3OROA

Mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 4)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
280
structure length
272
Chain Sequence
DRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIATAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine protein kinase
publication title Allosteric activation mechanism of the Mycobacterium tuberculosis receptor Ser/Thr protein kinase, PknB.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 272
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oroA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oroA01
3R02A 3RTPA 3HV4A 2YCQA 4HOKA 4NH1A 3NVKI 4RWLA 5IQAA 3VF8A 5BUIA 4W9WA 2PK9A 5IEYA 3ZC6A 1V0PA 4D4VA 4OT5A 4R7BA 4NW5A 3H0ZA 4GEOA 4GVAA 3RK9A 4JIAA 2X0GA 4USEA 3R04A 3F61A 5CXHA 4U79A 3O51A 4X3FB 2GS2A 2ZYBA 3VBYA 4OTWA 3VUHA 2KULA 4H3BA 3PPZA 1BLXA 2ITYA 2R3OA 2YDJA 3R63A 4RFZA 4OTIA 4P5QA 4U3ZA 4DH8A 4YJOA 4AW5A 2PYWA 2ZV9A 4XV2A 4FTMA 3DLSA 3EIDA 3ERKA 3R21A 3I5NA 4YGAA 3RM7A 3QC4A 4WD5A 5FBNC 3OEZA 3UTOA 1WBTA 2OIBA 4F9BA 2B4SB 2V7OA 2F49A 3AC8A 3A99A 3Q5ZA 1JQHA 2X4FA 5D41A 4MTAA 4YZMA 5IPJA 5E91A 5B2KA 4YUQA 1U5RA 3E93A 5CT7A 5CEIA 3WF8A 4FV9A 4C58A 3IGGA 5AUXA 2VWWA 2IZTA 5IKWA 4GG5A 4RA5A 2W1IA 4FV6A 2WHBA 4Z7GA 2XH5A 4MF1A 4WNKA 3SAYA 5T6KA 4DEBA 5IH6A 4QQ5A 4WO5A 3IG7A 3SX9A 2EVAA 3Q4UA 4H58A 5DEYA 2XKEA 4E3CA 3O2MA 5CEKA 3LCKA 5IZFA 3LM5A 3V8SA 2WMAA 4B99A 1OKZA 4U45A 4F6SA 4U6RA 3O17A 2H6DA 3W2CA 4XG8A 2IZSA 3VS1A 2B0QA 3KRJA 4DFXE 4USFA 1GJOA 4IEBA 4D4RA 2ERKA 4ACGA 4PY1A 3CY2A 4JT3A 4X2NA 5I3OA 4IE9A 3LAUA 2OK1A 2B1PA 2XNMA 3LQ3A 5AA8A 4ZIMA 3ENMA 3RWPA 4F9AA 4WSYA 3PJ8A 3OVVA 3GC7A 3R9RA 5AMNA 1OBGA 1UWJA 4UWBA 3LCSA 3LFCA 5HEZA 4BCQA 3BBTB 5J9LA 4IM2A 2C47A 2WFYA 4ZLYA 2VTIA 2QO2A 1ZYDA 2OKRA 5BPYA 2ZAZA 3JR1A 4RX5A 5HLNA 4RSSA 4PDSA 4Y95A 1RDQE 5D9HA 4D1ZA 3EQGA 4Q9ZA 3DXNA 3AT4A 3Q6WA 4FT0A 4IC7A 3DLZA 4TNDA 5HNBA 2PUNA 5IA5A 4GSBA 5E8TA 3DKOA 3F69A 3FJQE 3KKVA 3PY1A 4FT9A 2E9VA 3BQRA 4I93A 4MHAA 4O0RA 4PPBA 4OR5A 4QNYA 4YZ9A 4DT8A 2QC6A 5HE0A 4I21A 4EH2A 1JSTA 4JBOA 4I41A 2XM9A 3KXZA 2X9FA 3W8QA 2QONA 3O8PA 2X6EA 3CJFA 3KMWA 4J71A 2H9VA 2O65A 3L9NA 3VW6A 4IFGA 1Q8UA 4FZFB 5JQ5A 2WXVA 3PE2A 4WNPA 3PRIA 3P79A 5I9WA 5T68A 3QD2B 3UP2A 2YISA 2WOUA 4TL0A 3DTWA 3CJGA 4F7NA 2QU6A 2BAJA 2R3PA 4I24A 5HNIX 2GQSA 4O7RA 4IFCA 2A19B 3U6HA 3P4KA 2Y4PA 2OH4A 4FI1A 1M7QA 4YZBA 1JKTA 3R8ZA 4BGHA 4BC6A 3TXOA 4ITIA 4MXCA 3W2RA 4RZVA 3IW4A 4FNXA 2W1FA 4BDHA 4GVJA 4X2KA 3EQCA 4WSQA 5DNRA 3SQQA 3K3IA 2FVDA 4CXAA 2ITUA 3MTLA 4CSVA 4OUCA 5HBJA 3JVRA 3EN9A 5E92A 3D7TA 5IG1A 1Z9XA 2H8HA 5HKMA 3KXHA 5EDRA 4FT3A 2CCHA 1H0VA 4FE2A 2XA4A 3CCNA 4FVRA 1W8CA 3C5UA 4UXQA 4BYIA 2JBOA 4MXOA 2R0IA 4FV3A 2GHMA 5IQFA 4IAKA 4BDGA 2QLQA 5IDNA 4BBFA 4CFWA 2EXEA 2P2IA 2YZLA 5EKOA 4DFNA 5AP6A 3B2TA 2HW7A 2X8EA 3R30A 2PVFA 1BL6A 2X7GA 5DG5A 4BTFA 5BVFA 5LVPA 3BYVA 2XCHA 3UODA 1OL1A 3UMXA 1OKWA 3HEGA 1H08A 1XO2B 4FIHA 5G6VA 5DWRA 1H27A 3O8TA 2I0YA 2O8YA 4ANSA 5EM5A 5BX0A 3GEQA 4J99A 3FI8A 1UNGA 5HVKA 1OGUA 3KREA 5CNNA 1NXKA 4GYIA 5BVNA 3DB6A 4I6FA 4HYSA 3ALNA 3V6RA 3SC1A 4Y8DA 1ZY4A 3E63A 5ANDA 2ZVAA 1V1KA 4DCAA 4F63A 2HZ0A 3VS3A 4ZZNA 3ZFYA 2WTVA 3CE3A 3UG2A 4F08A 1W84A 4YJTA 2ZV2A 3UO4A 3DAEA 4C2WA 4PMPA 5DMZA 1UVRA 4AGWA 3VF9A 4AOIA 4L3LA 3DJ5A 1JOWB 3LLTA 4YLKA 4C57A 4FV8A 5A4LA 4JR7A 5EOLA 4CT1A 3BEGA 3NUPA 2ZJWA 3LCDA 3GCSA 4NEUA 1FBNA 4F4PA 3C13A 3DDPA 3PXFA 3QALE 1Q97A 4YZCA 2CJMA 3UNKA 3BWJA 3ZC5A 1PMVA 4TXCA 1JKSA 1VYZA 4FTJA 5EYKA 3GU5A 5AR4A 3VC4A 3C4ZA 4NKAA 2W99B 5EKNA 4IAZA 4HYHA 4YO6A 1QL6A 3AC2A 1IA9A 2G9XA 4M97A 2G1TA 1PMEA 3LXNA 1M2QA 3BPRA 4II5A 3KXXA 5AEPA 3SHEA 4C3FA 3C5IA 2YCFA 3D14A 3IOPA 3EKNA 2ZMCA 1FVTA 2OG8A 4GK3A 5HQ0A 3QC9A 1UU9A 3QQJA 1TKIA 4EOIA 2X9EA 4BN1A 4IB3A 4IX4A 4C4JA 5CF6A 2YM3A 2OSCA 2R5TA 2YA9A 3BELA 1RQQA 5L2IA 1PXMA 5ETIA 1ZOEA 2XIKA 4XP3A 4FGBA 3BV2A 3KMUA 1W0XC 2OJ9A 2W06A 3ORLA 1Y6AA 1B38A 2WQNA 3OY3A 4FUYA 4G34A 5H2UA 5M51A 4WA9A 2VWIA 2B7AA 3U8WA 1Z57A 4QYYA 4EYMA 4G5JA 4CRLA 1YRPA 2J7TA 2WMUA 1XBBA 3V01A 4FTUA 1NVQA 3QQFA 4HYIA 1HOWA 3TZ8A 4ENYA 1JAMA 2YABA 4WUAA 3JUHA 1H07A 4E6QA 2HWOA 5FEDA 2XEYA 4R6VA 3EQDA 3D7TB 4CNHA 2P55A 4YC3A 4I4FA 3UG1A 3WI6A 2J0IA 2WMTA 4X0MA 5E8XA 5CS6A 4G6LA 5M4IA 2R3QA 5ETCA 3RCDA 4B7TA 3UPZA 3L9MA 2OGVA 2QR8A 3TV7A 5I4NA 2QQ7A 2VX0A 1ZMUA 3PTGA 2XKCA 4L46A 1Q4LA 2GQRA 2OJGA 4XG7A 2OFVA 4U80A 4XMOA 2C0IA 3L1SA 3ORZA 1T45A 4CV9A 4IC8A 3FZSA 4EQMA 3F9NA 3PZHA 1P4OA 3DAKA 4FT7A 3RAIA 2CHLA 2I0HA 3A7GA 2PVHA 3QRJA 2GDOA 4FUXA 4IZYA 4AFJA 1Q61A 3DGKA 4NT4A 1URWA 4JIKA 3I1AA 4HVDA 2JBPA 3Q9XA 2JDSA 4TWCA 4HVGA 4YPSA 4IADA 5IMXA 3B8QA 1GZKA 3V51A 3H10A 2XUUA 3G5DA 2V7AA 3NCZA 3BGZA 3QA8A 5DT3A 4D0XA 2OWBA 4F09A 4JAJA 3IW7A 2UZOA 3LCTA 4BDJA 5I9ZA 3LKMA 4D4YA 1OBDA 3OCTA 4YHFA 1J1BA 4Q9SA 3MBLA 3LFAA 4UYNA 3TCPA 2YAAA 4R3CA 2VWXA 1NVSA 2WEIA 3HRBA 4IJPA 4FSTA 4L6QA 4RC3A 3COKA 4I0SA 4I92A 4RG0A 4L8MA 5DRBA 4B0GA 4MNEA 3F6XA 3VUTA 5HCXA 4FKOA 4ZTNA 4KUJA 2BRGA 5CSHA 3VBXA 1Q99A 2C69A 3VW8A 2W17A 4XUFA 2QOLA 1OITA 