3OROA

Mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 4)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
280
structure length
272
Chain Sequence
DRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIATAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine protein kinase
publication title Allosteric activation mechanism of the Mycobacterium tuberculosis receptor Ser/Thr protein kinase, PknB.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 81
structure length 272
sequence length 280
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oroA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oroA01
2FSLX 5IU2A 2IVUA 1H1SA 4TWPA 3QQJA 4BDBA 4GCJA 1JKTA 3FDNA 3S1HA 2VTHA 4FV1A 5L3AA 5HO8A 4DYMA 5FBOA 5IA5A 1K3AA 2OIQA 5AP5A 3S3IA 1Z9XA 3FLNC 4GVJA 2WQOA 3PZHA 1WVXA 1Q4LA 2A2AA 3ZEPA 1XHAA 2CN5A 2PVRA 3UMXA 4YP8A 3H4JA 2J0KA 1KOBA 3DBQA 3R04A 3CQWA 4D4SA 3V5LA 3ZFMA 3PJ8A 1OMWA 2C69A 4DBXA 4PF4A 4GU9A 3VF8A 4FKSA 2XBAA 3CY3A 3RKBA 3PXZA 4M68A 2QOQA 4KNBA 4DGMA 2YZLA 5HBEA 4XMOA 4PX6A 4YZMA 1BI8A 4LQMA 4E1ZA 4PTCA 3U4WA 3OFMA 4FOBA 5DBXA 4KRCA 3SRVA 4IVAA 3V8SA 4HVGA 4C2VA 3MB6A 2GSFA 3FZTA 3QZIA 2XNBA 5DEYA 3OBGA 3R30A 4TKSA 2BAQA 4MKCA 1YI3A 3KRXA 4BIDA 2R3IA 3DBCA 4IAIA 4L6QA 4AW0A 4CQEA 5KMOA 3Q32A 2I0YA 3OW4A 1FOTA 2E9PA 3LM5A 1M17A 4GW8A 4QMLA 2X9EA 5KMLA 2XNNA 2VNWA 3DBEA 3SLSA 2R0IA 2BFXA 5IISA 5CX9A 5EI2A 3JY9A 3KK8A 2BHEA 2XIYA 4ZZMA 3VRYA 2IVSA 4IWOA 2I1MA 3FMLA 4I22A 3KMMA 3FY0A 3NW7A 5DT3A 5EYKA 5AX3A 4M67A 3LVPA 4BHZA 5L2QA 3P7CA 3BHHA 2VX0A 3PP1A 3UVPA 4BI2A 4UMRA 2J4ZA 5AA9A 3NVMB 5B7VA 5AV0A 3KF7A 3SV0A 5B2LA 4HCUA 1VYZA 4XV3A 5HCZA 4IJPA 3Q9ZA 2QG5A 4APCA 4DH3A 4D9TA 3WILA 4I5CA 4BDDA 4ZAUA 3R28A 3BLRA 3EQDA 2Y4PA 1M2RA 4IDVA 3IQ7A 1RE8A 3ZLWA 3NW6A 2I0EA 4PV0A 4EK4A 5IQHA 4FT7A 3W2RA 4XBRA 2E9NA 4MXCA 4YLLA 4RLLA 2WIHA 4C4HA 3OWLA 4G5PA 1OB3A 1XH9A 4HVDA 2C0IA 3T3VA 3L1SA 3E7VA 4ZXTA 5AP4A 4M13A 1QL6A 4AA0A 3NNVA 4A9RA 3Q60A 2C5VA 4YJVA 1H00A 3VVHA 3DKCA 3ALOA 4MTAA 3PJ2A 3GT8A 3LCSA 2IG7A 3P7BA 3T8OA 4FV7A 3SW4A 2UZDA 1URCA 3E7OA 2V7AA 3ALNA 4FSUA 4BHNA 3HAMA 5LQFA 4QMZA 4DEEA 2Y4IB 2W5AA 4BDAA 2CCHA 3QC4A 5FBNC 4YU2A 4FTAA 4TZRA 5M4UA 2H9VA 4DG0E 4EOKA 4QYEA 1IA9A 4C33A 3IS5A 1ZYJA 1YDTE 4KSPA 4MXAA 4TYGA 5EOLA 4O7RA 2OBJA 3TIZA 4IACA 4PMTA 4WT6A 3LMHA 4QPSA 3F88A 4FUYA 1KWPA 3C13A 3S4QA 4GYIA 4PP9A 2A0CX 2JGZA 3G0EA 4UMQA 4W4XA 4QO9A 3DJ5A 3FHRA 2C4GA 5E8WA 4ZY4A 4ZS4A 3MVJA 2IW9A 3VUHA 3G0FA 5A46A 4XEYA 3NUUA 3MH2A 4JL9A 5EDRA 3W2PA 2JDOA 5EYCA 3BELA 2UW5A 3D7ZA 1OKWA 3KRLA 4XS2A 3JVSA 3H30A 4IANA 5H2UA 2R3NA 4ONAA 3O7LD 4FKIA 2G01A 5EOBA 1SVEA 3QRTA 4AA4A 4YC6A 4AE9A 5JQ8A 1PXNA 1XH4A 3OCSA 4YO6A 4CLJA 4CKIA 4MF1A 4AT3A 1JKSA 5CEMA 3H0ZA 3NNUA 5J79A 2W1ZA 5EK7A 3ZBXA 2F7ZE 3TJDA 3GENA 5LMBA 1ZZLA 3QGWA 3BHTA 1PKGA 3C1XA 2BIKB 2B4SB 3BIZA 4PRJA 2Z7LA 4AWIA 3LXLA 3QTRA 2ZJWA 2HK5A 2W17A 3BQCA 4FTMA 4CFXA 5IF1A 3O51A 2W5HA 4WO5A 2WKMA 1JSVA 5GZ9A 5LVOA 3I0QA 4QMSA 1O9UA 2XF0A 2XIRA 3WF7A 3U55A 1Q8YA 3W2CA 4LRKA 5E8ZA 2XK6A 3F3ZA 4IIRA 2VAGA 3WF8A 4GG5A 4I92A 3R1SA 3DXPA 3F61A 4BCNA 4U3YA 2HWPA 1OUYA 3DDQA 4JBOA 2XS0A 3EFJA 3IG7A 4MQ1A 4AGWA 3AT2A 3DB6A 3FAAA 3FMKA 5FXSA 1T45A 1OL6A 