4AU8A

Crystal structure of compound 4a in complex with cdk5, showing an unusual binding mode to the hinge region via a water molecule
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
290
structure length
276
Chain Sequence
GSQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVPSSALREICLLKELKHKNIVRLHDVLHKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CYCLIN-DEPENDENT KINASE 5
publication title Synthesis and Structure-Activity Relationship of 4-(1,3-Benzothiazol-2-Yl)-Thiophene-2-Sulfonamides as Cyclin-Dependent Kinase 5 (Cdk5)/P25 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 276
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4au8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4au8A01
5JEBA 5FUTA 2JKMA 2ZM1A 3G6GA 2JDSA 3QRTA 2WEVA 4KKHA 3KN6A 2X81A 4DEGA 4FIGA 1G5SA 3KL8A 3O71A 4OUCA 5HD7A 3TV6A 2ITUA 3Q4UA 5AAGA 1ZRZA 3FMEA 3V04A 2Q0BA 3JS2A 3IONA 1WBNA 4L68A 4NFMA 2WU7A 5BMSA 4O7SA 2R9SA 4G6NA 3PWYA 4EOOA 3EZRA 1F0QA 3FZ1A 4R5SA 4BB4A 5J9ZA 3SOCA 2P3GX 3P7AA 4JX7A 3SHEA 4G3EA 2QOIA 5C27A 4R1VA 3RAWA 2PZYA 4JS8A 2ZV9A 2C30A 4LQMA 2BHHA 1XH8A 3NNVA 3MVMA 3IGOA 2XF0A 4TNBA 5F1ZA 2WMAA 4FICA 2OZAA 5AUWA 4AFJA 5FGKA 3A8WA 4EZ3A 3UZRA 4WUAA 3AC2A 4DITA 1WVXA 2XKEA 3U6HA 4ZY6A 4FK6A 5TKDA 3G5DA 4BHNA 2QCSA 1PXKA 4UZHA 5ANEA 1SZMA 4FOCA 3ZMMA 5M4IA 2YM8A 3DAKA 2OGVA 1P5EA 2ZDUA 3I0OA 5EDQA 5I9VA 4I6BA 3AC4A 3MY5A 1TKIA 4BDHA 3R9NA 4L8MA 4V01A 4DEEA 3HKOA 3OMVA 3V8WA 4O0VA 4APPA 2JITA 2O3PA 1ZZLA 4G6LA 4DN5A 3FZSA 3DJ6A 4WSYA 2YM6A 2PK9A 4XH6A 3P1AA 5EM6A 5TR6A 2ZJWA 2R64A 3MI9A 3ZFXA 3MFSA 4H05A 4ITJA 1WVWA 3QYZA 3DT1A 5BUEA 2XH5A 4MD8E 2G2IA 3DOGA 4DAWA 5T6KA 3GC0A 3KVXA 4UN0C 2WTWA 2EVAA 3RALA 3ELJA 2X4FA 5AMNA 2WU6A 5A6OA 1H8FA 2Z7LA 5JN2A 5IZFA 2W17A 5IA3A 3ZUVA 3T9IA 2BIYA 3H3CA 4TT7A 4BKZA 4Z3VA 5AUVA 5DI1A 4MX9A 5HGIA 2JDRA 4NIFA 2VRXA 3E3PA 4CRSA 2ITWA 3T8OA 4J97A 2ONLC 3ACJA 4BCQA 2CCIA 5BUIA 5LQFA 2Z7RA 4K2RA 4DLJA 5A14A 2GHGA 2ONLA 2F4JA 3PA5A 4FZDB 3VS4A 4XG7A 2PMIA 4FK3A 3TJCA 4BC6A 4PTEA 4XNEA 1P14A 3UO5A 1PY5A 3K5UA 3OTUA 1R0PA 3ZLYA 3KEXA 3GNIB 2VD5A 3LCDA 1Y6BA 1L8TA 5CEQA 4RPVA 4LOPA 3HRFA 1UWHA 4QYGA 1U5RA 3VUKA 3LQ5A 3QCXA 1H00A 1OKWA 3DNEA 4KWPA 1Q8YA 2VAGA 4O0SA 4I0TA 2W5HA 1YWNA 4CMTA 4O7NA 4MNEB 4FVPA 5HZNA 3F3WA 4D2TA 4JDJA 4BDJA 4XV2A 5HBHA 4UXQA 1XBCA 2WEIA 2WQNA 1W8CA 4XEYA 4DLIA 3ZS5A 5HIEA 4MXCA 2CDZA 4IVDA 4RVLA 3MYGA 4EK8A 3JVRA 2X8DA 3NSZA 1M7NA 4AZWA 1H24A 3RWPA 4EK6A 5E8TA 3UNKA 2ZB1A 5HIBA 3O0GA 2I0YA 1FPUA 3K5VA 4OTPA 3FKOA 5A9UA 4HVGA 4ZSLA 4D5HA 2G2HA 4QNAA 2YITA 3VQUA 2HCKA 3FSKA 4FTJA 4EKLA 3TDWA 2OK1A 2UZBA 3QX4A 5IEYA 2FUMA 3RTPA 4QMNA 5CEMA 3G90X 4BFMA 5HVKA 5K0XA 2JKKA 2Z7SA 3EQHA 4MH7A 5DNRA 3VRZA 3LMGA 4I6FA 4MD7E 4R7HA 2E9VA 4FV4A 2RG5A 5FEQA 4ZMEA 3FZRA 4FTMA 5CNNA 3MS9A 3MFRA 4IADA 4M7IA 3HMPA 5AAFA 3T3UA 4QQ5A 3LLAA 3COIA 3DV3A 5IQAA 5KMNA 2VTQA 3BLQA 3SW4A 3VHKA 5ETIA 5DRBA 4F6SA 4FTIA 4CYJA 3GC8A 2R3LA 3NX8A 4RZWA 4X3JA 1WBOA 1XH7A 2QURA 2IZSA 3COHA 4RWJA 3EQBA 4C4GA 5AM6A 1O6YA 4IDTA 4D55A 4ZEGA 4DFUA 5HTIA 3DLSA 3R8VA 4M8TA 3D5VA 5FDXA 3NMUF 3VVHA 3OXZA 1J3HA 5HG7A 5EM5A 4FTTA 4GH2A 3QLFA 3E5AA 4CZUA 2GNHA 4AOTA 5I3OA 2PVKA 4WNKA 3T9TA 3JPVA 5TE0A 2FSOX 2XNNA 4C2WA 2W05A 4O7VA 3BELA 5CU3A 2B9FA 1OI9A 4NCTC 3O51A 5G6VA 4C59A 4AZSA 3OT8A 2PUIA 3E93A 4ZZMA 4O7RA 4LFIA 3CXWA 2OKRA 5CSPA 3IO7A 4KSQA 4NCTA 3KMWA 4L3PA 2IG7A 3VUMA 4DTAA 4HJOA 1J7IA 2PUNA 4FZAB 5C9CA 2YACA 1IR3A 3CCNA 4ZXTA 4BCNA 1V0BA 1Q99A 4I93A 3ORNA 4F9CA 1PMNA 5CI7A 4EHEA 4ZS4A 4CKJA 2VO6A 4PTCA 2CGWA 1W82A 4XS2A 3RPOA 5FXQA 4BGGA 3CQEA 4EUTA 4UWBA 1U5QA 4R7IA 5CVGA 3NYOA 1TQMA 3AC5A 5LWMA 4N4SA 5ETFA 4AT3A 4YJSA 5I0BA 5CNOA 5M4UA 2J0KA 4KIPA 4LUDA 5CWZA 3LJ0A 5KHXA 3CKXA 4YLLA 5J5SA 4FEUA 3UTOA 1ATPE 3MWUA 4FL3A 2JFLA 4FIIA 4IH8A 5AIRA 4CZYB 4HVIA 2ETRA 5LMAA 4M0YA 4L7SA 5DMZA 5ACBC 2FSMX 4FT3A 3QCSA 4H1JA 2JEDA 4FSYA 1P2AA 2BCJA 4G3FA 3RAIA 4DH8A 5DR2A 3QRIA 4YNOA 3FZPA 3ZFYA 5EOLA 3IOKA 2RSVA 4L67A 5EM8A 4FV2A 5M4FA 3UMWA 4OT5A 3UC3A 2PVYA 2UZVA 4BZNA 4DHFA 4RVTA 5JK3A 1ZYJA 5BUJA 4DTBA 4CMUA 1XKKA 3MV5A 3HL7A 4I0SA 4ACCA 2JBOA 3ACKA 3ZH8A 2XNBA 4I5CA 3MBLA 4M13A 3CP9A 2VX3A 5CF8A 5HORA 1SVHA 3ROCA 3WOWA 4AGUA 4YGAA 1KSWA 3QTXA 5IA0A 3OEZA 1DAWA 3PIXA 1W83A 2XKCA 3CD8A 2QU5A 3MSSA 3NUSA 3WYYA 2ACXA 4HNFA 3OXTA 4L7FA 4GT3A 1WBPA 4ZTQA 2PZ5A 3GB2A 3SDJA 2OZAB 3W2OA 4G34A 5IQEA 3O17A 3ODZX 5J95A 4X0MA 4A9YA 5CEOA 4BL1A 2UZWE 4LMNA 1Z57A 2PVRA 2PVLA 2X0GA 4BWXA 3U87A 1H1WA 2JAVA 4GT5A 5CASA 3FKNA 2ITXA 3KK8A 3WZEA 1KOAA 4KBKA 5E7RA 3AC1A 4O1OA 3H9RA 5KX8A 1XH4A 2HIWA 4I20A 3RINA 2YHVA 1M2RA 1R39A 1NY3A 4BGHA 4WSQA 3R9DA 4N0SA 3TZ8A 3DQXA 2O65A 2HZ0A 2RFEA 4IHPA 4GV1A 2R3GA 3RHKA 2XKFA 3S0OA 2NO3A 1MRYA 5T3QA 3SRVA 4C61A 4O0WA 2CN5A 3GCVA 3LFQA 4F7NA 3TNPC 3CPBA 3AT3A 3UYSA 4F1OA 5IU2A 5F94A 1MQBA 4RIWA 3F3VA 3QA0A 5L8JA 5CEIA 4DC2A 3VRYA 3QZIA 5HE2A 4NIFB 4NTSA 1SM2A 2C6OA 5D11A 4K18A 3WARA 2DQ7X 2WTKC 2XB7A 4YJUA 3HYHA 4WBOA 2C0TA 1DAYA 2Y0AA 4IB1A 4RIYA 5TT7A 1AQ1A 4GRBA 4OTRA 4RJ6A 3C0HA 3R8PA 4OAUC 