2OJIA 1WAKA 2YIWA 3QYWA 4XLVA 3CGOA 3CTJA 4KSPA 1BUHA 3EH9A 2ONLC 4NJ3A 1SVHA 4PPAA 5E1SA 4BICA 2C30A 3NNUA 1FQ1B 4U7ZA 3OT3A 2QOBA 2O3PA 2P33A 4MWIA 4YJSA 2IVVA 4EHEA 4XHKB 4CYIA 4BDCA 2C6IA 4FKSA 2AC5A 2E9OA 3I7CA 2XIRA 4EYJA 3N4VA 3WE4A 2QOHA 4M15A 1JWHA 4IB1A 2CNUA 2W5HA 1ZZ2A 4FV0A 2YN8A 2F2CB 4L00A 3VJOA 3D83A 3P7CA 3CD3A 3CR0A 2XNOA 1YDTE 4HGTA 3QFVA 3VUKA 3NIZA 3NUYA 3QF9A 3I79A 3L8XA 2Q0BA 5CAPA 1HCKA 4QP8A 3LLAA 3V8TA 3BYSA 4KAOA 3QCYA 1KE6A 4BCOA 1OUYA 3FLYA 4EOMA 4DF3A 5GJFA 4DE4A 3PJ2A 4XJ0A 3FKLA 3SOAA 3LQ8A 2IJMA 3Q3BA 4W4WA 1NA7A 5CVGA 3AQVA 4UB7A 4DN5A 4MH7A 3QYZA 1R39A 3U51A 1BMKA 4EQCA 4I5CA 5AJQA 4ZY4A 2BCJA 4PUZA 3GQIA 4FNWA 2RGPA 3E92A 4CMUA 5K5NA 1ZZLA 2HW6A 2W96B 5CYIA 2QG7A 3MVMA 4X2FA 3EFKA 2XK6A 4QP3A 4RIYA 4ZSEA 3LPBA 2ZB1A 4AZFA 3ATSA 2YERA 4CFNA 1YI3A 4FSMA 5HO6A 5AP5A 4M0YA 5JN2A 3DBEA 2BPMA 3BGQA 3LQ5A 3W8LA 1IRKA 4LGGA 4H3QA 2RF9A 3JY9A 5A4EA 1X8BA 1WZYA 2NRUA 4ALUA 3UVQA 3SA0A 4A9RA 2XRWA 3NAXA 5DOSA 4WBOA 2BRNA 3VWAA 4ANLA 3FLSA 4U9AA 2QNJA 3MJ2A 5BVKA 1YXXA 4DH7A 4U81A 2WQBA 1J91A 2C5OA 5JEBA 4FG8A 5J1VA 5M09A 4LM5A 4ZY6A 4M14A 3K5UA 1I09A 5ANKA 3O23A 4KIOA 5ACKA 5HD4A 4ZEGA 2GPHA 2QD9A 4X3FC 4MD7E 4HCTA 4I6HA 4D2RA 4PNIA 1XR1A 4RJ7A 2ZMDA 4DT9A 4J1RA 3MGYA 4MKCA 3GI3A 5AUYA 5EYMA 4D58A 3NYNA 1GIIA 1XQZA 1FVVA 5IQDA 3UOKA 3CGFA 5AAGA 2BALA 3NW7A 5FDXA 2VU3A 2YCRA 3LFSA 3BCEA 3FMKA 2ITVA 3DBCA 2V62A 5M06A 2PZ5A 1FMOE 3BX5A 4FODA 4NWMA 3EZRA 4QYGA 4X2GA 3R8PA 1R78A 4FTLA 5J1WA 5JZJA 3QD3A 2C5VA 2X2MA 4QRCA 4LOOA 4E1ZA 4O7ZA 4MNEB 5JFVA 4RLKA 1CSNA 1WCCA 3QU0A 5M56A 5HU9A 2CMWA 4OBPA 3RPYA 3EYHA 3I4BA 5EDPA 1OPKA 2IWIA 2XNEA 4EI4A 3A7IA 3KB7A 4ZTQA 5AIRA 3R1NA 4BTKA 3WZEA 3F82A 3BV3A 1SMHA 3MB6A 3C51A 3LCOA 3T3VA 2OU7A 4Q2AA 4CLIA 1JVPP 5CQUA 4AOTA 4LV8A 4U3YA 5B0XA 3TNHA 1TQPA 4EEVA 4O84A 2FUMA 3QL8A 2DWBA 2UW6A 3UIMA 2XIYA 2RSVA 4ZTMA 5AP7A 3R7GA 4QP4A 3ENHA 3HX4A 4XBRA 2P3GX 3IDBA 4MXYA 5BVWA 3TV4A 2R3IA 3BLHA 5JH6A 3FKNA 4FEQA 3HAVA 3PA3A 3TKIA 1PXOA 5IH4A 2WZJA 2NP8A 4FMQA 4QMXA 4BYJA 4D5KA 4R3RA 1MQBA 2BAQA 4PL3A 2WIPA 3UPXA 5TKDA 4E5BA 3EL8A 3CEKA 3NX8A 4HGEA 3NUSA 5IA2A 4JJRA 3BQCA 3LHJA 4IAYA 5CI6A 4BCNA 2JLDA 2PVMA 1PJKA 4IX3A 4X21A 4F0IA 2ZDTA 3FC1X 3IK3A 3IDPA 1LP4A 4U5JA 2HZNA 1UU7A 3VS2A 3FZPA 3UOLA 3HMOA 3NGAA 3COMA 3NW5A 3AC4A 4EJ7A 1O6KA 4O0XA 2Q0NA 2V5QA 5KKRB 3IW8A 2IVUA 1ZOHA 2WTJA 4GH2A 5DPVA 4RA4A 5JFWA 5E7RA 1FGKA 2VWVA 2Y4IB 4EOSA 2YFXA 4NKSA 4O0YA 2CKOA 1YI4A 2C3LA 3OS3A 3MFSA 2J0KA 3QAME 4IWQA 2W05A 4MYGA 4RIYB 4RJ3A 1KE5A 2DYLA 4A07A 4F0GA 5H9BA 4DG2E 3LFEA 4QP7A 5CAOA 3UYSA 3LOKA 4GIIA 4EH4A 3M42A 4RGJA 3C1XA 2WU7A 3P0MA 2BHHA 2R3FA 2E2BA 2HXLA 2QLUA 3QXPA 3ZO1A 3KCKA 4AT4A 3MN3A 5B2LA 5JSMA 3ATTA 4ZJIA 2JDOA 4UMRA 4B4LA 3E8EA 4O0VA 4ZAUA 2CKQA 1J1CA 4UXLA 3GBZA 3C4WA 1IAHA 4C59A 4AAAA 5AA9A 3DKCA 2BDFA 3BKBA 1J7UA 2QODA 2BRHA 5HO7A 2F57A 2VO6A 3A7FA 3K3JA 4GCJA 5CQWA 5KBQA 3CLYA 5IEVA 1OMWA 2BIKB 2XK9A 5HIDA 2IG7A 5C4LA 2C6EA 3WARA 3FZOA 3MVHA 4QMMA 3FMNA 4UWCA 1SVEA 4KBAA 4OGRA 3BI6A 3OXIA 3VBWA 2EB3A 5FBOA 3UIBA 4C4GA 1DAYA 1XJDA 3QQHA 5EI8A 1M17A 1J7LA 3FI3A 3UQCA 3COIA 3DY7A 4WNMA 4RT7A 3ZDIA 3S95A 1R0PA 4FT5A 4JAIA 2BDJA 2C5XA 2KTYA 1SM2A 3GQLA 4G9CA 3BHUA 3UVPA 3KXNA 4JVGA 1XH5A 3CC6A 2XS0A 5AR3A 3ZEWA 4U42A 2ERZE 1OVEA 2WMVA 5KZIA 3UYTA 4RX8A 4I1ZA 3FPQA 3G0EA 4XOYA 2YIXA 4FYOA 3R8MA 2R3RA 3VJNA 3UDBA 4GUEA 4F7JA 2C5NA 1WBPA 4FGRA 1NVRA 4HVIA 3UNZA 4W9XA 4PDOA 4G9RA 3LFFA 2X81A 3W10A 1MUOA 4DBNA 3QXOA 2O64A 1ZYCA 3OEFX 5EH0A 4YC6A 2BFYA 5JZNA 3SW4A 3TNWA 3DV3A 4FC0A 4BBMA 1WBSA 4LOPA 3QKMA 4Z16A 5HX6A 3V5QA 4AX8A 2YHVA 4EKLA 2RFDA 3AMBA 1KE7A 4CFXA 3DAJA 3OXZA 3U4UA 2JKOA 3R1SA 4OTQA 2PTKA 3F2AA 3OUKA 3GENA 5FRIA 4ASZA 3AG9A 3Q9YA 3PPKA 5DIAA 3UOHA 3WE8A 5JGBA 4HNFA 2QKWB 5FUTA 4A4OA 4I0RA 5HU3A 1STCE 4NU1A 4AF3A 4O81A 3QX2A 5D7VA 3JS2A 4GK2A 4IAFA 3LZBA 4EOKA 1TVOA 3DK6A 3F5PA 4WIHA 5AV3A 5J95A 5JRSA 3L9PA 3TNPC 2WQMA 4N57A 2HY81 2VX3A 2PVKA 1H8FA 3ZLWA 5M57A 3QTRA 2LGCA 2Z7LA 4JBPA 2Y6MA 3HUCA 5DHJA 5F1ZA 3CY3A 5E90A 3ORKA 3G6HA 3W16A 3G90X 2WMBA 3KN6A 2VO7A 1UKHA 4TRLA 3GB2A 2QOOA 2VTTA 3KULA 4ASEA 5AR5A 2YJSA 5H8GA 3RCJA 4KINA 5C03A 4L7SA 4BZOA 4Z55A 4ERWA 2F7XE 5AWMA 5LVOA 4FTOA 3TN8A 2YM8A 4O38A 4PX6A 1OI9A 3ORIA 4R7HA 5AP1A 2R3MA 3PJ1A 3E5AA 3PXYA 4D55A 5EHLA 3N51A 4RVKA 1PF8A 4X6QC 4AACA 3KF7A 4DINA 2F4JA 3NR9A 4YNEA 2R64A 3R71A 4GK4A 2HELA 3QA0A 5CTPA 3HAMA 5HI2A 2IVSA 4B6LA 3FMDA 2CDZA 3MW1A 4JNWA 4FEUA 5GZ9A 4BDBA 2PU8A 4CMTA 4F0FA 3T9IA 3G9NA 3Q4ZA 4ACHA 4EWHA 4FEVA 4KA3A 3KQ7A 4XNEA 4DTKA 2C0OA 1UV5A 2XNGA 5DLSA 5HLPA 1Y8YA 3JXWA 3SVVA 1ZAOA 4FR4A 4EORA 3IQ7A 5AV0A 3PG1A 3C0IA 4NW6A 5D12A 1LEZA 4IWDA 2C3IB 5CF5A 4G6NA 4PDYA 3H4JA 4F9WA 5DA3A 3H9OA 2A4LA 4GMYA 2VNYA 4X2JA 2C3JA 3BZ3A 2DS1A 4IANA 2QR7A 5ACBC 1SNUA 4XG9A 3UC3A 1YVJA 4ZOGA 4R77A 2WGJA 4AOJA 3Q9WA 4NTSA 3UGCA 4BDDA 2BUJA 3GCVA 4LRMA 4YPDA 5EI2A 3HLLA 3AD4A 5BVDA 4JX7A 4FTKA 1SZMA 3MH3A 4EZ5A 3NWWA 4TYJA 4S31A 4JG6A 2AYPA 4O7VA 2WTKB 3VRYA 5LXMA 2A27A 5A3XA 1H0WA 4QMSA 2Z60A 1YXVA 4QYEA 