5GIPE 5DG5A 3R8LA 5M51A 5AMNA 3AT4A 3KA0A 2BZJA 2VTOA 3GQLA 4C7TA 3HV5A 1RQQA 2UZVA 4RFYA 5I3OA 3VUDA 5M44A 2YCRA 4O7NA 4QD6A 3CTQA 3HRBA 3W8LA 5M07A 2JLDA 4RPVA 4JI9A 4NKSA 3ZO3A 2ONLC 4I4EA 2JIUA 4BZDA 2OFUA 1G8SA 5HBHA 4FYNA 2UW6A 2R3FA 4A07A 4IW0A 1UWHA 1LPUA 4HJOA 4XP2A 5IA1A 5KBRA 4Q9SA 4RA5A 2YLEA 1JAMA 3REPA 2WXVA 3L8VA 2ZV9A 1PXLA 3FI4A 4IAZA 5AR7A 4EHEA 4F6WA 4II5A 1OECA 1SYKA 3LFNA 2B9FA 3CPCA 4FSWA 4LRJA 4NM3A 3TM0A 4FKGA 4O7WA 4Z3VA 3NCZA 3NMUF 3TN8A 3T9IA 3R1NA 1H1RA 4O91A 4GU6A 5AV4A 3HV6A 4OR5A 3VUIA 2ZMDA 3FI3A 4JVGA 3VHEA 3KCKA 5BUEA 4FSQA 3EFKA 5TF9A 4CSVA 4FGRA 1HCLA 4E6QA 2AUHA 2OJGA 3EMGA 3W1FA 2Z7SA 3OXIA 3PXKA 4EWQA 2C0OA 4HPTE 1TVOA 4ANNA 4ZJJA 4QQ5A 5K4IA 3ZOSA 1AD5A 2WEVA 3MWUA 2FB8A 3R2BA 3BCEA 5CLPA 3A7HA 3W10A 4BDHA 3HYHA 1NVRA 1SZMA 5CENA 1ZYLA 4BL1A 4QP4A 3MPTA 4QMWA 5C1QB 5DGZA 2ETKA 4TYIA 1PYXA 1RW8A 1TQPA 3DXNA 3MJ1A 4CFUA 5KMKA 2QU5A 1Q24A 2YM3A 5A3XA 5E9EA 3O8PA 3W55A 2FVDA 4N6ZA 4EHVA 3NVKI 2ITYA 3ZM4A 2BDWA 3AQVA 2J50A 5IQFA 3PSBA 3A61A 3NYNA 3QKKA 4O0SA 3R7OA 4IZ7A 4GL9A 4LOPA 3MY5A 3RAWA 2O63A 4PL3A 3ZMMA 3U4UA 3Q5IA 4FKOA 4AFJA 4F7SA 4OBOA 4PL5A 3TKHA 4BTKA 3L8SA 4JRVA 4A9TA 2VD5A 2X8DA 3OTUA 1YXVA 4F70A 5EW9A 5CU3A 3FXXA 2GMXA 4FNXA 4U40A 2A1AB 3QQUA 2OXDA 2J6MA 2FGIA 4N0SA 3ZXTA 3ITZA 4FL3A 2C3KA 5A54A 3A7GA 4X3FB 1UNGA 4NM0A 2QI8A 4K11A 5FWKK 4FZ6A 3GFEA 4I5MA 2V55A 5JQ5A 2Y6OA 2GQSA 4YJTA 3N4UA 2JAVA 1H4LA 3UC4A 4FEQA 4P7EA 4RX7A 2BFYA 3FY2A 2VTNA 4JDHA 4CKJA 1YHVA 3BKBA 1IRKA 4L68A 4Y83A 5IEXA 4IAKA 2VUWA 5DHJA 3R22A 5HG9A 2PUIA 4DFYA 4IZAA 4QMPA 3RWPA 2JFLA 2ITOA 4G3FA 4K8AA 2CGXA 1PXIA 4FNZA 4Q2AA 3SAYA 4BKYA 4F9AA 5EQPA 3OWJA 2VTTA 3GU6A 4GIHA 2WMSA 1OBDA 4FKQA 3BQRA 3AC2A 1U5RA 4B6LA 4FODA 4E4LA 3DKFA 3OCGA 4EH6A 3QRIA 2VO7A 4U3ZA 4RX9A 2J5FA 3RNYA 2VRXA 4LL0A 4CZUA 3DZQA 3H9FA 4HYIA 5ANJA 4U41A 2XKFA 3DK7A 4WBBB 5M55A 3WZDA 2Q83A 4CZTA 4EHZA 2VTSA 3G6HA 2B52A 4IFGA 3ELJA 3OT8A 4FKVA 4YNEA 4FX3A 1W82A 5DOSA 3WF5A 3Q2MA 4A9YA 2JKMA 2VZ6A 4FV6A 4JG6A 4A4OA 3PUPA 5JKGA 2IZRA 3ORMA 5K3YA 2QC6A 2I0VA 2XM9A 2ZDTA 3O0GA 4XHKB 2Z8CA 3HZTA 2UW8A 4Y46A 3G9LX 5H3QA 2PULA 4RMZA 1XR1A 2IW6A 3QUEA 4ALVA 2OJFE 3MVMA 3O23A 3O71A 4NZWB 1H0WA 3QX4A 4W8EA 1WAKA 2QOKA 3UVQA 2CNUA 4V04A 3VW6A 5EHOA 3Q5ZA 4E73A 1M7NA 3KMUA 4EWHA 4NKAA 3U6IA 5A4CA 5CVFA 2YLFA 3TNPC 5D7AA 4DH7A 1BI7A 4FYOA 1UKHA 1WMKA 4GFOA 4K18A 4L3PA 4IX4A 3AD6A 4XG8A 3AC5A 4LGGA 4N70A 1M2PA 3L8XA 2A27A 4MK0A 1QPCA 3ZFYA 3Q9YA 3KCFA 3MA6A 2PVYA 3DZOA 2HYYA 2IPXA 2YCFA 4QQJA 2OICA 4QOXA 5EHLA 1PY5A 4QMXA 4YSMA 5H8BA 4FZAB 3RK9A 3OOMA 4AZEA 3QWJA 5CZHA 3NCGA 3PLSA 4C38A 2FH9A 2X7FA 4F65A 3FPQA 3FKNA 1VR2A 3GXLA 3ANRA 4K33A 3RVGA 4F08A 4LV5A 2V22A 2WOUA 4YJUA 5FM3A 2C47A 4FTNA 4RBLA 1SM2A 3Q4CA 4X2KA 3ZLXA 5HIEA 4R78A 4LRMA 4NM5A 1FVVA 3ZO1A 2BVAA 3E88A 4CFFA 1Y57A 3NIEA 3ORIA 4RA4A 4A9UA 4O0VA 1ZY4A 5CF6A 4FVQA 2BILB 2XA4A 3NRMA 1UU7A 5CSHA 5BVWA 4D1XA 4FEXA 4DG2E 5C27A 3IDBA 3OC1A 1UNHA 5B2KA 4M8TA 4KS7A 5ANEA 3E87A 3CCNA 1YOMA 4UZHA 3FHIA 4ALUA 4D2TA 3D5WA 2YIWA 5HX8A 4D1SA 5A6NA 3CR0A 2VX1A 4BB4A 4D2WA 4IX6A 5E8UA 3ERKA 1REJA 4UWBA 3QL8A 3TTIA 2V62A 5KHWA 2ZVAA 4NIFB 3C51A 3R7IA 2BZHB 3P9JA 4I1ZA 3HKOA 5JZNA 3RALA 3W2OA 2J51A 