4NL0A 3RBWA 1WBVA 3MIYA 2GFSA 5BYLA 4QP4A 2P0CA 4CZTA 2CN8A 1U46A 2OIQA 3P4KA 3C4CA 4KIOA 3ZOSA 4ANMA 4FTLA 5AA8A 5AV4A 3PVUA 4EOJA 2XYNA 3D94A 5LVMA 4Y73A 3M2WA 4G9RA 4AE9A 4FODA 4FV9A 5E8WA 5A4TA 1WFCA 2QQ7A 2J0JA 2J4ZA 3FY0A 4MF1A 1ZYSA 1AGWA 5IUHA 3UIXA 1K3AA 1GIHA 1F3MC 4X3FC 3FPQA 4RMZA 3U6IA 4S34A 2F49A 4Y5HA 2CHLA 2ETKA 3HGKA 4E8AA 5J7HA 1R78A 2OIBA 1H08A 2C1BA 5CVHA 5AV1A 4R78A 3PJ2A 4FIJA 4EK5A 5CANA 2BRBA 5IG1A 4O7YA 3RWQA 1RDQE 3QQJA 5LVPA 5FEDA 4WUNA 3MVHA 3OFMA 3UP2A 3H0ZA 3N4UA 3LW0A 2B7AA 3KULA 4N6ZA 5LVNA 1PXNA 3ZRLA 4AW5A 5F4NA 1A06A 1H1PA 3E63A 3FMHA 4G16A 4RIXB 5C4LA 1OPJA 4IC7A 4QYYA 3K3JA 4JR3A 4KBCA 2W96B 3R6XA 2SRCA 2R7IA 2VTHA 3E64A 3P0MA 4F4PA 5TF9A 4R3RA 2YIYA 2FA2A 4PWNA 4FL1A 4Y83A 1XO2B 1NT2A 2C6DA 4P5QA 4OTIA 2RKUA 3QZGA 2C68A 4YJRA 1WVYA 2GNGA 2CNUA 3QF9A 1MRUA 4FNXA 1L3RE 5DBXA 4FG7A 2IW9A 1CDKA 1ZY4A 3IPHA 2XK4A 4J71A 5DT3A 4TN6A 4IJ9A 3RPVA 3EN6A 1BKXA 4OBQA 5DVRA 1REKA 3LCTA 4EHZA 2Y9QA 4FA2A 4L53A 2C6TA 3TV7A 4YU2A 4FKJA 4O0UA 3FUPA 5DR9A 2GNLA 4QT1A 4TYHA 2C3IB 3PJ3A 2WTDA 4F6WA 5KMMA 4FGRA 1A9UA 5B7VA 4FE2A 4HVSA 3ZM9A 3FI4A 3CLYA 5BYZA 4RWIA 3ORLA 4FGBA 3FQSA 2Z02A 5A4LA 5FD2A 3GENA 3QKKA 4RJ3A 4AZEA 3NS9A 4NTTA 3WZKA 4NZWB 4WNMA 3GBZA 2C4GA 1YXVA 2IWIA 2PY3A 3LCOA 5E90A 3VBTA 5C26A 3U4WA 3I81A 1J91A 1OL6A 1GOLA 4H3QA 4DGMA 2C0IA 4PNIA 4RC3A 4FKSA 1XR1A 3FV8A 2IZUA 5ANOA 4C3RA 3EB0A 2B0QA 5EI8A 3QTSA 3ZBFA 4E6AA 1Q61A 4ZLYA 3ETAA 3PSDA 1IRKA 2HXLA 2AYPA 2DUVA 4GMYA 4KD1A 4PPBA 4C37A 1GNGA 2QKRA 4EKKA 4EBVA 4RRVA 3RI1A 1Q24A 3I6WA 5HTCA 3LFSA 3ZZEA 5CT7A 4JNWA 4TTHB 2OH4A 5DR6A 4BHZA 3BZ3A 4CSVA 4MQ1A 3SGCA 4ID7A 5AP3A 1Y57A 4C3FA 4GK2A 2O2UA 2YA9A 4ONAA 5DFPA 1BUHA 2UVYA 2PZRA 3PPKA 4OBOA 3NPCA 2CKEA 4H3PA 2BDFA 3JR1A 2W1HA 2I6LA 4MXXA 5CU6A 5ANIA 4BCOA 3BIZA 1SVGA 4FTAA 3DBDA 2X8EA 5J1WA 3TM0A 4GKIA 3ZLSA 4YC8A 4DG0E 4I41A 3CJFA 4C34A 4W4VA 2YABA 4ZSGA 4O2ZA 4N57A 4FTRA 4JXFA 1YHVA 3FXWA 4IQ6A 3RPSA 4BBEA 4F99A 2YZLA 2OFUA 3G6HA 4QMUA 3P79A 4UMRA 3ZU7A 2Y6OA 2CGUA 1JSUA 3DS6A 5ETCA 4AN3A 2J0IA 4AF3A 3GU7A 4DG3E 4U81A 2PU8A 3DTCA 4NM3A 1WZYA 5K4IA 4MCVA 4R1YA 3IQ7A 4U42A 4B9DA 5FDPA 5J7BA 2F2UA 3R7YA 4R6VA 3I79A 1R0EA 4JJRA 4CTCA 3OT3A 4TWPA 5H8GA 4FZ7A 4YJQA 4DFLA 4OTHA 3VNTA 4GK3A 2X2KA 4AGDA 2F2CB 2V5QA 3LCSA 3FLSA 5CT0A 3BGPA 1BI8A 4X2GA 2W99B 3UOKA 5A54A 3EN4A 1XH9A 4FUXA 4C3PA 1WMKA 3HMNA 3WF5A 1O6LA 2YEXA 2ZM3A 4R5YA 3ID6C 3IW4A 5CQUA 4ZIMA 3I60A 3GVUA 1XH6A 2CKQA 3EL7A 5AX9A 3CSVA 1ZYLA 3R00A 4O27B 2UW9A 3Q32A 4EHVA 4KINA 5FP5A 4ZZOA 4APCA 5HCYA 2PYWA 2OU7A 3EFWA 3P7CA 4J52A 3RK9A 1OZ1A 2PVFA 3UVRA 3D4QA 4H1MA 3OWPA 2XM8A 1URWA 4BIDA 3EQDA 3DKGA 3VUHA 1H01A 2PVJA 3AD5A 3UPXA 4KUJA 3PYYA 3DNDA 4O0RA 4WNPA 4FEQA 4LV5A 1CMKE 4IDVA 4XX9A 2BR1A 4QYEA 4AA5A 1YI4A 4ALVA 5KUPA 3NNWA 2OBJA 3QA8A 4O6LA 5FXRA 3FZTA 1KWPA 4GL9A 5C03A 4BZOA 3GOPA 3PUPA 3PY3A 1DM2A 1NVRA 3UVPA 3NWWA 1JAMA 4Z7HA 4UX9A 3DAEA 3F5PA 3GU5A 3QZFA 2A19B 4FTKA 4O21A 1J1BA 1G3NA 4O81A 4WIHA 5E91A 3MY0A 4MBLA 5JRQA 4CVAA 4QQTA 4BDCA 3UG1A 4RIOA 1FMOE 1ND4A 2F7XE 2Y4IC 3D2IA 2X7OA 3NUYA 3PXQA 4LV8A 3MGYA 4IXPA 4RIYB 4USEA 3BV2A 4ITHA 2WTKB 3IS5A 2C1AA 4G31A 5ACKA 4QMLA 1UKHA 2GMXA 4U9AA 3RK7A 3ZXZA 5J9LA 2GHLA 3UMXA 1UV5A 3A7HA 3R01A 4JL9A 5HOAA 3FEGA 1M52A 5IF1A 2HWOA 4IB3A 4IX4A 5CEKA 4L52A 4IIRA 3CY2A 3VWAA 2C3LA 4RJ5A 3RVGA 2R4BA 5EYMA 3BYMA 5EQPA 1XBBA 3RPRA 4BDKA 4EOSA 1MQ4A 1T46A 4ANNA 4EJNA 3RCJA 5M53A 4L00A 3RP9A 5CF4A 2BRHA 3SVVA 5EHOA 2W1EA 3HA8A 4GG7A 4PDOA 4X3FB 5HG8A 3W2QA 4QMQA 4PMMA 3F9NA 1UKIA 3CBLA 3POZA 3HP2A 5KBRA 5IQBA 2P2IA 3KB7A 2YJRA 4TY1A 4IM2A 2WMBA 4LMUA 2W4JA 4CKIA 4EI4A 5ETAA 4EOLA 5I9XA 4G17A 1KOBA 1FVVA 2FO0A 2W9ZB 2QLUA 3E92A 4YC6A 3KULB 5CYIA 4BI2A 4D4RA 3Q2JA 2ZVAA 3MPTA 3BQRA 3PTGA 4CFFA 3PG3A 3IKAA 3CS9A 4H36A 2BDJA 2BROA 3REPA 4J95A 2VWBA 1NA7A 4ZAUA 3R9HA 2JKQA 3BE2A 3QTWA 4USFA 2HZNA 2C69A 3TNHA 2XNPA 1H4LA 4M0ZA 3ZUUA 4DBXA 4C4JA 1AD5A 3BHUA 3I6UA 2ITQA 4IAKA 4YNEA 4G1WA 3EQGA 4IACA 1YI6A 4KBAA 3IW7A 4NM7A 4O96A 4PP7A 4PDYA 4O7LA 5DLSA 3UOJA 5H9BA 2WIHA 3EJ1A 1JQHA 3F3ZA 3R30A 2PUUA 2ZB0A 3UYTA 4G3CA 5E8UA 1LEZA 5M4CA 4HGEA 3DCVA 4F0GA 1JPAA 4KA3A 2ERKA 5CALA 1JBPE 4E6CA 3VS7A 3JXWA 4C0TA 3H9FA 2YLFA 2X9FA 1REJA 4TYHB 3KRWA 4ACMA 2R3NA 2VO7A 2XKDA 4YSJA 3PVBA 5ANJA 3TG1A 4MXAA 3LFEA 4F0FA 2QOQA 1OGUA 1KE7A 4AGCA 5FRIA 4F08A 2PE2A 2IW8A 3UIMA 3TL8A 1Z9XA 4Q5EA 3WF8A 3WF9A 4RQVA 2WO6A 2VTNA 3UC4A 3TN8A 4HZRA 3A99A 4R8QA 2O0UA 3CGOA 3K54A 5D41A 4DEDA 4L6QA 3R7OA 4AZVA 1PRYA 4EH3A 3TUBA 4Z7GA 3HRCA 4FSQA 1KV2A 2REIA 1JVPP 2A0CX 1KV1A 4JAIA 4EZ7A 3FLWA 4C4HA 2BZJA 3M1SA 3LFNA 5DEYA 4QP1A 4A07A 4E26A 4YBJA 5KO1A 4H58A 1F5QA 2W1GA 4XG2A 1TQIA 3EN9A 4JDKA 2ZOQA 5EW8A 1VJYA 3UOLA 1VR2A 3W10A 1TQPA 2G9XA 2WMRA 5FM3A 2C6LA 3GU6A 3G2FA 2JD5A 4KKGA 4TZRA 1Q3DA 5D12A 1ZZ2A 3VBWA 1H25A 5HI2A 4C8BA 2OH0E 2BKZA 4ZY5A 3ENHA 4JIKA 1NVSA 3BYVA 1WAKA 3MB6A 5EDPA 2C0OA 3D14A 4EK3A 4F64A 4O38A 2OICA 4Y85A 4ZK5A 4FYOA 1V1KA 1PXPA 2VTIA 3HUBA 4N6YA 5FBNC 3R8LA 3SC1A 5CSXA 2YCFA 3JY0A 4XLIA 4GKHA 5DN3A 1DS5A 4X2JA 5JFSA 3ZSGA 