3FSFA 2DUVA 3FBVA 5FWKK 3F3ZA 3DFCB 4IX6A 2XJ0A 4RIXA 2ZV7A 3UO5A 5E8UA 5I9YA 4APCA 3DK7A 3A61A 4G3GA 1JSVA 3QD4A 3UNJA 2XP2A 1BX6A 3RAWA 3OG7A 3E7VA 2Y8OA 5ANGA 2IO6A 3COHA 3GCPA 3RWQA 3W2SA 3T3UA 2XVDA 3ORNA 3FLQA 2Z2WA 3OXTA 2OIDA 1XKKA 3OTVA 4IVBA 1K2PA 3KVWA 2Y6OA 4DG0E 3ODZX 4FNYA 3MPMA 4R8QA 1VJYA 3LJ2A 4QTDA 5EDQA 2GTMA 2HAKA 1YXSA 2ITQA 2XKFA 4I5MA 3QRTA 4PV0A 4E8AA 4U41A 4GU6A 4IVDA 2W1HA 4MXXA 3QCSA 5D11A 4NFMA 1XH6A 3HA6A 3PP0A 2PVYA 3WBLA 5CEOA 5TF9A 4WNOA 3QKLA 4YZNA 3MFTA 2G15A 3OCSA 5HGIA 4ITJA 5CU6A 4CQGA 4AN3A 3S2PA 3Q4CA 3VS5A 3KULB 4KIKB 3E64A 4QMPA 3AC5A 3UP7A 5TOZA 4UMPA 1YXUA 3D5WA 3VS0A 3D7ZA 3KFAA 2YM6A 2XCKA 3GCUA 3PIYA 5H3QA 5KX8A 3WZKA 4O82A 2F2UA 4RQKA 1QCFA 3TV6A 4M3QA 2YIYA 3HVCA 3O7LD 4P5ZA 4UEUA 4M69A 4C3PA 2BKKA 4YSMA 5J79A 4BCJA 3VUMA 2JIUA 3UE4A 4AUAA 4FKRA 3FL5A 5IISA 3A8WA 1Q8WA 5DH3A 4WG5A 4FKUA 3PIZA 4O7TA 4ZJVA 4FX3A 4FZAB 3H3CA 3LXLA 3QZHA 4MQ2A 4GJ3A 1PMNA 3R1YA 3HDMA 3MFRA 4BCFA 2OXDA 5DR6A 3B2WA 2WTCA 4LL0A 4QTEA 4O7LA 2GNIA 3OF0A 2YIRA 4YJRA 2R3LA 4ANMA 5BYZA 1H1QA 4I23A 4D9TA 2X4ZA 4EJNA 4W4YA 5EW8A 4DITA 5HX8A 3HDNA 4CKIA 3F7ZA 4FKGA 3WOWA 4IJ9A 1ZYJA 3CTQA 4YLLA 5F20A 3LMHA 4G3EA 5HCZA 3ZM4A 2BFXA 3FHIA 3VQUA 5AUWA 5L2WA 3R0TA 5DEWA 4O7YA 4PTCA 4NFNA 1AQ1A 1P4FA 4IBMA 4WKQA 5DI1A 4MBJA 3ELJA 4QTCA 5LMBA 4FSRA 3NUUA 3OY1A 2RFNA 4QTAA 4TWOA 4UZDA 2GQGA 2R9SA 1JLUE 4FV1A 4J8NA 1MRYA 4UMQA 4AP7A 4RIXB 5JRQA 2WMXA 2IPXA 3ANQA 4QMQA 1VEBA 2QHNA 3PJCA 4J7BA 4CZYB 5C8NA 3ID6C 4D4SA 3MA3A 2WO6A 3IO7A 1U54B 3VBTA 3OMVA 4C2VA 3EL7A 3U9CA 3KVXA 5H8BA 3DU8A 1VYWA 3ZEPA 3BHTA 1Y8GA 1YKRA 4MK0A 2F7ZE 4RJ8A 3LE6A 3TZMA 4QMYA 3DZOA 4AW1A 3V3VA 4C4FA 4FIFA 4GKIA 3VS6A 1ZWSA 4XEYA 4L42A 5AFVA 1R3CA 3SGCA 1PRYA 3DFAA 2PE0A 3AC3A 2XIZA 4RWIA 3IONA 2PVLA 2VWUA 4S33A 4DEEA 3LFQA 4QOXA 3V04A 5IMEA 5EHYA 4JXFA 5CAUA 2W1EA 1OPLA 2QI8A 3ZXTA 4CTCA 5I5ZA 2B52A 4G31A 1TQIA 4L67A 2BR1A 3GNIB 4L43A 4RIOA 4YJQA 4U43A 2OJJA 3G51A 1A48A 3GT8A 5AR2A 3FXWA 3U6IA 3PWYA 4H3PA 3QTUA 5BVEA 4AGDA 3C0GA 4FSNA 4RMZA 4CKRA 3TDWA 4R1VA 4PNKA 5GJDA 2UW9A 4IAAA 3A7JA 1UU3A 4C3RA 4H1MA 4QMNA 4KS7A 1ATPE 4RQVA 3NVMB 2X8DA 2RIOA 2J51A 1OPJA 3FY2A 3TUBA 2HENA 3L8PA 4DTBA 2GHLA 3D5VA 3ZZEA 2O5KA 4DGNA 3BGPA 5IF1A 2FSOX 5DFPA 5LVNA 2PMLX 1APME 3EYGA 4D1XA 5DBXA 4YO4A 2Z02A 3ETAA 1XH8A 1REKA 3P86A 4DGOA 2NNWB 4NJDA 3SXRA 2PE2A 3KGAA 4Z7HA 4PL5A 4AFEA 4AG8A 2W4JA 3C0HA 3HP2A 5FP5A 5L2TA 4M69B 2VO3A 2JDVA 3AMYA 2V55A 2WU6A 1IASA 1PKDA 3AGMA 3LFNA 3PSDA 3PXRA 4CD0A 4ZLOA 2X39A 3A7HA 3QRUA 1RE8A 4JRVA 4NSTA 4FSUA 2IW8A 5K0KA 3ANRA 4XG6A 3HUBA 3MVJA 4L7FA 3NUNA 4M67A 4M0ZA 1T46A 2B9HA 3DBQA 1I44A 4DG3E 5LCJA 1E9HA 5LJJA 3DQWA 4BCIA 4FG7A 2XB7A 2HY0A 4MAOA 4FK6A 1PHKA 3W2OA 4AT5A 1OKYA 4O86A 2XBJA 3RHKA 4IX5A 3VULA 3FYJX 5FXSA 5EQEA 2BKZA 5LMKC 2QO9A 4DLIA 3ZDUA 3SKCA 4PP7A 2OW3A 4FTCA 3PYYA 5FDPA 4B9DA 5C26A 5AV1A 4L01A 5J9ZA 2XKDA 5FG8A 2JD5A 3HV7A 4YBJA 1WBWA 2BMCA 5EYCA 2BHEA 2QOIA 4FV7A 4R78A 4GKHA 3MH2A 5T3QA 5FTOA 1WBOA 3C9WA 4C7TA 3VUGA 3P08A 4UN0C 5CANA 3E62A 4GT5A 3EFWA 3NDMA 2HZ4A 4AZEA 3P9JA 4YNOA 4ZXTA 4G5PA 4QD6A 4YJVA 5BUJA 3D5UA 4E73A 5LVMA 3ULIA 4EOLA 4V05A 3LXKA 3OWKA 3HMMA 4M84A 2VTMA 2VWBA 3I5ZA 4JL9A 3TEIA 2X1NA 4GT3A 4TYEA 3ZBFA 3ZRLA 2G01A 1YXTA 2R3JA 3FMLA 3KXGA 4WOVA 2WD1A 5HESA 1KV2A 4N6ZA 4XV3A 4CFUA 2CPKE 3BHVA 2IVTA 3CKXA 3OHTA 2EU9A 3DZQA 4H39A 4QP2A 4BDEA 2R3HA 3G33A 3NSZA 3NZ0A 3GU8A 3OCGA 4DFUA 4GYGA 4J8MA 3DJ7A 4MX9A 4TWNA 3I81A 5IUHA 4DH1A 3EOCA 1M7NA 4YJNA 3OFMA 2R3GA 3HL7A 5AM7A 4KBCA 3OWJA 4HYUA 5IQIA 2XNPA 5C9CA 4RRVA 5I3RA 4FICA 4O22A 2E9PA 2QOKA 5IA1A 3ZOSA 2ETMA 5E8SA 5DT0A 4FTQA 2PZIA 4Y5QA 4YLJA 4K8AA 2W9FB 2WTWA 3O7LB 3S3IA 4H1JA 3UMWA 3ZYAA 1LR4A 4BI2A 1F3MC 4FSWA 4AGCA 2J2IB 5CVHA 1ZMWA 4XCUA 4DEHA 4HPUE 5FTGA 3VQHA 2J4ZA 4QYHA 3GU7A 5GNKA 2QCSA 2I1MA 3P1AA 5FP6A 2BVAA 5JGDA 4BY9E 4RJ4A 2B53A 4XG4A 4ASXA 3EHAA 2PUPA 3KC3A 3NYOA 2HZIA 2C68A 4QQJA 4TYHB 5CAQA 1GZNA 2NRYA 3BU6A 4KBKA 3SOCA 5E8WA 4O83A 4HCVA 2RFSA 3SLSA 2R0UA 3MIAA 2O0UA 4DC2A 5KNJA 5E4HA 4ZS0A 4QQCA 5HG7A 3TWJA 1GIJA 4ZMFA 4EK4A 2JAVA 3E3BX 4AT3A 3EFJA 4LQMA 2E9NA 3GFEA 3IS5A 4L3PA 4QP6A 3DB8A 5IUGA 3DXQA 4IQ6A 5CENA 4D2WA 1OIQA 1G8SA 5KMNA 2UV2A 5EYDA 4KIPA 2C6TA 4FKPA 3DKFA 2PULA 4IB5A 2VN9A 1QPDA 2C1BA 2BZKB 3IPHA 4NK9A 3WF9A 4CQEA 3FV8A 2EWAA 2C4GA 4HZRA 4L44A 3C4EA 3VAPA 4F65A 2J6MA 3CQEA 3QHWA 4RVMA 1GIHA 3GXLA 1G8AA 2O63A 3MB7A 3V5WA 3EWHA 4Y72A 2W5BA 3EFLA 3OUNB 5AR7A 3O71A 4FA2A 4R5YA 3C4CA 4LUDA 4YJPA 3OD6X 5HIBA 5LVLA 3V5PA 3SG9A 3SG8A 4C61A 3HMIA 4XRLA 3FYKX 4GRBA 4YTFA 5G1XA 4BTMA 2JIIA 4RVLA 1FINA 1ZLTA 4CFVA 3T9TA 3BYOA 2OIQA 1PMUA 2OXXA 5M4CA 2QOFA 4NZWB 4IWPA 1JSUA 4G6OA 2JEDA 3LW0A 1PXJA 1REJA 3BE2A 1MP8A 1P5EA 3BHHA 5K5XA 3JYAA 4V0GA 5A14A 3UQFA 3RZBA 2PSQA 1IG1A 3KK8A 4O1PA 3S1HA 3D4QA 5DE2A 3OZ6A 3D5XA 3R9HA 5BVOA 2I7QA 4FTNA 3MI9A 3VBVA 3OC1A 5J8IA 2CLXA 3WF5A 4DHFA 2UZBA 2PHKA 4JDHA 1YOLA 4BIBA 4IHPA 3DOGA 2W4KA 2PZYA 4FZ6A 4K2RA 5HVJA 2XYNA 3AD6A 2A2AA 2BIYA 4J98A 3KY2A 2FH9A 4FKJA 4AA4A 2BZIB 3RNIA 4H36A 4BDAA 