3QZGA 4AP7A 5IMXA 2WTWA 3IK3A 4KIOA 4ZIMA 3HA8A 4ZY6A 2W0JA 5EKOA 1O6KA 1LP4A 4HGSA 2REIA 4TYHA 3UE4A 3VBTA 2J5EA 2X7GA 3LXKA 4F1OA 4F0FA 2R3MA 2BTRA 4YSJA 4QMMA 2J0LA 1FINA 5HCXA 4EOSA 3HGKA 2RL5A 5LVPA 3LHJA 3N9XA 2J0JA 3DAKA 3NWWA 4K1BA 4R7HA 4NFNA 4DINA 5CI7A 3SOCA 4WIHA 2WMQA 1QMZA 3POZA 4FG7A 4KB8A 3RTPA 4RSSA 5HG5A 2CKPA 5AV3A 2XRWA 3UP7A 4XJ0A 3B2TA 4QTAA 5CI6A 3UNZA 3DLZA 1H1QA 4DH1A 3OMVA 1M7QA 5D7VA 3B2WA 5HO6A 3Q52A 4C4EA 4DFLA 2QO7A 4MX9A 3OXZA 3DK6A 4BCFA 4OTFA 4C2WA 2CLQA 3PA3A 4AT5A 4CNHA 4BFMA 2BDJA 5HG7A 5IA0A 4YLJA 5AUZA 2PE2A 2XB7A 2QOFA 4YBJA 4JQEA 4YJNA 3PG3A 4JDIA 2YFXA 1W0XC 2OZAB 2RFDA 3PRIA 4TYEA 5FGKA 5HVKA 5JGAA 2WNTA 3GBZA 4KKEA 4N6YA 3SD0A 5BNJA 2QHMA 4M7IA 4ARKA 4C02A 1H26A 4L46A 4C57A 3ROCA 3UO5A 4UX9A 2WPAA 3ORNA 4C58A 4BYIA 2F57A 1STCE 4D0XA 1QPEA 2BCJA 5CSPA 3FQSA 3ZSHA 3NNXA 4C4GA 4ZTHA 2QLQA 3AGLA 3TKIA 3ETAA 3CE3A 4FKUA 3NS9A 3VUTA 5BUJA 2WB8A 5HEZA 4QMNA 5CY3A 2G2IA 2R3OA 5JRQA 4PPCA 4FTOA 3G9NA 4DFXE 5BVOA 2B55A 3UPZA 2E9VA 4R7IA 3ZM9A 4JG8A 3EFWA 2C68A 1VEBA 2XK9A 3O17A 4FTQA 4O1OA 4AZTA 1VYWA 4EKKA 1PMVA 4BRXA 4O27B 3POOA 4ZZNA 3V01A 1J7UA 1H27A 4FNYA 4GV1A 4I0SA 2XH5A 1UU8A 2OJ9A 2YM7A 3ZRLA 3UOLA 3HMOA 5KZIA 3U8WA 2Z02A 3WYXA 1VZOA 3HVCA 3THBA 3DV3A 5HTCA 2GFCA 5JFVA 4UEUA 3NAYA 3K54A 4GSBA 2C6DA 3ZO2A 1H1WA 4CTCA 4EI4A 4LG4A 3VQUA 3SG8A 4MBLA 4E93A 1VJYA 4FSYA 4HCTA 4WSQA 4M15A 1QPDA 2G9XA 3V5JA 4M12A 5DWRA 5JRSA 5BMMA 1ZOHA 4TYJA 2WTKC 4FTIA 4NUSA 5K0KA 4E6CA 4EOQA 5LWNA 4IADA 5HG8A 3FZPA 4R5YA 3LCDA 2P55A 3ZU7A 3QRUA 4CV8A 2PUUA 3P79A 4EL9A 4P4CA 5AP7A 3M1SA 4OTQA 4USEA 2XKEA 2WO6A 4IQ6A 5CT0A 3RAIA 3R21A 4ZTMA 5GZAA 5KNJA 2WFYA 2YERA 4MBJA 4R7BA 1LR4A 5IQIA 2HY0A 4FL2A 2GNJA 3R0TA 4LM5A 3V3VA 4ZTLA 2VO3A 3D9VA 4C4FA 4C4IA 5LXMA 3QCXA 3AD4A 1R78A 3O96A 4YJOA 4ZJVA 5HE1A 3EN4A 2OSCA 3LCKA 3NYXA 4FUXA 3V5WA 3NR9A 3WARA 5C4KA 4QT1A 4RQVA 3I79A 2JBOA 4IWQA 4XH6A 3VS1A 3ZDUA 4RJ5A 4L44A 4KBAA 4HYHA 3TIYA 2XNGA 3IO7A 2Z2WA 3D0EA 4NYEA 3A4PA 2SRCA 1OUKA 4JBVA 3FXZA 2ITZA 2IJMA 1ZYCA 3D7TB 3COKA 2C1AA 2PZIA 3HMIA 3MTLA 3V5TA 2QD9A 4AGCA 3NUXA 5JFSA 2ZV2A 2W96B 5E4HA 3QQKA 1IG1A 2I6LA 3I6WA 2CLXA 5DR2A 3BBWA 5FTOA 4XG2A 3QQHA 5AP3A 5KO1A 3KMWA 1W83A 2BKZA 4BDEA 2YIQA 4W9WA 5EQYA 5AADA 4DFUA 4TWCA 4X2NA 4P5QA 5CASA 2YCQA 4U45A 4FT0A 4X2GA 4YBKA 3KXGA 2ZMCA 2WOTA 2EUFB 2ZOQA 3Q4ZA 2LGCA 4I0RA 3W2QA 3ZS5A 4CT2A 3FMDA 2VNYA 3TUDA 4DN5A 3CJGA 4ENXA 2BDFA 4WBOA 2EU9A 4D2VA 4JAIA 2X2MA 4LOOA 2E9UA 3BU3A 4AFEA 3QUDA 4GG7A 4XG9A 2WGJA 4TL0A 3UNKA 4UB7A 4OBPA 3KKVA 4AU8A 4XV1A 4EHGA 3OWPA 2VWXA 4PL4A 4IEBA 3ZDIA 3SGCA 3VNTA 3GC9A 2QHNA 2RFNA 4YPSA 2VWIA 2R3GA 4ZTNA 2OH4A 3GEQA 2E9OA 2DWBA 1G3NA 5ETCA 5AUWA 2J90A 5HD4A 3ODZX 5AP6A 5M53A 2ETRA 2AC3A 2XCHA 3VIDA 3DTCA 4D4VA 2JBPA 4O0UA 4YC3A 5AAEA 1KE8A 5I9WA 2BMCA 4EH8A 2YACA 2ZM4A 2RFEA 5EW3A 2JITA 2VO0A 4GIIA 5JFWA 4EH2A 1BYGA 3UZPA 3BV3A 2PU8A 3EWHA 2BRHA 4RJ4A 4JJRA 3ZZEA 4DEAA 2Q0NA 1NW1A 5IQGA 2YA9A 2H8HA 5L8JA 3ORZA 3QQGA 5J87A 3TL8A 2PZ5A 4L45A 2R3RA 3CP9A 1MQ4A 1KV1A 4HZSA 4O22A 1NVQA 4CLIA 4GKIA 1F0QA 1PXKA 4MNEB 2C6IA 3DBDA 3FYJX 3LQ8A 4QMYA 3DFCB 5IH6A 4W9XA 1OIRA 2BUJA 5IDPA 1ZWSA 3G90X 3W32A 3KFAA 5KE0A 2PUNA 4O0RA 3GCSA 3VS6A 2HW7A 