2YLEA 4AT4A 4U40A 3N9XA 3VAPA 3JY9A 2GSFA 4CYIA 4M12A 5GHVA 5HLWA 4R77A 1CTPE 3TACA 3GUBA 3DK6A 4Y8DA 3ZO3A 2XBJA 4ITIA 3FC2A 5KBQA 5HE0A 3OOMA 3L8SA 3E3BX 3UG2A 2J5FA 3NUAA 3FHRA 3CPCA 4UMQA 3ZZWA 5AR5A 5L2QA 4UYAA 3M11A 4YZBA 2B53A 3BLRA 1YOJA 3FLQA 5CX9A 3GXLA 5HCXA 2IPXA 4AN9A 1OKVA 3VUTA 4GVAA 3SX9A 2XK9A 4XV1A 2J0MB 5A4CA 1P4OA 5IA5A 2A27A 4WNOA 4NT4A 2B9IA 5EG3A 4BZDA 3Q52A 3HMIA 4K6ZA 4I94A 1M2PA 3TIZA 4LRJA 2GFCA 3QC4A 3TWJA 3HUCA 1CKJA 3RAKA 1XWSA 2I1MA 3PRIA 3VHEA 2I0HA 1IAJA 2O64A 3PZEA 5I9WA 3P86A 4E6DA 3MB7A 2C47A 4GVJA 5DH3A 5DPVA 2V7AA 1UNLA 3OXIA 5KCVA 3DZQA 4DA5A 4IANA 2W5AA 4BYJA 3CC6A 4CLJA 4U45A 3WI6A 3VJNA 4U79A 3Q9XA 4AW1A 3TKUA 1OM1A 3NIZA 4CT1A 1JOWB 2OIDA 4MTAA 3R73A 5LARA 4I5PA 4XG3A 5FQDC 4GS6A 2VZ6A 4YC3A 4O86A 2BFYA 5JSMA 4ORKA 4O6EA 2I0EA 4YUQA 2G2FA 4OTFA 2BDWA 3RJCA 3DB6A 5FG8A 1ZOGA 4ACHA 1VZOA 4HOKA 5AV0A 4EOKA 4PP9A 4EOQA 4GFMA 2YM7A 4QNYA 4RVKA 3LOKA 4NM0A 4XJ0A 3BX5A 3TJDA 1JLUE 4AZTA 2JBPA 4RIXA 1UWJA 4EORA 4E4MA 3V51A 4BVUA 4NKSA 3R7VA 4LGHA 3F82A 5FXSA 4OBPA 1M2QA 4P7EA 4XG4A 5EHLA 4E4NA 3N4TA 4YPDA 5H3QA 4QOXA 4AOJA 3EHAA 2WTVA 2IVUA 5GIOE 3BEGA 3UP7A 4O84A 2WQEA 2Y4IB 3PJ1A 4O0YA 5AR7A 4IEBA 4EC8A 5JMSA 3S4QA 4EHGA 3GI3A 3V8TA 3QU0A 4FKUA 4CCUA 5IEXA 4W8DA 3MTLA 5DA3A 3S1HA 4B8LA 1HOWA 4FR4A 3OBGA 4YJPA 3MPAA 4FVQA 4FV0A 4M66A 4CG8A 3F69A 3QTZA 5CI6A 4QPAA 5L2SA 2R2PA 4QMYA 2PE0A 4BGQA 4AP7A 2XK7A 4FOBA 5LVOA 5E92A 1FGIA 2GS6A 2C6IA 2RG6A 3DGKA 3R1QA 3S95A 4E3CA 3NUXA 2VTRA 4DTKA 3OROA 4BTJA 4RC4A 2Y4PA 3KREA 3LMHA 2PVNA 4D0WA 3KRRA 4O0XA 3ULIA 4BCJA 1G8SA 5HIDA 5C8KA 2RGPA 4NM5A 3NUNA 1QPJA 1MP8A 2ZV7A 3QQGA 2EUFB 3WE4A 2J90A 3AMYA 5D1JA 4AGWA 1H0WA 2Z7QA 2P2HA 1ZLTA 5E8ZA 2H6DA 4EH6A 4BIBA 2WMWA 1BLXA 1Q8UA 5DT0A 3PY0A 3PXRA 4TNDA 4W4XA 4DT9A 5HU9A 5EYCA 2RFSA 4AUAA 5LMKC 4KSPA 3D7ZA 3LFAA 5DHJA 4F63A 5LCJA 3R7EA 4EH7A 3V5PA 4AE6A 5JH6A 5LMKA 4P90A 3G15A 3PA4A 2QC6A 2UW4A 1ZY5A 3LCKA 1Y8GA 4L43A 5AV2A 3OCTA 5EYKA 4OAVB 4YLKA 5DEWA 2OF4A 2WQBA 3QGWA 4M14A 3DLZA 1LR4A 3DDQA 4LI5A 4Q5HA 2YIRA 5HTBA 3DAJA 4ZTMA 5KZIA 2XIYA 1APME 3QD2B 4J8NA 4A4OA 2XVDA 2R3KA 1W7HA 4IAFA 4E4XA 3LE6A 4ZSEA 3L8XA 5J5TA 2VU3A 4CMOA 4GJ3A 2J50A 4F9YA 3E7VA 4DYMA 1OKZA 2WMUA 3KRXA 2A2AA 5HE1A 2ITOA 1V0PA 4HPUE 4A9UA 2UZLA 4U3ZA 2ITZA 3BQCA 2W1CA 3BU3A 3QXPA 2FB8A 4A7CA 4YO6A 3UE4A 2ZV8A 3E87A 4CEGA 5CAQA 5FM2A 2VGOA 2YAKA 5H8EA 4EEVA 5I9ZA 2O8YA 5I4NA 4U43A 3CKWA 5M08A 4WA9A 4U80A 3UGCA 4ZLZA 4QTAA 3FLNC 3PXKA 4GK4A 4RA5A 3SKCA 4C7TA 4F65A 5DIAA 2PSQA 1O9UA 4OR5A 4FIHA 3V5LA 2WQOA 3AOXA 4EK4A 3ZRKA 4CFWA 4ZTNA 4QPMA 4ZTHA 3Q9ZA 3BWFA 4W9WA 3MW1A 2X7GA 3DU8A 5EW3A 4PUZA 5IEVA 3LVPA 3CQWA 3GP0A 4KIKA 3FI3A 5IUIA 3R04A 3VS1A 1T45A 1BL7A 2DS1A 1EH4A 4QTDA 2OJFE 3COMA 4CRLA 4DBNA 4P2KA 3NR9A 3MA3A 1OL5A 4FSNA 3H30A 3I4BA 4HCUA 3LXLA 3QRJA 4U6RA 4UY9A 4BCPA 3AGMA 3W2CA 2XS0A 3UQGA 3WZDA 3OW4A 2B4SB 1UNGA 3OOGA 2BMCA 3O96A 2VV9A 4RX8A 3WZJA 5HX8A 4WG4A 5AFVA 3O23A 3ALNA 3O50A 5L2IA 4AA4A 2WTCA 3DB8A 3SAYA 2XUUA 1H07A 3HNGA 1NXKA 4IZ5A 5B0XA 2RFNA 5AUXA 1FMKA 4J7BA 3DBFA 4XG9A 1YI3A 2G01A 4WO5A 5KMOA 2WNTA 1PXMA 1UU3A 3QTRA 5AADA 4EH8A 3B8RA 3W32A 1J7UA 4FKTA 2X2MA 2PVHA 3A2CA 1YWRA 3DKFA 3U4UA 4EWHA 5BVOA 2VTMA 2OJIA 5K0KA 2GPHA 2JDTA 2EWAA 3QUPA 4PY1A 4BDDA 5L3AA 2PE1A 3VBVA 2XNMA 3S2PA 3EQIA 2R7BA 2WMSA 4C4IA 2C5OA 4FV6A 2UUEA 3KVWA 3UDBA 2CMWA 2OXYA 3HZTA 3BU5A 4QRCA 4FKPA 5IH4A 1Q3WA 5LVLA 3UIUA 4NUSA 4E6QA 3IW8A 3WF7A 3N51A 4S2ZA 3DBQA 3UO6A 2WXVA 3OY1A 4XP2A 5BMMA 2C6MA 5GZAA 3II5A 4RVMA 4WG3A 4R3PA 1XBAA 4BDBA 3W55A 2BZIB 4E5WA 3HRBA 5BYYA 4FEXA 4MAOA 2P4IA 3IDCA 4EL9A 4QP2A 4S32A 2R3QA 4GIIA 4HVHA 4DFYA 2CGXA 3E62A 4L44A 5D7VA 5AR8A 4QQCA 3FAAA 5CENA 5HESA 2XNEA 4U97A 3QQKA 3PA3A 3GFEA 2WIPA 4O2PA 4X3FA 5AP1A 1YWVA 1IAHA 5HO6A 2PMLX 2F7ZE 2ZYBA 4BCMA 4E1ZA 2QONA 1YRPA 1M14A 3VF8A 2QOHA 3C4WA 4I3ZA 4G6OA 3R7IA 3TNQB 2WTIA 3LFFA 3UOHA 3L9LA 2YN8A 1H26A 1RJBA 2WGJA 3PSBA 4FSTA 2WHBA 3CE3A 4RQKA 3TNIA 4C2VA 3OS3A 3AC3A 3NAYA 4R3CA 3KF4A 3GC9A 5IQDA 2XEZA 2BTSA 4FKQA 4IX3A 3BHVA 2XK8A 1ZARA 4F09A 3D2KA 5HBEA 2W9FB 1OL7A 2EXMA 1Q97A 4KRCA 3C4ZA 4DEAA 2IVVA 3NEWA 4NJDA 2W5BA 4NK9A 2NRYA 2XRUA 5GJFA 3OZ6A 3ZFMA 2RFDA 3D5XA 2WD1A 1IG1A 3D83A 5D9HA 2UW5A 2X39A 2GQSA 1H1QA 3LM5A 4L3LA 5JGDA 5KE0A 2FH9A 1FOTA 3PZHA 4UMPA 4XUFA 3LIJA 2QHNA 4LRKA 4TWNA 4MXYA 3GCUA 5FWKK 1IEPA 3AMBA 3ZBXA 4FNWA 2C3JA 2VO0A 2UW0A 4YHTA 2HAKA 3A60A 5F20A 4EYJA 1KE8A 2XZSA 3P5KA 2RL5A 3Q9WA 4JDIA 3QCQA 1KE5A 2JIUA 4AX8A 2EXCX 1OL2A 2DWBA 2VNYA 5L8LA 4FKWA 2ZM4A 3PP0A 4QTBA 4IFGA 4UMTA 5LOHA 5CSHA 4PX6A 5E8XA 3TKHA 5E4HA 2PTKA 4KS7A 2NPQA 4YURA 4LM5A 3PPJA 2XCKA 3UNJA 4PNKA 1ZMVA 4PRJA 2UW6A 3L9MA 3Q3BA 5C4KA 5KMIA 5CEPA 4JIAA 2QLQA 3FPMA 4YZNA 4M67A 5G1XA 5HLPA 3ORZA 1OKYA 1FQ1B 2QG5A 4EQCA 3F61A 2IVTA 4FV1A 3E8NA 4G5PA 3NLBA 1H1SA 2J9MA 3QAME 5M56A 4LGDA 4FT0A 2OF2A 4ZSJA 2QR8A 5B2KA 1R1WA 2QOFA 5LXMA 4PV0A 5EKNA 3DFCB 1BYGA 4E93A 3MY1A 5B2MA 4HYSA 1YXSA 4DCAA 3VS5A 3VC4A 2I40A 4QP8A 3VBXA 1WBWA 4JI9A 4I22A 5GZ9A 4UEUA 5GIPE 4FSMA 2XNOA 1LPUA 2V22A 3HX4A 4X6QC 