3OROA

Mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 4)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
280
structure length
272
Chain Sequence
b'DRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIATAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine protein kinase
publication title Allosteric activation mechanism of the Mycobacterium tuberculosis receptor Ser/Thr protein kinase, PknB.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 272
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oroA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oroA01
4D28A 3WZEA 3ZZEA 4UV0A 3K2LA 2VRXA 3QXOA 4D2RA 3GQIA 3ROYA 3UTOA 4YR8A 4BCHA 4RJ3A 1PXLA 4FKRA 4IB0A 4O7VA 4OTHA 3DNEA 4JRVA 4IAKA 2YABA 2JD5A 5DHJA 5C27A 4D58A 2XJ2A 3BHVA 3GOPA 3H0ZA 3UGCA 3I0QA 3HAMA 4YZNA 4AE9A 4O7ZA 4ACDA 1URCA 2PVKA 3NLBA 3OZ6A 1TVOA 4S34A 4DH3A 3H4JA 2X4ZA 5I9YA 5LVPA 3V3VA 4HVDA 3UNKA 3W2SA 3F9NA 1Q3DA 2OIQA 3V6SA 2VTOA 3LVPA 1BLXA 4FZ7A 4AU8A 4TRLA 3ZDUA 1H26A 3L9NA 3THBA 4O6EA 4FGRA 1APME 2EXEA 2QG5A 4WNOA 4B8LA 4S32A 3KMWA 3RJCA 3F61A 4PRJA 4WSQA 3PPKA 5JRQA 4GEOA 4D4RA 3OXIA 4FOBA 3LXKA 3Q60A 5ETCA 4DC2A 3AOXA 3SC1A 2PVMA 3FC2A 5CTPA 3ZO3A 3N51A 3U9CA 4WG4A 2CGUA 2R3JA 4EH4A 4YGAA 3ACKA 4EC9A 4F9BA 1BL6A 3MTLA 4M68A 3G5DA 2PMNX 3EKNA 3LFFA 4BDIA 5HD4A 2IW9A 4DN5A 2CPKE 4CQEA 2P4IA 3QQJA 2GFCA 3GC7A 5CU6A 5FD2A 5I5ZA 4EOSA 1XH4A 5FLFA 4EUUA 4L6QA 3ANQA 5BYYA 4TXCA 3PFQA 4J7BA 1R39A 3MFSA 2ZOQA 3QGWA 3KN5A 5AX9A 4U6RA 5JZNA 4RWLA 3EB0A 4IVAA 2A4LA 2UZNA 3RAWA 5DH3A 2B54A 3FMHA 4K9YA 2I0EA 4KKHA 4EOQA 3VUIA 4QYGA 2CHLA 5ETIA 4FT3A 4L42A 5EI6A 2BZJA 2YERA 4GS6A 2YWPA 2VX3A 4IZYA 4DGLC 3GQLA 1J7LA 1OBGA 4RVLA 4CKRA 2UZDA 2VTHA 1E9HA 5EHYA 2XRUA 4FV7A 4JAIA 4DITA 3VO3A 2VTMA 3O71A 3M42A 4FSMA 3C9WA 3EQFA 5IQBA 2ZMCA 4NTTA 4HYSA 4W4WA 4PL3A 5EYMA 1WBWA 4DEHA 3ZLYA 5AAEA 3WYXA 5ANIA 2X9EA 3HV3A 4JR3A 3SGCA 4FKOA 1BYGA 4XNEA 4MXZA 4I4EA 4AE6A 4C4HA 4IAYA 4L3JA 5HBHA 5L6PA 3T9TA 5HCXA 2W0JA 4UMQA 4BZNA 3QCSA 4CT1A 4O0YA 4TYHB 2PUIA 3EYHA 3QTIA 4KBAA 4Y85A 4JIKA 5HIEA 4NK9A 4F08A 3TNIA 4F7JA 4ZLOA 2WTDA 2GFSA 3VF8A 2PZYA 2R3HA 4YJNA 3TG1A 3PP0A 3HMNA 2QO9A 3WE8A 4BRXA 4F64A 4DAWA 1FVRA 1Z57A 3VS5A 3OROA 4YUQA 3DBEA 5AR8A 4BCJA 4QMVA 5L8LA 2CCHA 2OLCA 4YZMA 4YLKA 4G2FA 4GU6A 3AD5A 1J1CA 1J3HA 1RQQA 4FV5A 5I0BA 4UYAA 4DFUA 4LMUA 3W1FA 5AP6A 2Q0NA 4KAOA 4UALA 1MQ4A 1JLUE 4X6QC 4XMOA 2W9ZB 1H1PA 2VZ6A 3C13A 3HV4A 4MEDA 4U44A 5GJFA 2IWIA 5HCYA 4CXAA 2W5HA 3PJCA 4L01A 2RL5A 4K1BA 2YA9A 2QOCA 2Z7LA 4YMJA 4BI2A 3ALOA 1PF8A 2OH4A 2CN5A 3QA8A 3VF9A 3Q9ZA 2PZRA 4JX7A 4R3RA 3U8WA 4AAAA 5IZFA 1Y57A 2GS7A 2VTRA 4L00A 4MQ1A 1W8CA 4HVGA 4USEA 5TO8A 1SYKA 3L8SA 1OUKA 3H9RA 2OFUA 3EQHA 5IUIA 1SVGA 3LFNA 1QMZA 5KBQA 2LGCA 3HDNA 4FTIA 4ALUA 5IISA 5EHLA 4WNMA 5DRBA 4GK3A 4G6LA 5KMJA 3QD0A 1CTPE 4C4JA 2PUUA 1BI8A 1VJYA 4NKSA 4F9CA 4FIFA 4GFGA 4Q5HA 2BTRA 4DFLA 5CF8A 2VV9A 2VWYA 4JT3A 4QP9A 4AZTA 1ZARA 2GU8A 1ZZLA 1B38A 1JKLA 1QPEA 1B6CB 4PNIA 3QKLA 5BYLA 4YU2A 2BMCA 4FT7A 4C62A 2X8DA 3ZC6A 3OBGA 5H2UA 3SDJA 3UIUA 2VWVA 1XH7A 3FKLA 3LCTA 3LOKA 4FTMA 3HL7A 4ZAUA 4ANQA 4AZWA 2PE0A 4QMLA 4I6BA 5AIRA 5EW8A 2FVDA 5EM8A 3OEZA 4YBJA 3DAKA 3HUCA 4EOLA 3JXWA 3G9NA 4FTAA 3E3PA 2NO3A 3PY1A 4ZEGA 4BGHA 3FMNA 3KRRA 2XM9A 3R7YA 1LUFA 2VO7A 5A3XA 5HLWA 1YVJA 4BDBA 1OM1A 1S9IA 2C6TA 3FZTA 3NZ0A 4LUDA 4EBVA 2YLEA 3VUMA 4JL9A 2W5BA 3OFMA 2FH9A 3ZBFA 4DEEA 3AG9A 5BUIA 3PPJA 2ZAZA 4UWBA 3HA6A 5CENA 3WF7A 4JX3A 3BCEA 3BQRA 2X7OA 3EQBA 1M2RA 2R2PA 4CZUA 3DGKA 3HP5A 3FHIA 4GUBA 1YI6A 4RC3A 2YZAA 4F7SA 1QPCA 4MF1A 3L1SA 2C30A 4HOKA 2XS0A 2BALA 2FO0A 2PTKA 4WHZA 3W8QA 5BVNA 3OY1A 3FMMA 4V05A 3TUBA 4S33A 3QC9A 3I0OA 4JVGA 4TKSA 2FYSA 3UBDA 5ETFA 4NM3A 5D12A 2DQ7X 2XB7A 3KB7A 4TL0A 1ZOGA 4GFMA 3ZUUA 3V5PA 4ANLA 2JIUA 3KL8A 1L3RE 4CD0A 4MNEA 1XKKA 2W1EA 4JDJA 4XYFA 1TQIA 2WTVA 4AQCA 1JSVA 3ORKA 2NPQA 4ZJJA 3AMYA 2B9JA 1SM2A 5CU3A 4BGGA 5H8GA 2VTTA 4KINA 2C69A 3ZUTA 4AF3A 1QCFA 4QMQA 5AP3A 1MRVA 3PZEA 4O22A 1LP4A 3U54A 2HY0A 3V6RA 4FTQA 1M2PA 4IM3A 4QMOA 3DDPA 4RVTA 5CAOA 3EIDA 3BEAA 1KWPA 4C59A 4R7IA 3ZCLA 5CEOA 2V5QA 3K3JA 5FWKK 2EB2A 3ZLXA 1ZY4A 2OJJA 2W99B 3C4FA 4DGGA 4U9AA 3P7BA 3OXZA 3PIYA 2AYPA 3F7ZA 3NIZA 3UPXA 5DEWA 3C4EA 3CE3A 4U5JA 4B0GA 4KRDA 3NUUA 4V01A 2P0CA 4AS0A 2OIDA 3KFAA 4JLCA 4OTIA 4EJNA 3D83A 4KS7A 5D10A 2BAQA 3QHRA 4NM0A 5HG7A 4PNKA 3F3UA 4FTCA 4RRVA 4XOYA 4RX5A 1OKVA 2ITOA 5CEKA 4LGHA 1PRYA 3SXFA 5DGZA 5HLNA 3ET7A 4LM5A 5J5TA 4FVRA 3PVGA 5ANOA 4ENXA 4IDTA 2WELA 3GU7A 4GK4A 2VO6A 5EHOA 5GHVA 3RM7A 3IDBA 4Q9ZA 3PRFA 2OZAB 5DI1A 4RT7A 1JKSA 5IQHA 3GCVA 1YWRA 4ZK5A 3H10A 4YJSA 1FINA 4FIHA 4JRNA 3BKBA 3P9JA 2CLXA 3NR9A 1ZZ2A 1SVHA 2H9VA 2WTKC 4PPBA 4EQMA 4IACA 1JQHA 2ACXA 2WU6A 4KKEA 3ORIA 5KMNA 3MVJA 1XR1A 3CJGA 4PX6A 3FQEA 2C4GA 3EOCA 4E4MA 4HW7A 2VTPA 4XHKB 5H8EA 3PG1A 3UVPA 3W2CA 4CKIA 4QTCA 2C0TA 4G3FA 4ZSEA 2X9FA 3UP2A 4R6VA 4D55A 2CKQA 3HAVA 5CQWA 4NU1A 3D94A 1Q5KA 4GVAA 5E8VA 2G9XA 4KRCA 1CKJA 4XBUA 4D2WA 4O7RA 5K5XA 2IVTA 1H8FA 2UV2A 3F2RA 3Q4CA 2PHKA 3DLSA 