 2PUPA 2W9ZB 2BUJA 2HY81 2O64A 4O0YA 2J4ZA 4G3DA 2X2MA 2X1NA 3CP9A 3BWJA 3FMHA 1Q5KA 2WOTA 4D0XA 2J0KA 4O7WA 3FV8A 4C3PA 2R3PA 2FA2A 4FR4A 3C4CA 5GJFA 4BCIA 4D28A 4HYUA 1RJBA 4PL4A 4MWHA 4LQMA 2BRMA 5I9YA 5E8VA 5E8UA 3NCZA 5HE3A 3LW0A 3G0EA 3VWAA 5JEBA 4NEUA 2J6MA 5DVRA 4BKYA 3FLSA 1XBCA 5AUWA 2R3KA 1R0PA 3NNWA 5T3QA 3VBVA 5H2UA 5G6VA 3PXYA 2J5EA 4YO6A 3HZTA 1E1VA 2OJFE 5KHXA 2V5QA 3WZUA 1VYZA 4IM2A 3M42A 4ZTQA 4E4MA 1UU9A 4WNOA 3O71A 4PY1A 4JXFA 4UWBA 4G6LA 3ZSGA 5AUTA 4TYIA 4DT8A 2QG5A 3PA4A 4U3YA 5AAGA 3ITZA 2A1AB 4AOIA 3A62A 3KCKA 4ZSLA 4J71A 5CZHA 5HLNA 4YJSA 1YI3A 1WFCA 4Z7GA 4BCNA 4C34A 3MY0A 4QMXA 3ZZEA 1CKJA 5B2MA 2G01A 4G9CA 3EQRA 2FVDA 3RHKA 4D9TA 3RCDA 4IH8A 4O91A 3ZUVA 2GTMA 3CCNA 1L3RE 3KMUA 4I5MA 4RC3A 5AP7A 3UC3A 3LVPA 2CGVA 5DPVA 5EHYA 4Z9LA 3I7CA 4D4VA 2ONLA 2XCKA 5L2SA 2QU5A 4AF3A 1H07A 5CS6A 1JBPE 3S1HA 3ZS5A 5C4LA 3VS4A 1XKKA 4WSYA 3EQDA 5C9CA 2XK8A 2BIKB 3LFEA 1DS5A 2JDOA 3FC1X 4QMZA 3RKBA 1YI6A 3BU3A 3HUBA 5FD2A 1JWHA 3OOMA 2IWIA 4P2KA 5F4NA 5J7BA 4CTBA 3MY1A 2GCDA 5I9XA 2G2HA 3FZTA 2HZIA 5C8NA 4C37A 2HYYA 2WMUA 2GFCA 4XLVA 3OEZA 3R01A 4UBAA 4DFBA 3PP1A 4ZZMA 1YDRE 3ZDIA 4FSRA 4UB7A 5K3YA 5KCVA 3BEGA 4GKHA 2VWIA 4IWQA 1H01A 2WHBA 1APME 1REKA 2WU7A 4X0MA 4XUFA 3PJ3A 3HX4A 3II5A 4FTUA 5LVOA 3A7IA 5BYLA 1VYWA 4PDYA 4QTAA 3AOXA 2ETRA 3R73A 3CD3A 4UXLA 3V04A 5EW8A 2CGWA 4AOTA 3S0OA 4CGAA 2CHLA 4W8EA 2QOLA 2WXVA 4S31A 3BHUA 5ETAA 4XLIA 3I1AA 3R1QA 4CG8A 4W4VA 1A06A 3NCGA 3BYUA 5IQDA 2IW6A 4EHVA 5HE2A 4BRXA 3IOKA 5LMKA 4F0GA 1URWA 4L9IA 4M66A 2OWBA 4QMYA 3HA6A 2HWPA 2HAKA 4BDJA 4F0IA 3COKA 3P7BA 4J1RA 5AEPA 5I3RA 4AZEA 4CRSA 4O84A 2WMWA 4XJ0A 4O7ZA 5ETCA 3WIKA 4I23A 2PZ5A 5J8IA 3W32A 2IJMA 2C3LA 2XK7A 1CKIA 2Z7QA 4NKSA 5AADA 5L6OA 3KKVA 3LAUA 4L68A 2XRWA 2UW6A 3UIUA 3BI6A 3E64A 1FGKA 5FQDC 3ETAA 3DNDA 2R3JA 2QNJA 2B7AA 4GJ3A 2Q0BA 2YISA 3H10A 4H39A 4RIWA 4GG7A 5CT7A 5JH6A 3FHIA 1JKLA 3FYKX 4AFEA 4C4EA 2H96A 3Q04A 4U44A 5FM2A 4J95A 4Q5HA 4U0IA 4BF2A 2VTSA 3QTIA 4IB5A 4AG8A 2WMVA 4RZWA 5IU2A 4U41A 2VWBA 4UMQA 2XKDA 4ZTHA 3F5PA 2GHLA 2X8EA 3CJFA 4S32A 1AD5A 4G3GA 1PXIA 3ZLSA 3ORXA 4BDAA 4IVAA 4HGSA 4IFCA 3OD6X 5AUVA 4WG3A 3OZ6A 4E1ZA 5KNJA 1Q4LA 4R1YA 4DYMA 4AZSA 3Q52A 3BGZA 4GEOA 4PRJA 4YZ9A 4BCGA 4C33A 5EYCA 2DYLA 3R7IA 3W55A 4PMSA 1ZY5A 4RWJA 4WUAA 5F95A 4KB8A 3RINA 5HLPA 2EXEA 4YNOA 3RPRA 1OIUA 3NNXA 4ZEGA 4K77A 2B55A 4FX3A 3E87A 1GJOA 4IAYA 5L6PA 4XOYA 3WYYA 3KXGA 4RWIA 3VAPA 5CY3A 4EOQA 3HRFA 2WTJA 1OM1A 2YFXA 2J50A 4JL9A 2Y7JA 4M97A 5E8TA 4MBJA 4ZOGA 4A4OA 2VTPA 2Y4IB 4GFGA 5BVNA 4K0YA 3WILA 2E9VA 1ERKA 2UW0A 2WTKC 1JKSA 2YIWA 4KIKA 1W98A 5ANIA 5IQAA 3PY0A 2BFXA 4I5HA 4AT5A 3P0MA 4ERWA 1WAKA 4JOAA 4JR3A 4Y72A 3ZO4A 3IONA 3KVXA 3MVMA 2OF4A 3CS9A 5L6WL 3EHAA 3C5UA 4YPSA 1FQ1B 3MFUA 2IVSA 3KCFA 1JVPP 3P86A 3ZC5A 4FV1A 4FKJA 4F9AA 2X81A 3CPBA 3NYNA 4RJ3A 3DS6A 5JZNA 4RSSA 1V0PA 2BDWA 3E62A 3ZO1A 1O6YA 4FIEA 2PZRA 3B2WA 4YPDA 3MH2A 2ONLC 4C02A 5M51A 2IZUA 4XCUA 3ORNA 5AP0A 4EK8A 1M52A 5DWRA 3S4QA 3O8TA 4EK4A 4I0TA 1H27A 3LPBA 2ITNA 1V0OA 4GJ2A 4MH7A 3GOKA 4IDVA 5I4NA 1G8SA 1R39A 4ARKA 3NYOA 4OTRA 4DLJA 4YZCA 4QD6A 1BX6A 3PE2A 5FBOA 5ANEA 3UOHA 4BN1A 4BCQA 2C30A 4RLKA 3JVRA 2R3IA 3RVGA 4ZZNA 1Y6BA 3E3PA 3GFEA 5HIDA 3HMMA 3N51A 4QP2A 5ACBC 2QQ7A 3KMMA 4O1OA 4GFMA 4U79A 2WIPA 4GSBA 3TT0A 3TWJA 4EONA 3DBQA 3OXTA 3ROCA 1J1CA 3WBLA 1P5EA 2ERKA 1IR3A 2CLQA 5BUIA 1H8FA 2C47A 3E8DA 4LL0A 4OBQA 1OECA 2HZ4A 4BFMA 5BPYA 2XP2A 5CEQA 2ZM3A 4RQVA 