4FKQA 3EQIA 1KOBA 2I6LA 2VWYA 3QWJA 5DRDA 3R7UA 4DEGA 3I60A 4IDVA 2YM7A 4DH5A 4E93A 5AAFA 3N9XA 3CQWA 1ERKA 4QPAA 5KMIA 4UY9A 2XM8A 3MY0A 3N4TA 1BL7A 2ONLA 5JFSA 4FTIA 3DTCA 3LIJA 2OF2A 2BRBA 4L45A 5AIKA 3RI1A 3SRVA 3TDVA 3GOKA 2HOGA 1OECA 4M8TA 3G2FA 5AP2A 3KCFA 4GT4A 3HV5A 2WQOA 2OFUA 2B9IA 2R3NA 4ZJJA 4F9CA 1W82A 4XX9A 4G2FA 2BZJA 5EW9A 4F1OA 5CU2A 4E4MA 5AX9A 4AQCA 1Z5MA 4S32A 1U5QA 3DT1A 5FM2A 1L3RE 3Q32A 3RAKA 4KABA 3H30A 2QO7A 3GGFA 4OAVB 2VTHA 4Y5HA 2WTDA 4W4VA 4BL1A 2V0DA 2OZAA 5M08A 2UW4A 3PVWA 3MV5A 4UBAA 1FPUA 4IVAA 5HBHA 3OP5A 4WG4A 3FMHA 5J9YA 4YC8A 5HG5A 4F7SA 5EQPA 2IZUA 2CLQA 5KBRA 3QQUA 1YHSA 4C36A 2JFLA 4LMNA 4YP8A 3F3WA 5AAEA 5L6OA 1YWVA 3Q04A 4XG3A 3MPTA 4ZP5A 3QHRA 3UOJA 2Z8CA 4KD1A 3QTIA 3ROYA 2B54A 4AZWA 5IH5A 5J7HA 1AGWA 1KSWA 2FSLX 3FLZA 5AV4A 1PXNA 4IZ5A 3NNXA 3MVLA 1UKIA 3W1FA 2WMSA 1SYKA 2VTQA 5EK7A 4HJOA 3NEWA 4XV9A 3IW6A 4AGUA 3ZH8A 3AT2A 3M2WA 4N4SA 2R7BA 1SVGA 1K3AA 3F2NA 3O0GA 4Y73A 2PVRA 2JKQA 2XK3A 2ZM3A 3BLQA 4FV5A 4PMTA 5M53A 2CKEA 1S9JA 1WBNA 2ITZA 3F88A 5K3YA 5A4TA 3IW5A 4LL5A 4OAUC 4RJ5A 2OF4A 1ZY5A 2G2FA 3QGYA 5CEPA 4K9YA 1E1XA 4FL1A 1RJBA 2X7FA 4DFLA 3MH0A 2H96A 2RKUA 4DLJA 4E4NA 4EK8A 5BYLA 4LI5A 3R8VA 2O2UA 4HVHA 3WZDA 4BCGA 4EC9A 1IEPA 2I40A 4WT6A 4H05A 5ETFA 3UJGA 3VN9A 5J5SA 4O7WA 1OUKA 4OTGA 4CKJA 5AX3A 4C33A 1CM8A 2WMWA 4MF0A 2OXYA 1WMKA 1AD5A 4V0GB 3V5JA 1CKIA 2ITXA 2VV9A 1UU8A 5FTQA 1F0QA 4K1BA 3C7QA 1XBAA 2WTIA 3F3TA 3R2YA 3PA5A 1BYGA 3UBDA 3FAAA 2VTAA 3DA6A 5CNOA 4C4EA 4QNAA 2W0JA 1E1VA 1G3NA 4TPTA 2QG5A 3A62A 4A9TA 3RAHA 2AUHA 1BKXA 3FI4A 3QQLA 2IW9A 4OLIA 3R6XA 2CKPA 4NCTA 4TT7A 2LAVA 3HZTA 5IA3A 3HV6A 4WRGA 3R7VA 5IA0A 3FHRA 4EQUA 5BMMA 4F70A 2Z7RA 2XYUA 1QPJA 4N0SA 4BCHA 4PRJA 3UZTA 4DGMA 4RIWA 3TNQB 4JDJA 4TW9A 2FSTX 1ZOGA 3K5VA 2UVXA 3K2LA 3CKWA 4XP0A 3SRVB 4BIEA 5L2QA 2WAJA 3NNVA 3R9DA 3DNEA 4YJUA 5LWMA 5C8MA 3ZO4A 1YOMA 2C0TA 3C50A 2NO3A 3W18A 5JFXA 3FI2A 2HWPA 2C6KA 4I6BA 4KB8A 3TG1A 3EB0A 4PDPA 2JIVA 3U87A 4QMZA 4ONAA 1H4LA 4Q5HA 3UVRA 4A9YA 4D0WA 5IUIA 2FYSA 5CI7A 4YSJA 4CGAA 3VIDA 2XNBA 2ZV8A 3FWQA 1IAJA 3KRRA 4USDA 3RINA 2UW8A 4YTCA 3E8NA 2CNVA 2OZAB 2ITNA 3MTFA 4UMTA 3RMFA 5L6PA 1YHVA 3BYMA 4ITHA 2GNHA 4BCKA 5C8KA 1OKVA 3EN7A 1URCA 4ENXA 3TZ9A 4KIKA 3NYVA 3PWDA 5I9UA 2GCDA 3ORTA 4DGLC 3FL4A 4DEDA 3ZO3A 3O50A 1NY3A 3EN5A 3FKOA 4O2ZA 4AE6A 1DI9A 4LYNA 2HCKA 4FOBA 4HVSA 4P2KA 2R3KA 5KMMA 4A9SA 4M7IA 5FD2A 2XEZA 5KHWA 4E20A 2P0CA 4BKJA 4JQEA 4JBQA 4UV0A 1B6CB 2PZPA 4ZSAA 1R0EA 3VVHA 5M4FA 3ALOA 4LMUA 2WKMA 4FV4A 1OM1A 3D94A 4KIQA 1KE8A 5JMSA 4CG9A 1PXLA 4WG3A 2H34A 2Z7SA 4MWHA 5D7AA 3LMGA 3OROA 5AUTA 2J0MB 3DS6A 1Y57A 3PPJA 3Q60A 3THBA 2YACA 3B8RA 5CY3A 3RPRA 2YLFA 3F3VA 3W55A 3AOXA 4BWKA 3KXMA 4D2TA 3R9OA 3KN5A 1WVXA 4P4CA 5F95A 4LFIA 4O0TA 4TZRA 4KSQA 5HE2A 1KWPA 1JKLA 3LMIA 2C6OA 3R22A 4YMJA 2VGPA 3AC1A 2G2IA 3DPKA 3QUEA 2R7IA 4DGGA 4BCMA 5EM8A 3KF4A 5EM7A 5IU2A 2OBJA 4LRKA 4O6LA 3TI1A 4RPVA 2RG5A 3Q2JA 3HMNA 1FOTA 3MY1A 3BBWA 3F3UA 2A1AB 4MBIA 4D5HA 3WZJA 3EZVA 4P90A 4K0YA 3FMEA 1PY5A 4I6QA 2GSFA 3KEXA 3FE3A 5FGKA 4Y83A 2J50A 1ZARA 2UVZA 3PFQA 4FIIA 4PTEA 4QT1A 2XNNA 3AD5A 4ZTRA 1CTPE 3DDQA 3DQXA 5AR8A 2AC3A 1WVYA 2VUWA 3P23A 2ITOA 3DNDA 5B7VA 3BLRA 2PVJA 3TIYA 5LWNA 3UZPA 3PY0A 4NIFA 4PMMA 3E8CA 5KMJA 1IR3A 1YHWA 2JITA 3G9LX 3ZUVA 4AW2A 4NM0A 1KV1A 3EQPA 1U54A 4XP2A 4FEXA 1V0BA 3PVBA 4K6ZA 2Y0AA 4S34A 5CU0A 2GNGA 1B39A 2YLEA 5CWZA 4ALVA 2QOCA 4TN6A 4OTFA 4RIWB 4ZS4A 3OBGA 4GS6A 3MA6A 4HPTE 5TR6A 3NPCA 4J96A 3UQGA 3WIGA 1QMZA 1BI8A 1Q8ZA 2EXMA 1YWRA 3OWLA 3ZHPC 5GIOE 3MY5A 4TYIA 1NT2A 2RG6A 2I0VA 3FC2A 5AM6A 4ZSLA 3OCBA 5J5TA 1P14A 1PKGA 1JBPE 4NM5A 3VNTA 4JI9A 4RX7A 5HO8A 1R1WA 4FVPA 4EK6A 2OH0E 5HZNA 1BI7A 4EHVA 1F5QA 2G2HA 4BF2A 2XK8A 3PUPA 4C02A 3QCQA 3LFDA 2VRXA 3HGKA 4F7LA 3V5TA 4ZLZA 3S00A 5L8JA 3WILA 2VTSA 3CTHA 3Q6UA 3KK9A 4C62A 4E6CA 4OT6A 4EH3A 4DBXA 3PRFA 5IQHA 3L8VA 3RPVA 4YBKA 4ZK5A 3NMUF 1H28A 3EQFA 4ZSJA 3ZLSA 4FKTA 5C27A 2WOTA 3H9FA 4L53A 4O2PA 5CSXA 5ANJA 3CD8A 4FSZA 5TE0A 4RFMA 3R83A 3ZO2A 2OZOA 3MS9A 3TJCA 4F6UA 3Q4TA 4UWYA 3E88A 4XG2A 4TYGA 3TL8A 1LPUA 2BTRA 3M11A 1Q3WA 1M14A 3CPCA 3FQHA 3PVUA 2YDIA 4I4EA 4MVFA 5EHOA 3SD0A 5DR2A 4IXPA 1Y6BA 3G6GA 3VUDA 3GC9A 4MCVA 3R9NA 2OI4X 4K11A 4OW8A 2GS6A 4EH5A 3VBQA 2PL0A 4GL9A 3UIXA 2XJ2A 2CN8A 2YM5A 5DVRA 1CKJA 1OB3A 5CT0A 3A8XA 2X7OA 2UW3A 4ANOA 5HVYA 3FEGA 5ANEA 1VZOA 2BZHB 2XJ1A 4W8EA 4S30A 3RBWA 4DH3A 5KO1A 1KUTA 4CYJA 1V0OA 3NCGA 2CGXA 4C34A 3GC0A 4ALWA 3UO6A 1HCLA 2ACXA 3ZRKA 4I0TA 1WFCA 4NTTA 5CVFA 4BGQA 2ZM4A 3OWPA 3I6UA 2ZM1A 3ZSHA 3RM6A 4EBWA 4O0SA 5H8EA 4PWNA 4I3ZA 3VHKA 5CSWA 4FVQA 3VO3A 2XK4A 4IWOA 4LG4A 5AP4A 4IAIA 3MESA 4O7NA 3POOA 5FXRA 2XF0A 3L9LA 4FTAA 4CCBA 4OBQA 4GFMA 3IGOA 2W1GA 4RJ6A 5F4NA 4ANNA 3L8SA 4R3PA 5IQEA 3EJ1A 3R8LA 2VWZA 3Q5IA 4YZDA 3E8DA 5KCVA 3NRMA 3ZM9A 3LVPA 3II5A 4ZSGA 3R7IA 4FK3A 3ZLYA 4AWIA 4FKLA 4ID7A 1JKKA 2YZAA 1H25A 3FLWA 3T8OA 4NIFB 1Y91A 2GNLA 4PPCA 4BB4A 4E6DA 3BIZA 4O91A 1H01A 2J90A 5LMAA 3ZXZA 3R00A 4YTHA 1ZYSA 4GIHA 2ESMA 3HV3A 5CU3A 3Q53A 4ORKA 4D9UA 