4FI1A 3ZO2A 1W84A 4XOZA 2JLDA 4WHZA 1G8AA 3KC3A 3KCFA 4BDGA 4TYEA 3Q53A 4R7BA 2XYUA 4QPSA 5AP2A 3ODYX 4AS0A 3ZC5A 2BHEA 3QHRA 3OBJA 4QTEA 2WAJA 5A46A 3KA0A 4FTUA 3R22A 4XLVA 1PKGA 3R2BA 3C9WA 4X2FA 5DOSA 3LJ2A 4ANQA 4BBMA 4CXAA 2DYLA 5DYJA 4N70A 3UQCA 3IW6A 4F9AA 4E20A 4IFCA 2R0UA 2QHMA 2R3RA 4AG8A 2VWVA 2HK5A 4AOIA 4D9UA 2WOTA 2OG8A 4EBWA 2E9PA 3TTJA 1HCLA 3FMMA 5CXHA 5EQEA 1ZOHA 3VS0A 5CAOA 5IUGA 3BPRA 3UIBA 4CQEA 3KXZA 2JIIA 3C13A 4Y5QA 2QI8A 2VO3A 3SD0A 4ANBA 2UZDA 2V55A 3Q60A 3IG7A 1PXOA 1TVOA 4KIKB 5CF5A 3BU6A 4K0YA 3F88A 3RHXA 3SG9A 2GDOA 5FTOA 3ZEPA 3F2RA 3ERKA 3O8UA 3TXOA 2J5EA 4FKVA 1YDTE 4ASDA 2C6KA 5A6NA 3VW6A 3TDVA 3KCKA 2IZTA 3KU2A 4LYNA 3AXWA 4ASXA 2C5YA 2VWIA 3A62A 3P9JA 2IJMA 3IDBA 4MXZA 4NW6A 5EW9A 5I9YA 4U3YA 2EB3A 5ITAA 4BCIA 2F9GA 1JNKA 4TL0A 5HU3A 3DDPA 3KXXA 3BEAA 3QC9A 3ZM4A 4X21A 4ALUA 4GFGA 5HO7A 4ACDA 4BIEA 5L6OA 4W4WA 4QMWA 4B7TA 3D0EA 4GYIA 4JQ7A 2VUWA 3RKBA 5KMJA 3PDTA 3PVGA 3U51A 4AN2A 3OW3A 3W1FA 5A4EA 2VTJA 4L45A 4TYIA 3GU4A 3SG8A 2X6EA 2Y8OA 1Q8WA 4EC9A 2BIKB 1UVRA 1ZOEA 2E9UA 3OY3A 4FC0A 4JG6A 4L01A 3LM0A 3UPZA 5FBOA 5F9EA 4Y72A 3LPBA 1XQZA 3Q96A 3OUNB 4J96A 5I3RA 3EH9A 2IN6A 3OP5A 3VUIA 1ZMUA 4PDSA 1H28A 2QO2A 2QU6A 4BWKA 4C4FA 2PWLA 5EH0A 3LFCA 4DEHA 1PMVA 3QBNA 3KXHA 5BVWA 2QO7A 5HQ0A 2OXDA 3AC8A 3TEIA 3SXSA 3U6JA 4M97A 3QD3A 4RZVA 2QODA 5JFWA 1W98A 3C7QA 2WKMA 3GCQA 4J98A 5JFXA 4JOAA 4C62A 2B55A 3R02A 1LUFA 4V04A 4FL2A 4M69A 2B9JA 1B38A 2Z8CA 4PPAA 3EQFA 3ATTA 5FEEA 4HYUA 5B2LA 1KUTA 4I6QA 3KFAA 4ZOGA 1FVTA 4RX7A 2XJ0A 4FKLA 4I21A 4NSTA 2XNGA 3AMAA 2YWPA 4J53A 4AZFA 4FMQA 3Q4TA 4D1SA 5L2WA 2CCHA 1A48A 4DH1A 3QQFA 3FBVA 5EM7A 3JVSA 5F95A 5GNKA 4CNHA 2YIQA 1U59A 3ORTA 5EOBA 4KKEA 4U0IA 1SVEA 4O22A 5I9UA 4YTFA 4GEOA 4RJ4A 4FX3A 4BN1A 2HY81 2W0JA 3W33A 2UVZA 4YZ9A 4CTBA 2YFXA 4BWPA 2YDIA 3ANRA 3EIDA 2X8IA 4ZS0A 4EOMA 3C1XA 3NYXA 3VQHA 1GZ8A 4C4EA 1SYKA 3R83A 4F1TA 3ZDIA 3M42A 2IW6A 4I5HA 3U9NA 4NYEA 3TCPA 1GZOA 2BUJA 2WZJA 3QTQA 4LGGA 3JYAA 4XP0A 5D10A 1PYXA 2C5VA 2R3PA 3FMLA 2QOCA 4JBVA 4ANLA 4HW7A 5K5XA 3PLSA 4FBXA 2Y6MA 3A4PA 5CQWA 1YVJA 3FI8A 2W4OA 2H34A 1UU7A 3PIYA 3CQUA 4X2NA 2W1FA 3EMGA 3FXXA 2G1TA 4AAAA 3VULA 3MH2A 3S00A 4YZCA 5EHYA 3GGFA 4PDPA 2ZDTA 4BDFA 3CTQA 4WRSA 4D4VA 2R3HA 4AQCA 3DK7A 4RX9A 4C33A 4D28A 3D5WA 5CU2A 5FLFA 4BYIA 1H1RA 4BDEA 3C4FA 4BF2A 3W2SA 3G33A 4XBRA 3Q04A 4MHAA 1GJOA 4HVDA 3BLHA 2ZV2A 3Q5ZA 3KXNA 4PL4A 5AM7A 2C3KA 4GJ2A 3MTFA 3TTIA 3W16A 4IWOA 3LXNA 4B6LA 3AD6A 4F7SA 2WPAA 4BI1A 2VNWA 4RBLA 4I4FA 5HO8A 3VUGA 3ZO1A 3DKOA 5E8VA 3MJ2A 1OIRA 5E8SA 2WQMA 3ORXA 5LJJA 5E9EA 5L8KA 4BI0A 2R5TA 2CNVA 3UZTA 5AJQA 3V5TA 3BYOA 3MPMA 5HVJA 3E8EA 4A4XA 1LEWA 3R28A 4EQUA 4UXLA 4II5A 3ZXTA 2R0IA 4F1MA 1XHAA 3HEGA 4OTGA 4U7ZA 3SOAA 4FUYA 4NKAA 2W1ZA 3Q4CA 3PVWA 3MA6A 4O83A 2YIWA 4GUBA 3DJ7A 2R3JA 3LLTA 4BICA 3QTIA 3OUKA 4QYHA 2YIXA 5AX3A 2I7QA 4U8ZA 4I4EA 3C5IA 2F57A 2J0LA 5BX0A 3R9RA 5BNJA 2P33A 2XIRA 5L4QA 5IPJA 5J9YA 1QPCA 2RF9A 3KF7A 1KE6A 3OVVA 2NP8A 3O8PA 3QRUA 4Y95A 2IO6A 4PPCA 4KS8A 5GJGA 3ZC6A 4LRMA 2YDJA 4EUUA 4FVRA 2H8HA 1OPLA 5HG9A 5AR2A 3C4EA 4MBJA 4NU1A 4OLIA 4XOYA 3BHYA 2WMVA 4A4LA 4EH9A 5LMBA 4F9BA 2PZPA 5IQFA 2WTJA 1GZKA 4TPTA 4Z16A 3HVCA 1IA8A 4XHKB 3P08A 5DE2A 4IM0A 1R3CA 2C5XA 4O7WA 3HAMA 1PXLA 2A4LA 2UW3A 3LMIA 3NW5A 1GIJA 2YCRA 2HY0A 3U55A 3IECA 4YR8A 1CSNA 2XK6A 4G5JA 5JFVA 3Q4ZA 3I5ZA 4IB0A 3ORIA 4FNYA 4GT4A 3FXZA 4RWLA 3SA0A 3QRKA 4K33A 2XIKA 3HDMA 3C51A 4W4YA 3NVKI 4ERKA 1Y8YA 1DI9A 4XRJA 3ENMA 1OIUA 3R1SA 4WD5A 3DXQA 3QQUA 2HW7A 5M55A 2CSNA 4DH7A 3BV3A 3QXOA 4K1BA 5BPYA 2OJGA 1PW2A 3U54A 3VBYA 4XBUA 1ZWSA 3MH1A 4A9RA 4UMUA 2PUPA 4IJPA 5GINE 3I0QA 4JG7A 4J8MA 2XK3A 1OITA 4KABA 2BPMA 2W1DA 4UWYA 4DFXE 4ZJJA 2BILB 3LAUA 3FDNA 4AXAA 5KMLA 4X2KA 4PMPA 2B9HA 4I23A 3D7TA 4MQ2A 3TV4A 4D1XA 3VUDA 5JKGA 5AP4A 3ZHPC 3FQEA 4RSSA 3W8QA 2ESMA 4MWHA 2ITYA 3WYXA 1SMHA 4GUEA 4DFZE 3MH3A 4EH4A 5CXZA 4XV3A 4FSZA 5J79A 4RFMA 5HCZA 1OL1A 3FWQA 1JKLA 3F5UA 4BKJA 4FTOA 4JQEA 3TIYA 4DH3A 3B2TA 3F7ZA 4LL5A 4JLCA 1BL6A 4BBFA 4U5JA 5IA4A 5ICPA 2V62A 3K2LA 4RT7A 3OTVA 3PLAE 1E9HA 5TOZA 3TZ7A 2E9NA 3EN5A 4ZP5A 3RZBA 2ZAZA 3MFUA 4XMOA 2IVSA 2AUHA 1NW1A 4M68A 4O82A 3VF9A 2J51A 4D2RA 5CAUA 2VWYA 3HLLA 3IOPA 2J7TA 2Z2WA 4D2SA 4F9WA 5AUYA 1ZMWA 3BWJA 4XYFA 4F6UA 3FY2A 1VYWA 5IDNA 2WELA 1OIYA 2BAKA 4Q9ZA 4CFNA 5JT2A 1OUYA 5AUTA 2YM4A 3U8WA 3EQRA 5LWNA 1PJKA 2QNJA 3EKKA 4GIHA 5EK7A 1Q8TA 3F7WA 2IZRA 3PFQA 1URCA 4GU9A 2WMXA 3OEFX 3FI2A 4GW8A 4FSWA 1I09A 4HCTA 1S9IA 3JUHA 3NW7A 4IZ7A 4M69B 4LOQA 2V7OA 5M44A 3ZLWA 4HGTA 3L9PA 1ZYCA 2C6EA 4OTQA 3VW8A 4JX3A 2VTOA 1UNHA 5DG5A 3POOA 3WZUA 4FT7A 1YXUA 1FBNA 2P55A 4UYNA 4OTWA 5AAEA 1YHSA 4JT3A 4NFNA 4BCFA 3UO4A 3F2AA 1GAGA 5T68A 5IQCA 3SQQA 2OJ9A 1OMWA 2VWXA 5JQ5A 3KXMA 3R9OA 3EKNA 2O63A 4YBKA 3FJQE 4C35A 4YZDA 3NIEA 3QTUA 3B8QA 4L42A 3QQLA 2Z60A 4DH5A 3BHTA 4L9IA 3ORMA 5AIKA 2ITTA 4M84A 3E8CA 4D4YA 2X2LA 3GFWA 3NYVA 4U41A 2QKWB 3G9LX 3MFTA 1PXIA 2JFMA 3HV4A 4E5AX 2PMNX 1PF8A 4PMTA 4CGAA 4HNIA 4JVGA 2ITNA 4B8MA 4MKCA 5M57A 2UZUE 5HICA 3FLZA 4IC8A 3NNXA 3QGYA 