4BIBA 4APCA 2E2BA 4L67A 4QMUA 2O63A 4JNWA 2QO9A 2PVKA 4AOJA 2SRCA 2EU9A 4D4RA 5FDPA 3F3ZA 2PUNA 3ZHPC 2PU8A 3ZXZA 1XH4A 4EYMA 2CKQA 5HG5A 5I5ZA 1PXPA 4BCHA 4TYHB 4R8QA 5A4EA 2VO7A 4OAUC 4W4YA 2QG7A 2P2IA 4WT6A 2FUMA 4CFUA 4GH2A 3SV0A 2ZB1A 5DMZA 4PTCA 1OBDA 3FI4A 3RAHA 4M12A 5F1ZA 2UZTA 1JQHA 5LMKC 2VUWA 4MBIA 4ANNA 4F1TA 3RALA 3R8UA 1M2QA 4JDIA 5DNRA 4BZNA 4G1WA 2F7XE 5ACKA 3VS6A 1UA2A 3AC8A 3ZH8A 3COMA 3GCQA 4BBEA 3FLQA 4HW7A 2C5OA 3KN5A 3RZBA 3MB6A 2RFDA 5CALA 5F94A 1R3CA 2WQBA 3LKMA 3PDTA 5CASA 5HBHA 4DFZE 4KS7A 2OJIA 5CT0A 3B2TA 2V55A 2JBOA 2B9IA 3MVHA 3ORTA 4HVGA 1RE8A 2WMXA 3UYSA 3F7ZA 3UZPA 2QR8A 3R7GA 4QYFA 5CEMA 4ITIA 4QNAA 3RAIA 5BUEA 4LRJA 3JR1A 4V0GB 4U81A 4C4HA 3NAXA 4DEIA 4WNMA 4XV2A 3QF9A 3QTRA 4TN6A 4E6CA 1ZOGA 3BV2A 4YJOA 3RJCA 3CTHA 4QMPA 2PUIA 4F9CA 1R1WA 3V6SA 3MFSA 3ATTA 2CNQA 4NM0A 2XIZA 3VUHA 3UODA 1XH7A 3V51A 2GHMA 3RWQA 4EBVA 3UG2A 3EQBA 1BUHA 5EQPA 1CMKE 3G9LX 4FZDB 4ITJA 4DGLC 2C4GA 1P4FA 1GOLA 3D5UA 2UZOA 3QZHA 3FZOA 4NTSA 1PXJA 3V8WA 5AV4A 1BYGA 2XYNA 3PWYA 2G2IA 3A4OX 3K5UA 5FM3A 5L8LA 4E73A 5KMKA 1IAJA 4CD0A 2OICA 5AP5A 4L52A 1Q41A 4BCPA 5C4KA 2YITA 4CFVA 4UN0C 3LJ2A 2IO6A 2C0OA 2BROA 3EQIA 3ZEPA 4IW0A 4OT6A 1SVEA 3JVSA 4K1BA 1XH8A 2FSOX 3R2BA 4BDFA 3CSVA 5A3XA 3QQFA 1OITA 2C6LA 3D5XA 3IOPA 3PY1A 4RRVA 4O0WA 4QNYA 3TNPC 4F1OA 3HGKA 5FLFA 5TT7A 3ZDUA 4FNZA 1QCFA 4FT5A 1YI4A 2QOBA 4OTPA 3QRIA 3R21A 1OPLA 1MP8A 5JFVA 4NH1A 4R3RA 3CD8A 3KN6A 5EKOA 1YOLA 2R2PA 4PNIA 5EYKA 5IPJA 2XK3A 2WTWA 3CGFA 5JQ8A 1S9JA 3F2AA 3NS9A 4JG7A 4JJRA 2YIQA 5IEVA 4Q2AA 3TJDA 5CU4A 2VRXA 2VTRA 5EI8A 4HVHA 1YXTA 2X2LA 4MXXA 1ZMVA 2QHNA 3FMJA 1ZY4A 5CSXA 3ZM4A 4A7CA 2BHHA 4FL3A 3ZRKA 3HNGA 4TWNA 4EOPA 3ZOSA 5I0BA 2Y9QA 4L53A 2XKEA 3FXZA 4FKQA 2XK6A 3QXOA 3C5IA 5ANJA 3WZEA 4ZTRA 4BHNA 4EUTA 3MN3A 4XP0A 3IECA 3U8WA 3E8EA 3FZPA 4GRBA 4KKGA 4HYIA 4X2NA 3DNEA 2F7ZE 2V22A 3EN7A 2YM5A 4IEBA 5HD7A 1YOJA 5C27A 4FGRA 4XRLA 2VWVA 1ZOHA 3IGGA 3NUPA 4F63A 4ZMEA 3C51A 3G6HA 3UZTA 2VD5A 2XVDA 5CQUA 4AA4A 3Q5ZA 5FP6A 5CVHA 4BWKA 3FY0A 5AR5A 5FG8A 3E7OA 4EQMA 2BRBA 3HRCA 1PY5A 3BE9A 3HV4A 2R4BA 3DZOA 3Q4TA 4QMLA 5CU3A 4BC6A 4DAWA 4GKIA 4LUEA 3LCOA 4O0SA 4A9UA 4AZVA 4RWLA 4FV4A 4AGDA 4J7BA 2BDJA 3IDBA 1PMVA 2C69A 3VHEA 2P0CA 4GT5A 4R6VA 4F7SA 5K5NA 5EHLA 3QCSA 3PLSA 4RJ4A 2XJ1A 2R3GA 2VTNA 2WD1A 3ANQA 5HBJA 1GZKA 4WOVA 3V5LA 5J7HA 3O17A 3OCBA 3PY3A 4ANMA 3KF7A 4FK3A 1CKPA 1OKWA 2H6DA 2UVYA 4UV0A 3GNIB 3EQCA 3R30A 3RNIA 3PJ8A 4FV6A 2O5KA 4HZSA 2ZM4A 5D1JA 3QWKA 2UZUE 3R1YA 3SXFA 2B53A 3UVRA 3ZBFA 3TUBA 2OZOA 2R64A 2PVHA 4MD9E 5KHWA 1CM8A 3I5NA 4IC8A 4DBNA 4F99A 2XZSA 4G6NA 4WRGA 3EOCA 5CU2A 4FSQA 5K4IA 3KY2A 1GZOA 3R7OA 4L43A 5DE2A 4QYGA 3DKFA 3TIYA 4C61A 3FEGA 4ZTSA 4EOJA 4YJRA 2YHVA 3U6IA 1F0QA 3UTOA 4FEXA 3MW1A 3BGQA 4TNBA 3UIMA 4L7SA 4BDGA 5KKRC 3MJ1A 4FTTA 3BHTA 4XEYA 4FIGA 1XBBA 4FT9A 4OTWA 2VGOA 4D4YA 1XHAA 2XNPA 4E7WA 4IIRA 3UOLA 5AR7A 2ZMCA 2OXDA 4YTCA 3COHA 4C7TA 5H8GA 4ANSA 2Q83A 2QU6A 4JAJA 4EEVA 5KX8A 5CWZA 1JLUE 4AX8A 2HWOA 4BDHA 3L8XA 4O22A 1U54A 4MNFA 4JX7A 5E8WA 4QMVA 4L00A 4FEVA 2G2FA 2JIVA 4Y8DA 4ALWA 1H1SA 4FUYA 4KA3A 2QURA 4IAIA 3CIKA 5DEYA 4H58A 2C5XA 2RF9A 2ZV9A 3CPCA 4B7TA 4BL1A 4O7TA 1ATPE 4S33A 4GYIA 2R3FA 1Q8YA 1ZXEA 1JSUA 4IZ5A 2NPQA 3BBTB 5G1XA 2WTCA 3MIAA 1WBNA 3OMVA 4WIHA 3GI3A 5DHJA 5EFQA 3ZU7A 5IQBA 2HENA 3SD0A 2GNIA 5A6NA 4W8DA 3DGKA 4FVPA 5ETIA 4EOLA 1Z9XA 4N6YA 3ELJA 5HEZA 5KO1A 4RVMA 1GZ8A 3D4QA 3I5ZA 3WZKA 1M2RA 3VUDA 4TKSA 2CN8A 