4UMUA 4NJ3A 3RPOA 3QTWA 5FQDC 2YDJA 3V6SA 5KKRC 3GNIB 3IW6A 3C7QA 2OF2A 2ZB0A 2F9GA 2R2PA 4ZSGA 3F7WA 3TZ7A 4AS0A 4O38A 4AG8A 3WF9A 2PVHA 3E8DA 1NXKA 2X6DA 2G15A 2GQRA 3G5DA 1FQ1B 3BYUA 3LJ2A 3C0HA 4FC0A 2CCIA 4FKPA 4IC7A 4ITJA 4RWKA 5HIDA 2PHKA 2UVXA 3V6RA 4YJSA 2FYSA 3Q53A 4GUBA 1Z5MA 4ANQA 5DH3A 2OJJA 3O7LB 3NYOA 4FV8A 4GT3A 4FIEA 4JRNA 3RPVA 4LMNA 3G15A 1OL7A 1I44A 3GVUA 5BVFA 5ANIA 5J1WA 3FPMA 3K2LA 3LCTA 2YM5A 3F3VA 4D55A 4KUJA 2PVJA 3MPMA 3NUNA 3PY0A 5C9CA 3RCJA 3QHRA 3I1AA 1S9JA 4D2RA 5IH4A 2QU6A 2VGPA 3WIKA 4G5JA 3RZFA 5ICPA 4FF8A 4C3FA 4NU1A 2BROA 3IW4A 1U59A 5JEBA 4ZLZA 2OW3A 1H8FA 1OGUA 2PYWA 2PSQA 5CNNA 3C9WA 4BF2A 3N51A 1ZMVA 3L9NA 1OPJA 4EC8A 4L53A 5A9UA 4AW2A 4RRVA 3UOKA 5TKDA 4MD9E 3HV7A 3W16A 4CT1A 2IO6A 3HA6A 5CYIA 4BWKA 4HGEA 4UBAA 3PJCA 5CU6A 1K2PA 3DJ7A 4UWYA 3Q9WA 3A2CA 1OL5A 4IM0A 3DQXA 1LEZA 1PKDA 2X9FA 2YZAA 3QC9A 4FG8A 1GZ8A 4IX5A 4QP7A 3AMYA 4W4YA 3R8UA 2VTQA 4BIBA 1J3HA 3NPCA 4CVAA 4PNIA 4NSTA 4JDJA 4EONA 1ZY5A 4HGLA 4HYSA 4FA2A 5HGIA 4WSYA 2LAVA 2GTNA 3MTFA 3FZOA 4CYIA 3KN6A 3P78A 4BICA 4YO4A 4AAAA 4U43A 4X6RA 5L8LA 1UVRA 1KSWA 3OS3A 3P5KA 3UIMA 4D4YA 3H0YA 1OI9A 3PE1A 2ERZE 4FV2A 2IZUA 4M69B 4EJNA 3PLAE 2EB3A 4BCJA 2P3GX 2QOOA 2ZV8A 3DY7A 4I23A 3A7IA 3KGAA 1U4DA 1FVTA 1Y8GA 4EYMA 3Q6WA 3UO4A 3FLSA 3WI6A 3WZUA 4YUQA 1H08A 4EBWA 2BAJA 3MN3A 2UW0A 3WE4A 4S34A 3RPRA 2GNGA 4ZSEA 4MHAA 4U81A 5BMSA 1G8AA 2JAMA 3EQBA 4UZDA 2C6TA 5J5SA 2CPKE 4NTSA 3EN6A 5L4QA 2B7AA 2YHVA 3W2SA 5CF5A 1U54B 3KY2A 4J8MA 3FWQA 2ITVA 2ERKA 2R0UA 4X3FA 4RX5A 5CEIA 4XRLA 5EQEA 5I5ZA 2W4OA 2Y7JA 4XNEA 4G3CA 2DYLA 2CNQA 4G6NA 4RVMA 2GQGA 3BGZA 4FZ7A 5FP5A 5FEQA 4DE4A 5DMZA 1H07A 3DNDA 3R6XA 1FBNA 3F3UA 3EQCA 2VU3A 3BLQA 4RQKA 3R9DA 1V0PA 3FE3A 4NT4A 3DJ6A 3MIYA 5LCJA 4A9SA 2WTJA 1A9UA 4FI1A 4FGBA 5HIBA 3RK5A 3LFEA 3IOPA 2HIWA 2B0QA 4OAUC 4DG3E 1HOWA 5DLSA 4C59A 2VWVA 2JIIA 4EBVA 3QRKA 5L6PA 4L7SA 4FSZA 4ZTSA 5IA2A 3P23A 2B9HA 4N4SA 5EM8A 3OCTA 5JK3A 3ET7A 3C4ZA 3OXTA 3MH1A 4TWOA 4FMQA 2J9MA 2HZ0A 3U87A 5AAGA 1AGWA 4QMQA 3FLZA 2HW6A 4FV3A 4MYGA 4EC9A 5CF4A 4ACCA 2WMBA 3QWKA 5HESA 4WKQA 3LQ5A 4J99A 3B8QA 4EOJA 2J7TA 4O0TA 5FTGA 4ORKA 3NYVA 1P14A 3KULB 4F64A 5DRBA 4ZK5A 5BX0A 3OY3A 2IN6A 3DKOA 1E1XA 4I6HA 5J95A 4BCMA 3F82A 3MVHA 3UZTA 2C6EA 4EQCA 2DUVA 2XM8A 4FTCA 4OGRA 4MXOA 1M52A 1Q41A 2HWOA 2JKQA 3QQLA 5HBJA 2YABA 4KS8A 3GOPA 4DFNA 1JLUE 1UV5A 4U97A 4GJ2A 3GC8A 2O8YA 3ULIA 3TDWA 3NGAA 4YC8A 3QLFA 2W4JA 3MJ2A 2WU6A 1M14A 3VULA 4R6VA 3L9LA 3L9PA 3OEZA 3ID6C 3C0GA 3RPYA 2UZNA 5LJJA 5E8XA 1PXPA 5DR6A 3TV6A 4E6AA 3GCQA 2O5KA 4XOYA 4JS8A 1Q61A 3QD3A 3NEWA 1GZOA 3VJNA 5AP1A 3TEIA 3FMMA 4ZSLA 1WBTA 5AEPA 5I9YA 2WMRA 2VTJA 2ZM3A 3TT0A 3UVRA 4F7NA 3D5VA 3F2RA 3UNJA 4JOAA 4F9YA 3FMNA 3DB8A 3FMHA 4ANBA 3UG2A 3EQRA 3AGMA 4EK5A 3EH9A 2YIYA 3IW8A 3ZC5A 4YHFA 5DR9A 5K0XA 4QTEA 4DTBA 3RAKA 3NLBA 4LUDA 4K9YA 1TKIA 1R39A 3VBWA 2W1FA 4ENYA 1T46A 2UZOA 2Z7RA 3P86A 3R63A 4IVCA 4E5BA 3B8RA 5CT7A 4D9UA 5I9UA 3GCPA 4RT7A 4WNKA 5A14A 1CKPA 3EN7A 4KKHA 4DCAA 4BZNA 4V05A 5M08A 2QOCA 3RCDA 2B54A 4BZOA 3K5UA 1PJKA 2C1BA 3DK3A 4L7FA 1A48A 1HCKA 3U6JA 2A19B 4ZSAA 3MY0A 3RWQA 5ANKA 4ACMA 4BBFA 2CHLA 2CKEA 2V7OA 2Z60A 3FC2A 4NIFA 3DPKA 3LMGA 4JXFA 4X2JA 3KC3A 