5E8YA 4BY9E 1U54A 4YJOA 3ZUTA 3W8LA 4FKOA 4TRLA 2Q0NA 3DBCA 4O0TA 2J6MA 1B6CB 2LGCA 3H0YA 2EXEA 4Q2AA 5DWRA 2GU8A 2ZMCA 4FIEA 5IQIA 3R2YA 3R7GA 2YCSA 4MBIA 1U4DA 4QP6A 4W8EA 2PHKA 5HG5A 4BR3A 5J1VA 4MXOA 3MIAA 5AP6A 1SNXA 5EYDA 3ZSIA 5JGAA 2CLXA 4BCKA 2B52A 4C02A 3LKMA 4DF3A 4YSMA 2EU9A 3KN5A 2QO9A 3V6SA 1DI8A 1BX6A 4TYJA 3GCPA 5E1SA 5HHWA 4QTCA 1I44A 3PP1A 3VS2A 2QOKA 2AC5A 2QVSE 3BRBA 1ZAOA 3BBWA 3DK3A 1MUOA 3DY7A 3BGZA 2YISA 3KRJA 3ZRMA 2VN9A 1JSVA 3FYJX 4IVBA 5EFQA 2NRUA 3BE9A 3R7UA 2H9VA 4FKRA 1FGKA 3ULZA 3V5WA 4DG2E 5IQHA 2JDVA 2JC6A 5KKRC 3QD4A 2YM3A 4DINA 3QFVA 3I7CA 3HECA 3L9NA 5EI6A 4ARKA 5J87A 2QG7A 3NVMB 5IH6A 2VWWA 4FV7A 3KQ7A 5AR3A 4BTFA 3R71A 5BVKA 4A9SA 3R0TA 3PXFA 4RX5A 5C8NA 4D1ZA 2VGPA 4UV0A 5KMKA 1YQJA 3MH0A 4RGJA 4K9YA 2VTTA 3QHWA 5CU4A 4IZAA 2BVAA 5M09A 3EFKA 5KHWA 3HAVA 2YCQA 3G51A 5JGBA 5CLPA 4OGRA 2FSTX 2HWPA 4CKRA 2XM9A 2Q83A 4EH2A 4ZMFA 5M06A 5CSVA 4CFUA 3CTJA 4RFYA 3DZOA 4DCEA 3ROYA 4DGGA 4M3QA 4B4LA 1Z5MA 2GNIA 5AP5A 2B1PA 4YPSA 4B99A 4YO4A 4USDA 4AFEA 3Q9YA 3HP5A 4RC2A 3CGFA 4D9TA 4QMTA 2LAVA 3EQCA 5L6WL 4CLIA 1PMEA 4PF4A 4DEIA 3GEQA 1JKKA 1MRVA 3EL8A 4QO9A 1M7QA 4I92A 4EJ7A 2W1IA 2KTYA 3B2WA 3H10A 5CVFA 3PE2A 4G2FA 2OXXA 1UU8A 4M15A 2HOGA 3NUPA 5H8BA 1GIIA 2B54A 5L6PA 2J2IB 1OVEA 5CY3A 3H4JA 3OF0A 3UODA 4KIQA 5AWMA 4WRGA 3OG7A 3ANQA 4K11A 4WG5A 2GS2A 4CT2A 4IAZA 1RW8A 3ZYAA 4D4SA 3FE3A 5BQ0A 3HV7A 3ZDUA 4J1RA 2ETMA 5C1QB 4UALA 5CTPA 4EH5A 2YM5A 3FL4A 5HX6A 4GSBA 2Y7JA 3A61A 5CAVA 4AA0A 4NJ3A 5ANKA 4ANSA 3E7OA 4ZTRA 2XIZA 3NUUA 5H2UA 2OO8X 2UW8A 4MWIA 2NNWB 4LUEA 1E1XA 4RFZA 3LZBA 4D0XA 1QMZA 2GCDA 2WB8A 4GCJA 5K5NA 2FYSA 4BCGA 4QQJA 3QD0A 3EFLA 4ASZA 5CSWA 2FSLX 3BYSA 3CY3A 3FLYA 3LQ8A 4UWCA 3VS6A 3A4OX 3Q5IA 4IWDA 3C4XA 2OFVA 4LOOA 4FV8A 3AG9A 4FTNA 3NAXA 4I5MA 3OCSA 2EB2A 1SNUA 4HGLA 1CKPA 3BKBA 4NH1A 4TYGA 3V8SA 4D58A 4H3BA 3CIKA 1OB3A 3D7TB 1Y91A 3Q2MA 2JIVA 5EI2A 1J1CA 2XCHA 4H39A 4DGLC 2OLCA 2UZTA 4ENXA 3FQHA 3CR0A 3I5NA 3R63A 4IE9A 5AV3A 5HE3A 2GNFA 4IAAA 5HVYA 4QMPA 1YXXA 4BCHA 4XRLA 1IASA 2E2BA 3O7LD 4ANOA 4BTKA 3ALOA 1PHKA 3V5JA 3QYWA 2YAAA 2O5KA 5KZ0A 2X6DA 2VX0A 4LG4A 5LCKA 4E73A 1JSTA 4BDIA 5M51A 3L8VA 5C8MA 2XP2A 4AW0A 1Y6AA 4AACA 2CNQA 1GY3A 4FSRA 2VX1A 4WT6A 2WOUA 2YDKA 3KRLA 3OC1A 1OIQA 3PXYA 4IW0A 3OWKA 2ERZE 3PG1A 3COKA 1CM8A 2X1NA 2XMYA 3Q6UA 4BDAA 4NWMA 3KY2A 5HD4A 4S33A 3NCGA 5E1EA 4GFOA 4OT6A 4EOPA 2UZOA 3LXKA 3F2NA 1E1VA 3VS3A 3KMUA 3C0IA 5M07A 3A7GA 5HNGA 3DQWA 4CFXA 3F6XA 1ZXEA 1NVQA 1P4FA 3IDPA 3IK3A 2YERA 1VYZA 3NYNA 4JR7A 4F70A 5HEZA 3GC7A 3UZPA 4MYGA 4IWPA 2OW3A 3EWHA 4YTCA 3BCEA 1XH5A 4RLLA 1ERKA 3EN7A 3VBQA 5FTGA 1UA2A 3G0EA 3L1SA 3PXZA 3F66A 3OWJA 4FEWA 2H96A 2CJMA 3QKMA 4KB8A 4DEBA 3BI6A 1YHWA 1PKDA 4QMSA 4YTHA 3OHTA 4CG9A 4W9XA 3KK9A 3PSCA 4S30A 4FV5A 3BYUA 5IKWA 4ASEA 3MDYA 4ENYA 4DGNA 5AP7A 4DFBA 1YOMA 3L8PA 4C36A 5KNJA 3P7BA 4UBAA 5HKMA 5BVEA 4GU6A 4CV8A 1XJDA 3WF6A 3RPYA 5GZ8A 3DFAA 4RWKA 2OI4X 4FG9A 3A8XA 2E9OA 2HXQA 4YMJA 3BGQA 4JBQA 1OBDA 3MN3A 3DXNA 2A1AB 4HPTE 4DGOA 5IA2A 4WKQA 4WBBB 3NW6A 2VTAA 3NZ0A 2WMTA 2HW6A 3HDNA 4FEVA 3EQPA 4ERWA 3THBA 3I1AA 4MD9E 5AUUA 4DFNA 2BZHB 3QQHA 3GCSA 4XG6A 3MVLA 5CS6A 5ANGA 4MNFA 1Q41A 3R8ZA 2OWBA 2UZNA 2R3MA 3QL8A 4RLKA 2JDOA 1S9JA 2HZIA 5HNBA 4Q9SA 1U54B 4FZ6A 4YJVA 4TWOA 5JRSA 4V0GA 4WOVA 4KNBA 2OZOA 2UVXA 5HBJA 2I0VA 2KULA 3D15A 1RQQA 5AA9A 2X4ZA 3FSFA 5EQYA 4AT5A 4MK0A 5AUZA 2R3OA 3OWLA 3KMMA 4JQ8A 4Z55A 5AR4A 2PPQA 1IA9A 2BKKA 1H0VA 4FT9A 5IMEA 4FKGA 3TT0A 3VIDA 3FZOA 2PZIA 4IWQA 3HV3A 3ZONA 4QYFA 1Q5KA 3PY1A 3SW7A 3Q6WA 3D9VA 5DGZA 1FINA 4TW9A 3TNWA 3HMOA 3R8MA 2WFYA 3CJGA 4AWIA 2VTSA 5CF6A 4TKSA 5IH5A 4L46A 4RG0A 4IM3A 3QWJA 4MF0A 1V0OA 2XJ2A 5CAPA 3HMMA 4P4CA 3PIZA 3ZTXA 3FMKA 4YP8A 1CKIA 2BAQA 1M17A 4O7TA 5A3XA 1WCCA 4FZFB 4KRDA 4A9TA 1JKSA 2C5NA 2HENA 2W4KA 3BBTB 5GJDA 3ZEWA 4EOIA 3EFJA 4G9CA 1OBGA 4OW8A 1BMKA 4PQNA 5EDRA 4D2WA 4FG8A 4FTQA 4IB5A 1K2PA 3A7FA 5KKRB 2CKPA 3G9NA 2R3FA 3AD4A 1LP4A 4GG5A 2CLQA 4I6HA 2ZMDA 4UZDA 5FP6A 1PXJA 3DBEA 5D7AA 4J99A 3SXRA 4BKYA 5BVDA 5CZIA 1OECA 3ZO4A 1UU9A 4CD0A 4I1ZA 5HLNA 3G0FA 3TZMA 3P23A 2XRWA 4FKIA 4JG8A 4CQGA 2GNJA 4FV3A 3DJ5A 3A7IA 3HV6A 3UJGA 2F7EE 4O1PA 4BRXA 5AP0A 4PL3A 2XJ1A 4EWQA 3UQFA 2GQGA 3WBLA 3C50A 3EYGA 3GOKA 3UNZA 4IVAA 5TO8A 1RE8A 3KXGA 4IVCA 4ZJVA 4F0IA 4IBMA 1H27A 3TUCA 3LQ3A 1HCKA 3V5QA 2VWZA 5K9IA 2UV2A 2UZEA 2X7FA 2RIOA 4D2PA 5DT4A 4QP7A 2BALA 4ZJIA 3RNYA 2W06A 4IAYA 5JQ8A 2JGZA 2R3IA 4HYHA 4PMSA 5AEPA 2CKOA 4GYGA 2HZ4A 4F7LA 3OD6X 4LL0A 3E8DA 3EOCA 3R8UA 3DA6A 5BVFA 3KGAA 4C38A 3QWKA 4O91A 3RAHA 4X6RA 1YW2A 2BRMA 3NNUA 3W2RA 4NEUA 4XG8A 4YJNA 3ZCLA 1K9AA 3VN9A 3CTHA 3HV5A 2XA4A 2X9EA 3QZHA 5I5ZA 2QOLA 3QX2A 5DRDA 1OPKA 3WILA 3KKVA 5JZJA 2OSCA 3R1YA 4A06A 4FIFA 1KE9A 4V05A 4YHJA 4NW5A 2QOOA 3FMJA 1YOLA 1FVRA 1VEBA 3WIGA 3FMDA 3UVQA 5CU0A 3ZLXA 3NCZA 4QD6A 3F3UA 4MNEA 5K3YA 3N4VA 4KAOA 3C0GA 2GS7A 2G15A 2OJJA 5IDPA 3TI1A 4RJ7A 3MESA 4OTDA 1B39A 3PE1A 3PWDA 3FMNA 2PULA 3O2MA 4CCBA 4IX5A 1PMUA 3LFBA 3LHJA 3S3IA 5IISA 5IMXA 3F5GA 4K77A 4S31A 1BI7A 2BRNA 4MEDA 3C5UA 4IX6A 