4OGRA 4PWNA 5D12A 3Q32A 2C1BA 1R0EA 3VJNA 4AZTA 4BHZA 2WQEA 2QVSE 3D7TA 3G6GA 4RIXA 1T45A 3MPMA 3VQHA 2WTKB 1GZNA 3K2LA 2V62A 3I6WA 2BIYA 5IG1A 4O7VA 1PF8A 3T9TA 3JPVA 1YWVA 3WIGA 4ZLYA 1PYXA 3OEFX 4RBLA 4ZLOA 5DN3A 4KUJA 2ITPA 2VWWA 3Q4CA 4MXZA 1WZYA 4XOZA 3UPXA 3DOGA 4L3LA 2C6MA 3GCSA 4RJ8A 2JD5A 2REIA 3BU5A 4KIQA 4ZZOA 1KSWA 4FIJA 3EL8A 4ZJIA 2DUVA 4QMSA 4AGCA 3DTCA 4Y83A 2RSVA 3ZEWA 4JIAA 3DLSA 3OXIA 3ZTXA 2GTNA 4YZDA 3MI9A 1UU8A 3MFTA 5BVEA 2EB3A 4DG2E 1ZMUA 1YDTE 1GIIA 1WBOA 4E20A 3U4WA 1E9HA 3IW7A 3LIJA 1Y91A 3D83A 3FMEA 2QCSA 3HKOA 4E5AX 4FKIA 3TV6A 1OBGA 4GUEA 3KULA 3MB7A 3P78A 1VEBA 4IB0A 2XIRA 4YMJA 3PIYA 2P55A 4LOQA 4CT1A 5IQCA 3DAKA 5IA5A 4L46A 3IW4A 4MEDA 4MBLA 3NPCA 1ZMWA 2GS7A 3R0TA 4HPTE 4NFNA 4ZP5A 5EI6A 2CKOA 2Z60A 5LARA 1M14A 4I94A 5M57A 5FEDA 4MTAA 3ALNA 2JAMA 4W9XA 3HDNA 5HVJA 5IMXA 4ANQA 2WPAA 5DR2A 4NU1A 3QCYA 5GNKA 2YM8A 4BZDA 4EK5A 2QLUA 1H1RA 4J98A 1Q3WA 5FTQA 4BDIA 3KL8A 3OOGA 2BRHA 2ESMA 3EZVA 3ZSHA 3KREA 3RK7A 3D2KA 3VIDA 3IW5A 5CZIA 3D15A 1YVJA 3UPZA 3GU5A 3VUKA 4GVJA 3HP2A 3A2CA 1OB3A 3IW6A 2CCHA 2QI8A 3A8WA 3ZMMA 5AV3A 3KU2A 4PTEA 5AMNA 4LFIA 3U4UA 3ROYA 2OK1A 3CGOA 3C0GA 3I4BA 4FTJA 3PXZA 3I81A 4U42A 3H9FA 3UMWA 3EFLA 3NIEA 3P1AA 4CXAA 5LQFA 4O6EA 2UVZA 3F5UA 4IM0A 3RPOA 3EJ1A 3K54A 3UVQA 4I1ZA 2LGCA 3TG1A 4EK3A 4YR8A 2I0YA 1FVRA 4II5A 2NNWB 4O7YA 2JKQA 2QOQA 2FO0A 3AC3A 3KXNA 3NYXA 2ZV7A 2GSFA 4BBFA 3W16A 1H25A 3MA6A 2XNOA 1M7QA 1E1XA 1DI9A 2XNNA 3NUUA 3VQUA 3ZFXA 4O82A 5IH6A 4TW9A 4PV0A 4MD8E 2Y6OA 2R0IA 1IASA 2YM4A 4FT3A 4C4GA 4QT1A 2CKEA 1OL2A 2B4SB 2PY3A 4FVQA 3V01A 4YO4A 3C4FA 1SVHA 4U7ZA 5FDXA 4RIWB 3WI6A 4ZIMA 3KMWA 1OKZA 3MH0A 3SHEA 5J5SA 4JIKA 5I9ZA 3GP0A 2HZNA 1W8CA 3CR0A 4AP7A 4F9WA 2WNTA 3AG9A 3QWJA 4MXYA 2NP8A 4O1PA 3R8LA 4LUDA 4DH7A 4FSYA 3KXMA 4G34A 3Q3BA 3OUNB 2W9FB 4JS8A 4PF4A 3KA0A 2C6KA 2W1DA 4FBXA 4CMUA 2YLEA 4LOOA 2YM6A 2Z2WA 1MUOA 4NZWB 4RFMA 5AR3A 3SDJA 1YQJA 3KXHA 2ZMDA 5IA1A 4YHFA 3TKHA 2UW7A 4Q9SA 4KBCA 4DFNA 4RQKA 5CANA 3FMLA 4O0VA 2UZVA 1XH9A 4F0FA 3FJQE 3C7QA 2JGZA 2JIIA 2VO6A 4XV3A 4G5JA 4KRDA 5HU3A 1IEPA 3U54A 4QO9A 3EFWA 3CY2A 4ANBA 4NW5A 2A4LA 3KXXA 2P3GX 3ZSIA 4JQ8A 2OIBA 2XKFA 4ZTNA 4PP7A 2XEZA 4U9AA 3I7BA 4ZY5A 4LI5A 4RX9A 2C3JA 4HNIA 4IADA 4M13A 5GJGA 4X6QC 5M53A 4KIKB 4M0ZA 3VBTA 2VAGA 2FGIA 4BR3A 3F6XA 3DLZA 3R2YA 2XS0A 4JBPA 4U45A 3AC4A 2YCQA 3V8TA 1OMWA 4IWOA 1P4OA 3BIZA 1BI7A 4AUAA 4RA5A 3RNYA 4EH6A 1S9IA 5HIBA 4F08A 3ORPA 4L42A 1NVRA 4JQEA 4IWDA 1PMUA 3E63A 4UXQA 3PPZA 2W5BA 1W83A 5CXHA 4XG9A 4IB1A 3W2QA 5DRDA 5CX9A 5KMJA 4Z16A 4QMNA 3QYWA 4ANLA 5HQ0A 4BDKA 4XX9A 1G3NA 3RPSA 4EOOA 4B99A 3NAYA 1PKDA 3O7LB 4ASXA 3H3CA 4BBMA 2R3QA 5CNNA 4FEUA 4P90A 3QTSA 4ACHA 3UE4A 4C62A 3L9NA 2WKMA 4G5PA 1KUTA 1YWRA 1O6LA 4GV1A 1W82A 4EOIA 4DFLA 5BVOA 4HGEA 2X8DA 1T46A 2QKRA 3Q60A 4O0RA 2WQOA 4DC2A 4IVBA 4E4XA 4EOMA 3UQCA 1RDQE 4E6QA 5IEYA 1JKKA 2C6DA 3PIXA 4U43A 4B8LA 4CYJA 5IH4A 4FSUA 4M67A 2WTDA 4RZVA 1AGWA 3MJ2A 4GK2A 3SOAA 3HVCA 3LM0A 3EB0A 4N6ZA 3SRVA 3TTIA 2Q0NA 2VTJA 3VS2A 4F1MA 3MS9A 3R7YA 3ZRLA 5JSMA 4QP1A 2QODA 3Q9WA 4I24A 4IZYA 2C5VA 4KWPA 4FKGA 5EH0A 5CTPA 2YJRA 3CXWA 4D55A 3EQHA 4S30A 1A9UA 4EZ7A 3QUEA 4CZYB 4EK6A 3CE3A 2C0IA 5EDQA 3UGCA 3UO6A 4YGAA 4MQ1A 3AT2A 2JDTA 2A2AA 2W1HA 2X7GA 1MRYA 1WVXA 3FZ1A 5JGDA 4APPA 3CQWA 2C0TA 3FMKA 3TJCA 3TN8A 2F2CB 3BRBA 2PMNX 3FMDA 5I9WA 4ZMFA 5JN2A 4I6FA 2ITWA 3Q53A 3LJ0A 2FYSA 4J8NA 4FV3A 3VBWA 4FT7A 4P5QA 4CYIA 4EH4A 3QD4A 2J7TA 3OT8A 