3LFQA 1PMNA 4BWXA 4LOQA 5HO8A 1PXNA 2QLQA 3ORNA 4GIIA 4I20A 4X6RA 2RFNA 4XP0A 3FDNA 2X8EA 3QQFA 2BZKB 4D4YA 5TOZA 1YOLA 3CD3A 2HWPA 3RPRA 5C4KA 3ORTA 2VTJA 1LEZA 4FVPA 3SX9A 2ITTA 5DR2A 1T46A 3OUNB 4J8MA 3RHXA 3R01A 4RSSA 5FDXA 3ZRLA 5JQ8A 4I24A 2BTSA 4TYJA 2XIYA 2C5OA 3DK6A 1GY3A 2XK9A 3OS3A 3QRKA 1SMHA 3QWKA 4HYIA 3LPBA 3S95A 5A54A 3BLHA 5DNRA 4KIPA 3W2RA 4KD1A 2QKRA 5HKMA 5AEPA 4TW9A 4DF3A 4USDA 3KRJA 4X3FA 3GC9A 3EFWA 3Q5ZA 3FLSA 4FC0A 2F9GA 3LLTA 2R3MA 2XUUA 4FV8A 3MESA 4KB8A 5CNNA 4BWKA 2OG8A 4ZTLA 4BCPA 3FV8A 5D9HA 5I9WA 4B9DA 3E7VA 4WD5A 3RALA 5HOAA 3NAXA 2Z60A 2OKRA 5AUTA 5EI8A 3TTIA 3W10A 1OL6A 2BRMA 2QO2A 4AXAA 3R8VA 4CMOA 5IUHA 4ASEA 3GB2A 1VR2A 2ITXA 3KXZA 3QX4A 4BICA 3OCSA 4GG7A 5C26A 4FZ6A 4YLLA 4JJRA 5A4QA 5IQCA 3JS2A 1JKTA 4HPUE 5GINE 2JBOA 1URWA 4C4IA 3QCYA 4W9XA 5HBEA 3G51A 5CU2A 3MV5A 4FEQA 4FSTA 1H1WA 5JRSA 1PXIA 2P55A 1YOJA 2EXMA 3CEKA 5CU4A 4OBPA 4ASXA 5CX9A 2W7XA 2RIOA 2PULA 1Q8YA 4ZP5A 3VBTA 3BHUA 4IZAA 3GCUA 2XK3A 4RVKA 4O0RA 2R5TA 1RW8A 2DYLA 4NT4A 4QMTA 3FMKA 4LMNA 3RI1A 3KVXA 4V0GB 4EYJA 5CWZA 4C36A 5AV2A 3Q9WA 3EQDA 3U4UA 4XG2A 5KHXA 5HQ0A 5DYJA 3IS5A 3OWJA 4IX3A 3DFCB 4UXLA 3D15A 3UNJA 1IEPA 4E6AA 3MVMA 4CFWA 4JG8A 1V0BA 2YDKA 3FYKX 1Q8TA 4FUYA 5KNJA 1H4LA 2ONLA 4BWPA 4ZZNA 4LQMA 3DPKA 2VTLA 3ZM9A 4R3CA 5EH0A 5EI2A 5EG3A 1MUOA 3NX8A 4GW8A 4AX8A 2O5KA 2XIZA 3BHHA 2YAAA 4DCAA 1STCE 1PMEA 3A7GA 2YIXA 4F09A 3DT1A 4CTBA 3BZ3A 4O0UA 2BDJA 2PK9A 5E8WA 3V8SA 2O65A 3F5UA 3O2MA 5L8JA 2WMSA 2A0CX 4J96A 5EYCA 3OCGA 2BDFA 4IM0A 4ITHA 3CKWA 3MPAA 3CY2A 4C38A 4L53A 4OT5A 3PUPA 4PL5A 1UU3A 3ENMA 3FPQA 2XNNA 4H3QA 3IW7A 4QMWA 2E9NA 4GUEA 5CSWA 5AR7A 3RNIA 2Y9QA 2ZDUA 3QTWA 3QAME 5DVRA 4H3BA 4CFNA 5AA8A 4QMZA 5KZIA 3LQ3A 5LMKC 4G31A 4G3GA 4OAUC 4QP3A 4GYIA 3CLYA 5IA2A 4HCVA 3AC1A 4BN1A 1W84A 4E4LA 4NW6A 1QPJA 2XBJA 3E3BX 3O7LD 3ZLWA 4O0XA 4XRJA 1H1QA 3BQCA 4U8ZA 3I5NA 5HIBA 4L52A 5D1JA 3DU8A 4ZJIA 3TKHA 2IVUA 4M69A 3R2YA 4IWPA 2ITVA 3FMDA 1H07A 1PKDA 3BIZA 2V62A 4JDKA 4L45A 3AMAA 4DGOA 4IB1A 2X6DA 5FXRA 3HRFA 2GNFA 4FIEA 3EQPA 3UPZA 3LM5A 2QOFA 3VUDA 4TT7A 4DBNA 3DA6A 5DA3A 3DK3A 4DEDA 3VUHA 1GIIA 4KIOA 2C5XA 5KCVA 4QPMA 2Z7SA 3BYUA 5E1SA 5DT0A 4AA4A 5JEBA 3COMA 3DTCA 3EZVA 3OBJA 2J0KA 4MXAA 3KN6A 4RX8A 4YNOA 4CEGA 5JGAA 2VTIA 1SZMA 3U9NA 3RKBA 2WTCA 4DLJA 1SNUA 5DWRA 4TNDA 1YXUA 1LPUA 4K2RA 4J98A 1YHSA 4TYEA 3UC4A 2C6IA 3WIKA 4NEUA 4AG8A 5CASA 2VTQA 4XJ0A 3FC1X 4IWOA 4RA4A 3FI4A 3TNHA 3V5LA 2YM3A 1JWHA 4IAAA 4G6OA 2WTKB 1FBNA 3QKMA 4FTOA 4NZWB 3UP7A 1UU9A 2BZIB 4QPSA 3BYVA 4O2PA 3NUSA 1YRPA 4JBVA 4E7WA 4MXOA 3KCFA 4I3ZA 3ROCA 5E8ZA 3ODZX 3OEFX 3C0IA 3JYAA 3P78A 4NW5A 3PG3A 3O0GA 2QHNA 4RJ6A 3UOJA 4CV8A 2HK5A 2B9IA 3QWJA 2VTSA 3ZEPA 4QMNA 4YPDA 4EC8A 3EQCA 3IW5A 4HVSA 3L8VA 4J95A 2BVAA 4BDAA 4O1PA 3GCSA 4I0SA 5CI6A 5TR6A 3TI1A 5CF6A 2ZV2A 5AUUA 2F7EE 2WOTA 4YJQA 3R8LA 3LJ1A 2WPAA 3V5WA 5ACKA 2IZRA 1F0QA 1WVYA 3TZ8A 4DG0E 2B52A 3COHA 2J0LA 5DFPA 3LFEA 4L7FA 3I60A 5DPVA 4RIYA 4C4GA 3BLRA 1ZY5A 5CVHA 2OU7A 4C34A 3H9OA 2WEIA 2WQMA 4U42A 2W05A 4RIWB 1OIQA 5E90A 5CU0A 4RWIA 4C33A 4ENYA 4X2GA 5E8TA 5KMKA 1WBPA 1XHAA 2NP8A 1OL5A 2W1HA 4FSZA 2Z2WA 2WGJA 2PSQA 3KA0A 3QTXA 4HNIA 4IVCA 2XYNA 5CEPA 3BI6A 4AGWA 1PHKA 2OI4X 4IDVA 3GVUA 2XF0A 5D7VA 5KUPA 3PVUA 4UMUA 1G8SA 3F5PA 1A48A 4N57A 1XBCA 5C03A 2OF4A 2P33A 4F9WA 3ZXZA 4QPAA 2C1AA 3ALNA 3DLZA 3QYWA 4OT6A 4ZY4A 3K54A 3ZO2A 2GDOA 4S31A 4TPTA 4D4VA 1VYWA 4BKJA 5M08A 3TWJA 3NYXA 4NTSA 4YTCA 2WOUA 5F4NA 4Y5HA 4L8MA 1HOWA 3LCKA 3P0MA 3PIXA 5HTBA 4ZXTA 3VC4A 4A9YA 2V22A 1HCLA 4RZVA 2C3JA 3OCTA 5HO6A 3E64A 3FQHA 1KOAA 1DI8A 4TYGA 4ZTSA 1H01A 2REIA 2X39A 3TXOA 2WMWA 3P5KA 4OTPA 5CVGA 4CZYB 2PZIA 4MD9E 4TN6A 2OK1A 4RFZA 4IX4A 4ZTQA 4AFEA 1PW2A 2WD1A 5BVWA 5L6WL 4NIFB 1UV5A 3R7GA 4JS8A 2F7ZE 1K9AA 1R0PA 1SNXA 2BUJA 3OY3A 2CJMA 4C61A 3LAUA 3GU5A 4L43A 5AP2A 3BU3A 5AV3A 2XKCA 3ORXA 5KZ0A 4GSBA 4C7TA 2ZDTA 4DT8A 3GCQA 5KX8A 4CMUA 3EQGA 1OVEA 2IVSA 3DJ6A 4O0VA 3SOCA 2BAJA 4TYHA 4FBXA 2UZLA 3QQGA 2R3KA 2X0GA 2Y4PA 3OOGA 2OZOA 3W18A 2W4KA 3ZYAA 5JMSA 4M0ZA 4FG8A 5FEQA 4WKQA 4I6FA 2IPXA 3ZM4A 2XCKA 4MD7E 4EOMA 3CSVA 2OH0E 3A4OX 4PPAA 2OJFE 5HICA 3SV0A 2VTAA 4BIBA 3KRWA 4DEGA 2PMOX 4I94A 5HIDA 4L3PA 3N9XA 1W83A 5B2MA 4NCTA 4ZJVA 2QLUA 3PSBA 4BDHA 4FOCA 2WEVA 2F7XE 5EW9A 5HE2A 1UWHA 4UMPA 1VZOA 2J9MA 4FMQA 4UEUA 4X2FA 4IAFA 4IE9A 4JXFA 1ZWSA 3EYGA 1WBOA 3BX5A 3BGPA 3TL8A 3UYTA 3VBWA 4EK4A 5J1VA 3VJOA 3DBCA 4E5AX 3RAHA 3T9IA 3E5AA 3TV7A 3VS2A 3JY0A 3SKCA 5K9IA 5CI7A 4R1YA 2JDOA 2F57A 4D1XA 4YC8A 3Q96A 1DAWA 4X3JA 4QD6A 5KMIA 4RFMA 4B4LA 5AM7A 4HZSA 3FJQE 3R9RA 3MFUA 4XV1A 3UNZA 1EH4A 4BB4A 1PXJA 4TTHB 2CNVA 2E2BA 3E62A 2O63A 4AT3A 3KMUA 4PTEA 4ZIMA 3V5QA 1KE5A 4AZSA 4AZEA 4E6CA 5L3AA 3CJFA 2PVJA 2C6MA 3F3TA 3VHKA 2R3FA 4PP9A 1WVWA 2VWWA 2RGPA 3DJ5A 3F5XA 1Y8GA 2HW7A 3DFAA 4FTRA 3OCBA 4IB5A 5CLPA 2PPQA 4E6QA 3HGKA 2XNPA 1W7HA 2WQOA 3SRVB 3NNUA 2XH5A 4J71A 4M8TA 5HG8A 4FIJA 4O83A 3VBQA 4GV1A 4U3ZA 2YAKA 3OT3A 5DRDA 5TT7A 1ZYCA 3RK7A 1K3AA 1UU7A 3W2PA 5AV1A 4YHFA 1WBSA 3PVWA 3F3VA 3R2BA 5FP6A 3QKKA 1BI7A 