2QOBA 4YTIA 3QXOA 4B8LA 2YAKA 2C0TA 5K5XA 3R8MA 3TI1A 5DN3A 3ZTXA 3PXQA 2I40A 1OBGA 2VGOA 1KE6A 3A8XA 4O1PA 3SG9A 4MAOA 4DCEA 4PWNA 2WMAA 4J71A 2JDRA 3KU2A 1MP8A 3VS0A 4E7WA 5CAQA 2HZIA 4NM7A 4ZOGA 3LLAA 4DEDA 3HEGA 3QUPA 1PRYA 2VWBA 3QFVA 4UYAA 2HXQA 4RJ6A 4DC2A 4YTFA 1Q8UA 1BL7A 4MXXA 3MFUA 3MH3A 4QQCA 1UU9A 3GB2A 3TZ9A 4H36A 3T9TA 3HRCA 4EUUA 5AM6A 3IONA 4FIGA 5DE2A 3QD2B 5A4QA 1Q99A 5L8KA 4QMUA 2YEXA 3FMEA 4RJ3A 4RIXB 3EN5A 5J8IA 2W9FB 1WCCA 5GNKA 3V5PA 5K4JA 3A7FA 1YI4A 2UUEA 2OXXA 3F5GA 3NDMA 3F6XA 3F3WA 5I0BA 3UGCA 2OWBA 4DGOA 3TUBA 3SW7A 4BCKA 4QP6A 3MI9A 3Q6UA 3PJ3A 4OW8A 1OPKA 1PMNA 2EXMA 3QKLA 3TZMA 5IDNA 2OZAA 1GY3A 3PVGA 4OTIA 3SKCA 3U9NA 1IA8A 4HNIA 1H01A 5AP2A 3TUCA 5IQAA 2QOHA 4S33A 4QP3A 3NUYA 4WHZA 3CXWA 2XP2A 3WF6A 2ITQA 5B0XA 1RDQE 4QYFA 4QMVA 1TQIA 4Z16A 5FDPA 3KRWA 4YTHA 5EM7A 1M2QA 3IW7A 4FKLA 4BVUA 4D1ZA 4DBNA 4Y5QA 1GIJA 4G3GA 4IZYA 5LMKA 1JVPP 2W4KA 2Z7QA 5BVKA 3EL7A 2PE0A 3JR1A 5I4NA 4AN9A 3IGOA 3QKMA 4QP1A 4QYGA 3CLYA 1KE7A 4TY1A 3WBLA 4DT8A 3MBLA 5HHWA 5L2WA 2NO3A 4UYNA 3MFSA 3QU0A 3MESA 4JIKA 5ANOA 4FR4A 5FP6A 4PPBA 4HZRA 2P2IA 2X8IA 5D41A 5FD2A 4BDCA 2BKKA 1V0OA 4RLKA 2BZIB 4FTKA 4L42A 3WZEA 3ZFXA 4BCPA 2R3PA 1APME 3CY2A 4FEUA 4JG7A 3GQIA 3I5NA 4PMSA 1H25A 3GCVA 4I94A 4AA5A 2QOLA 4BWPA 2CNVA 2XIXA 5HVJA 4KSQA 4BBMA 4C36A 4GK3A 2OJIA 4C0TA 4R77A 1Y91A 2G1TA 3R71A 5DIAA 5EYMA 3SXSA 3R7GA 3NX8A 1GJOA 3VN9A 4RG0A 2WMXA 1OKYA 3UDBA 1ZLTA 4R3CA 1UWJA 3LW0A 4NFMA 4K6ZA 1J1BA 5DI1A 5EH0A 3W18A 3MSSA 2WHBA 3ROYA 5HU3A 5CF8A 3LQ3A 4N57A 2X0GA 4D28A 4RIWB 1YOLA 5CQWA 3UODA 2NPQA 2UW7A 4BTMA 4IDTA 3QHWA 5TT7A 5E8YA 3V8TA 3CD3A 4IB3A 3SX9A 4MD8E 4U7ZA 4G1WA 5EFQA 5CEQA 3ATSA 5HOAA 2F2CB 4X6QC 5M57A 1PW2A 3P4KA 5DT4A 4DITA 3LIJA 4J96A 4CQGA 1Y6BA 5EM5A 3I60A 4XLIA 3PJ1A 2X8EA 3BYMA 1IR3A 4EOMA 4AE6A 4RFZA 2ZM1A 3QRJA 1GAGA 4O6EA 4X21A 4NW6A 3VF9A 4OTPA 3E3PA 4A7CA 4ZMFA 4NWMA 2R5TA 3QBNA 4ERKA 5DRDA 2ITWA 4U6RA 3BLHA 4L8MA 1OL1A 2C6MA 3BGQA 5J7HA 1PMUA 3FL4A 4MF0A 4FG9A 4CCBA 3MPAA 4E20A 5C01A 4XLVA 5M09A 2WIPA 4U44A 3D5XA 3GU7A 4H1MA 3V51A 1ATPE 3MB7A 3NW5A 3QYWA 2R9SA 3RNIA 1UNLA 3N4VA 3D7TA 1B39A 3ACJA 1WVWA 1YRPA 4FZDB 4ERWA 1OITA 5ACKA 4JT3A 2R3HA 3UG1A 3V5QA 4OAVB 3KXMA 3CEKA 3BBTB 5LVMA 3PSDA 4CFNA 5IZFA 4IE9A 3BHYA 2I0HA 1PHKA 4I20A 5CAUA 2PVLA 3ATTA 2EWAA 2P4IA 1R3CA 1OIUA 2P33A 2OZOA 3A8WA 3MFTA 4V0GB 4IVDA 4CRSA 5KBQA 3BV2A 4D2SA 3D5UA 4AZWA 3VRZA 3LKMA 2BZKB 4O86A 3RK7A 4G6OA 4H05A 4PMPA 2CGVA 2XBJA 3QYZA 1YWVA 1XBAA 5TE0A 4PPAA 4L01A 4BKZA 2ETMA 2HELA 3PXRA 4IX3A 2WU7A 3PP0A 4ZEGA 3LMIA 2OU7A 1XWSA 3C4CA 3UBDA 1SVGA 4Z7HA 4AUAA 4Q9ZA 4O7ZA 4WNOA 2B9JA 2QR7A 3E3BX 3OG7A 2XK8A 4FV4A 5IA3A 3PWDA 1NY3A 4RIYB 2W1CA 3G33A 2F2UA 5HTBA 1YKRA 2VWZA 4XUFA 4JNWA 5AJQA 3EN9A 3AXWA 5CTPA 1O6LA 2UV2A 3P0MA 4ALWA 3LFFA 2HAKA 4KD1A 5L6OA 4F6UA 4YJPA 4QP9A 1OZ1A 4G3EA 4XG7A 5AV2A 4O82A 2QG7A 5EM6A 2RIOA 2BIYA 3SXFA 3OD6X 4QP8A 4FTTA 3VUKA 3QA0A 4QPMA 2XYUA 4I93A 4F09A 5AUYA 5IH5A 3OW3A 5HTIA 4KRDA 2BPMA 4E6DA 4TPTA 4GVAA 2C5OA 3QAME 2UZWE 2JD5A 1R0PA 4WRGA 2OI4X 3VS2A 4BDJA 5CEOA 2BRMA 4BIEA 3G6GA 4EH9A 4QTCA 3PTGA 4PQNA 5ANGA 3DBFA 5I9XA 5CAVA 3FYKX 3CTJA 4QMOA 4B9DA 5KMNA 4RIOA 4KAOA 2R3QA 4FKRA 4CKRA 