2PULA 3HRBA 4IB3A 1CDKA 4MWIA 5LWNA 2UW4A 4JDJA 5CAUA 1BMKA 3NX8A 3ALOA 3NEWA 3LFSA 4Y73A 5CAOA 3NRMA 3C0IA 4KKEA 4BKZA 3SQQA 2WMTA 2XRUA 1PXNA 3EKNA 4RFZA 3GGFA 2ETMA 3NIZA 3SX9A 4AA0A 4OW8A 2XCHA 4TPTA 4GS6A 5AV1A 4YC6A 4A9RA 1UVRA 2WGJA 4QMMA 5KKRB 2YIYA 3R22A 4KD1A 4O0UA 2BZKB 1MRUA 3QTWA 4C4FA 3QZIA 3DTWA 5KMIA 4HOKA 4CQEA 2R3OA 3CQEA 4GVAA 5AP3A 5IQEA 4YBJA 2YDJA 4FK6A 1URCA 3Q2MA 3I79A 4X3FC 1UWJA 3F2NA 3KRJA 3FMMA 5FXSA 4EH3A 4CRLA 1OL6A 3DT1A 2YA9A 2GNHA 3LXPA 1GAGA 4ACGA 4D9UA 1WBSA 4JRNA 4ORKA 5M09A 3RZFA 5M4FA 3KRRA 2HOGA 4FI1A 4G31A 3PPKA 1YXUA 4I0SA 3ZO3A 4ENXA 4UALA 4YJNA 3HAMA 3QLGA 3CQUA 4L44A 2WIHA 4BCMA 2O2UA 2ITUA 4I5PA 1Q61A 2X6EA 4JI9A 2WMAA 5CYIA 5A4TA 4P7EA 1CTPE 4XYFA 2A27A 4ITHA 2VN9A 1WVWA 4G6OA 4YLJA 3A8XA 3UNZA 2B0QA 3JY9A 3GU7A 2PVLA 5A4QA 2QLQA 1UU3A 3FPMA 2OH0E 5DFPA 3TNHA 4BGHA 1NVSA 4WBBB 3LMGA 4NTTA 2E9UA 2X7FA 3P7AA 4H05A 1FMOE 2EXMA 4FVRA 5CEPA 5K9IA 2G1TA 2ZV8A 4EUUA 2XK4A 3NDMA 4XG3A 3E5AA 2XYUA 3GBZA 5TF9A 5A14A 4IDTA 3HP5A 3SXRA 3QU0A 3VO3A 2OIQA 2NO3A 4MXOA 3VUIA 3ZFYA 2E9PA 1AQ1A 2ITXA 3DXPA 3K5VA 3TEIA 4IZAA 2VWXA 5DT3A 4IFGA 4V04A 2CSNA 3REPA 5BYZA 4FKTA 3NYVA 1Z5MA 5J1VA 1GIHA 3GQLA 2WQNA 3QKKA 1NY3A 5J5TA 2WMBA 3W2SA 5J9ZA 5K0XA 4N0SA 4YJTA 4QTBA 4QPAA 4DEEA 4FV7A 3W18A 1FGIA 3DB6A 4EHGA 4EOKA 2WTIA 5IA4A 4AW2A 4RX8A 4C0TA 5EM7A 2FH9A 3L9PA 5HO7A 1UKIA 2XIXA 1Y8YA 4LGDA 5L2IA 4M84A 5E4HA 4TRLA 2YCSA 3A99A 3LE6A 1QMZA 1FOTA 5M4UA 3C4XA 5GIPE 2YM7A 3G2FA 3KRXA 4XP2A 4AE6A 4GFOA 2W5HA 4RX5A 3VS1A 4WA9A 2CMWA 2IZRA 5AAEA 1F5QA 1PXKA 4I6HA 3WYXA 4CZTA 4TNDA 4P5ZA 2GNJA 1YXVA 1BKXA 1V1KA 5EW3A 1XH5A 3PXFA 2ITQA 4M8TA 3CBLA 1KWPA 1NVQA 3GQIA 3GCVA 3DKOA 5HD4A 2QO2A 4PL5A 4DEHA 3TUDA 3AT4A 3JUHA 3SW7A 1M2PA 4I93A 3EH9A 4X3JA 2O8YA 2GS6A 4MXCA 3ENHA 4CNHA 5L2TA 4FF8A 3QZFA 3A7HA 3KFAA 4QP6A 1HOWA 3BYVA 2VTHA 5DBXA 3R83A 3NMUF 3FQEA 4TT7A 4C36A 5JFSA 3OW4A 4IM3A 2XA4A 3BCEA 3F3VA 5CAVA 3BV3A 4G9RA 3QC9A 3E88A 3V6RA 5BUJA 3VW6A 4KIOA 1PYEA 2J51A 4E5BA 2IVTA 1GIJA 1B39A 4QQ5A 4YJPA 4A4LA 1YRPA 4JVGA 1KV2A 3OHTA 2YABA 4IX6A 5D7VA 3U6JA 5JZJA 3WZDA 4QYEA 3L8SA 3ENMA 1RW8A 2PVNA 2X7OA 3BQCA 3OY1A 4WHZA 3N4UA 3Q4UA 1VR2A 2RFEA 1YHVA 4FV2A 1W7HA 3MVJA 3NW6A 4IC7A 4JLCA 3EL7A 3D7ZA 2ITYA 3OY3A 4RIYA 4DGOA 3G51A 3SA0A 1H26A 4H3PA 3CEKA 4J53A 4QP9A 3MESA 5GINE 4TY1A 4FSWA 2R9SA 3D0EA 4MNEA 3FQSA 1ZYLA 4FTCA 4HNFA 3GC0A 1X8BA 3OG7A 3NLBA 3OCGA 4G3EA 3E3BX 4QP4A 3UVPA 2UVXA 3LQ3A 4BIDA 4BIEA 3TKIA 4B0GA 4RWKA 4ZK5A 4F7LA 1L8TA 5IQIA 3P4KA 3QTQA 4V01A 5BVFA 3KRWA 3I0OA 2R3LA 3RPVA 1U54B 4ZLZA 3EYHA 3A7JA 4BWXA 2PL0A 4MX9A 3PA3A 2W4KA 4GYGA 5LCKA 4UMRA 3Q5IA 2IZSA 4IX4A 4TTHB 5L4QA 4BB4A 2PPQA 3PFQA 4EH5A 3BBWA 3F69A 3M2WA 4FZ7A 3R8PA 5AX3A 5F9EA 5B0XA 2R3HA 4IX3A 4E3CA 5HZNA 2W96B 2XBJA 4OTIA 2B9JA 4ZSJA 4K11A 5H8BA 3MPAA 2BTRA 3IK3A 1IA9A 3OVVA 2UZDA 4CQGA 3DKCA 3F5GA 5KMOA 4M3QA 5AIKA 4BI2A 3NVKI 4ALUA 4YURA 4YTFA 5E7RA 5IUIA 4I20A 4UYAA 1IG1A 4L3PA 5I9UA 3PG3A 2VWUA 1JAMA 4BTMA 3U55A 2UZWE 4IAKA 2PMIA 4FIIA 4AW0A 5KZ0A 3DFAA 1Q3DA 3D7TB 1WBTA 2YDKA 4RIXB 4FV8A 3LFDA 3D14A 3DFCB 3H4JA 3MBLA 4U3ZA 3KXZA 2JBPA 4FKVA 4TYJA 5HNGA 4BCJA 4USFA 2C6EA 2VTIA 3BZ3A 2FB8A 3ORIA 4PDSA 5DEWA 5DYJA 5K0KA 4D4SA 3VUMA 2C68A 4F64A 2G15A 3SG8A 3AC5A 4HVSA 2KTYA 2WEVA 4RVTA 1LEWA 5AUUA 4KIPA 1NA7A 2GNLA 2IW9A 4FOCA 5AWMA 3TZ8A 3QL8A 3PIZA 3RBWA 4YZBA 3FYJX 3L1SA 4O83A 1Q62A 4R7BA 4OBOA 3THBA 2F57A 3QD3A 2HIWA 3ZC6A 5M56A 1STCE 2QOHA 1YXXA 1QPDA 3NNUA 5EM8A 2W06A 2XKCA 2ACXA 2BFYA 3IDPA 3FBVA 4OLIA 3KULB 4NM5A 4UEUA 1OUKA 4EORA 1OPKA 4NK9A 3M1SA 2OFUA 2JLDA 2OJ9A 4DE4A 4R3PA 3TM0A