4IACA 1PW2A 2FO0A 2JFMA 1GOLA 4M12A 1A9UA 4KKGA 3TZ7A 2YEXA 4EL9A 4A06A 4MNFA 3OBJA 5GZAA 3VHEA 5L3AA 3TT0A 1UNLA 1YQJA 5A4QA 2CGUA 5L8KA 2J5FA 4L52A 5J87A 3TNIA 1H1RA 4N6YA 3WIKA 3FZ1A 3F5XA 5ETAA 4PQNA 3F66A 2C5YA 2UZNA 4MXAA 4ZZMA 5GIPE 1ZMVA 3MPAA 2JDTA 4OBOA 5IEXA 4MD8E 3PIXA 4U44A 1H1PA 4FSYA 3VS4A 3A4PA 3R01A 4B8LA 2EXCX 2JKKA 2YWVA 5ICPA 2ZOQA 2NPQA 1GZOA 4DYMA 3TJDA 3QLGA 4GV1A 4A7CA 4BCPA 4HZSA 4DFYA 5HCYA 1XBCA 3HP5A 4HGLA 3VRZA 4G17A 3QBNA 3TM0A 1YWNA 3D15A 3E7OA 2W5AA 3QWKA 2HIWA 2YDKA 2YAKA 4UX9A 3CP9A 3PG3A 5CZIA 5I9XA 1UWHA 3CBLA 3FQSA 3QRIA 5FQDC 4MEDA 5EM6A 3RGFA 3PDTA 3QX4A 4LV5A 5K4IA 4CEGA 4BKYA 2J0LA 3UZRA 3E87A 4LGDA 1XH7A 2QKRA 3RK5A 3GVUA 3HA8A 4S2ZA 3SDJA 4MQ1A 2JAMA 2VTNA 3S4QA 4AA0A 1PXIA 5IQBA 4IZAA 4D28A 3RK7A 1SNXA 4AN2A 3TACA 5CF4A 4RWJA 5HTCA 5AP3A 3PP1A 3BU5A 4TYHA 4GW8A 4BDKA 2X2LA 3D0EA 3SV0A 4E26A 5CAVA 1Q62A 2VTPA 2A0CX 4NM3A 3MFUA 4EH6A 1CKPA 3SXSA 2V22A 2WB8A 2VO0A 5CZHA 5GHVA 5K0XA 5KKRC 4C38A 1JNKA 3W2QA 4QP1A 3C4FA 5AADA 2Y4IC 3ODYX 3KMMA 1LUFA 3NLBA 1PXKA 1U4DA 4G3CA 3ORPA 3M1SA 4JX3A 3ULZA 3HKOA 4EH8A 5CF8A 3TIZA 4M66A 5AV2A 4CTBA 4F99A 4RFYA 4CFMA 1XH9A 1O9UA 5F9EA 4BZDA 2CGWA 2WELA 1TQMA 4R5SA 3IECA 5A9UA 2GS7A 3NUXA 4P7EA 4DAWA 1FGIA 4QQTA 1Q8TA 1Q8YA 2GMXA 3MH1A 5CEQA 5JGAA 3CIKA 2PWLA 2VTRA 4B8MA 2J5EA 3FQEA 1P2AA 5GINE 1XHAA 2PE1A 4KKHA 4WRSA 4AS0A 3LM0A 3ZLXA 2VX1A 4G16A 4ANBA 3D2IA 3RVGA 1OL2A 2ETRA 1QPCA 3PE1A 2WQEA 5HTIA 2XIXA 3P78A 4EOQA 5HG9A 2UZTA 5C1QB 2BAKA 1Q3DA 1XH4A 3F5UA 5TO8A 1OIYA 2CCIA 5C01A 4AZVA 2RFEA 4KS8A 1Q41A 4BTJA 5KHXA 1YDSE 3ACJA 3GU4A 5CASA 2JDRA 3GFWA 3QTQA 2PMIA 3JPVA 4XLIA 2W9ZB 5A54A 4UZHA 5CLPA 5M44A 3PSCA 3RZFA 2W1ZA 3QKKA 3RHXA 2DQ7X 4QPMA 4RC2A 4EK3A 4JG7A 2VTOA 4QMUA 4YURA 3U54A 5HG8A 5BMSA 4EBVA 5CXZA 3FDNA 4PL4A 5CALA 2HYYA 2YJRA 4JRNA 4W4XA 3QZIA 3V8WA 3WZUA 4E7WA 2VTJA 2REIA 2WNTA 4ACDA 4CRSA 4E6AA 1O6YA 5EW3A 3FXZA 3K54A 2BTSA 4M68A 1PYXA 3WF6A 3U6JA 4L9IA 5LCKA 5KZ0A 3IKAA 2XBAA 4AN9A 4UMUA 2EB2A 2GNJA 3EMGA 3VS7A 3ZMMA 5M07A 1IA8A 2GHGA 3ITZA 5HICA 3GP0A 2UZEA 3DBDA 4GJ2A 4XV1A 2BILB 2W4OA 3HYHA 4M13A 4YHJA 1W83A 4F64A 3WYXA 5K4JA 3MYGA 3FY0A 3FSKA 4EHZA 2QHMA 3QD0A 4FIJA 3BE9A 1Q24A 3QTZA 4J97A 3FZTA 5LOHA 3ZFXA 4I5PA 1DM2A 1FMKA 2OO8X 5L2SA 3ZUUA 4MXZA 4RWKA 4BHZA 4Z3VA 5HD7A 3F2RA 4N70A 3TTJA 1NW1A 5DYJA 4NUSA 5HNGA 3PLAE 3CPBA 2YM4A 3UIUA 4C37A 4O0WA 4WBBB 1J3HA 4FF8A 5IQGA 3KA0A 2UW7A 4Y46A 4AZTA 5B2MA 1WBVA 2UVYA 3PXZA 4FG9A 5EFQA 1ND4A 2EUFB 3Q2MA 3WYYA 4FKVA 3SXFA 4Q5EA 5E9EA 4FOCA 5I0BA 4ZZOA 1U46A 3QUPA 5HLWA 3KL8A 1MRVA 4HNIA 3QUDA 5LQFA 3QLFA 4ACMA 1W7HA 4DFBA 5DR9A 3U55A 4BVUA 4FL3A 4TWPA 3I7BA 1FVRA 4BFMA 1ZRZA 4KKEA 3R2BA 4ARKA 4LGHA 1OL5A 3DXPA 2JKMA 4TTHB 2R4BA 2FGIA 1S9IA 3FZRA 4IMYA 3GUBA 3W32A 2GTNA 3PXKA 3ORXA 1OL6A 3HRCA 3MJ1A 5CSVA 3RKBA 3AXWA 2I0EA 3O96A 2YIQA 3QRKA 4FTRA 4EONA 3EQRA 3V6SA 4BIDA 3RALA 4IVCA 3HNGA 4FKIA 3PJ3A 1DI8A 3R1QA 1Q5KA 4LOQA 1YW2A 4DA5A 1YOJA 2C6DA 4AZSA 3DBFA 4AU8A 2PMNX 3FPMA 3R7OA 2XZSA 3LJ0A 3PVGA 2ZDUA 3TTIA 3ZZWA 2XRUA 4O0UA 5A4CA 2CGVA 3F7WA 3NW6A 4F1TA 4RX9A 1PXPA 1W98A 2CSNA 4W8DA 3MSSA 4AXAA 3E3PA 4TNBA 3ROCA 5LMKA 2GU8A 3S0OA 4O1OA 3P5KA 5CSPA 1L8TA 3PA4A 3BWFA 3BEAA 4IZ7A 3U9NA 3ZSIA 4UALA 4E5AX 4JBVA 4ZY5A 3QTXA 5GJGA 5A6OA 1H24A 5HORA 3IOKA 3NIEA 4G3DA 3GOPA 4OTRA 2PVNA 5AUUA 2ITPA 3NAYA 4D2VA 3ZU7A 2C6MA 2FSMX 3POZA 4CMOA 3U4WA 1ZYLA 2WMRA 4GFOA 1GAGA 4FZ7A 4EWQA 3OW4A 2QVSE 4BI1A 3EKKA 3BRBA 4I22A 2C3KA 3MIYA 5F94A 4A9UA 4E5WA 3CSVA 1RW8A 4R7IA 1MRUA 4RZWA 4XS2A 2Y9QA 4I20A 4ZTLA 2WTKC 5M55A 5ANIA 1UNHA 4BDIA 5I9VA 5C4KA 1OZ1A 4EH9A 3CXWA 2PPQA 5D1JA 3PLSA 4EUTA 4BKZA 4JOAA 4IDTA 5EQYA 2FB8A 3RPOA 1K9AA 4NCTC 3EN4A 4DEAA 2XMYA 1LEWA 3PZEA 1CDKA 1ZXEA 2YITA 4A4XA 5HE1A 5KMKA 3AT3A 4V01A 5ANOA 4IM0A 4FYNA 1O6LA 4CG8A 5EG3A 3I6WA 5IA4A 4FNZA 5ITAA 2YCSA 5HE3A 2PUIA 2FA2A 4C4IA 5JK3A 4JLCA 3ZCLA 2W1DA 3AGLA 5JKGA 3ACKA 4C4HA 3Q96A 4JG8A 5HIEA 4IB0A 3DJ6A 2IZRA 2JGZA 3ZFMA 2Z7QA 4BDFA 3LJ1A 2UZLA 2UZUE 4QMLA 1H00A 4F6WA 2F7EE 4TY1A 1H1SA 3HECA 3F5GA 2WPAA 4CVAA 2HXQA 2CNQA 3EQHA 3TUDA 5AUZA 4EZ3A 4JDKA 3P7BA 3PY3A 5K9IA 4YU2A 1OIRA 2QURA 1KE9A 4GU9A 5E8VA 2P4IA 4RBLA 4ACCA 4EK5A 5TT7A 4AE9A 3UC4A 4UYAA 5E1EA 2IW6A 4OTHA 3NYXA 4C8BA 4EOPA 3QZGA 1GY3A 1DAWA 3I0OA 4QPSA 4TKSA 4EZ7A 3JVSA 5A6NA 5AUVA 3ORMA 4GFGA 4ZTHA 2JC6A 2UW5A 3HRFA 2SRCA 4J53A 4BBEA 4BGGA 4CV8A 3QTWA 1M2RA 4CZUA 4DTAA 3QQGA 3N4UA 3DK3A 2RL5A 3H0YA 4DFZE 2WMQA 3G0FA 4CT2A 4ZTSA 4RVTA 3BHYA 5L4QA 5IDPA 2OLCA 4I94A 4U97A 4HCUA 1MQ4A 3QQKA 4FBXA 5HTBA 4O27B 2VNWA 4FIEA 3PXQA 5E8YA 4Z9LA 4DCEA 3A2CA 3GU6A 2BROA 5CU4A 4D2SA 2ZB0A 3QZFA 4O21A 4JR3A 4ASDA 3ZUTA 1VR2A 4HGSA 4JQ8A 2BDWA 3CQUA 3ZTXA 4CZTA 5BNJA 2GFCA 2PUUA 4O6EA 4CCUA 3R28A 5JQ8A 4F9YA 4X6RA 4NL0A 4OTPA 4BR3A 4BWPA 3WF7A 5M4UA 3FXXA 2GNFA 2X6DA 2PY3A 3LXPA 2B9JA 2E9UA 4XH6A 4DEIA 1H26A 2VTLA 4EC8A 2GFSA 4D1SA 3Q9ZA 4FKWA 2CN5A 4FTTA 3V5LA 4A4LA 4BWXA 4X3FA 4IIRA 1OIUA 3R73A 4HW7A 1OL7A 3VUIA 4GUBA 4Y85A 1M2PA 4FL2A 4FEWA 3DCVA 4YR8A 2X8IA 2XK7A 2WIHA 4QMWA 3RNYA 