4IAIA 4ACGA 4PTGA 3SRVB 4C58A 3TZ9A 4YTIA 3W18A 3QKLA 3O7LB 2PMOX 3RCDA 2BTRA 4ZTSA 2JAMA 4L3JA 3RM7A 5CZHA 2CPKE 3H9OA 3RGFA 4QMOA 3V01A 1W0XC 4RIWB 2HYYA 3QALE 2PL0A 4CV9A 3HA6A 4I0RA 4MVFA 4QMXA 4E5BA 4XP3A 3DXPA 3P78A 4QMZA 5IA1A 3AGLA 3MVJA 3GQLA 3F3TA 4HZSA 3PJ8A 3W2PA 3QUDA 2BZKB 1Q8ZA 2FVDA 3MJ1A 2QOBA 4HYIA 3A7JA 4CFMA 4CFVA 5K4JA 3QUEA 3DKCA 4JAJA 3CEKA 2WMQA 2YWVA 2YJSA 4FTCA 3FC1X 3WE8A 4E7WA 4U44A 2VWUA 2QD9A 3AT4A 3ITZA 3PRFA 3QLGA 4ZY4A 3ZSHA 5J8IA 4HGSA 1Q62A 3FL5A 3LJ1A 5IQGA 3ORKA 4YJTA 2AC3A 3AT2A 3SXFA 2HELA 3U9CA 2ITVA 5A4QA 3TKIA 3NGAA 4YHFA 4FSUA 4FNZA 4JDHA 3FKLA 2QR7A 4G3DA 4TXCA 2XEYA 4EONA 4FF8A 2VTLA 3O8TA 4AU8A 1J7LA 3PJCA 4Y46A 1YXTA 4PL5A 4C57A 4BTMA 4IZYA 3FHIA 3GQIA 2JKOA 3OCBA 4G3GA 4P5ZA 2VTPA 5BVNA 3RM6A 4JRVA 3PPZA 3EZVA 3SV0A 5FTQA 1GZNA 2BFXA 2GQRA 3SLSA 4ZLOA 2W7XA 4Z9LA 3LFDA 2BRGA 2YZAA 2PVMA 4DE4A 4O7ZA 2XIXA 3IGGA 1Q4LA 5JZNA 4EQMA 2CGVA 3E88A 4UB7A 3AQVA 3IW5A 3TUDA 3RMFA 3T3VA 1JWHA 2BAJA 4RA4A 5HNIX 3GT8A 4XCUA 4E4LA 3EYHA 4ZZNA 2FGIA 3V3VA 5EKOA 1WBSA 2UW7A 4XV9A 3GU8A 4QMMA 1PYEA 1YKRA 4QP9A 3QCYA 3I7BA 4AW2A 3D5UA 1WBTA 1X8BA 4B0GA 4K8AA 4I24A 4F7JA 2GTNA 1ZYDA 4D2VA 1QCFA 4QP3A 3DPKA 3BHHA 3RNIA 4JBPA 3R21A 3K3IA 3OCGA 2GHMA 4JRNA 4TWCA 2ITPA 1QL6A 1YDRE 1JKTA 2GTMA 1YDSE 3ET7A 3NDMA 3R1NA 4JBOA 4X7QA 4YZMA 5ANDA 3RZFA 3VJOA 1O6KA 4EZ5A 5L2TA 4V0GB 4ZTLA 3CD3A 4DT8A 4HCVA 4FYNA 3ATSA 4IMYA 4EYMA 4D5KA 2V0DA 3RK5A 4ZSAA 3VO3A 3NRMA 2XBAA 3F5XA 3FYKX 4FT5A 3DTWA 3WIKA 1OUKA 3UBDA 4QMVA 3V6RA 4RJ8A 1STCE 1QPDA 5C01A 4YLJA 4ALWA 1QPEA 3LXPA 3ORPA
chains in the Genus database with same CATH superfamily
5JEBA 5FUTA 2JKMA 2ZM1A 3G6GA 2JDSA 3QRTA 2WEVA 4KKHA 3KN6A 2X81A 4DEGA 4FIGA 1G5SA 3KL8A 3O71A 4OUCA 1W2FA 5HD7A 3TV6A 3UDTA 2ITUA 3Q4UA 5AAGA 1ZRZA 3FMEA 3V04A 2Q0BA 3JS2A 4AXEA 3IONA 1WBNA 4L68A 4NFMA 2WU7A 5BMSA 4O7SA 2R9SA 4G6NA 3PWYA 4EOOA 3EZRA 1F0QA 3FZ1A 4R5SA 4BB4A 5J9ZA 3SOCA 2P3GX 3P7AA 4JX7A 3SHEA 4G3EA 2QOIA 5C27A 4R1VA 3RAWA 2PZYA 4JS8A 2ZV9A 2C30A 4LQMA 2BHHA 1XH8A 3NNVA 3MVMA 3IGOA 2XF0A 4TNBA 5F1ZA 2WMAA 4FICA 2OZAA 5AUWA 4AFJA 5FGKA 3A8WA 4EZ3A 3UZRA 4WUAA 3AC2A 4DITA 1WVXA 2XKEA 3U6HA 4ZY6A 4FK6A 5TKDA 3G5DA 4BHNA 2QCSA 1PXKA 4UZHA 5ANEA 1SZMA 4FOCA 3ZMMA 5M4IA 2YM8A 3DAKA 2OGVA 1P5EA 2ZDUA 3I0OA 5EDQA 5I9VA 4I6BA 3AC4A 3MY5A 1TKIA 4BDHA 3R9NA 4L8MA 4V01A 4DEEA 3HKOA 3OMVA 3V8WA 4O0VA 4APPA 2JITA 2O3PA 1ZZLA 4G6LA 4DN5A 3FZSA 3DJ6A 4WSYA 2YM6A 2PK9A 4XH6A 3P1AA 5EM6A 5TR6A 2ZJWA 2R64A 3MI9A 3ZFXA 3MFSA 4H05A 4ITJA 1WVWA 3QYZA 3DT1A 5BUEA 2XH5A 4MD8E 2G2IA 3DOGA 4DAWA 5T6KA 3GC0A 3KVXA 4UN0C 2WTWA 2EVAA 3RALA 3ELJA 2X4FA 5AMNA 2WU6A 5A6OA 1H8FA 2Z7LA 5JN2A 5IZFA 2W17A 5IA3A 3ZUVA 3T9IA 2BIYA 3H3CA 4TT7A 4BKZA 4Z3VA 5AUVA 5DI1A 4DHZA 4MX9A 5HGIA 2JDRA 4NIFA 2VRXA 3E3PA 4CRSA 2ITWA 3T8OA 4J97A 2ONLC 3ACJA 4BCQA 2CCIA 5BUIA 5LQFA 2Z7RA 4K2RA 4DLJA 5A14A 2GHGA 2ONLA 2F4JA 3PA5A 4FZDB 3VS4A 4XG7A 2PMIA 4FK3A 3TJCA 4BC6A 4PTEA 4XNEA 1P14A 3UO5A 1PY5A 3K5UA 3OTUA 1R0PA 3ZLYA 3KEXA 3GNIB 2VD5A 3LCDA 1Y6BA 1L8TA 5CEQA 4RPVA 4LOPA 3HRFA 1UWHA 4QYGA 1U5RA 3VUKA 3LQ5A 3QCXA 1H00A 1OKWA 3DNEA 4KWPA 1Q8YA 2VAGA 1G8JA 4O0SA 4I0TA 2W5HA 1YWNA 4CMTA 4O7NA 4MNEB 4FVPA 3W0SA 5HZNA 3F3WA 4D2TA 4JDJA 4BDJA 4XV2A 5HBHA 4UXQA 1XBCA 2WEIA 2WQNA 1W8CA 4XEYA 4DLIA 3ZS5A 5HIEA 4MXCA 2CDZA 4IVDA 4RVLA 3MYGA 4EK8A 3JVRA 2X8DA 3NSZA 1M7NA 4AZWA 1H24A 3RWPA 4EK6A 5E8TA 3UNKA 2ZB1A 5HIBA 3O0GA 2I0YA 1FPUA 3K5VA 4OTPA 3FKOA 5A9UA 4HVGA 4ZSLA 4D5HA 2G2HA 4QNAA 2YITA 3VQUA 2HCKA 3FSKA 4FTJA 4EKLA 3TDWA 2OK1A 2UZBA 3QX4A 5IEYA 2FUMA 3RTPA 4QMNA 5CEMA 3G90X 4BFMA 5HVKA 5K0XA 2JKKA 2Z7SA 3EQHA 4MH7A 5DNRA 3VRZA 3LMGA 4I6FA 4MD7E 4R7HA 2E9VA 4FV4A 2RG5A 5FEQA 4ZMEA 3FZRA 4FTMA 5CNNA 3MS9A 3MFRA 4IADA 4M7IA 3HMPA 5AAFA 3T3UA 4QQ5A 3LLAA 3COIA 3DV3A 5IQAA 5KMNA 2VTQA 3BLQA 2X0PA 3SW4A 3VHKA 5ETIA 5DRBA 4F6SA 4FTIA 4CYJA 3GC8A 2R3LA 3NX8A 4RZWA 4X3JA 1WBOA 1XH7A 2QURA 2IZSA 3COHA 4RWJA 3EQBA 4C4GA 5AM6A 1O6YA 4IDTA 4D55A 4ZEGA 4DFUA 5HTIA 3DLSA 3R8VA 4M8TA 3D5VA 5FDXA 3NMUF 3VVHA 3OXZA 1J3HA 5HG7A 5EM5A 4FTTA 4GH2A 3QLFA 3E5AA 4CZUA 2GNHA 4AOTA 5I3OA 2PVKA 4WNKA 3T9TA 3JPVA 5TE0A 2FSOX 2X0QA 2XNNA 4C2WA 2W05A 4O7VA 3BELA 5CU3A 2B9FA 1OI9A 4NCTC 3O51A 5G6VA 4C59A 4AZSA 3OT8A 2PUIA 3E93A 4ZZMA 4O7RA 4LFIA 3CXWA 2OKRA 5CSPA 3IO7A 2ZFYA 4KSQA 3BL9A 4NCTA 3W0MA 3KMWA 4L3PA 2IG7A 3VUMA 4DTAA 4HJOA 1J7IA 2PUNA 4FZAB 5C9CA 2YACA 1IR3A 3CCNA 4ZXTA 4BCNA 1V0BA 1Q99A 4I93A 3ORNA 4F9CA 1PMNA 5CI7A 4EHEA 4ZS4A 4CKJA 2VO6A 4PTCA 2CGWA 1W82A 4XS2A 3RPOA 5FXQA 4BGGA 3CQEA 4EUTA 4UWBA 1U5QA 4R7IA 5CVGA 3NYOA 1TQMA 4BJJB 3AC5A 5LWMA 4N4SA 5ETFA 4AT3A 4YJSA 5I0BA 5CNOA 5M4UA 2J0KA 4KIPA 4LUDA 5CWZA 2XAOA 3LJ0A 5KHXA 3CKXA 4YLLA 5J5SA 4FEUA 3UTOA 1ATPE 3MWUA 4FL3A 2JFLA 4FIIA 4IH8A 5AIRA 4CZYB 4HVIA 2ETRA 5LMAA 4M0YA 4L7SA 5DMZA 5ACBC 2FSMX 4FT3A 3QCSA 4H1JA 2JEDA 4FSYA 1P2AA 2BCJA 4G3FA 3RAIA 4DH8A 5DR2A 3QRIA 4YNOA 3FZPA 3ZFYA 5EOLA 3IOKA 2RSVA 4L67A 5EM8A 4FV2A 5M4FA 3UMWA 4OT5A 3UC3A 2PVYA 2UZVA 4BZNA 4DHFA 4RVTA 5JK3A 1ZYJA 5BUJA 4DTBA 4CMUA 