chains in the Genus database with same CATH superfamily
2YWPA 2YAAA 3NSZA 2C6IA 3HV3A 1F3MC 4NKAA 1DAYA 1JSTA 2OIDA 4IBMA 4ACMA 4C35A 1LR4A 3LFFA 4EH9A 1XMMA 3BHVA 3HAVA 4G3FA 2XB7A 4XV9A 4BCOA 3PG1A 3BGPA 4PDOA 2GMXA 5A4LA 3QCQA 2F2UA 3GFWA 5DLSA 3AD6A 3A7FA 3KEXA 3ORLA 5AAFA 2PZIA 4EJNA 3RAKA 4E5WA 4N4SA 4UMTA 4AXFA 2J9MA 3Q9ZA 4KSQA 3QYZA 4RGJA 4JX3A 3FI3A 4ZXTA 1J7IA 3FXXA 4RC2A 3PE1A 4ZS4A 2B52A 3FZSA 3UOKA 3LFAA 4QPSA 4B8MA 4DTAA 3RP9A 1GY3A 3ATSA 1PRYA 2ZB0A 4ZTMA 4BDEA 3V5TA 4BVUA 5HLWA 1FINA 2C5NA 3BKBA 1U4DA 3POZA 4QQTA 2YWVA 3Q9YA 1WMKA 3F82A 4OBPA 4FOBA 5ANKA 4UMUA 2ZFYA 5JT2A 3PUPA 3SW4A 4MKCA 5HCYA 3OWKA 3N9XA 3DPKA 1K2PA 4QMWA 5HX8A 4KNBA 1B38A 5L2WA 3DQWA 4YSMA 3VF8A 3FLZA 3VS3A 3HV7A 3HUCA 4TXCA 4AZFA 4C38A 4A9TA 4CV8A 4D5HA 3FKLA 2WMSA 2QHMA 4UMPA 4W4XA 3LJ1A 3R9DA 3VC4A 5HESA 2V7AA 3ID6C 3LOKA 4ACCA 4FZFB 3IS5A 3C50A 3PWDA 4M68A 2CGUA 2OSCA 1KE5A 3QLFA 4NJ3A 3VW8A 4F6WA 2HXLA 4NWMA 3S3IA 4ZY4A 4XS2A 4FIFA 5TO8A 5E8YA 4CEGA 2XIYA 2LAVA 1REJA 3QX2A 2YZLA 3UOJA 1J7UA 3QKLA 2PE0A 3OTUA 4MAOA 5CI7A 3KRLA 4UY9A 5J9YA 3FKOA 5DRBA 1TKIA 3WF5A 2R3RA 4GK3A 1Q8UA 4FV0A 3MA3A 3Q2JA 5K5XA 2QO7A 5DG5A 2W1FA 4AW5A 2YDIA 4YHTA 1R78A 3OW3A 1WVYA 1ZLTA 3CY3A 5CAPA 3FDNA 4WBOA 4MVFA 4WNKA 4F6SA 3E8CA 4FYOA 4ANOA 5M55A 4BTKA 3C1XA 5CXZA 4RJ5A 3QAME 4MF0A 3QBNA 2RKUA 2OF2A 4RVKA 3HMOA 4FKRA 5C03A 4QTCA 2CNVA 4FKLA 3LFNA 3E93A 4FJVA 4O0TA 5HIEA 2JITA 3TNQB 4RVLA 4EQUA 2QOIA 4FNXA 3QXPA 3MH1A 3K3IA 3BLQA 4JBQA 4NFMA 4NW6A 5DH3A 5EQEA 4LM5A 2HZ0A 4QYYA 5EHOA 2QR7A 4X6RA 1MQBA 2XM8A 4LRKA 4V05A 4KBAA 3AGMA 3SC1A 1PMNA 5GZAA 2Z8CA 3P5KA 4JBOA 5FEEA 2X0OA 4N57A 4XG6A 3S95A 2W17A 4EI4A 3P7CA 3TI1A 5KBRA 4GIIA 4DFXE 4DH8A 4XHKB 5JGAA 1OKYA 5HICA 2CGXA 4AGUA 4DINA 5EI2A 4GT4A 4BDCA 3UNKA 3UNJA 4MYGA 3UC4A 4FE2A 3QGWA 2G9XA 3IGOA 4FMQA 4LMUA 4MXAA 5F20A 4O7NA 4O4CA 5DI1A 3QQGA 2X6DA 3P08A 3JYAA 4BKJA 4D58A 2UZNA 1RQQA 2PK9A 5HE0A 3ODYX 3O0GA 5IA0A 3QTXA 2XNBA 4I4FA 3WE8A 3PLAE 3WF7A 3A7GA 4JRVA 2HCKA 4LL5A 4DEGA 4IE9A 3EQPA 3E8NA 4EQCA 5FEQA 5FXRA 3OCTA 4U6RA 5GIOE 1TQPA 3IO7A 3UYTA 5HORA 5LMBA 3SOCA 5IDPA 2P4IA 2Y4IC 4JG6A 4USEA 3MPTA 3NUNA 4AA5A 2B9HA 4LV8A 3R9OA 2HW6A 5CQWA 3U51A 2WB8A 2VO0A 4TZRA 3LZBA 1SYKA 4N70A 4YLLA 4C3FA 3HMPA 2EVAA 4J52A 3FC2A 1OVEA 3DK7A 2C3IB 3RM7A 1OL7A 3AMBA 2FSMX 3H30A 5IQFA 5AR2A 3EZRA 5KMLA 4JAIA 3AT3A 3VJOA 3L8PA 4U40A 4PNKA 5E91A 2DQ7X 4GMYA 4DBXA 4PMMA 2OG8A 3DAJA 4FKOA 5AP6A 3OF0A 3UZRA 3SRVB 4QP8A 3QQKA 3V5QA 2HXQA 3MH3A 5E8SA 4B9DA 4C3RA 1OZ1A 2XNEA 3PJ1A 3NUXA 4DHFA 4NL0A 4BI0A 4D2VA 4IVDA 3BELA 3O8PA 5HTBA 5J79A 2ZAZA 4TYGA 3ODZX 4M15A 1ST4A 1JOWB 3VN9A 3R1SA 3TZ9A 3TTJA 2YIRA 1Z57A 3LQ8A 3FUPA 4WSQA 2W1EA 3QUPA 1SVGA 3CLYA 3G90X 2OXYA 3RMFA 2XBAA 1G5SA 3PVGA 3DZQA 1J7LA 2H34A 4K9YA 2OBJA 4I41A 4AWIA 5DT4A 5IISA 4JG8A 3VS7A 4BTJA 5LVMA 2ZM1A 3SG9A 4CVAA 3EYGA 2PSQA 5IUHA 5FGKA 4BJJA 3F7WA 4FC0A 4KBKA 2JFLA 2VZ6A 4ZSGA 3CTQA 4CFNA 5CU0A 5AR4A 2JDSA 5LWMA 2BKZA 1KE9A 4BYJA 3S00A 2AC3A 5J87A 1ZWSA 3OC1A 3OWLA 2BZHB 5J95A 4QOXA 4PTGA 2WMRA 3VONA 3QC4A 2VX1A 3FL4A 4LG4A 2A98A 3GENA 5E92A 5C8KA 2PYWA 3UQFA 2ITOA 4FNYA 4NCTC 4YLKA 2VV9A 2XF0A 4DTBA 3BE2A 4HCVA 4PUZA 5LOHA 2J0IA 3BHHA 4O4FA 5IF1A 4YJQA 4EZ5A 3QRTA 4B6LA 4IAFA 4CLJA 1YKRA 1QL6A 3ULZA 3FZRA 1UWHA 2BMCA 4A9SA 2ZVAA 1B6CB 2WU6A 