2HK5A 4EHGA 4IH8A 4QYFA 5DGZA 4O96A 5BYYA 3H9RA 5FM3A 2VZ6A 4D2PA 4X3JA 2Y7JA 3R7EA 3EN6A 4RC4A 2ITWA 2PMOX 3A4OX 3P7AA 2W7XA 4BZNA 1H1WA 2B55A 2UZVA 4C0TA 3FMMA 3R8UA 3NUAA 4QTBA 1GZ8A 4EKKA 3MDYA 3QTSA 3TKUA 5D10A 5E8ZA 4YTIA 4X7QA 1J7IA 1JPAA 3W2PA 5DT4A 5L6WL 3TKHA 2OICA 3FMJA 5IQCA 1DS5A 3ZBXA 3OOMA 4PP9A 4IW0A 4LUEA 4PTGA 4C35A 2Q83A 2J0JA 5L8LA 3LFBA 4EOJA 4EOOA 5CEMA 1UA2A 3ET7A 3KU2A 5A46A 4JS8A 4K33A 4NYEA 4BI0A 1QPEA 2VGOA 5FLFA 5FEEA 5J7BA 1KOAA 3EQBA 3KRWA 4WHZA 4WUNA 4CFFA 4RLLA 4I5HA 1M52A 4FV2A 2QOQA 5KE0A 3RJCA 5KMOA 1PYEA 3QCXA 4QMOA 2IN6A 3O8UA 3NS9A 2B9FA 2ITTA 1A06A 3QGWA 1WVWA 2UZWE 5JT2A 4K18A 4KRDA 2WEVA 3MWUA 3OTUA 2F9GA 4KRCA 3OW3A 3A60A 4R1YA 3RPSA 3FUPA 3NNWA 4G1WA 4L68A 3D2KA 4NM7A 4EH7A 5GZ8A 2R2PA 4YHTA 4F1MA 3SW7A 4U0IA 2QU5A 3ZSGA 4FSQA 4O7SA 4QMTA 4OTDA 4JDIA 2YWPA 5HOAA 1EH4A 4G3FA 3BYUA 4KWPA 5HBEA 4MBLA 5FXQA 3ZRMA 1U59A 3PSBA 4FZDB 5EI6A 4BHNA 2ETKA 3I0QA 4QP9A 4XRJA 4BRXA 4GG7A 3R7YA 3W33A 4J52A 1G5SA 4XYFA 5CX9A 5LARA 3Q52A 4CLJA 4MD9E 3FLNC 5AP0A 2PZRA 3GCQA 5FEQA 3ZS5A 4ZMEA 2OJFE 5BUEA 2C6LA 1GNGA 2X2KA 3OOGA 5DN3A 4PMSA 5KMLA 2UUEA 4E4XA 3AMAA 3TUCA 4AA5A 3IDCA 4IM3A 2P2HA 4QO9A 3JY0A 4U40A 4XBUA 2VAGA 4FIGA 4XOZA 5EOBA 4ERKA 2W1CA 4ANQA 1YI6A 4E4LA 5KUPA 4KNBA 3DKGA 3REPA 2BRMA 2J9MA 3GC8A 1XWSA 2UZDA 3OT8A 3HMPA 4J95A 4LRJA 4PF4A 4V04A 3CS9A 3ZONA 4EUUA 4L3JA 3BU3A 5BQ0A 4AW0A 3KRLA 5HHWA 1YDRE 2UW0A 2C1AA 3D9VA 4K77A 4APPA 4JQ7A 3C4XA 3KRXA 1CMKE 4QMVA 4U8ZA 3RP9A 3G15A 2VD5A
chains in the Genus database with same CATH superfamily
3R02A 3RTPA 3HV4A 2YCQA 4HOKA 4NH1A 3NVKI 4RWLA 5IQAA 3VF8A 5BUIA 4W9WA 2PK9A 5IEYA 3ZC6A 1V0PA 4D4VA 4OT5A 4R7BA 4NW5A 3H0ZA 4GEOA 4GVAA 3RK9A 4JIAA 2X0GA 4USEA 3R04A 3F61A 5CXHA 4U79A 3O51A 4X3FB 2GS2A 2ZYBA 3VBYA 4OTWA 3VUHA 2KULA 4H3BA 3PPZA 1BLXA 2ITYA 2R3OA 2YDJA 3R63A 4RFZA 4OTIA 4P5QA 4U3ZA 4DH8A 4YJOA 4AW5A 2PYWA 2ZV9A 4XV2A 4FTMA 3DLSA 3EIDA 3ERKA 3R21A 3I5NA 4YGAA 3RM7A 3QC4A 4WD5A 5FBNC 3OEZA 3UTOA 1WBTA 2NYAA 2OIBA 4F9BA 2B4SB 2V7OA 2F49A 3AC8A 3A99A 3Q5ZA 1JQHA 2X4FA 5D41A 4MTAA 4YZMA 5IPJA 5E91A 5B2KA 4YUQA 1U5RA 3E93A 5CT7A 5CEIA 3WF8A 4FV9A 4C58A 3IGGA 5AUXA 3O5AA 2VWWA 2IZTA 5IKWA 4GG5A 4RA5A 2W1IA 4FV6A 2WHBA 4Z7GA 2XH5A 4MF1A 4WNKA 3SAYA 5T6KA 4DEBA 5IH6A 4QQ5A 4WO5A 3IG7A 3SX9A 2EVAA 3W0NA 3Q4UA 4H58A 5DEYA 2XKEA 4E3CA 3O2MA 5CEKA 3LCKA 5IZFA 3LM5A 3V8SA 2WMAA 4B99A 1OKZA 4U45A 4F6SA 4U6RA 3O17A 2H6DA 3W2CA 4XG8A 2IZSA 3VS1A 2B0QA 3KRJA 4DFXE 4USFA 1GJOA 4IEBA 4D4RA 2ERKA 4ACGA 1OGYA 4PY1A 3CY2A 4JT3A 4X2NA 5I3OA 4IE9A 3LAUA 2OK1A 2B1PA 2XNMA 3LQ3A 5AA8A 4ZIMA 3ENMA 3RWPA 4F9AA 4WSYA 3PJ8A 3OVVA 3GC7A 3R9RA 5AMNA 1OBGA 1UWJA 4UWBA 3LCSA 3LFCA 5HEZA 4BCQA 3BBTB 5J9LA 4IM2A 2C47A 2WFYA 4ZLYA 2VTIA 2QO2A 1ZYDA 2OKRA 5BPYA 2ZAZA 3JR1A 4RX5A 5HLNA 4RSSA 4PDSA 4Y95A 1RDQE 5D9HA 4D1ZA 3EQGA 4Q9ZA 3DXNA 3AT4A 3Q6WA 4FT0A 3AKLA 4IC7A 3DLZA 4TNDA 5HNBA 2PUNA 5IA5A 4GSBA 5E8TA 3DKOA 3F69A 3FJQE 3KKVA 3PY1A 4FT9A 2E9VA 3BQRA 4I93A 4MHAA 4O0RA 4PPBA 4OR5A 4QNYA 4YZ9A 4DT8A 2QC6A 5HE0A 4I21A 4EH2A 1JSTA 4JBOA 4I41A 1TZDA 2XM9A 3KXZA 2X9FA 3W8QA 2QONA 3O8PA 2X6EA 3CJFA 3KMWA 4J71A 2H9VA 2O65A 3L9NA 3VW6A 4IFGA 1Q8UA 4FZFB 5JQ5A 2WXVA 3PE2A 4WNPA 3PRIA 3P79A 5I9WA 5T68A 3QD2B 3UP2A 2YISA 2WOUA 4TL0A 3DTWA 3CJGA 4F7NA 2QU6A 2BAJA 2R3PA 4I24A 5HNIX 2GQSA 4O7RA 4AXCA 4IFCA 2A19B 3U6HA 3P4KA 2Y4PA 2OH4A 4FI1A 1M7QA 4YZBA 1JKTA 3R8ZA 4BGHA 4BC6A 3TXOA 4ITIA 3UDSA 4MXCA 3W2RA 4RZVA 3IW4A 4FNXA 2W1FA 4BDHA 4GVJA 4X2KA 3EQCA 4WSQA 5DNRA 3SQQA 3K3IA 2FVDA 4CXAA 2ITUA 2IF8A 3MTLA 4CSVA 4OUCA 5HBJA 3JVRA 3EN9A 5E92A 3D7TA 5IG1A 1Z9XA 2H8HA 5HKMA 3KXHA 5EDRA 4FT3A 2CCHA 1H0VA 4FE2A 2XA4A 3CCNA 4FVRA 1W8CA 3C5UA 4UXQA 4BYIA 2JBOA 4MXOA 2R0IA 4FV3A 2GHMA 5IQFA 4IAKA 4BDGA 2QLQA 5IDNA 4BBFA 4CFWA 2EXEA 2P2IA 2YZLA 5EKOA 4DFNA 5AP6A 3B2TA 2HW7A 2X8EA 3R30A 5BV3A 2PVFA 1BL6A 2X7GA 5DG5A 4BTFA 5BVFA 5LVPA 3BYVA 2XCHA 3UODA 1OL1A 3UMXA 1OKWA 3HEGA 1H08A 1XO2B 4FIHA 5G6VA 5DWRA 1H27A 3O8TA 2I0YA 2O8YA 4ANSA 5EM5A 5BX0A 3GEQA 4J99A 3FI8A 1UNGA 5HVKA 1OGUA 3KREA 5CNNA 1NXKA 4GYIA 5BVNA 3DB6A 4I6FA 4HYSA 3ALNA 3V6RA 3SC1A 4Y8DA 1ZY4A 3E63A 5ANDA 2ZVAA 1V1KA 4DCAA 4F63A 2HZ0A 3VS3A 4ZZNA 3ZFYA 2WTVA 3CE3A 3UG2A 4F08A 1W84A 4YJTA 2ZV2A 3UO4A 3DAEA 4C2WA 4PMPA 5DMZA 1UVRA 3W0SA 4AGWA 3VF9A 4AOIA 4L3LA 3DJ5A 1JOWB 3LLTA 4YLKA 4C57A 4FV8A 5A4LA 4JR7A 5EOLA 4CT1A 3BEGA 3NUPA 2ZJWA 3LCDA 3GCSA 4NEUA 1FBNA 4F4PA 3C13A 3DDPA 3PXFA 3QALE 1Q97A 4YZCA 2CJMA 3UNKA 3BWJA 3ZC5A 1PMVA 4TXCA 1JKSA 1VYZA 4FTJA 5EYKA 3GU5A 5AR4A 3VC4A 3C4ZA 4NKAA 2W99B 5EKNA 4IAZA 4HYHA 4YO6A 1QL6A 3AC2A 1IA9A 2G9XA 4M97A 2G1TA 1PMEA 3LXNA 1M2QA 3BPRA 4II5A 3KXXA 5AEPA 3SHEA 4C3FA 3C5IA 2YCFA 3D14A 3IOPA 3EKNA 2ZMCA 1FVTA 2OG8A 4GK3A 5HQ0A 3QC9A 1UU9A 3QQJA 1TKIA 4EOIA 2X9EA 4BN1A 4IB3A 4IX4A 4C4JA 5CF6A 2YM3A 2OSCA 2R5TA 2YA9A 3BELA 1RQQA 5L2IA 1PXMA 5ETIA 1ZOEA 2XIKA 4XP3A 4FGBA 3BV2A 3KMUA 1W0XC 2OJ9A 2W06A 3ORLA 1Y6AA 1B38A 2WQNA 3OY3A 4FUYA 4G34A 5H2UA 5M51A 4WA9A 2VWIA 2B7AA 3U8WA 1Z57A 4QYYA 4EYMA 4G5JA 