1XKKA 3MV5A 3HL7A 4I0SA 4ACCA 2JBOA 1TZDA 3ACKA 3ZH8A 2XNBA 4I5CA 3MBLA 4M13A 3CP9A 2VX3A 5CF8A 5HORA 1SVHA 3ROCA 3WOWA 4AGUA 3UDZA 4YGAA 1KSWA 3QTXA 5IA0A 3OEZA 1DAWA 3PIXA 1W83A 2XKCA 3CD8A 2QU5A 3MSSA 3NUSA 3WYYA 2ACXA 4HNFA 3OXTA 4L7FA 4GT3A 1WBPA 4ZTQA 2PZ5A 3GB2A 3SDJA 2OZAB 3W2OA 4G34A 5IQEA 3O17A 3ODZX 5J95A 4X0MA 4A9YA 5CEOA 4BL1A 2UZWE 4LMNA 1Z57A 2PVRA 2PVLA 2X0GA 4BWXA 3U87A 1H1WA 2JAVA 4GT5A 5CASA 3FKNA 2ITXA 3KK8A 3WZEA 1KOAA 4KBKA 5E7RA 3AC1A 4O1OA 3H9RA 5KX8A 1XH4A 2HIWA 4I20A 3RINA 2YHVA 1M2RA 1R39A 1NY3A 4BGHA 4WSQA 3R9DA 4N0SA 3TZ8A 3DQXA 2O65A 2HZ0A 2RFEA 4IHPA 4GV1A 2R3GA 3RHKA 2XKFA 4I6LA 3S0OA 2NO3A 3AKJA 1MRYA 5T3QA 3SRVA 4C61A 4O0WA 2CN5A 3GCVA 3LFQA 4F7NA 3TNPC 3CPBA 3AT3A 3UYSA 4F1OA 5IU2A 5F94A 1MQBA 4RIWA 3F3VA 3QA0A 5L8JA 5CEIA 4DC2A 3VRYA 3QZIA 5HE2A 4NIFB 4NTSA 1SM2A 2C6OA 5D11A 4K18A 3WARA 2DQ7X 2WTKC 2XB7A 4YJUA 3HYHA 4WBOA 2C0TA 1DAYA 2Y0AA 4IB1A 4RIYA 5TT7A 1AQ1A 4GRBA 4OTRA 4RJ6A 3C0HA 3R8PA 4OAUC 4NL0A 3RBWA 1WBVA 3MIYA 2GFSA 5BYLA 4QP4A 2P0CA 4CZTA 2CN8A 1U46A 2OIQA 3P4KA 3C4CA 4KIOA 3ZOSA 4ANMA 4FTLA 5AA8A 5AV4A 3PVUA 4EOJA 2XYNA 3D94A 5LVMA 4Y73A 3M2WA 4G9RA 4AE9A 4FODA 4FV9A 5E8WA 5A4TA 1WFCA 2QQ7A 2J0JA 2J4ZA 3FY0A 4MF1A 1ZYSA 1AGWA 5IUHA 3UIXA 1K3AA 1GIHA 1F3MC 4X3FC 3FPQA 4RMZA 3U6IA 4S34A 2F49A 4Y5HA 2CHLA 2ETKA 3HGKA 4E8AA 5J7HA 1R78A 2OIBA 1H08A 2C1BA 5CVHA 5AV1A 4R78A 3PJ2A 4FIJA 4EK5A 5CANA 2BRBA 5IG1A 4O7YA 3RWQA 1RDQE 3QQJA 5LVPA 5FEDA 4WUNA 3MVHA 3OFMA 3UP2A 3H0ZA 4O4CA 3N4UA 3LW0A 2B7AA 3KULA 4N6ZA 5LVNA 1PXNA 3ZRLA 4AW5A 5F4NA 1A06A 1H1PA 3E63A 3FMHA 4G16A 4RIXB 4DHJA 5C4LA 1OPJA 3UDSA 4IC7A 4QYYA 3K3JA 4JR3A 4KBCA 2W96B 3R6XA 2SRCA 2R7IA 2VTHA 3E64A 3P0MA 4F4PA 5TF9A 4R3RA 2YIYA 2FA2A 4PWNA 4FL1A 4Y83A 1XO2B 1NT2A 2C6DA 4P5QA 4OTIA 2RKUA 3QZGA 2C68A 4YJRA 1WVYA 2GNGA 2CNUA 3QF9A 1MRUA 4FNXA 1L3RE 5DBXA 4FG7A 2IW9A 1CDKA 1ZY4A 3IPHA 2XK4A 4J71A 5DT3A 4TN6A 4IJ9A 3RPVA 3EN6A 1BKXA 4OBQA 5DVRA 1REKA 3LCTA 4EHZA 2Y9QA 4FA2A 3AKKA 4L53A 2C6TA 3TV7A 4YU2A 4FKJA 4O0UA 3FUPA 5DR9A 2GNLA 4QT1A 4TYHA 2C3IB 3PJ3A 2WTDA 4F6WA 5KMMA 4FGRA 1A9UA 5B7VA 4FE2A 4HVSA 3ZM9A 3FI4A 3CLYA 5BYZA 4RWIA 3ORLA 4FGBA 3FQSA 2Z02A 5A4LA 5FD2A 3GENA 3QKKA 4RJ3A 4AZEA 3NS9A 4NTTA 3WZKA 4NZWB 4WNMA 3GBZA 2C4GA 1YXVA 2IWIA 2PY3A 3LCOA 5E90A 3VBTA 5C26A 3U4WA 3I81A 1J91A 1OL6A 1GOLA 4H3QA 4DGMA 2C0IA 4PNIA 4RC3A 4FKSA 1XR1A 3FV8A 2IZUA 5ANOA 4C3RA 3EB0A 2B0QA 5EI8A 3QTSA 3ZBFA 4E6AA 1Q61A 4ZLYA 3ETAA 3PSDA 1IRKA 2HXLA 2AYPA 2DUVA 4GMYA 4KD1A 4PPBA 4C37A 1GNGA 2QKRA 4EKKA 4EBVA 4RRVA 3RI1A 4O4BB 1Q24A 3I6WA 5HTCA 3LFSA 3ZZEA 5CT7A 4JNWA 4TTHB 2OH4A 5DR6A 4BHZA 3BZ3A 4CSVA 4MQ1A 3SGCA 4ID7A 5AP3A 1Y57A 4C3FA 4GK2A 2O2UA 2YA9A 4ONAA 5DFPA 1BUHA 2UVYA 2PZRA 3PPKA 4OBOA 3NPCA 2CKEA 4H3PA 2BDFA 3JR1A 2W1HA 2I6LA 4MXXA 5CU6A 5ANIA 4BCOA 3BIZA 1SVGA 4FTAA 3DBDA 2X8EA 5J1WA 3TM0A 4GKIA 3ZLSA 4YC8A 4DG0E 4I41A 3CJFA 4C34A 4W4VA 2YABA 4ZSGA 4O2ZA 4N57A 4FTRA 4JXFA 1YHVA 3FXWA 4IQ6A 3RPSA 4BBEA 4F99A 2XANA 2OFUA 2YZLA 3G6HA 4QMUA 3P79A 4UMRA 3ZU7A 2Y6OA 2CGUA 1JSUA 3DS6A 5ETCA 4AN3A 2J0IA 4AF3A 3GU7A 4DG3E 4U81A 2PU8A 3DTCA 4NM3A 1WZYA 5K4IA 4MCVA 4R1YA 3IQ7A 4U42A 4B9DA 1XMMA 5FDPA 5J7BA 2F2UA 3R7YA 4R6VA 3I79A 1R0EA 4JJRA 4CTCA 3OT3A 4TWPA 5H8GA 4FZ7A 4YJQA 4DFLA 4OTHA 3VNTA 4GK3A 2X2KA 4AGDA 2F2CB 2V5QA 3LCSA 3FLSA 5CT0A 3BGPA 1BI8A 4X2GA 2W99B 3UOKA 5A54A 3EN4A 1XH9A 4FUXA 4C3PA 1WMKA 3HMNA 3WF5A 1O6LA 2YEXA 2ZM3A 4R5YA 3ID6C 3IW4A 5CQUA 3NFFB 4ZIMA 3I60A 3GVUA 1XH6A 2CKQA 3EL7A 5AX9A 3CSVA 1ZYLA 3R00A 4O27B 2UW9A 3Q32A 4EHVA 4KINA 5FP5A 4ZZOA 4APCA 5HCYA 2PYWA 2OU7A 3EFWA 3P7CA 4J52A 3RK9A 1OZ1A 2PVFA 3UVRA 3D4QA 4FRFA 4H1MA 3OWPA 2XM8A 1URWA 4BIDA 3EQDA 3DKGA 3VUHA 1H01A 2PVJA 3AD5A 3UPXA 4KUJA 3PYYA 3DNDA 4O0RA 4WNPA 4FEQA 4LV5A 1CMKE 4IDVA 4XX9A 2BR1A 4QYEA 4AA5A 1YI4A 4ALVA 5KUPA 3NNWA 2OBJA 3QA8A 4O6LA 5FXRA 3FZTA 1KWPA 4GL9A 5C03A 4BZOA 3GOPA 3PUPA 3PY3A 1DM2A 1NVRA 3UVPA 3NWWA 1JAMA 4Z7HA 4UX9A 3DAEA 3F5PA 3GU5A 3QZFA 2A19B 4FTKA 4O21A 1J1BA 1G3NA 4O81A 4WIHA 5E91A 3MY0A 4MBLA 5JRQA 4CVAA 4QQTA 4BDCA 3UG1A 4RIOA 1FMOE 1ND4A 2F7XE 2Y4IC 3D2IA 2X7OA 3NUYA 3PXQA 4LV8A 3MGYA 4IXPA 4RIYB 4USEA 3BV2A 4ITHA 2WTKB 3IS5A 2C1AA 4O4EA 4G31A 5ACKA 4QMLA 1UKHA 2GMXA 4U9AA 3RK7A 3ZXZA 5J9LA 2GHLA 3UMXA 1UV5A 3A7HA 3R01A 4JL9A 5HOAA 3FEGA 1M52A 5IF1A 2HWOA 4IB3A 4F78A 4IX4A 5CEKA 3BL7A 4L52A 4IIRA 3CY2A 3VWAA 2C3LA 4RJ5A 3RVGA 2R4BA 5EYMA 3BYMA 5EQPA 1XBBA 3RPRA 4BDKA 4EOSA 1MQ4A 1T46A 4ANNA 4EJNA 3RCJA 5M53A 4L00A 3RP9A 5CF4A 2BRHA 3SVVA 5EHOA 2W1EA 3HA8A 4GG7A 4PDOA 4X3FB 5HG8A 3W2QA 4QMQA 4PMMA 3F9NA 1UKIA 3CBLA 3POZA 3HP2A 5KBRA 5IQBA 2P2IA 3KB7A 2YJRA 4TY1A 4IM2A 2WMBA 4LMUA 2W4JA 4CKIA 4EI4A 5ETAA 4EOLA 5I9XA 4G17A 1KOBA 1FVVA 2FO0A 2W9ZB 2QLUA 3E92A 4YC6A 3KULB 5CYIA 4BI2A 4D4RA 3Q2JA 2ZVAA 3MPTA 3BQRA 3PTGA 4CFFA 3PG3A 3IKAA 3CS9A 4H36A 2BDJA 2BROA 2A98A 3REPA 4J95A 2VWBA 1NA7A 4ZAUA 3R9HA 2JKQA 3BE2A 3QTWA 4USFA 2HZNA 2C69A 3TNHA 2XNPA 1H4LA 4M0ZA 3ZUUA 4DBXA 4C4JA 1AD5A 3BHUA 3I6UA 2ITQA 4IAKA 4YNEA 4G1WA 3EQGA 4IACA 1YI6A 4KBAA 