3HDMA 3VRZA 5HG9A 4RLLA 2R0UA 2GDOA 4EH7A 3BYSA 4O38A 3LMIA 4KRCA 5L2QA 5L3AA 2UW8A 3RM6A 5B2KA 2V7OA 4YC8A 4X3FA 5AP1A 2Z7SA 3F3TA 3R7VA 4DFUA 4BCFA 3R8ZA 2E9OA 4EZ3A 4OTFA 1UNGA 3LQ5A 5CAQA 1H28A 5ETFA 3ZFMA 4J99A 4KABA 3SKCA 4FRFA 3VVHA 3NW5A 2RFSA 1YXSA 2Y6MA 3UP7A 3OS3A 4IAZA 1H4LA 5L8JA 3VS0A 4F9BA 2PVJA 3F66A 3ZBXA 3U87A 4L01A 1FVTA 2VTOA 5FTGA 3ACJA 4FYNA 1ZYCA 1TQMA 3QQLA 3Q9XA 3KGAA 4ZSAA 4WG5A 2DS1A 3IG7A 3G15A 5JK3A 3R04A 3GOPA 5H9BA 2O0UA 3L9LA 4OT5A 2VTAA 3M11A 4DH5A 3GB2A 4U97A 3VULA 4C59A 2I1MA 2JIUA 5EW9A 4YZNA 4QP7A 5KMMA 5AIRA 2UZBA 1Q97A 4M0YA 3EQFA 3PVWA 4L6QA 3TZ7A 4BDBA 4QP3A 3VBXA 4WKQA 5D10A 1ZRZA 3NZ0A 3MIYA 4DFYA 3DU8A 4FEWA 3FSKA 2R5TA 2CKPA 4H3QA 3PJ2A 2W4JA 1OI9A 2NRUA 2W1GA 3PPJA 3QD2B 4L3JA 5CEKA 3DBFA 3QX4A 1QPCA 5DIAA 4JQ7A 4UZDA 4BWPA 1OPJA 4M69A 2VTTA 4Q5EA 2J0JA 3FQHA 2E9NA 4FTMA 3JXWA 4I4EA 5CNOA 4YSJA 2X4ZA 2PWLA 2XNMA 3COIA 2I0VA 3ORMA 2O65A 4WG4A 5D41A 5D7AA 4C57A 3LFBA 5IDNA 5TOZA 3PRIA 4A06A 4DHJA 3C4WA 4Y5QA 4AU8A 3PSDA 4YUQA 1UNLA 2AUHA 3F3UA 3OFMA 4XP3A 3ZUTA 4C2WA 4CFMA 5HG7A 4FL1A 4FNWA 4EWHA 1ZYJA 2J90A 4H1JA 4LRMA 4FTLA 1P14A 4GU9A 4GU6A 3TZMA 2O3PA 2XANA 4DF3A 2QOKA 3KB7A 4MQ2A 3BLAA 3R28A 4XG2A 4WUNA 5CLPA 5HVKA 2ETKA 3QGYA 2XK9A 3BQRA 3GCUA 4LOPA 1OIRA 3WOWA 5LVNA 3UIXA 4FTAA 3I60A 4FSMA 2ZYBA 1DI8A 4EBWA 5EG3A 5EK7A 4AE9A 1O9UA 3G0FA 4FTIA 1M7NA 4S34A 4C58A 2BAQA 3K3JA 2WMQA 1U5RA 4RX7A 4CFWA 3WF8A 4XRJA 1JPAA 4E93A 4DEAA 4H1MA 2OGVA 3DQXA 2JKMA 3PTGA 2JC6A 4YTHA 4BGQA 2QKWB 3RGFA 1WBVA 4JDKA 2YJSA 3GUBA 4O81A 1YWNA 3V5JA 4LV5A 5A4CA 2BTSA 5IA2A 2GQGA 1SM2A 5CSVA 3RWPA 4YBKA 4XV1A 4CSVA 3Q6UA 4EC8A 1OL1A 4C8BA 4HPUE 3QQHA 4XH6A 4ZSEA 2VX3A 4NYEA 2B1PA 5EDPA 4IX5A 4HVIA 1VZOA 1Q99A 1JSVA 2XUUA 2PVRA 3FAAA 4KINA 2OKRA 4RC4A 1NT2A 2BDFA 1XH6A 2XNGA 4ID7A 4GCJA 4J96A 5I3OA 5JRSA 4DG0E 3TKUA 4Z7HA 4WRSA 3MYGA 3PVUA 4PQNA 4HGLA 5E90A 1JNKA 4C4JA 5JFXA 3UO5A 1FBNA 3BHYA 2OH4A 3ACKA 4X2GA 4ZTLA 1PXLA 1H1PA 1UNHA 2ERZE 2HELA 2QD9A 3F5XA 2EXCX 3O2MA 1PXMA 5CVFA 4F09A 3PXQA 3QKMA 4O4DA 3DBCA 3LFCA 3O8UA 1KOAA 4FKWA 5JRQA 4X2FA 4ERKA 2I7QA 2Z02A 3V5PA 3CJGA 2VGPA 4YZMA 4QMQA 4ZY6A 1WCCA 4CFXA 4CCUA 4XMOA 4YJVA 4YJUA 2WAJA 3WARA 4Z3VA 4J97A 4U5JA 2UW5A 5FTOA 2AYPA 5LCJA 4OTHA 3R8MA 3P9JA 4AQCA 3ERKA 3GXLA 3VNTA 4RIYB 3R02A 4C4IA 4ALVA 4RJ7A 3DY7A 3Q96A 4K8AA 2VTMA 2IF8A 5IKWA 4MNEB 2EB2A 3PA5A 2YCRA 3R71A 4CKRA 5IZFA 4DGGA 3QQUA 3QD0A 5JFWA 4EWQA 4AS0A 2OXXA 2YIXA 3GU6A 3JS2A 4ENYA 3T8OA 5EDRA 3RPYA 3H0YA 2CCIA 2PVMA 3F9NA 3ZONA 3U6HA 3F88A 2CNUA 2F9GA 4CTCA 3SLSA 1PW2A 4FL2A 3LCDA 3MV5A 4U80A 5J9LA 2BPMA 4ACDA 3BWFA 2OZAA 4CG9A 3BU6A 2X0GA 3I0QA 5IA3A 4MUQA 3QHRA 1BI8A 1WBPA 3OP5A 5CENA 2ITZA 2W4OA 2JKOA 4XG7A 3TL8A 4R7IA 3LM5A 4I0RA 4GIHA 5ANDA 3DK3A 3LFQA 4FSNA 1QPEA 4IANA 4NIFA 4ASZA 4CLIA 2J5FA 5HBEA 3W1FA 1ZAOA 4JBVA 1H08A 1UKHA 2NYAA 3AGLA 2ZJWA 3RCJA 3BYOA 4GW8A 1SNXA 4O96A 4EC9A 5BYYA 4B4LA 1Q8ZA 4FGBA 4JR7A 4LGHA 4CCBA 5BNJA 4PP9A 4BZOA 3RTPA 3U9NA 2CPKE 2OU7A 2WZJA 4WD5A 2W1CA 3W2CA 4O6LA 3DXNA 5K4JA 4QQJA 3D5WA 5AUZA 4F9YA 2EUFB 2ITVA 1P2AA 3C4ZA 4BI1A 2WOUA 4BY9E 2IG7A 1J91A 2GFSA 5CI6A 3L9MA 3QZGA 4IZ7A 1GNGA 3EN4A 3GC7A 3PFYA 4DT9A 3R00A 3QA0A 3OUKA 4A07A 3VRYA 3QRKA 3O50A 2VTQA 3EQGA 3R9RA 3V3VA 5FWKK 4DH1A 3VHKA 4UZHA 4BTFA 3GT8A 3QFVA 4D0WA 4DLIA 3PZEA 3ZCLA 4IVCA 1PKGA 3W0RA 3DJ7A 4NT4A 3ZM9A 3W8LA 2IW8A 3KVWA 3F61A 3DB8A 3GVUA 5EOBA 4DITA 2W7XA 5TR6A 2EWAA 4NJDA 4XNEA 5BQ0A 1H0VA 5DOSA 