1GZNA 2WFYA 5E9EA 1OKYA 5AV4A 4MTAA 1U4DA 4GL9A 5JFVA 3B2WA 4BDCA 5DIAA 2ZJWA 3O51A 4L44A 2WTWA 3R7IA 3RPVA 3G9LX 3QC4A 5IQIA 3QCXA 4HVIA 4FKLA 3FUPA 3EWHA 3MWUA 4AZFA 1GOLA 5JFXA 5CQUA 3REPA 5FQDC 3IW4A 2WKMA 3P79A 2OICA 4ZSLA 3ZRMA 5K4IA 4P5ZA 3HDMA 4Y95A 5AWMA 4A4XA 5M4FA 1Y6BA 4RA5A 4JIAA 4F7NA 3OUKA 4PP7A 5BPYA 5GNKA 2EWAA 2QNJA 4FV6A 4ACHA 2UZVA 1U54A 4B8MA 4ACMA 4WA9A 2BR1A 4EK3A 5HVJA 4ERWA 4YLJA 2OJIA 4X2KA 2X2MA 3HV5A 4DCEA 4F9AA 5E91A 2PVYA 4RQKA 1K2PA 3F66A 5EM5A 4ZY6A 1ZYDA 3F6XA 4D5HA 1GZ8A 3CXWA 3LFCA 4C0TA 2I6LA 1IG1A 3ZFXA 4JI9A 3LJ0A 1YOMA 4RIXB 4ANNA 5A6OA 1YXTA 4O0SA 2ITZA 3DCVA 3WZDA 3FI3A 3I1AA 4QT1A 3Q4TA 2XIRA 4F1TA 2JAMA 3EN9A 4PQNA 3LQ8A 5JFWA 3NW5A 5D7AA 5FP5A 4FYOA 3VS0A 2VWIA 2WTIA 2QURA 4FKUA 1KV1A 1UKHA 3MB7A 4K33A 3TTJA 3FEGA 3V8TA 2V7OA 4DH1A 4J8NA 5KMOA 2C5YA 2OF2A 3FY2A 2ETMA 3O8PA 3R1QA 1CSNA 3DQWA 4O7TA 2PVNA 4K11A 1YHVA 3M1SA 4W4XA 1ATPE 4W8DA 1V0PA 3WF6A 2VU3A 2IJMA 3FLNC 4D2SA 2KTYA 1U46A 3KXNA 3C7QA 3ZXTA 3NEWA 3R9HA 3BE9A 3AD6A 1YW2A 3BPRA 4CCBA 2RF9A 5M4CA 3AD4A 3DNDA 4QNAA 3WF8A 4L46A 1XQZA 5AX3A 4DGNA 5AP5A 3IK3A 5EKNA 3DDQA 5BVDA 2ZV9A 2W1FA 2XIXA 3QD3A 4B6LA 1IR3A 4ZTRA 4ORKA 1OKWA 4RC2A 3MW1A 4O0TA 1WZYA 4W4YA 4FF8A 4XG4A 3VWAA 2W1CA 4EORA 3SXRA 3HZTA 4C4FA 4DFNA 2BKKA 3M11A 4O6LA 3EL7A 3VS7A 3D7TB 4FNYA 1V1KA 3K5VA 5CSVA 4BTMA 1IASA 4JOAA 1P14A 3GUBA 5HCZA 5FEDA 2OFVA 3NMUF 2CMWA 2JDTA 3RZFA 3UDBA 3DBFA 4QMYA 4BY9E 4WNPA 2UW8A 4FEWA 4KABA 4FUXA 4EH3A 2R3RA 1QL6A 2C68A 3DAJA 4FTKA 1XO2B 3ZOSA 5CF5A 3RK5A 2J2IB 4IJ9A 3PLSA 3T8OA 3UOKA 3QRJA 1OI9A 4G1WA 1R1WA 2E9VA 3WBLA 5CAUA 5A46A 2GHMA 3PE2A 4BCMA 4KBCA 5AA9A 4LUEA 1R78A 3ETAA 3ELJA 4WUAA 1M52A 3GBZA 4P90A 4UWYA 3AC8A 3ITZA 3QZFA 3R71A 4O1OA 3KCKA 4Z55A 2UW7A 4MBIA 4KWPA 3ZLSA 4CTCA 4EKLA 4ZMEA 3AQVA 1OITA 2UZWE 5EW3A 5IMEA 5KO1A 5LWNA 3UQCA 3GGFA 3MH2A 4U43A 5FTOA 4AW5A 2GPHA 4WSYA 5ANGA 3GU4A 2R7IA 5EOLA 3MIAA 3ZO1A 5J79A 4YBKA 3UVQA 1M17A 4C3FA 5KKRC 4DEIA 4PMTA 3CTHA 2P2HA 3HECA 2YISA 3KEXA 3RAKA 2YWVA 4EZ3A 4KUJA 3PJ1A 3QHWA 4H58A 4FICA 1PXMA 2VO0A 3L9LA 4YZDA 4LL0A 4PL4A 3C0GA 3MJ2A 1I44A 3GFWA 4HYUA 4MNFA 4Z9LA 5AFVA 5IG1A 2ERZE 3TM0A 4D4SA 3E87A 3QL8A 1OPKA 2C1BA 2JFMA 5M53A 3DJ7A 2ZM4A 3KULA 3SLSA 1NT2A 1CMKE 2OBJA 2YIRA 3BELA 3PXZA 4MAOA 4DHFA 2OW3A 4V04A 1GIJA 2AC5A 4BBEA 1P2AA 1MP8A 3PVBA 5JFSA 2Q83A 4BGQA 3DXNA 4FL3A 3II5A 3C4CA 3EH9A 4XP2A 1M14A 3R8PA 4PDPA 1OB3A 3ERKA 3LQ5A 2QONA 2XP2A 4D1SA 2W1ZA 4DH7A 3R7OA 4GU9A 3BGQA 4QYFA 4IADA 2IZTA 1YXXA 4DTKA 4EL9A 4FTJA 5M55A 3HVCA 1WBTA 2JDSA 2QODA 5A4CA 4YZCA 4MX9A 2WXVA 3IECA 1BL7A 4I5HA 4IC7A 1CDKA 4PMPA 1WCCA 5LWMA 4BCQA 1H27A 1DAYA 2C3KA 4FG7A 5IH6A 1H0WA 3D5UA 3C4WA 5FM3A 3R30A 2YDJA 1H28A 3MTFA 4G34A 4QO9A 1M7QA 4YTHA 1NW1A 2PUNA 3JY9A 2PWLA 1G3NA 4QTDA 5C8MA 2F2UA 3DBDA 2X7GA 1PJKA 4RX7A 5M4UA 1TKIA 3MPMA 1OGUA 3R7UA 3TIYA 2XNGA 1OIRA 3LFDA 3PTGA 2B1PA 3QBNA 2JDVA 3R00A 4R5SA 2QR7A 1NVRA 1GNGA 2J90A 3CQEA 2XJ1A 3DKCA 1NA7A 2GS2A 4FL1A 3KKVA 4FSWA 4WIHA 3DKOA 4N0SA 5DT4A 5C4LA 4MD8E 5HGIA 3BYSA 4O2ZA 2UW5A 3E92A 4E26A 2I7QA 2W1DA 4KNBA 4GFOA 5H3QA 5KE0A 5AAFA 4EHEA 2VX1A 3Q6WA 4H39A 4KA3A 3LFSA 3R8UA 3D2IA 4FL2A 5JT2A 2JBPA 2C3LA 2J0JA 3KC3A 3ENHA 3BV2A 5TKDA 3TV4A 1NY3A 3WOWA 2ZYBA 3ZMMA 2JAVA 2R9SA 2ERKA 4RC4A 1H25A 4OLIA 4QP8A 3E8CA 3BWFA 3RWPA 3G2FA 3QCQA 2XNOA 3BEGA 4II5A 4QP7A 3VUKA 4MVFA 4AGCA 4AN9A 2A27A 3CGFA 2UZTA 5C8KA 4GCJA 4XX9A 1JKKA 2XNBA 4YSMA 3TEIA 2EU9A 1FVTA 3RGFA 3PYYA 4BKZA 3B8QA 4AA5A 3I7BA 1Q8UA 3P1AA 5AR3A 4ZS0A 4F99A 2FSOX 3ULIA 1Y91A 2C0OA 4J1RA 2A2AA 2EB3A 3D4QA 3HMIA 4DH5A 4I0TA 4LFIA 5AIKA 4MQ2A 3O8TA 3A4PA 3UIMA 3NIEA 5HBJA 3DAEA 3EN5A 3QUPA 4IVBA 2JFLA 4EONA 4ASZA 5IDPA 1GZOA 1ZAOA 3R7EA 5CZHA 4I0RA 4FR4A 4X3FC 5AP1A 3BBTB 2Y8OA 2ZB1A 4G6NA 5CSPA 3LCDA 3IONA 4JQ7A 3FMLA 5DG5A 5HO7A 2QKWB 4MKCA 2ESMA 2PY3A 3LFAA 3ZZWA 4R78A 4FKGA 2Y7JA 4FV4A 5F1ZA 2UW3A 3P7CA 3VIDA 1FGIA 3FSFA 2QOIA 2O0UA 4FYNA 4FSYA 2PU8A 5CY3A 4UWCA 3FLZA 5EQEA 3W55A 1H08A 4DEBA 4Z7HA 4EH8A 4MBLA 4G5PA 4F0GA 3VBVA 2P2IA 1RE8A 4D2PA 2JITA 5HU3A 4F65A 4RBLA 5J5SA 4ID7A 5B7VA 4YJUA 2I40A 5J7HA 1U5QA 4CT2A 4GK2A 3JR1A 5DN3A 2ZB0A 3AC2A 3BBWA 3GI3A 4G3DA 4XH6A 3BU6A 5CYIA 2YCQA 3BV3A 4J97A 3HV6A 3F2NA 4EK5A 1G5SA 2VWBA 1FOTA 4KSPA 2CCIA 4LRKA 2C6KA 4F4PA 2J0MB 3AC5A 2PUPA 4IAZA 5AUVA 5FM2A 1R3CA 2ZM3A 3QTRA 4EOPA 3ZU7A 3R02A 1LR4A 3RHKA 2J7TA 4QMPA 3RP9A 5BVOA 3R9NA 2JKQA 3PXQA 5TE0A 2WMVA 2W9FB 2I0VA 3KXMA 4O38A 2QU5A 3OTVA 2ONLC 4C57A 2OXYA 4R77A 3A8XA 5A14A 3L8XA 3DV3A 3Q32A 4XG3A 2J5EA 4AW2A 4QQTA 3FI2A 4IZ5A 1PKGA 2QOHA 4MCVA 3GENA 4C2WA 1BX6A 3PZHA 2GQRA 5F20A 4FK3A 2VWUA 3QZGA 3LJ2A 4AA0A 3VS1A 1FMKA 3QD4A 3SHEA 2UZBA 2HZ4A 3GC0A 1JAMA 5I9XA 4GVJA 3AGMA 4OTDA 3P7AA 4EHVA 3Q5IA 3R1NA 1DI9A 4OTQA 3W2OA 3ZH8A 4HJOA 2FSTX 3KRLA 2P3GX 4TWOA 5KKRB 4N6ZA 3IOKA 4NJDA 3U55A 4CFXA 4F0FA 1WAKA 1L8TA 2B55A 4BCIA 2XK7A 2SRCA 2UUEA 4XOZA 5CNOA 5M4IA 1Y8YA 4JDHA 4MNEB 3KMMA 2YDIA 3IPHA 5E8YA 1Q3WA 4KIQA 4AW0A 3I6UA 2UW6A 3MN3A 5BX0A 3L9MA 2HELA 2Z7RA 4FG9A 3RCDA 4AT4A 3GNIB 4RZWA 