3KXNA 2CKQA 3QGYA 3RZBA 3D94A 4MNEA 3AC3A 2QNJA 1IAJA 2HOGA 4NCTA 3ZSIA 3RJCA 4LOQA 1XH5A 4YHJA 3OOGA 3BU6A 2YWVA 1YVJA 4FT3A 2UVYA 5CU0A 3DDPA 2JC6A 1UU3A 4B8MA 2OO8X 3EIDA 1KV2A 4L43A 4AZFA 4O7YA 4F0IA 5F20A 3C4EA 3CBLA 5AR3A 3R8VA 5FXQA 2GNHA 3LPBA 4CD0A 2R4BA 1DAYA 5DEWA 3ZEWA 4XV2A 3ZZWA 1NA7A 4Z7GA 4Y5HA 4CMTA 4KWPA 5BVDA 4BCQA 3R2YA 1ZRZA 2B1PA 3FLYA 3LE6A 4XBUA 2X39A 4XOZA 5AUTA 4USFA 3HNGA 3RINA 3PDTA 5AP0A 3Q4UA 3OF0A 2OKRA 4BI1A 5HE3A 3SA0A 5HX6A 3DGKA 2X2LA 4EOPA 3I0OA 3CJFA 2PVKA 4CMUA 4F0GA 3O8TA 4M97A 2OH0E 5F9EA 3P7AA 4IM3A 3R8ZA 3FZRA 4OTRA 2JDVA 4IBMA 5AV1A 5M06A 4BY9E 4MWIA 2RKUA 2XNEA 1JSTA 3IDCA 4FTUA 3R9HA 4M14A 4TNDA 3QTXA 2AC5A 3A4OX 5AIKA 2XZSA 2QODA 1CM8A 5H8GA 3TNQB 4C8BA 1UA2A 3QD4A 1DS5A 2Y4IC 4IHPA 4MXZA 1Q62A 1NVSA 4RFMA 4F7LA 4CG8A 2WMWA 4PDSA 4G3DA 3COIA 3PE2A 4GEOA 4UXQA 2CDZA 1YWRA 3DLSA 5KMJA 4MBIA 1J1CA 4W4VA 1GIHA 2EXEA 4S32A 4WNPA 4PDOA 3PVBA 3OVVA 4G9CA 2C5NA 4F4PA 1WZYA 1Q97A 3EOCA 3I7CA 3OTVA 5HE0A 5HU9A 1U46A 4EEVA 3LOKA 1ERKA 5CXHA 2C3IB 3RBWA 4M69A 1MRYA 3S00A 3V8WA 2PVMA 4MCVA 2R3JA 1YOJA 4RWJA 5IUHA 3ANQA 1O6YA 2A4LA 4JX7A 5FG8A 4O7SA 4ZLYA 4MVFA 4KIKB 2ESMA 4FSNA 4HPUE 4RC4A 4O84A 3SDJA 5IQBA 3GU4A 3UO6A 3BHUA 2XRUA 4ZS0A 2OK1A 4FKWA 1P4OA 2ZYBA 1K9AA 2W1IA 5E7RA 2VX3A 3NZ0A 4I6FA 3HV4A 3PVUA 3D2KA 3DFAA 4UMTA 2WMVA 1ZAOA 4XP0A 4ANLA 4FT9A 4GYGA 5DNRA 3LXPA 3O50A 3PWYA 1DI8A 2JDSA 5CEPA 1U54A 5F94A 5HLPA 3ULZA 4ZTRA 1ZOGA 3HMNA 3MIAA 2YISA 3VC4A 5FDXA 3C50A 4ASXA 2QKWB 3H3CA 4G31A 4KBKA 3UP2A 3UQGA 3CKXA 4U80A 4YZCA 3RM7A 3VQHA 4FVPA 4O0XA 4RC3A 5ACBC 5T68A 5BVEA 2GHGA 5IQCA 4BTFA 4HYUA 2FSOX 4CV9A 4JR3A 3QXPA 5G1XA 3M11A 4EZ5A 1YDSE 5CU2A 3SOAA 1A06A 4BGHA 4TW9A 3PZEA 3QZFA 4A06A 1FGIA 3KQ7A 5IKWA 1W7HA 3CPBA 4OTGA 5L2TA 3BYOA 4ACGA 4P90A 2GCDA 4GFGA 1R1WA 4YZNA 2VO6A 3RHXA 2BALA 3C4XA 4UALA 4YNOA 4JQ8A 5AR8A 5ETFA 1BKXA 3ZYAA 4DAWA 3GC0A 2XCKA 3NUSA 4LFIA 3PY3A 2G2HA 5EG3A 5BYLA 5L6WL 2JKOA 3IECA 1MRUA 4IB0A 3TNIA 4KBCA 2QVSE 5IMEA 3DA6A 5CSVA 5CVHA 2RFSA 1JQHA 1SNXA 1WFCA 2C6LA 2OF4A 2PZRA 2XYNA 4H58A 4CFWA 3BPRA 4NJDA 4R3PA 2XKCA 4GFMA 3R9NA 4DEIA 3EHAA 1V0BA 3E92A 3RM6A 4C3PA 3FJQE 5M4CA 3W33A 3OHTA 4QPAA 3AC4A 2GTMA 5CQUA 4EORA 3M2WA 5LOHA 2WTIA 4QYHA 1GIIA 2GU8A 4DHFA 4BDKA 1Y8YA 3FMJA 3QCSA 3ZUUA 2PPQA 3KULA 2W1GA 1JOWB 3VBQA 3IPHA 4O2ZA 3P1AA 5C03A 3UOJA 3UJGA 4S2ZA 2V0DA 2FUMA 2F7EE 4EZ3A 3BWFA 3KB7A 2UW4A 3EYHA 4EUTA 1Q8WA 3S2PA 3R73A 2B9IA 5CWZA 2W99B 2NP8A 4QMTA 3NSZA 4RWLA 3PA4A 4F63A 4UY9A 3EFLA 4IWPA 2QKRA 3VBVA 4EK8A 4ZJIA 4WD5A 3UYTA 3TDVA 3FLQA 3JVRA 3L8PA 3EKNA 3MYGA 4MD7E 5CVGA 5J9YA 5A4TA 4PMMA 1OKVA 5B2MA 3DAJA 4J95A 4F1MA 4TRLA 3UC3A 1NT2A 1Z57A 4DFBA 3TTJA 4BCIA 4H39A 2OIDA 4Y95A 5L2SA 3K3IA 4ZY5A 2FA2A 2WMTA 3JPVA 4M66A 4OLIA 5DFPA 2OXYA 1OIYA 2WD1A 2WTDA 4ITIA 3EYGA 3C0IA 5DPVA 4YZ9A 3GP0A 4CMOA 1XH6A 3PPZA 1DAWA 2HXLA 5I9ZA 3AMAA 3ZHPC 4I3ZA 5IPJA 1XH8A 3ORPA 5HD7A 3C4FA 4WNMA 4F99A 4F9BA 4E4MA 3U9CA 4D0WA 3E8EA 2QOIA 4P5ZA 4DEBA 5E8TA 4MNFA 2H6DA 3I5ZA 1WBNA 4I24A 5DA3A 5CXZA 4XP3A 4AZVA 3PSCA 4UXLA 5J5TA 4HW7A 4I0TA 3COHA 5C4LA 2PE1A 1FPUA 2JFMA 3EQHA 2O64A 5GZ8A 1ZMUA 3LAUA 1Q8ZA 1XBCA 3LFCA 4BBEA 3VWAA 4LGHA 3I7BA 3V04A 2W06A 3A62A 4BCHA 3MVLA 