5KZIA 3PZHA 4PPAA 3UDBA 1H1QA 3G9NA 3AD5A 4FZ6A 1TQIA 3EN9A 4FV9A 4M14A 2ZOQA 5JKGA 3A60A 2YERA 1DM2A 3QALE 4KAOA 5EM5A 4O86A 2W99B 4X2JA 3CKXA 1YW2A 4KKHA 3T3UA 4AZWA 3BX5A 3OXZA 3ZLYA 3OROA 1TVOA 5HO8A 3IKAA 4G16A 4UWYA 3R7EA 3HL7A 5HU9A 3ET7A 4RJ6A 4E4NA 4NUSA 4GG5A 4AW1A 1HCKA 3C9WA 4LYNA 4NSTA 3RK9A 1YDSE 3PXKA 3FSFA 4E8AA 1K9AA 2C1AA 5EM6A 4I6QA 4NM3A 2ZDTA 4RFYA 4FSZA 2HK5A 2WO6A 4FV5A 4IAAA 5AX9A 5E9EA 4I5CA 1H0WA 5HCXA 2JAVA 3UBDA 4AGWA 3O96A 4UX9A 4CV9A 4GUBA 5CEIA 4O2ZA 4FT0A 4E6DA 2IEWA 5CF6A 3BEAA 1U5QA 3PJCA 2OLCA 3ZRMA 1ZZ2A 1OKVA 3HMIA 4TWOA 5KE0A 5IQGA 4FIHA 4EYJA 4G2FA 4E26A 4F4PA 3EWHA 4OTGA 3RHXA 4F70A 2GNFA 4D2PA 2YAKA 3AC2A 5A9UA 5B7VA 3PYYA 1TFFA 4FG7A 3DDPA 4CT2A 4Y5HA 4MK0A 3VBQA 5HNIX 2GQRA 4RT7A 4XBRA 5BV3A 3DBEA 3KF4A 5CF5A 3GC9A 5CSWA 2GQSA 4RIOA 4CKJA 1SZMA 3LCSA 4RA4A 5C8MA 1Y6AA 5HKMA 5BX0A 4FTKA 4DN5A 5I9VA 2WQMA 4ZJJA 2PE1A 2WTVA 2ZV2A 3DAEA 4IJ9A 3UIBA 4F6UA 2BVAA 4PL3A 4QYHA 5TE0A 3FI8A 3DV3A 2CLXA 3V5WA 3WE4A 3LHJA 5T6KA 2BALA 4YTIA 4DG3E 4BYIA 2GHGA 3VUTA 2I0EA 3UMXA 2V0DA 1JKTA 2UZEA 3HECA 4IWPA 4Z55A 5FRIA 2R3MA 3NUSA 5CU6A 1WBWA 5DA3A 3D5VA 5EYMA 4O7LA 4Y46A 2YM3A 4I22A 2J0MB 2VO3A 4K18A 5DT0A 4CFFA 4I6BA 5A54A 2PVFA 4Q9ZA 5BMSA 3HLLA 1XO2B 5AP2A 3EN6A 4LGGA 2NRYA 1LUFA 1SNUA 2XJ0A 4AN9A 3TIZA 4D2WA 4TWCA 2OFVA 3H0ZA 4UYNA 4AN2A 2YCFA 2Y8OA 4BICA 5FBNC 4MF1A 1VLRA 3R6XA 4IMYA 4HJOA 4P4CA 4QMTA 3BLHA 5ANOA 2GNGA 4W9WA 5BVDA 3H9OA 4PPBA 2A19B 2JFMA 3BYMA 4FG9A 4I6LA 3LMHA 2RFNA 3SGCA 5C1QB 2I0HA 3TDWA 4FTQA 2BZJA 3GEQA 1KOBA 4FTRA 4IXPA 3DBDA 4XG4A 4YU2A 4O0XA 3DJ5A 3OTVA 5FP5A 5HI2A 3TNIA 3DKGA 2PE2A 5LVLA 4EL9A 3O7LD 4HYHA 4OTQA 2P33A 3DK6A 3TACA 4O21A 3MWUA 1OGUA 4YP8A 3IW8A 4A4XA 3L8VA 4AXAA 3MSSA 1NW1A 5IUGA 5M06A 3OCSA 4E6AA 2OJJA 2DWBA 2KULA 2QC6A 2VWYA 4DGMA 2XH5A 3HYHA 4O2PA 5M08A 3UO4A 4R3CA 3BLRA 5AA9A 2IVUA 3LXKA 1UU7A 2H9VA 4K33A 4D1ZA 1H00A 2PUUA 5LJJA 3D2IA 2UV2A 2XIKA 5GHVA 3DXQA 2JKKA 2YZAA 2J0LA 4X2KA 3ZLWA 4FKUA 1Q8TA 3IQ7A 4QTEA 3O23A 4FKSA 3R9HA 3ULIA 4J8MA 3NGAA 3FPQA 3GC8A 4ONAA 4RPVA 5JMSA 3TV7A 4EKLA 2PZYA 4L8MA 5A6OA 4D2RA 1NXKA 2X9EA 4AAAA 3CC6A 5ICPA 5HHWA 2FSTX 4HGTA 3LLTA 3OT3A 3AMAA 3PP0A 2R3NA 3U9CA 4AFJA 4G17A 3QA8A 4PX6A 3TNWA 2I6LA 2J2IB 3FMNA 2RL5A 4HVDA 4O7RA 4S2ZA 5M4IA 5LVPA 4OR5A 1W0XC 3ORZA 4FZAB 3TUCA 1OUYA 1Y8GA 2GU8A 3DJ6A 4D5KA 5AR8A 2UW9A 3OBJA 1PHKA 2UZLA 3T9IA 3A61A 4FEQA 4QPMA 2C6OA 1M17A 3RI1A 4Y85A 5CF4A 3KC3A 5FXQA 3TDVA 2BZIB 5EKNA 3ZO2A 5HGIA 3PRFA 4FSTA 3E7VA 4E4LA 2GPHA 2F7EE 1XQZA 3LCTA 3UP2A 2X8IA 4D2SA 4CZUA 5AV2A 3ZUUA 2JEDA 4I21A 5EQYA 2UW3A 1BL7A 1KE6A 5IH5A 2PVYA 3QUDA 4EHZA 4BJJB 2Z7RA 4D1SA 3W0QA 4AT4A 5KMNA 4GK4A 4HZRA 3GU4A 3EKKA 5CVGA 3NUAA 2XEYA 2FSLX 1ZYDA 2VNWA 3ZLXA 1ZOEA 3FI2A 4K2RA 3FLNC 3QHWA 4AT3A 2W1ZA 2YN8A 4TYHA 3AXWA 5E1EA 3SXSA 3C0HA 3G33A 2HW7A 3P79A 4QMOA 4I92A 1V0BA 3O51A 3ZYAA 2PTKA 4H3BA 4NCTA 2PHKA 2QONA 5TKDA 4F65A 2BKKA 4JDHA 1YHWA 3MFRA 2X2KA 3B8QA 2AC5A 3LXNA 1I09A 2Y0AA 3TV4A 4F7JA 2OJGA 3A4PA 3NW7A 4PPCA 1EH4A 3F3WA 4I3ZA 5DR6A 1KE8A 1OIYA 5JQ5A 3UDTA 3GU8A 1W84A 2B9FA 3FXWA 4MCVA 1J3HA 4EJ7A 1KE7A 1Y57A 3QCXA 1OIQA 4X3FB 3VS5A 5A46A 4R78A 1ZYSA 4U8ZA 5BVKA 3VUGA 1FPUA 1HCLA 5DR9A 5CSPA 1PMEA 1ZZLA 2IVVA 3KK8A 1IAHA 1YHSA 2BAJA 2W0JA 3HMNA 3OWPA 4IHPA 4IQ6A 3R63A 3LLAA 2VWZA 5KUPA 5E8XA 2BILB 4HYSA 3WF9A 2C5YA 3IDCA 3PSCA 3N4TA 4DH3A 3FL5A 5HTIA 4RG0A 5HVYA 4RMZA 3HV6A 3QRJA 5CSHA 5EYDA 4PMPA 1OL5A 1XMLA 2XJ2A 3QQJA 