3NNXA 1ZRZA 4CCUA 4EYMA 4KIKA 4MXYA 4K6ZA 2HYYA 4RIWA 4XRLA 4ANMA 2R3IA 4P4CA 3QQKA 3BU5A 3OC1A 4XCUA 5J1WA 3LLAA 4LL5A 1BMKA 4I93A 4RFYA 4ZZMA 3UZRA 4UN0C 2YCRA 1OBDA 2VD5A 3W33A 4BF2A 2QOBA 2XZSA 1PXOA 4CFFA 4BDJA 5CF4A 2OO8X 2H34A 4AZVA 2HZNA 5JSMA 3O8UA 2W1IA 3F5GA 4RJ5A 2ITNA 3Q2JA 3PJ8A 1OPJA 4PMSA 1LEWA 1F5QA 4BIEA 5CEQA 3OHTA 4A9TA 1UU8A 3TIZA 2WQEA 4Y72A 5HESA 4XV2A 1OKZA 2PMIA 2X81A 4BCKA 2HXQA 2QO7A 3MIYA 4NM5A 2XCHA 3DB8A 4ANSA 4CYJA 4XG7A 3VS3A 3LZBA 3PA4A 4EH7A 1PYEA 1OMWA 2G2FA 4QQCA 5HI2A 3RZBA 1YWNA 3UO4A 5D41A 4RJ8A 4EKKA 4DGMA 4O21A 4PDOA 4OGRA 5IEVA 3MB6A 2CGXA 3UIXA 2VGPA 3ORLA 4FSQA 4F6WA 3CP9A 2IO6A 3UG2A 3VBXA 2ETRA 2YJSA 2BRBA 2VNWA 3NYOA 3A2CA 3DK7A 3R04A 2UZOA 2WMBA 5FG8A 1YI4A 3VJNA 3HA8A 4GKHA 3NNVA 2JEDA 2WMRA 2B7AA 1UVRA 2HOGA 3D5VA 3QUEA 5CVFA 4IC8A 2VX0A 2DWBA 3MH0A 3Q9XA 4IVDA 4HZRA 4XLIA 2FSMX 4OUCA 5AJQA 5E8XA 5FBNC 4BHNA 2UZUE 3UIBA 1Q99A 4J52A 2AC3A 3FXWA 4YPSA 2BPMA 2DUVA 5JQ5A 3UVRA 4X2JA 4CKJA 4HGTA 5AV0A 5KMMA 5GJDA 1ERKA 5JKGA 2PZPA 4BIDA 3CBLA 3F88A 3TN8A 2FSLX 2CNUA 4EBWA 3U6JA 1NVQA 1KE9A 1KE8A 2E9OA 2GNGA 2XK8A 3HV7A 3LHJA 3LW0A 3OWKA 4FTLA 4OTRA 2JKOA 4KSQA 4U97A 2VGOA 3UMXA 2YIYA 4F1OA 1P5EA 1RJBA 3MDYA 4AOTA 3BE2A 3QTZA 4YHTA 5M56A 4X3FB 4YJOA 5DT3A 4DFYA 3VULA 4CMTA 4X7QA 4BTKA 2EVAA 2OWBA 5AMNA 1WVXA 4ZSGA 5FTGA 5F94A 4HGSA 3N4TA 3A7JA 4NFNA 4ZSAA 4R7BA 4EK6A 1PXKA 1JVPP 1IAJA 3G33A 3H0YA 4MBJA 3R7VA 3AMBA 2Z8CA 4U80A 3SG8A 1V0OA 3C5UA 3QQLA 2BRNA 4OBQA 3MPTA 5EOBA 3EFJA 5GZ9A 4JBPA 3R9OA 3NVMB 2BIYA 2XM8A 3PA5A 3CR0A 4FKQA 4A9RA 2BHHA 3FLWA 3IOPA 1RDQE 5M51A 4YSJA 1DS5A 5JN2A 4I92A 2Q0BA 5EM6A 5HVYA 1MQBA 2X8IA 1IRKA 3B8RA 1OL2A 2XYUA 2ZM1A 3I7CA 5IA4A 4IQ6A 4XEYA 5EM7A 2C5VA 4ZLYA 2X7FA 3R28A 3OF0A 4OAVB 3S2PA 4BCFA 3Q9YA 3NSZA 4WBBB 2C6LA 3ZC5A 4D2VA 4H3PA 3CTQA 3LKMA 5K3YA 3TKIA 4NYEA 1PYXA 4CSVA 3CQUA 1YWVA 5HX8A 4E1ZA 3C4ZA 1G8AA 5AADA 1DM2A 5BVEA 5FGKA 1U5RA 4ZZOA 5BUJA 3R8MA 3S1HA 3ZSIA 4P7EA 4WOVA 5K5NA 4MYGA 4RX9A 5ACBC 4D9UA 1IAHA 4EZ5A 3BHYA 3OP5A 2I0HA 4JBQA 4GJ3A 4UMTA 4HVHA 3F3ZA 3NAYA 3ANRA 4K18A 3QFVA 4M12A 3DB6A 5HG5A 3WF9A 4G3CA 4A4LA 3K3IA 4FT9A 5K0KA 4O7LA 2QHMA 3F69A 4OTGA 3S3IA 3P4KA 4MF0A 4PPCA 4AUAA 5HZNA 5LMKA 2BZHB 5H9BA 4M67A 4IEBA 3TNWA 1J7UA 1M7NA 4FV2A 4FEXA 2WB8A 2GTNA 4Q2AA 4LOPA 4RLKA 4GRBA 3QUDA 4NCTC 5AAGA 1SVEA 3CKXA 2WMTA 4CFMA 1ZXEA 4PTCA 5KBRA 4XUFA 5L2WA 4A07A 4RIXA 3UMWA 3GC8A 4LV8A 3POOA 5CT0A 5FDPA 4X0MA 4EZ7A 1XWSA 4I23A 4NM7A 4AW1A 3KXHA 3L8PA 3WE4A 2R7BA 3FQSA 4EH6A 4O7YA 5A4TA 1B39A 4DFBA 5M09A 2XJ0A 1X8BA 4FKSA 5IQAA 4BL1A 5GZ8A 3UOLA 2UVZA 4CRSA 4EJ7A 3Q53A 5EQYA 5G1XA 3NRMA 3RPSA 4DEAA 4ERKA 4X2NA 3FSKA 3V8WA 3FZPA 3EKKA 5CAQA 2OXDA 2XVDA 4KS8A 4MK0A 3FLQA 4Y8DA 5LMBA 3CD8A 2KULA 1O6KA 2QVSE 2X2LA 2AUHA 3MY5A 4WRSA 3U6IA 5GZAA 3ODYX 4WT6A 4GT3A 2BFYA 3SOAA 5C8NA 1YHWA 2PE1A 1YI3A 1ZOEA 4M69B 3A61A 4M0YA 3DY7A 4FA2A 2IW8A 5J7BA 2GQGA 2XK4A 5FRIA 4UZHA 5EYDA 1W82A 1Q61A 2JDRA 3CPCA 3M2WA 4XG9A 1GJOA 3KF7A 3LXLA 3QX2A 3AT4A 4K77A 4L3LA 3UE4A 4AGUA 4E3CA 3TNQB 2QCSA 2J0IA 4EWHA 3E8DA 4EEVA 1ZYJA 2JIVA 5LCJA 3ORZA 2YZLA 5CXZA 1AGWA 4IH8A 2XKDA 3PA3A 4EQCA 2W4JA 4YC3A 4TWNA 3U87A 4O7SA 4NSTA 4FTUA 4A9SA 3NUAA 4EH2A 5EKOA 4ZOGA 1YKRA 2EXCX 4DFZE 4FKWA 4K8AA 4YHJA 1O9UA 4HGEA 3RPOA 3EL8A 4C8BA 3D5WA 3FMEA 5L8KA 4ZS4A 5ANJA 3UZPA 3FZOA 5DOSA 3NDMA 4PDSA 3U6HA 2GNIA 3DZQA 3MA6A 5HD7A 4U7ZA 1IA8A 3I81A 2W17A 4OTFA 2ITWA 1KV2A 3IW6A 4IFGA 3RBWA 2XBAA 3LXNA 1UKIA 4FX3A 3TJDA 3I5ZA 4D2TA 2V0DA 3HMPA 2JKKA 1CKPA 3KXXA 4BI1A 5FEEA 3MFTA 3DOGA 5TF9A 3U4WA 4AP7A 2A19B 5AR4A 4EOOA 1UNHA 2YLFA 3AT3A 3F3WA 3G90X 5LQFA 4WUNA 2UVXA 1JSTA 2XRWA 1I09A 2W4OA 3FZRA 5I3OA 4BVUA 3WARA 4BBMA 5I9VA 2YFXA 1CKIA 4FK6A 5JK3A 3QLFA 3UYSA 1JPAA 2YIQA 4E93A 3U51A 4DTAA 4S30A 4LV5A 2BFXA 2GNJA 4WG3A 4C3RA 3ZONA 3IW8A 3R63A 4RVMA 4RIYB 2QOKA 5E8SA 5ICPA 2BKZA 4YO6A 5J9LA 2WO6A 4TWPA 3ATTA 3W32A 3MY0A 2BIKB 2YM4A 3FI8A 5A4LA 4IFCA 3BGZA 3SW4A 4E4NA 4U79A 2VWXA 2W96B 2CNQA 4G9RA 3UJGA 2J51A 3OWPA 4N70A 4UYNA 4BZOA 5DE2A 2R3GA 4IJPA 4MXCA 5JH6A 4B7TA 2WMXA 3FE3A 5IF1A 4FNXA 4IXPA 4FI1A 4JAJA 4IANA 2WMQA 2YM6A 4FKIA 5AP0A 1XH6A 4HNFA 1OL1A 3ZBXA 4X21A 5AM6A 4ACCA 5LVMA 5DR9A 3UODA 4GT5A 2ZV7A 5AUWA 3ZEWA 3WILA 1Y6AA 4ITJA 1XBAA 3KXGA 4JBOA 1KSWA 2WAJA 5LCKA 5EDQA 1YQJA 3SD0A 2WNTA 4EWQA 3OXTA 4EQUA 3L9PA 4LG4A 3T3UA 4Y83A 4W8EA 3TZ7A 4UXQA 3JVSA 4LRMA 3DS6A 3WF5A 5IEYA 4O91A 5H8BA 3R1YA 4EOJA 3Q2MA 2F4JA 2WMAA 2Y6OA 3WZKA 5K0XA 3NCGA 4RGJA 4AOJA 4AT5A 4O7WA 4FVQA 1H0VA 5B2LA 3W8LA 3QQUA 1FQ1B 2WMUA 2PVRA 1TQMA 1OECA 4F7LA 4BDGA 3IDCA 2VNYA 5DLSA 5CALA 2J6MA 3PIZA 2IG7A 1KE6A 3MH3A 1OIUA 1H00A 3KK9A 3TJCA 3V01A 4D9TA 4DYMA 2C0IA 3I6WA 1XBBA 5IH4A 3GXLA 5BMMA 5AUZA 4M7IA 4Y5QA 3VW6A 4BDKA 2CKOA 5M57A 2XA4A 2CLQA 2WQBA 5T6KA 5JGBA 5BQ0A 2OIBA 4R3PA 3TUCA 3SG9A 4IW0A 2WIPA 3FL4A 3ZFYA 3OT8A 1OIYA 5C9CA 4JQEA 2Y6MA 4FT0A 1WBVA 1XH9A 2E9UA 2F2CB 4JDIA 4DH8A 3D9VA 4DE4A 4R8QA 5IPJA 4GYGA 2H6DA 4U0IA 1ZYSA 5M44A 4E4XA 5IQDA 2X2KA 5LARA 3ULZA 5FXSA 2GNLA 3C1XA 3KQ7A 2PVFA 2HWOA 3EQRA 