4CRLA 1YRPA 2J7TA 2WMUA 1XBBA 3V01A 4FTUA 1NVQA 3QQFA 4HYIA 1HOWA 3TZ8A 4ENYA 1JAMA 2YABA 4WUAA 4AXEA 3JUHA 1H07A 4E6QA 2HWOA 5FEDA 2XEYA 4R6VA 3EQDA 3D7TB 4CNHA 2P55A 4YC3A 4I4FA 3UG1A 3WI6A 2J0IA 2WMTA 4X0MA 5E8XA 5CS6A 4G6LA 5M4IA 2R3QA 5ETCA 3RCDA 4B7TA 3UPZA 3L9MA 2OGVA 2QR8A 3TV7A 5I4NA 2IEWA 2QQ7A 2VX0A 1ZMUA 3PTGA 2XKCA 4L46A 1Q4LA 2GQRA 2OJGA 4XG7A 2OFVA 4U80A 4XMOA 2C0IA 3L1SA 3ORZA 1T45A 4CV9A 4IC8A 3FZSA 4EQMA 3F9NA 3PZHA 1P4OA 3DAKA 4FT7A 3RAIA 2CHLA 2I0HA 3A7GA 2PVHA 3QRJA 2GDOA 4FUXA 4IZYA 4AFJA 1Q61A 3DGKA 4NT4A 1URWA 4JIKA 3I1AA 4O4FA 2JBPA 3Q9XA 4HVDA 2JDSA 4TWCA 4HVGA 4YPSA 4IADA 5IMXA 3B8QA 1GZKA 3V51A 3H10A 2XUUA 3G5DA 2V7AA 3NCZA 3BGZA 3QA8A 5DT3A 4D0XA 2OWBA 4F09A 4JAJA 3IW7A 2UZOA 3LCTA 4BDJA 5I9ZA 3LKMA 4D4YA 1OBDA 3OCTA 4YHFA 1J1BA 4Q9SA 3MBLA 1W2CA 3LFAA 4UYNA 2YAAA 4R3CA 2VWXA 1NVSA 2WEIA 3HRBA 4IJPA 4FSTA 4L6QA 4RC3A 3COKA 4I0SA 4I92A 4RG0A 4L8MA 5DRBA 4B0GA 4MNEA 3F6XA 3VUTA 5HCXA 4FKOA 4ZTNA 4KUJA 2BRGA 5CSHA 3VBXA 1Q99A 2C69A 3VW8A 2W17A 4XUFA 2QOLA 1OITA 2OJIA 1WAKA 2YIWA 3QYWA 4XLVA 3CGOA 3CTJA 4KSPA 1BUHA 3EH9A 2ONLC 4NJ3A 1SVHA 4PPAA 5E1SA 4BICA 2C30A 3NNUA 1FQ1B 4U7ZA 3OT3A 2QOBA 2O3PA 2P33A 4MWIA 4YJSA 2IVVA 4EHEA 4XHKB 4CYIA 4BDCA 2C6IA 4FKSA 2AC5A 2E9OA 3I7CA 2XIRA 4EYJA 1XMMA 3WE4A 3N4VA 2QOHA 4M15A 1JWHA 4IB1A 2CNUA 2W5HA 1ZZ2A 4FV0A 2YN8A 2F2CB 4L00A 3VJOA 3D83A 1ST4A 3P7CA 3CD3A 3CR0A 2XNOA 1YDTE 4HGTA 3QFVA 3VUKA 3NIZA 3NUYA 3QF9A 3I79A 3L8XA 2Q0BA 5CAPA 1HCKA 4QP8A 3LLAA 3V8TA 3BYSA 4KAOA 3QCYA 1KE6A 4BCOA 1OUYA 3FLYA 4EOMA 4DF3A 5GJFA 4DE4A 3PJ2A 4FRFA 4XJ0A 3FKLA 3SOAA 3LQ8A 2IJMA 3Q3BA 4W4WA 1NA7A 5CVGA 3AQVA 4UB7A 4DN5A 4MH7A 3QYZA 1R39A 3U51A 1BMKA 4EQCA 4I5CA 5AJQA 4ZY4A 2BCJA 4PUZA 3GQIA 4FNWA 2RGPA 3E92A 4CMUA 5K5NA 1ZZLA 2HW6A 2W96B 5CYIA 2QG7A 3MVMA 4X2FA 3EFKA 2XK6A 4QP3A 4RIYA 4ZSEA 3LPBA 2ZB1A 4AZFA 3ATSA 2YERA 4CFNA 1YI3A 4FSMA 5HO6A 5AP5A 4M0YA 5JN2A 3DBEA 2BPMA 3BGQA 3LQ5A 3W8LA 1IRKA 4LGGA 4H3QA 2RF9A 3JY9A 5A4EA 1X8BA 1WZYA 2NRUA 4ALUA 3UVQA 3SA0A 4A9RA 2XRWA 3NAXA 5DOSA 4WBOA 2BRNA 3VWAA 4ANLA 3FLSA 4U9AA 2QNJA 3MJ2A 5BVKA 1YXXA 4DH7A 4U81A 2WQBA 1J91A 2C5OA 5JEBA 4FG8A 5J1VA 5M09A 4LM5A 4ZY6A 4M14A 3K5UA 1I09A 5ANKA 3O23A 4KIOA 5ACKA 5HD4A 4ZEGA 2GPHA 2QD9A 4X3FC 4MD7E 4HCTA 4I6HA 4D2RA 4PNIA 1XR1A 4RJ7A 2ZMDA 4DT9A 4J1RA 3MGYA 4MKCA 3GI3A 5AUYA 5EYMA 4D58A 3NYNA 1GIIA 1XQZA 1FVVA 5IQDA 3UOKA 3CGFA 5AAGA 2BALA 3NW7A 5FDXA 2VU3A 2YCRA 3LFSA 3BCEA 3FMKA 2ITVA 3DBCA 2V62A 5M06A 2PZ5A 1FMOE 3BX5A 4FODA 4NWMA 3EZRA 4QYGA 4X2GA 3R8PA 1R78A 4FTLA 5J1WA 5JZJA 3QD3A 2C5VA 2X2MA 4O4BB 4QRCA 4LOOA 4E1ZA 4O7ZA 4MNEB 5JFVA 4RLKA 1CSNA 1WCCA 3QU0A 5M56A 5HU9A 2CMWA 4OBPA 3RPYA 3EYHA 3I4BA 5EDPA 1OPKA 2IWIA 2XNEA 4EI4A 3A7IA 3KB7A 4ZTQA 5AIRA 3R1NA 4BTKA 3WZEA 3F82A 3BV3A 1SMHA 3MB6A 3C51A 3LCOA 3T3VA 2OU7A 4Q2AA 4CLIA 1JVPP 2AQXA 5CQUA 4AOTA 4LV8A 4U3YA 5B0XA 3TNHA 1TQPA 4EEVA 4O84A 2FUMA 3QL8A 2DWBA 2UW6A 3UIMA 2XIYA 2RSVA 4ZTMA 4O4CA 5AP7A 3R7GA 4QP4A 3ENHA 3HX4A 4XBRA 2P3GX 3IDBA 4MXYA 5BVWA 3TV4A 2R3IA 3BLHA 5JH6A 3FKNA 4FEQA 3HAVA 3PA3A 3TKIA 1PXOA 5IH4A 2WZJA 2NP8A 4FMQA 4QMXA 4BYJA 4D5KA 4R3RA 1MQBA 2BAQA 4PL3A 2WIPA 3UPXA 5TKDA 4E5BA 3EL8A 3CEKA 3NX8A 4HGEA 3NUSA 5IA2A 4JJRA 3BQCA 3LHJA 4IAYA 5CI6A 4BCNA 2JLDA 2PVMA 1PJKA 4IX3A 4X21A 4F0IA 2ZDTA 3FC1X 3IK3A 3IDPA 1LP4A 4U5JA 2HZNA 1UU7A 3VS2A 3FZPA 3UOLA 3HMOA 3NGAA 3COMA 3NW5A 3AC4A 4EJ7A 1O6KA 4O0XA 2Q0NA 2V5QA 5KKRB 3IW8A 2IVUA 1ZOHA 2WTJA 4GH2A 5DPVA 4RA4A 5JFWA 5E7RA 1FGKA 2VWVA 2Y4IB 4EOSA 2YFXA 4NKSA 4O0YA 2CKOA 1YI4A 2C3LA 3OS3A 3MFSA 2J0KA 3QAME 4IWQA 2W05A 4MYGA 4RIYB 4RJ3A 1KE5A 2DYLA 4A07A 4F0GA 5H9BA 4DG2E 3LFEA 4QP7A 5CAOA 3UYSA 3LOKA 4GIIA 4EH4A 3M42A 4RGJA 3C1XA 2WU7A 3P0MA 2BHHA 2R3FA 2E2BA 2HXLA 2QLUA 3QXPA 3ZO1A 3KCKA 4AT4A 3MN3A 5B2LA 5JSMA 3ATTA 4ZJIA 2JDOA 4UMRA 4B4LA 3E8EA 4O0VA 4ZAUA 2CKQA 1J1CA 4UXLA 3GBZA 3C4WA 1IAHA 4C59A 4AAAA 5AA9A 3DKCA 2BDFA 3BKBA 1J7UA 2QODA 2BRHA 5HO7A 2F57A 2VO6A 3A7FA 3K3JA 4GCJA 5CQWA 5KBQA 3CLYA 5IEVA 1OMWA 2BIKB 2XK9A 5HIDA 2IG7A 5C4LA 2C6EA 3WARA 3FZOA 3MVHA 4QMMA 3FMNA 4UWCA 1SVEA 4KBAA 4OGRA 3BI6A 3OXIA 3VBWA 3AKKA 2EB3A 5FBOA 3UIBA 4C4GA 1DAYA 3W0MA 1XJDA 3QQHA 5EI8A 1M17A 1J7LA 3FI3A 3UQCA 3COIA 3DY7A 4WNMA 4RT7A 3ZDIA 3W0RA 3S95A 1R0PA 4FT5A 4JAIA 2BDJA 2C5XA 2KTYA 1SM2A 3GQLA 4G9CA 3BHUA 3UVPA 3KXNA 4JVGA 1XH5A 3CC6A 2XS0A 5AR3A 3ZEWA 4U42A 2ERZE 1OVEA 2WMVA 5KZIA 3UYTA 4RX8A 4I1ZA 3FPQA 3G0EA 4XOYA 2YIXA 4FYOA 2A98A 2R3RA 3R8MA 3VJNA 3UDBA 4I6LA 4GUEA 4F7JA 2C5NA 1WBPA 4FGRA 1NVRA 4HVIA 3UNZA 4W9XA 4PDOA 4G9RA 3LFFA 2X81A 3W10A 1MUOA 4DBNA 3QXOA 2O64A 1ZYCA 3OEFX 5EH0A 4YC6A 2BFYA 5JZNA 3SW4A 3TNWA 3DV3A 4FC0A 4BBMA 1WBSA 4LOPA 3QKMA 4Z16A 5HX6A 3V5QA 4AX8A 2YHVA 3ML1A 4EKLA 2RFDA 3AMBA 1KE7A 4CFXA 3DAJA 3OXZA 3U4UA 2JKOA 3R1SA 4OTQA 2PTKA 3F2AA 3OUKA 3GENA 5FRIA 4ASZA 3AG9A 3Q9YA 3PPKA 5DIAA 3UOHA 3WE8A 5JGBA 4HNFA 2QKWB 5FUTA 2X0QA 4A4OA 4I0RA 5HU3A 1STCE 4NU1A 4AF3A 4O81A 3QX2A 5D7VA 3JS2A 4GK2A 4IAFA 3LZBA 4EOKA 1TVOA 3DK6A 3F5PA 4WIHA 5AV3A 5J95A 5JRSA 