3IOKA 4C3RA 2XMYA 3UQCA 5KZ0A 4B0GA 3UTOA 4X3FC 3WIGA 3F9NA 2ZB1A 4B99A 5F1ZA 4G6LA 5GHVA 3OCBA 4HCVA 4R1YA 4RWIA 4OT6A 2VWWA 2WTKB 4PY1A 2JIVA 3VW8A 1JBPE 2XEYA 4D4RA 4UMPA 4CTBA 3DTWA 5FUTA 2CKOA 5KUPA 3I4BA 3RAHA 2VWUA 2EVAA 4DTKA 3NUPA 4U5JA 4JBQA 2WQBA 3EB0A 5H9BA 3F69A 3H10A 2IZTA 2QONA 1YWNA 4G17A 5FLFA 1CKJA 1W8CA 1GZNA 3ZO4A 3KL8A 1LEWA 2GNIA 3A60A 4YGAA 5LVLA 2XK4A 2PVFA 1BUHA 1KE5A 3EL8A 4I5HA 4WRSA 2C5XA 4G9RA 3Q2JA 3BWJA 4DEHA 4DLIA 3QCYA 3DCVA 3LXNA 4O96A 2XK7A 3PY1A 2PMOX 4RIXA 5IUGA 3GC7A 3ODYX 3TJCA 4MQ2A 2YDIA 1F3MC 2F49A 3HP5A 3BZ3A 1JSUA 4IZ5A 3ZUVA 3Q96A 3II5A 3KXXA 3JUHA 1FVRA 4CRLA 4EK6A 2DQ7X 4FEVA 4PTGA 4R8QA 4NTTA 3A99A 3OUKA 4R1VA 2IZSA 2WTVA 3KRRA 3HMMA 4QTDA 2QLUA 2VV9A 2XIKA 4GKHA 3FZSA 4GJ3A 2UZBA 4NK9A 1Q3WA 4OTWA 5E90A 3PIZA 4FV0A 3QALE 2W05A 2YM8A 4FNWA 4DT9A 3DS6A 3DU8A 4U42A 5C8KA 5K9IA 5AR5A 1YXTA 2XVDA 2JKKA 3JYAA 4K2RA 4IC8A 3TWJA 4YMJA 5C26A 5JH6A 1QCFA 3VS3A 4YJQA 5DT0A 2PVNA 2GFSA 2EXCX 3FC1X 5D10A 5CALA 5JSMA 3U54A 4EOLA 1SVHA 2F4JA 4Q5EA 2RGPA 4U0IA 3HDMA 4D5KA 5GJDA 3S95A 3HMPA 3AC1A 4ACHA 4GS6A 4C62A 4RJ7A 5IEVA 3MW1A 2BTSA 3BI6A 1CKIA 5HORA 4YJRA 3LFQA 2GNFA 3ZRKA 3UZRA 4C35A 4TWNA 5CU4A 3W8QA 3SVVA 3VS5A 1EH4A 4FSMA 4U79A 5CANA 3O2MA 3ZCLA 4KABA 1CTPE 3Q9XA 1I09A 3PRFA 1CDKA 1X8BA 4CZYB 3WZJA 2UW9A 3VUGA 2R3KA 5JZJA 4AX8A 1Q3DA 2Y0AA 3HV3A 4FKTA 3AG9A 1J7LA 3NAXA 4Y72A 5IUIA 3BE2A 3FLWA 5I3RA 2UZEA 4BN1A 3HAVA 4E26A 2OG8A 3PPJA 1WBPA 4P2KA 2VTAA 4EKLA 3TACA 2C6OA 4X3JA 4RZWA 3FI2A 4G34A 5BQ0A 3F66A 3SRVB 3OY1A 4QRCA 5CSWA 4DFZE 3VO3A 3F5PA 4BCGA 5AFVA 4LMUA 4O81A 1PYEA 4RIWA 1U5QA 4CFMA 3LJ1A 3HDNA 5J9ZA 1SNUA 4E3CA 4NW5A 3OWKA 5M56A 4FV5A 4Y73A 3FV8A 5IEYA 3BE9A 2GS2A 4GK4A 2QO2A 4KINA 1WBSA 3LFSA 1OM1A 3HL7A 4IWDA 4AT4A 2CJMA 3KRJA 4CCUA 4BKJA 4ID7A 2UVZA 4QYYA 1R0EA 3QCQA 3VS7A 5KKRB 3S0OA 4RC2A 5JN2A 4ZTQA 3T3UA 4K0YA 2W1HA 5DYJA 3JS2A 3NNWA 3R9OA 1GOLA 3CD8A 3MS9A 4Y8DA 4E4XA 3FEGA 2YCSA 4KIPA 3RPSA 3BU5A 4ZLOA 5F4NA 4AQCA 1Q8TA 5T3QA 2ITPA 2C30A 3E8NA 4IFCA 5FTQA 5ANDA 3KREA 4JLCA 4LL5A 2J0IA 3MV5A 2ONLA 3BRBA 5E8VA 1BL6A 3RHKA 2QR8A 4I6QA 2XJ1A 3LM0A 3VBXA 3KF4A 4EQMA 4PDPA 3CS9A 3DT1A 2WQNA 2X4ZA 1ZZ2A 2O65A 4UN0C 4GT4A 4KKGA 3E62A 3RMFA 4R3RA 3VS4A 2XUUA 3PFQA 4K77A 4LI5A 4X7QA 1JKLA 3IGGA 3FZ1A 4PDYA 2RSVA 2NNWB 4CXAA 4S31A 4B4LA 1B6CB 1J91A 4V0GA 4MXYA 2B53A 3ZXZA 1J7IA 1ND4A 4JIAA 4JR7A 3BEGA 4M0ZA 3R7YA 3TV4A 3MFRA 3MGYA 1W84A 1PF8A 3SXRA 3U6HA 1XBBA 5JFXA 2Y6MA 3BYSA 3CGOA 5JGBA 4TNBA 4IAFA 4ZSJA 4I4FA 1P4FA 2PZPA 3R00A 4L9IA 1YW2A 3RI1A 4DA5A 4J53A 3R01A 4EYJA 2OLCA 5HNIX 2I7QA 5AUUA 4FIIA 5CAPA 3BX5A 3VAPA 3DQWA 2FSMX 4J52A 1ZYSA 3GU5A 3DAEA 2ITNA 2VTIA 3ACKA 3K5VA 2WQMA 4Y85A 2CSNA 5EDPA 3ZBFA 5EYDA 5J7BA 4FIHA 1ZOEA 4RIYA 3M42A 5D11A 2ACXA 5ITAA 5LMKC 3VBYA 5JMSA 2HZ4A 5CZIA 5AR4A 3E5AA 4AGDA 4AZSA 3DOGA 2X81A 2J0MB 5E8SA 5BPYA 1WBVA 3GUBA 5HVYA 1H28A 1V1KA 3LZBA 2W7XA 3OP5A 3OROA 3P08A 4EH7A 5AUXA 5CSXA 5AWMA 4BI0A 1OPLA 5GJFA 4A4XA 3I81A 3ORXA 2VN9A 2X4FA 2KULA 2YJSA 3QA8A 4YPDA 2PMLX 4O21A 4PNKA 2VTMA 4IXPA 3IKAA 4AN2A 4YTCA 3WE8A 2ITXA 2AYPA 2GHMA 1MQBA 2XEZA 5EHYA 3NUAA 4H3QA 4XRJA 4Z55A 4PUZA 4I6BA 1QPJA 3PVWA 2X7OA 3RP9A 5HICA 4AGUA 4Q5HA 4J98A 3ZC6A 