2I1MA 3PLAE 4MWIA 2R3OA 4OTWA 4QP6A 3K5UA 4QMXA 2UW9A 5ANEA 2CKPA 4RJ4A 3Q04A 2OZAA 2VAGA 4NFMA 2BDWA 3CGOA 1UNLA 2PMLX 3OOMA 2C5NA 3CIKA 3GOKA 5L2TA 4Z16A 4PY1A 3EFLA 4R7HA 2O2UA 4R5YA 4APCA 5CT7A 5AUYA 2ZV8A 3PXYA 1JSUA 1XJDA 4UMRA 3LMGA 4C37A 1KE7A 5ITAA 2QI8A 4BDDA 3UG1A 3AGLA 4JQ8A 1ZMWA 3MI9A 3OW4A 5BVKA 3EFKA 3PRIA 3KK8A 3TZ9A 4LYNA 1YDTE 1Z9XA 4FKVA 4ZLZA 2QG7A 1YDSE 4LI5A 3NCZA 2YCSA 2XEZA 4WG5A 3VQUA 3DZOA 4XG8A 5FXQA 3LMIA 4TZRA 4W4VA 1ZYLA 3D2KA 5GJGA 5HE0A 4C58A 1Z5MA 5CEIA 3D0EA 3V04A 4Q9SA 4UB7A 5HHWA 4CYIA 5DMZA 1HCKA 1YXSA 2XEYA 4APPA 4I41A 3BRBA 3QZIA 5HX6A 4RPVA 4YTIA 4FSUA 3C4XA 4CQGA 5E1EA 3PP1A 4AN3A 3OMVA 3MS9A 3A62A 3HP2A 4I21A 4PF4A 4QYHA 2WU7A 2QOQA 3OTUA 4Y46A 3UQFA 4P2KA 2R0UA 3ORMA 3ZS5A 2C3IB 4J53A 4XG6A 4L9IA 2PZ5A 4TYIA 3EN7A 4GH2A 3ZTXA 5DEYA 3PE1A 1A06A 2WHBA 5L6OA 3VUGA 4EHZA 5IH5A 5IQEA 3FKOA 1H1SA 2R3LA 3ZO4A 4E73A 1U54B 1H1RA 1O6YA 3VS6A 2BAKA 3O50A 2C47A 3IGGA 4AOIA 3LFBA 4G17A 4PTGA 3D7ZA 1XH5A 2BILB 5HTCA 4A06A 5ETAA 3IGOA 3QF9A 2RKUA 3N4VA 4MWHA 4E20A 2X6EA 4IIRA 2O8YA 3OG7A 4BCOA 5A6NA 2GHGA 5HU9A 1E1XA 1E1VA 1ZMVA 5CSXA 4JR7A 3OVVA 2RSVA 3QTSA 2XNMA 4N6YA 3TACA 4ZTMA 5FUTA 4RJ7A 5IU2A 2R3QA 5HORA 1F3MC 1WMKA 2O64A 4AWIA 5KHWA 4O96A 3AC3A 3GP0A 3NNWA 4NUSA 3MYGA 4V0GA 3FZSA 3O23A 5T68A 3VAPA 1AQ1A 5L2IA 3SW7A 4U40A 5T3QA 4XBRA 4ALVA 3S00A 4F1MA 2GMXA 4WRGA 3GCPA 4M84A 3VBYA 2JC6A 3D14A 1J7IA 2NNWB 3E8NA 4RLLA 5BUEA 5IQFA 4O84A 5A4EA 5J87A 3V51A 3MSSA 4EI4A 1QPDA 3COIA 4CVAA 3W2QA 3EJ1A 5LJJA 4HCUA 4ARKA 4FTTA 3VS4A 3V5TA 3HUBA 4D5KA 3I4BA 3EN4A 4U81A 4I4FA 5EK7A 2B0QA 3WZUA 3RINA 4A4OA 2YN8A 3NYNA 3HYHA 1JNKA 1CM8A 3FKNA 4LGGA 2QQ7A 4QOXA 4GT4A 3PY3A 4JG7A 5B2KA 4F6SA 3E93A 2Z02A 3COKA 2YCFA 3R8ZA 3VNTA 2GTMA 3H3CA 2B53A 1REKA 4QYYA 4CV9A 4IHPA 2WZJA 1GIHA 1Q4LA 4BKYA 4C3PA 3ZRKA 5M07A 3DKGA 4IM2A 4M66A 3LCSA 3VN9A 3I79A 3N4UA 2VO3A 4DG2E 2H96A 1T45A 4QMSA 4DG3E 3BWJA 3FY0A 4FKPA 4NWMA 5L2SA 2ZVAA 4QP4A 5EDPA 4EH9A 5HVKA 4DLIA 2QD9A 5KMLA 2VWZA 4IWDA 2PYWA 4EOIA 4OBOA 2IVVA 5CS6A 2QOOA 3BLQA 2G1TA 4FODA 5HE3A 4ASDA 2RFEA 3WI6A 3MA3A 3DXPA 3ZSHA 2VUWA 4QRCA 5F9EA 2CN8A 3NUXA 3CC6A 5HEZA 3GT8A 4GJ2A 3TDVA 1Q41A 3PPZA 4BI0A 2GNHA 2ZMDA 3C0HA 3LE6A 2PVLA 3JVRA 3PSDA 4NJ3A 5CXHA 4WO5A 4EH5A 1XH8A 5EYKA 1BUHA 3UQGA 1FVVA 4G16A 4QYEA 3E63A 4CG9A 4F63A 3MJ1A 2OJ9A 2UW4A 3Q6UA 4FTNA 4G5JA 3EQIA 3IG7A 4L67A 4PUZA 4QNYA 3VW8A 4FKTA 2CGVA 2JGZA 4I1ZA 4RIOA 3TZMA 4IX6A 3RK9A 2YEXA 5I9UA 1OZ1A 2QOLA 4UBAA 3UOHA 2HIWA 1OPLA 2Y4IC 5CSHA 3KREA 3F7WA 3KULB 1J91A 2ITQA 4XV3A 1ND4A 3IO7A 1ZOHA 2JIIA 2XMYA 4K0YA 4A9UA 4F0IA 4QQ5A 3PXFA 3QRIA 2I0YA 3P23A 5HNBA 2J50A 2W06A 2DS1A 5HG9A 3WIGA 2IW6A 3KGAA 4QMUA 5IQGA 4MHAA 3UC3A 3JPVA 4W9WA 5J9YA 3B2TA 4GG5A 3RNYA 1P4FA 2OGVA 4Z7GA 5E4HA 2JKMA 3A7FA 3PJ3A 4CGAA 4TNBA 2LAVA 3PWYA 3R0TA 2C6EA 3NUYA 4FV1A 4YJPA 4PMMA 3P86A 5AUXA 3RTPA 3QTQA 4HCTA 4J99A 4ALWA 2BHEA 4QTAA 4Q5EA 2O3PA 2WTJA 3C50A 4EUTA 1AD5A 4QP1A 2WIHA 1A9UA 3EN6A 3ZDIA 5GIPE 4FV3A 2BRGA 2HZIA 4YJRA 3FZ1A 1W0XC 1NVSA 4O0WA 3EZRA 3HNGA 4DT9A 1BKXA 2QR8A 3GU6A 4ZMFA 2YM7A 3TV6A 3C5IA 3A99A 4RMZA 3ORPA 5HLPA 4FZFB 4IAIA 3R6XA 3FYJX 5IDNA 3EHAA 1J1BA 4F70A 3FWQA 3TT0A 4M3QA 3KVWA 2FUMA 3E8EA 1W98A 5HE1A 3ID6C 5LMAA 4BDFA 3ATSA 4XP3A 4JNWA 5IA3A 2XKFA 3A7HA 4E5WA 1Q62A 3BYOA 4LGDA 1UWJA 3ZFMA 2HZ0A 1O6LA 3F82A 3PDTA 1KOBA 3QALE 3MVLA 4BFMA 2XK6A 2BCJA 2YACA 1PMUA 4I5PA 4PV0A 5M06A 4ZTNA 1KUTA 2C6DA 1UNGA 1MRUA 4C4EA 2RFSA 4XV9A 4BCGA 2RG5A 5E92A 1S9JA 3Q52A 3VRYA 5D11A 4EK8A 3A8WA 2NRYA 3PY0A 2YM8A 3WZJA 4R1VA 5IA1A 3RPYA 5EDRA 3G0EA 4CFVA 1PXPA 2YM5A 4FNZA 4H05A 3QA0A 4I6QA 2UW0A 3FL5A 2G15A 1OUYA 4FE2A 2X4FA 4GMYA 4E6DA 3HLLA 4FGBA 4I6HA 4NIFA 2W1GA 3VQHA 2R64A 4QMMA 4IWQA 3MH1A 5IA5A 2R4BA 4YZ9A 5IUGA 5AR2A 1REJA 3SQQA 4KBKA 1M2QA 5IKWA 5J9ZA 2CSNA 4FZAB 4XS2A 1YXVA 2C6OA 3Q4UA 5I3RA 5C1QB 4FEUA 3SAYA 2XKEA 4OW8A 3ZHPC 5L4QA 4C2VA 3ZUVA 1VEBA 5IA0A 1PY5A 3DTWA 2FB8A 5BNJA 3NW7A 2PL0A 3AC4A 4FIIA 4YURA 4YJTA 4BTFA 5I4NA 4G9CA 3NYVA 1UA2A 1OL7A 2G2IA 2QC6A 3CS9A 3DKFA 4BCNA 3MBLA 5EQPA 4BC6A 4YC6A 4HYHA 3SA0A 4U45A 1TQPA 2BRHA 4YJVA 2XNEA 2GCDA 4QTBA 3R73A 3KY2A 4GIHA 3G0FA 4S2ZA 4DBXA 3AT2A 4M14A 3R83A 2W5AA 5ANKA 3LM0A 4F9YA 3OWLA 4LOOA 4O27B 3IDPA 4E8AA 4BZDA 4QTEA 4ZTHA 2BROA 5C01A 3CCNA 3LCOA 3QGYA 2RFDA 3HRBA 4U41A 5K4JA 2VN9A 2GSFA 4AGDA 4TWCA 4XLVA 5J95A 3RWQA 3UO6A 4AACA 3IQ7A 3OD6X 5E8UA 2CGWA 4YNEA 4Z3VA 2GS6A 3QD2B 3S0OA 5F95A 3NPCA 4D1ZA 5L2QA 4FSNA 2IZUA 5LXMA 3SVVA 4P5QA 5A9UA 3NS9A 2VTNA 1VYZA 3IKAA 2B9HA 4DFXE 2ITUA 4C02A 4YP8A 4RWJA 4TY1A 5EFQA 5JGDA 4FIGA 1FPUA 4ITIA 5CAVA 2B9FA 2J4ZA 3O7LB 4IX5A 3RMFA 3FXXA 5LVNA 5DBXA 3CTJA 2JLDA 3OW3A 4CZTA 3SRVA 2IZSA 2PVHA 2YIWA 3H30A 3QXPA 1ZLTA 4NKAA 5LVOA 2OJGA 3HX4A 1FMOE 3QU0A 4IZ7A 3HKOA 4PWNA 3VUTA 4O82A 3R1SA 2CDZA 3ZSGA 3LIJA 3E7OA 5JZJA 3UO5A 3CQWA 5GIOE 4FSRA 3RAIA 3AXWA 5IMXA 3QRUA 2Y0AA 2YITA 3R22A 4FT5A 2CKEA 2J5FA 3MY1A 4O86A 4BR3A 2YJRA 1Q97A 2HCKA 3FHRA 4BTJA 4ZY5A 1YDRE 5CZIA 3ACJA 3TCPA 4O81A 4CG8A 3QZHA 4D0XA 1JBPE 4FV9A 5DR6A 