3IW7A 4NM7A 4O96A 4PP7A 4PDYA 4O7LA 5DLSA 3UOJA 5H9BA 2WIHA 3EJ1A 1JQHA 3F3ZA 3R30A 2PUUA 2ZB0A 3UYTA 4G3CA 5E8UA 1LEZA 5M4CA 4HGEA 3DCVA 4F0GA 1JPAA 4KA3A 2ERKA 5CALA 1JBPE 4E6CA 3VS7A 3JXWA 4C0TA 3H9FA 2YLFA 2X9FA 1REJA 4TYHB 3KRWA 4ACMA 2R3NA 2VO7A 2XKDA 4YSJA 3PVBA 5ANJA 3TG1A 4MXAA 3LFEA 4F0FA 2QOQA 1OGUA 1KE7A 4AGCA 5FRIA 4F08A 2PE2A 2IW8A 3UIMA 3TL8A 1Z9XA 4Q5EA 3WF8A 3WF9A 5BV3A 4RQVA 2WO6A 2VTNA 3UC4A 3TN8A 4HZRA 3A99A 4R8QA 2O0UA 1ST0A 3CGOA 3K54A 5D41A 4DEDA 4L6QA 3R7OA 4AZVA 1PRYA 4EH3A 3TUBA 4Z7GA 3HRCA 4FSQA 1KV2A 2REIA 1JVPP 2A0CX 1KV1A 4JAIA 4EZ7A 3FLWA 4C4HA 2BZJA 3M1SA 3LFNA 5DEYA 4QP1A 4A07A 4E26A 4YBJA 5KO1A 4H58A 1F5QA 2W1GA 4XG2A 1TQIA 1TFFA 3EN9A 4JDKA 2ZOQA 5EW8A 1VJYA 3UOLA 1VR2A 3W10A 1TQPA 2G9XA 2WMRA 5FM3A 2C6LA 3GU6A 3G2FA 2JD5A 4KKGA 4TZRA 3O5AA 1Q3DA 5D12A 1ZZ2A 3VBWA 1H25A 5HI2A 4C8BA 2OH0E 2BKZA 4ZY5A 3ENHA 4JIKA 1NVSA 3BYVA 1WAKA 3MB6A 5EDPA 2C0OA 3D14A 4EK3A 4F64A 4O38A 2OICA 4Y85A 4ZK5A 4FYOA 1V1KA 1PXPA 2VTIA 3HUBA 4N6YA 5FBNC 3R8LA 3SC1A 5CSXA 2YCFA 3JY0A 4XLIA 4GKHA 5DN3A 1DS5A 4X2JA 5JFSA 3ZSGA 2YLEA 4AT4A 4U40A 3N9XA 3VAPA 3JY9A 2GSFA 4CYIA 4M12A 5GHVA 4O4DA 5HLWA 4R77A 1VLRA 1CTPE 3TACA 3GUBA 3DK6A 4Y8DA 3ZO3A 2XBJA 4ITIA 3FC2A 5KBQA 5HE0A 3OOMA 3L8SA 3E3BX 3UG2A 2J5FA 3NUAA 3FHRA 3CPCA 4UMQA 3ZZWA 5AR5A 5L2QA 4UYAA 3M11A 4YZBA 2B53A 3BLRA 1YOJA 3FLQA 5CX9A 1W2CA 3GXLA 5HCXA 2IPXA 4AN9A 1OKVA 3VUTA 4GVAA 3SX9A 2XK9A 4XV1A 2J0MB 5A4CA 1P4OA 5IA5A 2A27A 4WNOA 4NT4A 2B9IA 5EG3A 4BZDA 3Q52A 3HMIA 4K6ZA 4I94A 1M2PA 3TIZA 4LRJA 2GFCA 3QC4A 3TWJA 3HUCA 1CKJA 3RAKA 1XWSA 2I1MA 3PRIA 3VHEA 2I0HA 1IAJA 2O64A 3PZEA 5I9WA 3P86A 4E6DA 3MB7A 2C47A 4GVJA 5DH3A 5DPVA 2V7AA 1UNLA 3OXIA 5KCVA 3DZQA 4DA5A 4IANA 2W5AA 4BYJA 3CC6A 4CLJA 4U45A 3WI6A 3VJNA 4U79A 3Q9XA 4AW1A 3TKUA 1OM1A 3NIZA 4CT1A 1JOWB 2OIDA 4MTAA 3R73A 5LARA 4I5PA 4XG3A 5FQDC 4GS6A 2VZ6A 4YC3A 4O86A 2BFYA 5JSMA 4ORKA 4O6EA 2I0EA 4YUQA 2G2FA 4OTFA 2BDWA 3RJCA 3DB6A 5FG8A 1ZOGA 4ACHA 1VZOA 4HOKA 5AV0A 4EOKA 4PP9A 4EOQA 4GFMA 2YM7A 4QNYA 4RVKA 3LOKA 4NM0A 4XJ0A 3BX5A 3TJDA 1JLUE 4AZTA 2JBPA 4RIXA 1UWJA 4EORA 4LDTA 4E4MA 3V51A 4BVUA 4NKSA 3R7VA 4LGHA 3F82A 5FXSA 4OBPA 1M2QA 4P7EA 3P5JC 4XG4A 5EHLA 4E4NA 3N4TA 4YPDA 5H3QA 4QOXA 4AOJA 3EHAA 2WTVA 2IVUA 5GIOE 3BEGA 3UP7A 4O84A 2WQEA 2Y4IB 3PJ1A 4O0YA 5AR7A 4IEBA 4EC8A 5JMSA 3S4QA 4EHGA 3GI3A 3V8TA 3QU0A 4FKUA 4CCUA 5IEXA 4W8DA 3MTLA 5DA3A 3KIOC 3S1HA 4B8LA 1HOWA 4FR4A 3OBGA 4YJPA 3MPAA 4FVQA 4FV0A 4M66A 4CG8A 3F69A 3QTZA 5CI6A 4QPAA 5L2SA 2R2PA 4QMYA 2PE0A 4BGQA 4AP7A 2XK7A 4FOBA 5LVOA 5E92A 1FGIA 2GS6A 2C6IA 2RG6A 3DGKA 3R1QA 3S95A 4E3CA 3NUXA 2VTRA 4DTKA 3OROA 4BTJA 4RC4A 2Y4PA 3KREA 3LMHA 2PVNA 4D0WA 3KRRA 4O0XA 3ULIA 4BCJA 1G8SA 5HIDA 5C8KA 2RGPA 4NM5A 3NUNA 1QPJA 1MP8A 2ZV7A 3QQGA 2EUFB 3WE4A 2J90A 3AMYA 5D1JA 4AGWA 1H0WA 3PUFC 2Z7QA 2P2HA 1ZLTA 5E8ZA 2H6DA 4EH6A 4BIBA 2WMWA 1BLXA 1Q8UA 5DT0A 3PY0A 3PXRA 4TNDA 4W4XA 4DT9A 5HU9A 5EYCA 2RFSA 4AUAA 5LMKC 4KSPA 3D7ZA 3LFAA 5DHJA 4F63A 5LCJA 3R7EA 4EH7A 3V5PA 4AE6A 5JH6A 5LMKA 4P90A 3G15A 3PA4A 2QC6A 2UW4A 1ZY5A 3LCKA 1Y8GA 4L43A 5AV2A 3OCTA 5EYKA 4OAVB 4YLKA 5DEWA 2OF4A 2WQBA 3QGWA 4M14A 3DLZA 1LR4A 3DDQA 4LI5A 4Q5HA 2YIRA 5HTBA 4JMQA 3DAJA 4ZTMA 5KZIA 2XIYA 1APME 3QD2B 4J8NA 4A4OA 2XVDA 2R3KA 1W7HA 4IAFA 4E4XA 3LE6A 4ZSEA 3L8XA 5J5TA 2VU3A 4CMOA 4GJ3A 2J50A 4F9YA 3E7VA 4DYMA 1OKZA 2WMUA 3KRXA 2A2AA 5HE1A 2ITOA 1V0PA 4HPUE 4A9UA 2UZLA 4U3ZA 2ITZA 3BQCA 2W1CA 3BU3A 3QXPA 2FB8A 4A7CA 4YO6A 3UE4A 2ZV8A 3E87A 4CEGA 5CAQA 5FM2A 2VGOA 3ML1A 2YAKA 5H8EA 4EEVA 5I9ZA 2O8YA 5I4NA 4U43A 3CKWA 5M08A 4WA9A 4U80A 3UGCA 4ZLZA 4QTAA 3FLNC 3PXKA 4GK4A 4RA5A 3SKCA 4C7TA 4F65A 3W0RA 5DIAA 2PSQA 1O9UA 4OR5A 4FIHA 3V5LA 2WQOA 3AOXA 4EK4A 3ZRKA 4CFWA 4ZTNA 4QPMA 4ZTHA 3Q9ZA 3BWFA 4W9WA 3MW1A 2X7GA 3DU8A 5EW3A 4PUZA 5IEVA 3LVPA 3CQWA 3GP0A 4KIKA 3FI3A 5IUIA 3R04A 3VS1A 1T45A 1BL7A 4LV7A 2DS1A 1EH4A 4QTDA 2OJFE 3COMA 4CRLA 4DBNA 4P2KA 3NR9A 3MA3A 1OL5A 4FSNA 3H30A 3I4BA 4HCUA 3LXLA 3QRJA 4U6RA 4UY9A 4BCPA 3AGMA 3TMOA 3W2CA 2XS0A 3UQGA 3WZDA 3OW4A 2B4SB 1UNGA 3OOGA 1ST4A 2BMCA 3O96A 2VV9A 4RX8A 3WZJA 5HX8A 4WG4A 5AFVA 3O23A 3ALNA 3O50A 5L2IA 4AA4A 2WTCA 3DB8A 3SAYA 2XUUA 1H07A 3HNGA 1NXKA 4IZ5A 5B0XA 2RFNA 5AUXA 1FMKA 4J7BA 3DBFA 4XG9A 1YI3A 2G01A 4WO5A 5KMOA 2WNTA 1PXMA 1UU3A 3QTRA 5AADA 4EH8A 3B8RA 3W32A 1J7UA 4FKTA 2X2MA 2PVHA 3A2CA 1YWRA 3DKFA 3U4UA 4EWHA 5BVOA 2VTMA 2OJIA 5K0KA 2GPHA 2JDTA 2EWAA 3QUPA 4PY1A 4BDDA 5L3AA 2PE1A 3VBVA 2XNMA 3S2PA 3EQIA 2R7BA 2WMSA 4C4IA 2C5OA 4FV6A 2UUEA 3KVWA 3UDBA 2CMWA 2OXYA 3HZTA 3BU5A 4QRCA 4FKPA 5IH4A 1Q3WA 5LVLA 3UIUA 4NUSA 4AXDA 4E6QA 3IW8A 3WF7A 3N51A 4S2ZA 3DBQA 3UO6A 2WXVA 3OY1A 4XP2A 5BMMA 2C6MA 5GZAA 3II5A 4RVMA 4WG3A 4R3PA 1XBAA 4BDBA 3W55A 2XALA 2BZIB 4E5WA 3HRBA 5BYYA 4FEXA 4MAOA 2P4IA 3IDCA 4EL9A 4QP2A 4S32A 2R3QA 4GIIA 4HVHA 4DFYA 2CGXA 3E62A 4L44A 5D7VA 5AR8A 4QQCA 3FAAA 5CENA 5HESA 2XNEA 4U97A 3QQKA 3PA3A 3GFEA 2WIPA 4O2PA 4X3FA 5AP1A 1YWVA 1IAHA 5HO6A 2PMLX 2F7ZE 2ZYBA 4BCMA 4E1ZA 2QONA 1YRPA 1M14A 3VF8A 2QOHA 3C4WA 4I3ZA 4G6OA 3R7IA