3SAYA 4TYEA 4AN3A 3E92A 4TWPA 4V0GA 4H36A 3QRUA 4ZS0A 2BR1A 3QTUA 4YHJA 4PDPA 5HX6A 2H8HA 4AACA 4CMTA 1H1WA 3I6UA 1ZARA 3DDQA 3OBGA 5LMAA 5E8ZA 3VF9A 2VU3A 1DAWA 3AD4A 3WZJA 2VX0A 4QQCA 5AP4A 5T68A 4BDDA 4WNPA 2X9FA 4GL9A 5LXMA 1O6KA 3W8QA 5L8KA 1LEZA 5AA8A 3NR9A 4R7HA 4FICA 1U46A 3OWJA 3W2PA 3UQGA 4BGGA 3KK9A 1CSNA 3MTLA 3R8VA 1VJYA 4R5YA 4M69B 2CDZA 3KQ7A 1SMHA 4HCUA 4X7QA 5GZ9A 4DTKA 4R1VA 5AJQA 4G3CA 4QTDA 4X21A 5KBQA 3FLYA 4C2VA 5JGBA 2CN5A 3MY5A 4FUXA 4ZAUA 5GJDA 2RGPA 4BCKA 4DEDA 5B2LA 3F2RA 3LCKA 5E1SA 4L45A 4UWCA 1XWSA 4FTNA 2X39A 5H8EA 2QOCA 4Y95A 2A0CX 5HO6A 4DCAA 4DDIA 3V8SA 2OO8X 3CKWA 1LP4A 4DA5A 3UDSA 2X4FA 1BL6A 2YACA 3TXOA 3EFKA 3GCPA 3TYKA 2W05A 4XBUA 1Q24A 5IEXA 3UG1A 5M4CA 4L7FA 3HEGA 3FE3A 1G8AA 2IZTA 4CKIA 5HE1A 4EH8A 4K6ZA 4F7NA 1FVVA 2BCJA 2R7BA 2HY0A 4FKPA 4NM7A 1MRVA 3G5DA 3NVMB 3RK5A 1U59A 3R9NA 3DA6A 2OW3A 5HG8A 1H24A 5CEOA 4CMOA 1MQ4A 2Y4PA 3PSBA 3EIDA 3P23A 2QOFA 4USDA 3NUYA 2XMYA 3D9VA 4KSPA 3W33A 5BMMA 2B54A 5HTCA 3C13A 3W2OA 3AMYA 2OI4X 1IRKA 5AFVA 2YLFA 4QRCA 5BVWA 3Q4ZA 4FG8A 2WFYA 2RG6A 5D9HA 3SVVA 3D94A 1K3AA 3MTFA 4OTDA 2PMLX 2WEIA 5AM6A 3VBYA 4D2TA 5IQHA 5D11A 4EOSA 2GS2A 3ZXTA 4XG8A 1ND4A 1PXOA 2ZDUA 4M7IA 5HNBA 5C26A 3ANRA 3MDYA 4ASDA 3FY2A 3W2RA 4DCEA 1A48A 2YEXA 4TL0A 4D1XA 5IMEA 5DGZA 2I40A 3H9RA 4FA2A 1Q8WA 5M07A 4GT3A 4FODA 5H3QA 3LXLA 3IPHA 4ZJVA 4YNEA 5GZ8A 2C6TA 4OUCA 4MHAA 4WO5A 3HAMA 3PVBA 1XBAA 3N4VA 5J1WA 3QTZA 1BLXA 3AKJA 3BL7A 5HOAA 3PXRA 3FHRA 5FUTA 2RG5A 3TCPA 2JDVA 4ASEA 3FKNA 4JT3A 2UUEA 4W4WA 4EKKA 3ZZWA 4KS8A 5AV0A 4R5SA 3R7UA 3W0SA 4A9YA 3T3VA 5M44A 2C3KA 2W1IA 2BAKA 3EMGA 2VTLA 5ANGA 4EHEA 3MVLA 4EH2A 2BRNA 2VNYA 3B8RA 1FMKA 2RIOA 3MGYA 2IN6A 3NNVA 3CTJA 5EOLA 5C01A 3W10A 2JDRA 4DGNA 4IACA 4O7SA 1IA8A 4HCTA 3C4EA 3EN5A 1XR1A 2ITTA 2F49A 1TZDA 2XM9A 1XJDA 3FWQA 2P2HA 3HA8A 3NWWA 4O27B 3RAWA 3WF6A 4R77A 4AXEA 2OZAB 3ORKA 5ITAA 2WELA 2Z7LA 2IPXA 3HV5A 4FTOA 4DEBA 3Q6WA 3S2PA 3FLWA 1KV1A 2F4JA 2QOOA 3R1NA 5AM7A 4IJPA 2BRGA 4LMNA 5CF8A 1LPUA 3AC1A 2CJMA 1UV5A 2R7IA 4MD7E 4NIFB 1J1BA 3UJGA 1QPJA 2W5AA 4PMTA 3ML1A 3EFJA 4OAVB 1YOMA 2PMOX 3DCVA 3POOA 4YC3A 5AUXA 2BHEA 2PZPA 3BPRA 5HCZA 1I44A 5AUYA 3JY0A 3AQVA 1PJKA 2PUPA 2W9ZB 2BUJA 2HY81 2O64A 4O0YA 2J4ZA 4G3DA 2X2MA 2X1NA 3CP9A 3BWJA 3FMHA 1Q5KA 2WOTA 4D0XA 2J0KA 4O7WA 3FV8A 4C3PA 2R3PA 2FA2A 4FR4A 3C4CA 5GJFA 4BCIA 4D28A 4HYUA 1RJBA 4PL4A 4MWHA 4LQMA 2BRMA 5I9YA 5E8VA 5E8UA 3NCZA 5HE3A 3LW0A 3G0EA 3VWAA 5JEBA 4NEUA 2J6MA 5DVRA 4BKYA 3FLSA 1XBCA 5AUWA 2R3KA 1R0PA 3NNWA 5T3QA 3VBVA 5H2UA 5G6VA 3PXYA 2J5EA 4YO6A 3HZTA 1E1VA 2OJFE 5KHXA 2V5QA 3WZUA 1VYZA 4IM2A 3M42A 4ZTQA 4E4MA 1UU9A 4WNOA 3O71A 4PY1A 4JXFA 4UWBA 4G6LA 3ZSGA 5AUTA 4TYIA 4DT8A 2QG5A 3PA4A 4U3YA 5AAGA 3ITZA 2A1AB 4AOIA 3A62A 3KCKA 4ZSLA 4J71A 5CZHA 5HLNA 4YJSA 1YI3A 1WFCA 4Z7GA 4BCNA 4C34A 3MY0A 4QMXA 3ZZEA 1CKJA 5B2MA 2G01A 4G9CA 3EQRA 3W0MA 2FVDA 3RHKA 4D9TA 3RCDA 4IH8A 4O91A 3ZUVA 3O5AA 3TMOA 2GTMA 3CCNA 1L3RE 3KMUA 4I5MA 4RC3A 5AP7A 3UC3A 3LVPA 2CGVA 5DPVA 2X0PA 5EHYA 4Z9LA 3I7CA 4D4VA 2ONLA 2XCKA 5L2SA 2QU5A 4AF3A 1H07A 5CS6A 1JBPE 3S1HA 3ZS5A 5C4LA 3VS4A 1XKKA 4WSYA 3EQDA 5C9CA 2XK8A 2BIKB 3LFEA 1DS5A 2JDOA 3FC1X 4QMZA 3RKBA 1YI6A 3BU3A 3HUBA 5FD2A 1JWHA 3OOMA 2IWIA 4P2KA 5F4NA 5J7BA 4CTBA 3MY1A 2GCDA 5I9XA 2G2HA 3FZTA 2HZIA 5C8NA 4C37A 2HYYA 2WMUA 2GFCA 4XLVA 3OEZA 3R01A 4UBAA 1ST0A 4DFBA 3PP1A 4ZZMA 1YDRE 3ZDIA 4FSRA 4UB7A 5K3YA 5KCVA 3BEGA 4GKHA 2VWIA 4IWQA 1H01A 2WHBA 1APME