4CLJA 3G6HA 5AP7A 3RM6A 2H8HA 4U3YA 2Y4IB 4YZBA 4NH1A 3QLGA 4BDEA 2GQSA 1MRYA 1U59A 2R3NA 5FTQA 3G15A 4JG6A 4KIKB 4BYJA 2HAKA 3E88A 4YTFA 3QTUA 3NUPA 3NVKI 3Q3BA 5E7RA 3VVHA 4IMYA 3Q4ZA 5CEMA 4C35A 2V55A 4CRLA 3H9FA 3CY3A 2UVYA 3P08A 3R9DA 4F6UA 4RG0A 3QYZA 1NXKA 2X1NA 3GU8A 3C51A 3PSCA 4DINA 5HTIA 4FNWA 3FAAA 3CPBA 2XIKA 4IBMA 4G3EA 3PJ2A 1WBNA 4N4SA 4EOKA 4M97A 3HEGA 3HRCA 2G2HA 1GZKA 3POZA 3G6GA 4I5CA 4ONAA 4DA5A 2YHVA 3KU2A 3FBVA 2PE2A 5HNIX 4FEVA 1P4OA 4RWKA 4UZDA 2HENA 4UX9A 3SXSA 3FXZA 4I5MA 3VRZA 3MGYA 3GEQA 1Q24A 3F2AA 3BHTA 3O96A 3O17A 5CANA 4FV0A 5BMSA 3T3VA 4BYIA 3A60A 3RCJA 1WFCA 3NUNA 4Y73A 3A7IA 4RQVA 2ITPA 5J8IA 4B99A 2QU6A 2Z7QA 4MXXA 3FPMA 4L7SA 3V5JA 4CLIA 2IN6A 2NRUA 3BYMA 2G01A 4MH7A 4M13A 4HPTE 3DXQA 1Q8WA 5BYZA 5CAPA 3DBQA 4IB3A 2EUFB 3TNPC 3TUDA 4ACGA 4PDYA 2RG6A 4EHGA 4ANOA 2A1AB 4H1MA 4D0WA 3MFRA 3WYYA 1FGKA 3QQHA 2R3PA 3KRXA 3TDWA 4H1JA 3RVGA 3W16A 5I9ZA 1IA9A 4USFA 2F49A 2HXLA 2HY81 3NWWA 5G6VA 4HGLA 4ZSJA 4UY9A 3KF4A 3LMHA 4A7CA 1GAGA 3TKUA 3PXKA 4NL0A 4BBFA 1JOWB 4LRJA 4WBOA 5FBOA 5B0XA 4YO4A 3VHEA 3PWDA 4E5BA 2HW6A 2ITYA 4KKGA 4L68A 4GKIA 2E9PA 3DQXA 2ETKA 4OR5A 5AP4A 3UZTA 2OSCA 3MVHA 4CFUA 5AR5A 4DTBA 3D7TA 1Q8ZA 3S4QA 4FZDB 4O7NA 3R21A 3FMJA 3FLYA 4ANBA 3GFEA 3D5XA 2R0IA 1R0EA 2B4SB 5BVFA 3NW6A 3HMMA 2OXXA 2FA2A 4QP2A 4QQJA 5LVLA 4AFJA 4AN2A 4I22A 4WNKA 4BHZA 4CNHA 5LOHA 2UZEA 3EMGA 5ANDA 2FGIA 3LXPA 1ZMUA 2WQNA 3NGAA 1H24A 2GHLA 4FKJA 3PXRA 3QRTA 2V7AA 5IEXA 3HMOA 4M15A 4H36A 3JUHA 5HNGA 1PMVA
chains in the Genus database with same CATH superfamily
4D28A 3WZEA 3ZZEA 4UV0A 3K2LA 2VRXA 3QXOA 4D2RA 3GQIA 3ROYA 3UTOA 4YR8A 4BCHA 4RJ3A 1PXLA 4FKRA 4IB0A 4O7VA 4OTHA 3DNEA 4JRVA 4IAKA 2YABA 2JD5A 5DHJA 5C27A 4D58A 2XJ2A 3BHVA 3GOPA 3H0ZA 3UGCA 3I0QA 3HAMA 4YZNA 4AE9A 4O7ZA 4ACDA 1URCA 2PVKA 3NLBA 3UDTA 3OZ6A 1TVOA 4S34A 4DH3A 3H4JA 2X4ZA 5I9YA 5LVPA 3V3VA 4HVDA 3UNKA 3W2SA 3F9NA 1Q3DA 2OIQA 3V6SA 2VTOA 3LVPA 1BLXA 4FZ7A 4AU8A 4TRLA 3ZDUA 1H26A 3L9NA 3THBA 4O6EA 4FGRA 1APME 2EXEA 2QG5A 4WNOA 4B8LA 4S32A 3KMWA 3RJCA 3F61A 4PRJA 4WSQA 3PPKA 5JRQA 4GEOA 4D4RA 3OXIA 4FOBA 3LXKA 3Q60A 5ETCA 2XAOA 4DC2A 3AOXA 3SC1A 2PVMA 3FC2A 5CTPA 3ZO3A 3N51A 3U9CA 4WG4A 2CGUA 2R3JA 4EH4A 4YGAA 3ACKA 4EC9A 3UDSA 4F9BA 1BL6A 3MTLA 4M68A 3G5DA 2PMNX 3EKNA 3LFFA 4BDIA 5HD4A 2IW9A 4DN5A 2XANA 2CPKE 4CQEA 2P4IA 3QQJA 2GFCA 3GC7A 5CU6A 5FD2A 5I5ZA 4EOSA 1XH4A 5FLFA 4EUUA 4L6QA 3ANQA 5BYYA 4TXCA 3PFQA 4J7BA 1R39A 3MFSA 2ZOQA 3QGWA 3KN5A 5AX9A 4U6RA 5JZNA 4RWLA 3EB0A 4IVAA 2A4LA 2UZNA 3RAWA 5DH3A 2B54A 3FMHA 4K9YA 2I0EA 4KKHA 4EOQA 3VUIA 4QYGA 2CHLA 5ETIA 4FT3A 4L42A 5EI6A 2BZJA 2YERA 2IF8A 4GS6A 2YWPA 2VX3A 4IZYA 4DGLC 3GQLA 1TFFA 1J7LA 1OBGA 4RVLA 4CKRA 2UZDA 2VTHA 1E9HA 5EHYA 2XRUA 4FV7A 4JAIA 4DITA 3VO3A 2VTMA 3O71A 3M42A 4FSMA 3C9WA 3EQFA 5IQBA 2ZMCA 4NTTA 4HYSA 4W4WA 4PL3A 5EYMA 1WBWA 4DEHA 3ZLYA 5AAEA 3WYXA 5ANIA 2X9EA 3HV3A 4JR3A 3SGCA 4FKOA 1BYGA 4XNEA 4MXZA 4I4EA 4AE6A 4C4HA 4IAYA 4L3JA 5HBHA 5L6PA 3T9TA 5HCXA 2W0JA 4UMQA 4BZNA 3QCSA 4CT1A 4O0YA 4TYHB 2PUIA 3EYHA 3QTIA 4KBAA 4Y85A 4JIKA 5HIEA 4NK9A 4F08A 3TNIA 4F7JA 4ZLOA 2WTDA 2GFSA 3VF8A 2PZYA 2R3HA 4YJNA 3TG1A 3PP0A 3HMNA 2QO9A 3WE8A 4BRXA 4F64A 4DAWA 1FVRA 1Z57A 3VS5A 3OROA 4YUQA 3DBEA 5AR8A 4BCJA 4QMVA 5L8LA 2CCHA 2OLCA 4YZMA 4YLKA 4G2FA 4GU6A 3AD5A 1J1CA 1J3HA 1RQQA 4FV5A 5I0BA 4UYAA 4DFUA 4LMUA 2X0OA 5AP6A 3W1FA 2Q0NA 4KAOA 4UALA 1MQ4A 1JLUE 4X6QC 4XMOA 2W9ZB 1H1PA 2VZ6A 3C13A 3HV4A 4MEDA 4U44A 5GJFA 2IWIA 5HCYA 4CXAA 2W5HA 3PJCA 4L01A 2RL5A 4K1BA 2YA9A 2QOCA 2Z7LA 4YMJA 4BI2A 3ALOA 1PF8A 2OH4A 2CN5A 3QA8A 3VF9A 3Q9ZA 2PZRA 4JX7A 4R3RA 3U8WA 4AAAA 5IZFA 1Y57A 2GS7A 2VTRA 4L00A 4MQ1A 1W8CA 4HVGA 4USEA 5TO8A 1SYKA 3L8SA 1OUKA 3H9RA 2OFUA 3EQHA 5IUIA 1SVGA 3LFNA 1QMZA 5KBQA 2LGCA 3HDNA 4FTIA 4ALUA 5IISA 5EHLA 4WNMA 5DRBA 4GK3A 4G6LA 5KMJA 3QD0A 1CTPE 4C4JA 2PUUA 1BI8A 1VJYA 4NKSA 4F9CA 4FIFA 4GFGA 4Q5HA 2BTRA 4DFLA 5CF8A 2VV9A 2VWYA 4JT3A 4QP9A 4AZTA 1ZARA 2GU8A 1ZZLA 1W2FA 1B38A 1JKLA 1QPEA 1B6CB 4PNIA 3QKLA 5BYLA 4YU2A 2BMCA 4FT7A 4C62A 2X8DA 3ZC6A 3OBGA 5H2UA 3SDJA 3UIUA 3O5AA 2VWVA 1XH7A 3W0QA 3FKLA 3LCTA 3LOKA 4FTMA 3HL7A 4ZAUA 4ANQA 4AZWA 2PE0A 4QMLA 3PUFC 4I6BA 5AIRA 5EW8A 2FVDA 5EM8A 3OEZA 4YBJA 3DAKA 3HUCA 4EOLA 2IEWA 3JXWA 3G9NA 4FTAA 3E3PA 2NO3A 3PY1A 4ZEGA 4BGHA 3FMNA 4AXEA 3KRRA 2XM9A 3R7YA 1LUFA 2VO7A 4QEBA 5A3XA 5HLWA 1YVJA 4BDBA 4O4EA 1OM1A 1S9IA 2C6TA 3FZTA 3NZ0A 4LUDA 4EBVA 2YLEA 3VUMA 4JL9A 2W5BA 3OFMA 2FH9A 3ZBFA 4DEEA 3AG9A 5BUIA 3PPJA 2ZAZA 4UWBA 3HA6A 5CENA 3WF7A 4JX3A 3BCEA 3BQRA 2AEGA 2X7OA 3EQBA 1M2RA 2R2PA 4CZUA 1XMMA 3DGKA 3HP5A 3FHIA 4GUBA 1YI6A 4RC3A 2YZAA 4F7SA 1QPCA 4MF1A 3L1SA 2C30A 4HOKA 2XS0A 2BALA 2FO0A 2PTKA 4WHZA 3W8QA 5BVNA 3OY1A 3FMMA 4V05A 3TUBA 4S33A 3QC9A 3I0OA 4JVGA 4TKSA 2FYSA 3UBDA 5ETFA 4NM3A 5D12A 2DQ7X 2XB7A 3KB7A 4TL0A 1ZOGA 4GFMA 3ZUUA 3V5PA 4ANLA 2JIUA 3KL8A 1L3RE 4CD0A 4MNEA 1XKKA 2W1EA 4JDJA 4XYFA 1TQIA 2WTVA 4AQCA 1JSVA 3ORKA 2NPQA 4ZJJA 3AMYA 2B9JA 1SM2A 5CU3A 4BGGA 5H8GA 2VTTA 4KINA 2C69A 3ZUTA 4AF3A 1QCFA 4QMQA 