3L9PA 3TNPC 2WQMA 4N57A 2HY81 2VX3A 2PVKA 1H8FA 3ZLWA 5M57A 3QTRA 2LGCA 2Z7LA 4JBPA 2Y6MA 3HUCA 5DHJA 5F1ZA 3CY3A 5E90A 3ORKA 3G6HA 3W16A 3G90X 2WMBA 3KN6A 2VO7A 1UKHA 4TRLA 3GB2A 2QOOA 2VTTA 3KULA 4ASEA 5AR5A 2YJSA 5H8GA 3RCJA 4KINA 5C03A 4L7SA 4BZOA 4Z55A 4ERWA 2F7XE 5AWMA 5LVOA 4FTOA 3TN8A 2YM8A 4O38A 4PX6A 1OI9A 3ORIA 4R7HA 5AP1A 2R3MA 3PJ1A 3E5AA 3PXYA 4D55A 5EHLA 3N51A 4RVKA 1PF8A 4X6QC 4AACA 3KF7A 4DINA 2F4JA 3NR9A 4YNEA 2R64A 3R71A 4GK4A 2HELA 3QA0A 5CTPA 3HAMA 5HI2A 2IVSA 4B6LA 3FMDA 2CDZA 3MW1A 4JNWA 4FEUA 5GZ9A 4BDBA 2PU8A 4CMTA 4F0FA 3T9IA 3G9NA 3Q4ZA 4ACHA 4EWHA 4FEVA 4KA3A 3KQ7A 4XNEA 4DTKA 2C0OA 1UV5A 2XNGA 5DLSA 5HLPA 1Y8YA 3JXWA 3SVVA 1ZAOA 4FR4A 4EORA 3IQ7A 5AV0A 3PG1A 3C0IA 4NW6A 5D12A 1LEZA 4IWDA 2C3IB 5CF5A 4G6NA 4PDYA 3H4JA 4F9WA 5DA3A 3H9OA 2A4LA 4GMYA 2VNYA 4X2JA 2C3JA 3BZ3A 2DS1A 4IANA 2QR7A 5ACBC 1SNUA 4XG9A 3UC3A 4QEBA 4DDIA 1YVJA 4ZOGA 4R77A 2WGJA 4AOJA 3Q9WA 4NTSA 3UGCA 4BDDA 2BUJA 3GCVA 4LRMA 4YPDA 5EI2A 3HLLA 3AD4A 5BVDA 4JX7A 4FTKA 1SZMA 3MH3A 4EZ5A 3NWWA 4TYJA 4S31A 4JG6A 2AYPA 4O7VA 2WTKB 3VRYA 5LXMA 2A27A 5A3XA 1H0WA 4QMSA 2Z60A 1YXVA 4QYEA 3FSFA 2DUVA 3FBVA 5FWKK 3F3ZA 3DFCB 4IX6A 2XJ0A 4RIXA 2ZV7A 3UO5A 5E8UA 5I9YA 4APCA 3DK7A 3A61A 4G3GA 1JSVA 3QD4A 3UNJA 2XP2A 1BX6A 3RAWA 3OG7A 3E7VA 1ST0A 2Y8OA 5ANGA 2IO6A 3COHA 3GCPA 3RWQA 3W2SA 3T3UA 2XVDA 3ORNA 3FLQA 2Z2WA 3OXTA 2OIDA 1XKKA 3OTVA 4IVBA 1K2PA 3KVWA 2Y6OA 4DG0E 3ODZX 4FNYA 3MPMA 4R8QA 1VJYA 3LJ2A 4QTDA 5EDQA 2GTMA 2HAKA 1YXSA 2ITQA 2XKFA 4I5MA 3QRTA 4PV0A 4E8AA 4U41A 4GU6A 4IVDA 2W1HA 4MXXA 3QCSA 5D11A 4NFMA 1XH6A 3HA6A 3PP0A 2PVYA 3WBLA 5CEOA 5TF9A 4WNOA 3QKLA 4YZNA 3MFTA 2G15A 3OCSA 5HGIA 4ITJA 5CU6A 4CQGA 4AN3A 3S2PA 3Q4CA 3VS5A 3KULB 4KIKB 3E64A 4QMPA 3AC5A 3UP7A 5TOZA 4UMPA 1YXUA 3D5WA 3VS0A 3D7ZA 3KFAA 2YM6A 2XCKA 3GCUA 3PIYA 5H3QA 5KX8A 3WZKA 4O82A 2F2UA 4RQKA 1QCFA 3TV6A 4M3QA 2YIYA 3HVCA 3O7LD 4P5ZA 4UEUA 4M69A 4C3PA 2BKKA 4YSMA 5J79A 4BCJA 3VUMA 2JIUA 3UE4A 4AUAA 4FKRA 3FL5A 5IISA 1VLRA 3A8WA 1Q8WA 5DH3A 4WG5A 4FKUA 3PIZA 4O7TA 4ZJVA 4FX3A 4FZAB 3H3CA 3LXLA 3QZHA 4MQ2A 4GJ3A 1PMNA 3R1YA 3HDMA 3MFRA 4BCFA 2OXDA 5DR6A 3B2WA 2WTCA 4LL0A 4QTEA 4O7LA 2GNIA 3OF0A 2YIRA 4YJRA 2R3LA 4ANMA 5BYZA 1H1QA 4I23A 4D9TA 2X4ZA 4EJNA 4W4YA 5EW8A 4DITA 5HX8A 3HDNA 4CKIA 3F7ZA 4FKGA 3WOWA 4IJ9A 1ZYJA 3CTQA 4YLLA 5F20A 3LMHA 4G3EA 5HCZA 3ZM4A 2BFXA 3FHIA 3VQUA 5AUWA 5L2WA 3R0TA 5DEWA 4O7YA 4PTCA 4NFNA 1AQ1A 1P4FA 4IBMA 4WKQA 5DI1A 4MBJA 3ELJA 4QTCA 5LMBA 4FSRA 3NUUA 3OY1A 2RFNA 4QTAA 4TWOA 4UZDA 2GQGA 2R9SA 1JLUE 4FV1A 4J8NA 1MRYA 4UMQA 4AP7A 4RIXB 5JRQA 2WMXA 2IPXA 3ANQA 4QMQA 1VEBA 2QHNA 3PJCA 4J7BA 4CZYB 5C8NA 3ID6C 4D4SA 3MA3A 2WO6A 3IO7A 1U54B 3VBTA 3OMVA 4C2VA 3TMOA 3EL7A 2AEGA 3U9CA 3KVXA 5H8BA 3DU8A 1VYWA 3ZEPA 3BHTA 1Y8GA 1YKRA 4MK0A 2F7ZE 4RJ8A 3LE6A 3TZMA 3UDTA 4QMYA 3DZOA 4AW1A 3V3VA 4C4FA 4FIFA 4GKIA 3VS6A 1ZWSA 4XEYA 4L42A 5AFVA 1R3CA 3SGCA 1PRYA 3DFAA 2PE0A 3AC3A 2XIZA 4RWIA 3IONA 2PVLA 2VWUA 4S33A 4DEEA 3LFQA 4QOXA 2XARA 3V04A 5IMEA 5EHYA 4JXFA 5CAUA 2W1EA 1OPLA 2QI8A 3ZXTA 4CTCA 5I5ZA 2B52A 4G31A 1TQIA 4L67A 2BR1A 3GNIB 4L43A 4RIOA 4YJQA 4U43A 2OJJA 3G51A 1A48A 3GT8A 5AR2A 3FXWA 3U6IA 3PWYA 4H3PA 3QTUA 5BVEA 4AGDA 3C0GA 4FSNA 4RMZA 4CKRA 3NFGB 3TDWA 4R1VA 4PNKA 5GJDA 2UW9A 4IAAA 3A7JA 1UU3A 4C3RA 4H1MA 4QMNA 3PUFC 4KS7A 1ATPE 4RQVA 3NVMB 2X8DA 2RIOA 2J51A 1OPJA 3FY2A 3TUBA 4LV7A 2HENA 3L8PA 4DTBA 2GHLA 3D5VA 3ZZEA 2O5KA 4DGNA 3BGPA 5IF1A 2FSOX 5DFPA 5LVNA 2PMLX 1APME 3EYGA 4D1XA 5DBXA 4YO4A 2Z02A 3ETAA 1XH8A 1REKA 3P86A 4DGOA 2NNWB 4NJDA 3SXRA 2PE2A 3KGAA 4Z7HA 4PL5A 4AFEA 4AG8A 2W4JA 3C0HA 3HP2A 5FP5A 5L2TA 4M69B 2VO3A 2JDVA 3AMYA 2V55A 2WU6A 1IASA 1PKDA 3AGMA 3LFNA 3PSDA 3PXRA 4CD0A 4ZLOA 2X39A 3A7HA 3QRUA 1RE8A 4JRVA 4NSTA 4FSUA 2IW8A 5K0KA 3ANRA 4XG6A 3HUBA 3MVJA 4L7FA 3NUNA 4M67A 4M0ZA 1T46A 2B9HA 3DBQA 1I44A 4DG3E 5LCJA 1E9HA 5LJJA 3DQWA 4BCIA 4FG7A 2XB7A 2HY0A 4MAOA 4FK6A 1PHKA 3W2OA 4AT5A 1OKYA 4O86A 2XBJA 3RHKA 4IX5A 3VULA 3FYJX 5FXSA 5EQEA 2BKZA 5LMKC 2QO9A 4DLIA 3ZDUA 3SKCA 4PP7A 2OW3A 4FTCA 3PYYA 5FDPA 4B9DA 5C26A 5AV1A 4L01A 5J9ZA 2XKDA 5FG8A 2JD5A 3HV7A 4YBJA 1WBWA 2BMCA 5EYCA 2BHEA 2QOIA 4FV7A 4R78A 4GKHA 3MH2A 5T3QA 5FTOA 1WBOA 3C9WA 4C7TA 3VUGA 3P08A 4UN0C 5CANA 3E62A 4GT5A 3EFWA 3NDMA 2HZ4A 4AZEA 3P9JA 4YNOA 4ZXTA 4G5PA 4O4EA 4QD6A 4YJVA 5BUJA 3D5UA 4E73A 5LVMA 3ULIA 4EOLA 4V05A 3LXKA 3OWKA 3HMMA 4M84A 2VTMA 2VWBA 3I5ZA 4JL9A 3TEIA 2X1NA 4GT3A 4TYEA 3ZBFA 3ZRLA 2G01A 1YXTA 2R3JA 3FMLA 3KXGA 4WOVA 2WD1A 5HESA 1KV2A 4N6ZA 4XV3A 4CFUA 2CPKE 3BHVA 2IVTA 3CKXA 3OHTA 2EU9A 3DZQA 4H39A 4QP2A 4BDEA 2R3HA 3G33A 3NSZA 3NZ0A 3GU8A 3OCGA 4DFUA 4GYGA 4J8MA 3DJ7A 4MX9A 4TWNA 3I81A 5IUHA 4DH1A 3EOCA 1M7NA 4YJNA 3OFMA 2R3GA 3HL7A 5AM7A 4KBCA 3OWJA 4HYUA 5IQIA 2XNPA 5C9CA 4RRVA 5I3RA 4FICA 4O22A 2E9PA 2QOKA 5IA1A 3ZOSA 2ETMA 5E8SA 5DT0A 4FTQA 2PZIA 4Y5QA 4YLJA 4K8AA 2W9FB 2WTWA 3O7LB 3S3IA 4H1JA 3UMWA 3ZYAA 1LR4A 4BI2A 1F3MC 4FSWA 4AGCA 2J2IB 5CVHA 1ZMWA 4XCUA 4DEHA 4HPUE 5FTGA 3W0QA 3VQHA 2J4ZA 4QYHA 3GU7A 5GNKA 2QCSA 2I1MA 3P1AA 5FP6