5AP3A 1MRVA 3PZEA 4O22A 1LP4A 3U54A 4BJJA 2HY0A 3V6RA 4FTQA 1M2PA 4IM3A 4QMOA 3DDPA 4RVTA 5CAOA 3EIDA 3BEAA 1KWPA 4C59A 4R7IA 3ZCLA 5CEOA 2V5QA 3K3JA 5FWKK 2EB2A 3ZLXA 1ZY4A 2OJJA 2W99B 3C4FA 4DGGA 4U9AA 3P7BA 3OXZA 3PIYA 2AYPA 3F7ZA 3NIZA 3UPXA 5DEWA 3C4EA 3CE3A 4U5JA 4B0GA 4KRDA 4DHZA 3NUUA 4V01A 2P0CA 4AS0A 2OIDA 3KFAA 4JLCA 4OTIA 4EJNA 3D83A 4KS7A 5D10A 2BAQA 3QHRA 4NM0A 5HG7A 4PNKA 3F3UA 4FTCA 4RRVA 4XOYA 4RX5A 4I6LA 1OKVA 2ITOA 5CEKA 4LGHA 1PRYA 3SXFA 5DGZA 5HLNA 3ET7A 4LM5A 5J5TA 4FVRA 3PVGA 5ANOA 4ENXA 4IDTA 2WELA 3GU7A 4GK4A 2VO6A 5EHOA 5GHVA 3RM7A 3IDBA 4Q9ZA 3PRFA 2OZAB 5DI1A 4RT7A 1JKSA 5IQHA 3GCVA 1YWRA 4ZK5A 3H10A 4YJSA 1FINA 4FIHA 4JRNA 3BKBA 3P9JA 2CLXA 3NR9A 1ZZ2A 1SVHA 2H9VA 2WTKC 4PPBA 4EQMA 4IACA 1JQHA 2ACXA 2WU6A 4KKEA 3ORIA 5KMNA 3MVJA 1XR1A 3CJGA 4PX6A 3FQEA 2C4GA 3EOCA 4E4MA 4HW7A 2VTPA 4XHKB 5H8EA 3PG1A 3UVPA 3W2CA 4CKIA 4QTCA 2C0TA 4G3FA 4ZSEA 2X9FA 3UP2A 4R6VA 4D55A 2CKQA 3HAVA 5CQWA 1G8JA 4NU1A 3D94A 1Q5KA 4GVAA 5E8VA 2G9XA 3ML1A 4KRCA 1CKJA 4XBUA 4D2WA 3AKJA 5K5XA 4O7RA 2IVTA 1H8FA 2UV2A 3F2RA 3Q4CA 2PHKA 3DLSA 3LFQA 1PMNA 4BWXA 4LOQA 5HO8A 1PXNA 2QLQA 3ORNA 4GIIA 4I20A 4X6RA 2RFNA 4XP0A 3FDNA 2X8EA 3QQFA 2BZKB 4D4YA 5TOZA 1YOLA 3CD3A 2HWPA 3RPRA 5C4KA 3ORTA 2VTJA 1LEZA 4FVPA 3SX9A 2ITTA 5DR2A 1T46A 3OUNB 4J8MA 3RHXA 3R01A 4RSSA 5FDXA 3ZRLA 5JQ8A 4I24A 2BTSA 4TYJA 2XIYA 2C5OA 3DK6A 1GY3A 2XK9A 3OS3A 3QRKA 1SMHA 3QWKA 4HYIA 3LPBA 3S95A 5A54A 3BLHA 5DNRA 4KIPA 3W2RA 4KD1A 2QKRA 5HKMA 5AEPA 4TW9A 4DF3A 4USDA 3KRJA 4X3FA 3GC9A 3EFWA 3Q5ZA 3FLSA 4FC0A 2F9GA 3LLTA 2R3MA 2XUUA 4FV8A 3AKLA 3MESA 4KB8A 5CNNA 4BWKA 2OG8A 4ZTLA 4BCPA 3FV8A 5D9HA 5I9WA 4B9DA 3E7VA 4WD5A 3RALA 5HOAA 3NAXA 2Z60A 2OKRA 5AUTA 5EI8A 3TTIA 3W10A 1OL6A 2BRMA 2QO2A 4AXAA 3R8VA 4CMOA 5IUHA 4ASEA 3GB2A 1VR2A 2ITXA 3KXZA 3QX4A 4BICA 3OCSA 4GG7A 5C26A 4FZ6A 4YLLA 4JJRA 5A4QA 5IQCA 3JS2A 1JKTA 4HPUE 5GINE 2JBOA 1URWA 4C4IA 3QCYA 4W9XA 5HBEA 3G51A 5CU2A 3MV5A 4FEQA 4FSTA 1H1WA 5JRSA 1PXIA 2P55A 1YOJA 2EXMA 3CEKA 5CU4A 4OBPA 4ASXA 5CX9A 2W7XA 2RIOA 2PULA 1Q8YA 4ZP5A 3VBTA 3BHUA 4IZAA 3GCUA 2XK3A 4RVKA 4O0RA 2R5TA 1RW8A 2DYLA 4NT4A 4QMTA 3FMKA 4LMNA 3RI1A 3KVXA 4V0GB 4EYJA 5CWZA 4C36A 5AV2A 3Q9WA 3EQDA 3U4UA 4XG2A 5KHXA 5HQ0A 5DYJA 3IS5A 3OWJA 4IX3A 3DFCB 4UXLA 3D15A 3UNJA 1IEPA 4E6AA 3MVMA 4CFWA 4JG8A 1V0BA 2YDKA 3FYKX 1Q8TA 4FUYA 5KNJA 1H4LA 2ONLA 4BWPA 4ZZNA 4LQMA 3DPKA 2VTLA 3ZM9A 4R3CA 5EH0A 5EI2A 5EG3A 1MUOA 3NX8A 4GW8A 4AX8A 2O5KA 2XIZA 3BHHA 2YAAA 4DCAA 1STCE 1PMEA 3A7GA 2YIXA 4F09A 3DT1A 4CTBA 3BZ3A 4O0UA 2BDJA 2PK9A 5E8WA 3V8SA 2O65A 3F5UA 3O2MA 5L8JA 2WMSA 2A0CX 4J96A 5EYCA 3OCGA 2BDFA 4IM0A 4ITHA 3CKWA 3MPAA 3CY2A 4C38A 4L53A 4OT5A 3PUPA 4PL5A 1UU3A 3ENMA 3FPQA 2XNNA 4H3QA 3IW7A 4QMWA 2E9NA 4GUEA 5CSWA 5AR7A 3RNIA 2Y9QA 2ZDUA 3QTWA 3QAME 5DVRA 4H3BA 4CFNA 5AA8A 4QMZA 5KZIA 3LQ3A 5LMKC 4G31A 4G3GA 4OAUC 4QP3A 4GYIA 3CLYA 5IA2A 4HCVA 3AC1A 4BN1A 1W84A 4E4LA 4NW6A 1QPJA 2XBJA 3E3BX 3O7LD 3ZLWA 4O0XA 4XRJA 1H1QA 3BQCA 4U8ZA 2X0QA 3I5NA 5HIBA 3TYKA 4L52A 5D1JA 3DU8A 4ZJIA 3TKHA 2IVUA 4M69A 3R2YA 4IWPA 2ITVA 3FMDA 1H07A 1PKDA 3BIZA 2V62A 4JDKA 4L45A 3AMAA 4DGOA 4IB1A 2X6DA 5FXRA 3HRFA 2GNFA 4FIEA 3EQPA 3UPZA 3LM5A 2QOFA 3VUDA 3BL7A 4TT7A 4DBNA 3DA6A 5DA3A 3DK3A 4DEDA 3VUHA 1GIIA 4KIOA 2C5XA 5KCVA 4QPMA 2Z7SA 3BYUA 5E1SA 5DT0A 4AA4A 5JEBA 3COMA 3DTCA 3EZVA 3OBJA 2J0KA 4MXAA 3KN6A 4RX8A 4YNOA 4CEGA 5JGAA 2VTIA 1SZMA 3U9NA 3RKBA 2WTCA 4DLJA 1SNUA 5DWRA 4TNDA 1YXUA 1LPUA 4K2RA 4J98A 1YHSA 4TYEA 3UC4A 2C6IA 3WIKA 4NEUA 4AG8A 5CASA 2VTQA 4XJ0A 3FC1X 4IWOA 4RA4A 3FI4A 3TNHA 3V5LA 2YM3A 1JWHA 4IAAA 4G6OA 2WTKB 1FBNA 3QKMA 4FTOA 4NZWB 3UP7A 1UU9A 2BZIB 4QPSA 3BYVA 4O2PA 3NUSA 1YRPA 4JBVA 4E7WA 4MXOA 3KCFA 4I3ZA 3ROCA 5E8ZA 3ODZX 3OEFX 3C0IA 3JYAA 3P78A 4NW5A 3PG3A 3O0GA 2QHNA 4RJ6A 3UOJA 4CV8A 2HK5A 2B9IA 3QWJA 2VTSA 3ZEPA 4QMNA 4YPDA 4EC8A 3EQCA 3IW5A 4HVSA 3L8VA 4J95A 2BVAA 4BDAA 4O1PA 3GCSA 4I0SA 5CI6A 5TR6A 3TI1A 5CF6A 2ZV2A 5AUUA 2F7EE 2WOTA 4YJQA 3R8LA 3LJ1A 2WPAA 3V5WA 5ACKA 2IZRA 1F0QA 1WVYA 3TZ8A 4DG0E 2B52A 3COHA 2J0LA 5DFPA 4AXDA 3LFEA 4L7FA 3I60A 5DPVA 4RIYA 4C4GA 3BLRA 1ZY5A 5CVHA 2OU7A 4C34A 3H9OA 2WEIA 2WQMA 4U42A 2W05A 4RIWB 1OIQA 5E90A 5CU0A 4RWIA 4C33A 4ENYA 4X2GA 5E8TA 5KMKA 1WBPA 1XHAA 2NP8A 1OL5A 2AQXA 2W1HA 2Z2WA 2WGJA 2PSQA 3KA0A 3QTXA 4HNIA 4IVCA 2XYNA 5CEPA 1G8KA 3BI6A 4AGWA 1PHKA 2OI4X 4IDVA 3GVUA 2XF0A 5D7VA 5KUPA 3PVUA 4UMUA 1G8SA 3F5PA 1A48A 3AKKA 4N57A 1XBCA 5C03A 2OF4A 2P33A 4F9WA 3ZXZA 4QPAA 2C1AA 3KIOC 3ALNA 3DLZA 3QYWA 4OT6A 4ZY4A 3K54A 3ZO2A 2GDOA 4S31A 4TPTA 4D4VA 1VYWA 4BKJA 5M08A 3TWJA 3NYXA 4NTSA 4YTCA 2WOUA 5F4NA 4Y5HA 4L8MA 1HOWA 3LCKA 3P0MA 3PIXA 5HTBA 4ZXTA 3VC4A 4A9YA 2V22A 1HCLA 4RZVA 2C3JA 3OCTA 5HO6A 3E64A 3FQHA 1KOAA 1DI8A 4TYGA 4ZTSA 1H01A 2REIA 2X39A 3TXOA 4AXCA 2WMWA 3P5KA 4OTPA 5CVGA 4CZYB 2PZIA 4MD9E 4TN6A 2OK1A 4RFZA 4IX4A 4ZTQA 4AFEA 1PW2A 2WD1A 5BVWA 5L6WL 4NIFB 1UV5A 3R7GA 4JS8A 2F7ZE 1K9AA 1R0PA 1SNXA 2BUJA 3OY3A 2CJMA 4C61A 3LAUA 3GU5A 4L43A 5AP2A 3BU3A 5AV3A 2XKCA 3ORXA 5KZ0A 4GSBA 4C7TA 2ZDTA 4DT8A 3GCQA 5KX8A 4CMUA 3EQGA 1OVEA 2IVSA 3DJ6A 4O0VA 3SOCA 2BAJA 4TYHA 4FBXA 2UZLA 3QQGA 2R3KA 2X0GA 2Y4PA 3OOGA 2OZOA 3W18A 2W4KA 3ZYAA 5JMSA 4M0ZA 4FG8A 5FEQA 4WKQA 4I6FA 2IPXA 3ZM4A 2XCKA 4MD7E 4EOMA 3CSVA 2OH0E 3A4OX 4PPAA 2OJFE 5HICA 3SV0A 2VTAA 4BIBA 4DDGA 3KRWA 4DEGA 2PMOX 4I94A 5HIDA 4L3PA 3N9XA 1W83A 5B2MA 4NCTA 4ZJVA 2QLUA 3PSBA 4BDHA 4FOCA 2WEVA 2F7XE 5EW9A 5HE2A 1UWHA 4UMPA 1VZOA 2J9MA 4FMQA 4UEUA 4X2FA 4IAFA 4IE9A 4JXFA 1ZWSA 3EYGA 1WBOA 3BX5A 3BGPA 3TL8A 3UYTA 3VBWA 4EK4A 5J1VA 3VJOA 3DBCA 4E5AX 3RAHA 3T9IA 3E5AA 3TV7A 3VS2A 3JY0A 3SKCA 5K9IA 5CI7A 4R1YA 2JDOA 2F57A 4D1XA 4YC8A 3Q96A 1DAWA 4X3JA 4QD6A 5KMIA 4RFMA 4AAYA 4B4LA 5AM7A 4HZSA 3FJQE 3R9RA 3MFUA 4XV1A 3UNZA 1EH4A 4BB4A 1PXJA 4TTHB 2CNVA 2E2BA 3E62A 2O63A 4AT3A 3KMUA 4PTEA 4ZIMA 3V5QA 1KE5A 4AZSA 4AZEA 4E6CA 5L3AA 3CJFA 2PVJA 2C6MA 3F3TA 3VHKA 2R3FA 4PP9A 1WVWA 2VWWA 2RGPA 3DJ5A 3F5XA 1Y8GA 2HW7A 3DFAA 4FTRA 3OCBA 4IB5A 5CLPA 2PPQA 4E6QA 3HGKA 2XNPA 1W7HA 2WQOA 3SRVB 3NNUA 2XH5A 4J71A 4M8TA 5HG8A 4FIJA 4O83A 3VBQA 4GV1A 4U3ZA 2YAKA 3OT3A 5DRDA 5TT7A 1ZYCA 3RK7A 1K3AA 1UU7A 3W2PA 5AV1A 4YHFA 1WBSA 3PVWA 3F3VA 3R2BA 5FP6A 3QKKA 1BI7A 1GZNA 2WFYA 5E9EA 3W0SA 1OKYA 5AV4A 4MTAA 1U4DA 4GL9A 5JFVA 3B2WA 4BDCA 5DIAA 2ZJWA 3O51A 4L44A 2WTWA 3R7IA 3RPVA 3G9LX 3QC4A 5IQIA 3QCXA 4HVIA 4FKLA 3FUPA 3EWHA 3MWUA 4AZFA 1GOLA 5JFXA 5CQUA 3REPA 5FQDC 3IW4A 2WKMA 3P79A 2OICA 4ZSLA 3ZRMA 5K4IA 4P5ZA 3HDMA 4Y95A 5AWMA 4A4XA 5M4FA 1Y6BA 4RA5A 4JIAA 4F7NA 3OUKA 4PP7A 5BPYA 5GNKA 2EWAA 3W0PA 2QNJA 1ST4A 4FV6A 4ACHA 2UZVA 3VONA 1U54A 4B8MA 4ACMA 3W0OA 4WA9A 2BR1A 4EK3A 5HVJA 4ERWA 4YLJA 2OJIA 4X2KA 2X2MA 3HV5A 4DCEA 4F9AA 5E91A 2PVYA 4RQKA 1K2PA 3F66A 5EM5A 4ZY6A 1ZYDA 3F6XA 4D5HA 1GZ8A 3CXWA 3LFCA 4C0TA 2I6LA 1IG1A 3ZFXA 4JI9A 3LJ0A 1YOMA 4RIXB 4ANNA 1ST0A 5A6OA 1YXTA 4O0SA 2ITZA 3DCVA 3WZDA 3FI3A 3I1AA 4QT1A 3Q4TA 2XIRA 4F1TA 2JAMA 3EN9A 4PQNA 3LQ8A 5JFWA 3NW5A 5D7AA 5FP5A 4FYOA 3VS0A 2VWIA 2WTIA 2QURA 4FKUA 1KV1A 1UKHA 3MB7A 4K33A 3TTJA 3FEGA 3V8TA 2V7OA 4DH1A 4J8NA 5KMOA 2C5YA 2OF2A 3FY2A 2ETMA 3O8PA 3R1QA 1CSNA 3DQWA 4O7TA 2PVNA 4K11A 1YHVA 3M1SA 4W4XA 1ATPE 4W8DA 1V0PA 3WF6A 2VU3A 2IJMA 3FLNC 4D2SA 2KTYA 1U46A 3KXNA 3C7QA 3ZXTA 3NEWA 3R9HA 3BE9A 3AD6A 1YW2A 3BPRA 4CCBA 2RF9A 5M4CA 3AD4A 3DNDA 4QNAA 3WF8A 4L46A 1XQZA 5AX3A 4DGNA 5AP5A 3IK3A 5EKNA 3DDQA 5BVDA 2ZV9A 2W1FA 2XIXA 3QD3A 4B6LA 1W2CA 1IR3A 4ZTRA 4ORKA 1OKWA 4RC2A 3MW1A 4O0TA 1WZYA 4W4YA 4FF8A 4XG4A 3VWAA 2W1CA 4EORA 3SXRA 3HZTA 4C4FA 4DFNA 2BKKA 3M11A 4O6LA 3EL7A 3VS7A 3D7TB 4FNYA 1V1KA 3K5VA 5CSVA 4BTMA 1IASA 4JOAA 1P14A 3GUBA 5HCZA 5FEDA 2OFVA 3NMUF 2CMWA 2JDTA 3RZFA 3UDBA 3DBFA 4QMYA 4BY9E 4WNPA 2UW8A 4FEWA 4KABA 4FUXA 4EH3A 2R3RA 1QL6A 2C68A 3DAJA 4FTKA 1XO2B 3ZOSA 5CF5A 3RK5A 2J2IB 4IJ9A 3PLSA 3T8OA 3UOKA 2XALA 3QRJA 1OI9A 4G1WA 1R1WA 2E9VA 3WBLA 5CAUA 5A46A 2GHMA 3PE2A 4BCMA 4KBCA 5AA9A 4LUEA 1R78A 3ETAA 3ELJA 4WUAA 1M52A 3GBZA 4P90A 4UWYA 3AC8A 3ITZA 3QZFA 3R71A 4O1OA 3KCKA 4Z55A 2UW7A 4MBIA 4KWPA 3ZLSA 4CTCA 4EKLA 4ZMEA 3AQVA 1OITA 2UZWE 5EW3A 5IMEA 5KO1A 5LWNA 3UQCA 3GGFA 3MH2A 4U43A 5FTOA 4AW5A 2GPHA 4WSYA 5ANGA 3GU4A 2R7IA 5EOLA 3MIAA 3ZO1A 5J79A 4YBKA 3UVQA 1M17A 4C3FA 5KKRC 4DEIA 4PMTA 3CTHA 2A98A 2P2HA 3HECA 2YISA 3KEXA 3RAKA 2YWVA 4EZ3A 4KUJA 3PJ1A 3QHWA 4H58A 4FICA 1PXMA 2VO0A 3L9LA 4YZDA 4LL0A 4PL4A 3C0GA 3MJ2A 1I44A 3GFWA 4HYUA 4MNFA 4Z9LA 4QDEA 5AFVA 5IG1A 2ERZE 3TM0A 4D4SA 3E87A 3QL8A 1OPKA 2C1BA 2JFMA 5M53A 3DJ7A 2ZM4A 3KULA 3SLSA 1NT2A 1OGYA 1CMKE 2OBJA 2YIRA 3BELA 3PXZA 4MAOA 4DHFA 2OW3A 4V04A 1GIJA 2AC5A 4BBEA 1P2AA 1MP8A 3PVBA 5JFSA 2Q83A 4BGQA 3DXNA 4FL3A 3II5A 3C4CA 3EH9A 4O4BB 4XP2A 1M14A 3R8PA 4PDPA 1OB3A 3ERKA 3LQ5A 2QONA 2XP2A 4D1SA 2W1ZA 4DH7A 3R7OA 4GU9A 3BGQA 4QYFA 4IADA 2IZTA 1YXXA 4DTKA 4EL9A 4FTJA 5M55A 3HVCA 1WBTA 2JDSA 2QODA 5A4CA 4YZCA 4MX9A 2WXVA 3IECA 1BL7A 4I5HA 4IC7A 1CDKA 4PMPA 1WCCA 5LWMA 4BCQA 1H27A 1DAYA 2C3KA 4FG7A 5IH6A 5BV3A 1H0WA 3D5UA 3C4WA 5FM3A 3R30A 2YDJA 1H28A 3MTFA 4G34A 4QO9A 1M7QA 4YTHA 1NW1A 2PUNA 3JY9A 2PWLA 1G3NA 4QTDA 5C8MA 2F2UA 3DBDA 2X7GA 1PJKA 4RX7A 5M4UA 1TKIA 3MPMA 1OGUA 3R7UA 3TIYA 2XNGA 1OIRA 3LFDA 3PTGA 2B1PA 3QBNA 2JDVA 3R00A 4R5SA 2QR7A 1NVRA 1GNGA 2J90A 3CQEA 2XJ1A 3DKCA 1NA7A 2GS2A 4FL1A 3KKVA 4FSWA 4WIHA 3DKOA 4N0SA 5DT4A 5C4LA 4MD8E 5HGIA 3UDZA 3BYSA 4O2ZA 2UW5A 3E92A 4E26A 2I7QA 2W1DA 4KNBA 4JMQA 4GFOA 5H3QA 5KE0A 5AAFA 4EHEA 2VX1A 3Q6WA 4H39A 4KA3A 3LFSA 3R8UA 3D2IA 4FL2A 5JT2A 2JBPA 2C3LA 2J0JA 3KC3A 3ENHA 3BV2A 5TKDA 3TV4A 1NY3A 3WOWA 2ZYBA 3ZMMA 2JAVA 2R9SA 2ERKA 4RC4A 1H25A 4OLIA 4QP8A 3E8CA 3BWFA 3RWPA 3G2FA 3QCQA 2XNOA 3BEGA 4II5A 4QP7A 3VUKA 4MVFA 4AGCA 4AN9A 2A27A 3CGFA 2UZTA 5C8KA 4GCJA 4XX9A 1JKKA 2XNBA 4YSMA 3TEIA 2EU9A 1FVTA 3RGFA 3PYYA 3TMOA 4BKZA 3B8QA 4AA5A 3I7BA 1Q8UA 3P1AA 5AR3A 4ZS0A 4F99A 2FSOX 3ULIA 1Y91A 2C0OA 4J1RA 2A2AA 2EB3A 3D4QA 3HMIA 4DH5A 4I0TA 4LFIA 5AIKA 4MQ2A 3O8TA 3A4PA 3UIMA 3NIEA 5HBJA 3DAEA 3EN5A 3QUPA 4IVBA 2JFLA 4EONA 4ASZA 5IDPA 1GZOA 1ZAOA 3R7EA 5CZHA 4I0RA 4FR4A 4X3FC 5AP1A 3BBTB 2Y8OA 2ZB1A 4G6NA