4OUCA 2NRUA 1Q5KA 3KEXA 1H1PA 4O83A 5FM2A 1S9IA 5TOZA 4EH5A 3CC6A 2CN8A 3Q4TA 4L67A 5FEEA 5KX8A 3JY0A 5AR2A 4L52A 3K3JA 4AW1A 1WBOA 1XJDA 4JX3A 2E2BA 3AT3A 4NL0A 1P5EA 4YZDA 2BR1A 4HVSA 4J97A 3R83A 3R7VA 1YXSA 3CGFA 4NEUA 2WELA 3DKGA 4FK3A 4OTDA 3UOHA 3TZ8A 4TTHB 4G2FA 5BYYA 5M4IA 3ORKA 4ANSA 4IH8A 2PZYA 5HI2A 2W5BA 3IW5A 2W1EA 4FSTA 3ZONA 2ITUA 3ZLSA 4FV9A 2ITTA 4W4WA 4CYJA 3QZHA 4I41A 5IQDA 3FBVA 5EDQA 3E64A 5A6OA 3KVXA 4IMYA 2XKDA 2PWLA 4WG5A 5BVNA 4TT7A 3A7JA 5HNGA 5IA4A 2XNMA 3GGFA 4ZP5A 4BCOA 4F9CA 5HE2A 4F9WA 3D14A 5BUIA 2Y9QA 4E4NA 4CFVA 2UW3A 4WUAA 2IW8A 3E63A 3I6UA 5LCKA 5AIRA 3EJ1A 1YHWA 4KA3A 1MUOA 2CGWA 3Q04A 5LMAA 1E9HA 2F7XE 4W8DA 5CNOA 3QD0A 3AMBA 2PK9A 4XX9A 4AOIA 3R7UA 2UZLA 1L3RE 1UKIA 4BDIA 4JAJA 1BMKA 1XKKA 4FVRA 4ASEA 2YJRA 3UIBA 5LWMA 5J1VA 3CTHA 1MRVA 3HRFA 4FT5A 4RZVA 1E1VA 4FL1A 4MH7A 4DF3A 4AXAA 2XNOA 4ITHA 2KTYA 3TNHA 4F7JA 2RF9A 2HENA 4FIFA 5C8NA 2YIXA 2YN8A 1RJBA 1WVYA 4LUEA 4O0WA 4HVIA 3HUBA 1SMHA 3VJOA 2UZTA 3RGFA 3LFBA 3TXOA 2WZJA 2JDTA 2C3LA 3NIZA 2EB2A 4YURA 3BYVA 3TCPA 3PIXA 3UYSA 2BHHA 3HLLA 4WG4A 5TR6A 3FKLA 3ZSGA 2QCSA 4IVBA 4UV0A 4H3BA 5C8MA 2XNPA 4O0YA 4YLKA 4F1TA 4FIJA 3ZUTA 3AC8A 4AF3A 5J9LA 3BGPA 3LFAA 4FOCA 4HNFA 4KIKA 4L3JA 2VTPA 3F2NA 4OBQA 4EOIA 5I9VA 3Q3BA 3ORTA 2BRNA 4C61A 1TQMA 4GMYA 1Y6AA 3UIXA 1PXOA 4NH1A 3CQEA 3ORLA 4IJ9A 2QO9A 3ZRMA 5CAOA 2GNLA 3MDYA 4DH5A 3CSVA 3F5UA 2HY81 2O3PA 5KCVA 3H9RA 4GK2A 4E5WA 4CGAA 3H9OA 3HECA 5GJGA 2FO0A 5D1JA 4LGDA 3SC1A 4GRBA 5F95A 4V01A 2WEIA 2WAJA 4EJ7A 2O0UA 2RG6A 2ZAZA 4J1RA 1FMOE 2BRGA 3CIKA 4JQ7A 4DLJA 3IDPA 4FK6A 1P2AA 4DTAA 2X1NA 5E91A 5AAFA 4BC6A 4RVTA 3DXQA 3FQHA 3QTIA 3GU8A 2G2FA 3R1QA 3LJ0A 4ASDA 2UZUE 4ACDA 3GCUA 2GPHA 3EKKA 3WOWA 4U9AA 4WG3A 1FGKA 3D4QA 3LLTA 2YITA 2WQEA 4NCTC 5H8EA 4BGGA 4L3LA 4FTLA 3UQFA 3FI8A 1ZMWA 5A4EA 2Y8OA 1URWA 5EI8A 2P0CA 4RVKA 4EK3A 3FKOA 2XK3A 3ENMA 3N4TA 2YM6A 1OVEA 5E1EA 2R7IA 4B7TA 4MEDA 1BX6A 5M4FA 5EW8A 4GUEA 2XIZA 3UIUA 4C4JA 3QF9A 1PXJA 2PL0A 4RGJA 2OGVA 4PTEA 3D15A 2BRBA 2HZNA 3KXZA 4FSRA 4L00A 4D58A 1OIQA 2VTRA 5E92A 3F3TA 2PMNX 2OFVA 2R3LA 2W9ZB 5AM7A 2Q0BA 2WMUA 3D83A 4AN3A 4AOJA 1JWHA 2XJ0A 4BGQA 5FXRA 2CMWA 2CGUA 4QNAA 3WZKA 3F7ZA 1CMKE 1ZARA 3DNEA 4XG6A 3U51A 5CEKA 4CG9A 4USDA 3O8UA 1XO2B 4PP7A 5GIOE 5AX9A 4YZBA 4EH3A 1AQ1A 5BYZA 4DGNA 4RVLA 3GFWA 4R5SA 3TKUA 1KE9A 4H3PA 4IM2A 5HQ0A 5D9HA 3TV7A 5AA8A 2YDKA 4FTJA 3G51A 3PIYA 3F2AA 4DGGA 3JXWA 5FEDA 5T6KA 3C4WA 1JPAA 3QTZA 3SHEA 3OUNB 4WOVA 4I5PA 2H34A 4M0YA 4C34A 4DEGA 2V5QA 2WTCA 3LCOA 4FTRA 4GT5A 4O2PA 4XG3A 3R7EA 3ENHA 5KHXA 1L8TA 3ZLYA 4GH2A 4O7LA 4HGTA 3R8PA 3EZRA 3ZH8A 4AOTA 3AOXA 4D5HA 1JKKA 4IB5A 3HUCA 3EQPA 3KK9A 3MA3A 4TXCA 2GS6A 4WUNA 5CS6A 4BDFA 4LYNA 1ZXEA 5AUVA 3KVWA 5A4LA 2GS7A 3R1YA 2R7BA 4HOKA 4O6LA 2VWYA 5HLWA 2H96A 5JGDA 4KIQA 3UPXA 3VUMA 3OBJA 4A4LA 5GINE 4O7VA 4JDKA 3QX2A 4ASZA 3FSKA 4ANOA 2ZV7A 1OKZA 5DVRA 3GI3A 4M3QA 3EQFA 3FXWA 4IAAA 5L2IA 2OIBA 1DI9A 4BDGA 4F6SA 2QQ7A 4E5AX 5HLNA 4U8ZA 3KXHA 1FMKA 3EZVA 2IWIA 4ZMEA 4I21A 5IQEA 4IAYA 3PA5A 4DH8A 1GZKA 1IEPA 5EKNA 3HX4A 2X2KA 2R64A 4FKJA 3MY1A 3PYYA 2JEDA 4XYFA 4BR3A 3E93A 3G2FA 1PMEA 3PG1A 2J2IB 4J8NA 3FQEA 3TNWA 3KN5A 1PXMA 4M84A 3MH0A 3SQQA 4LV8A 1DM2A 1G5SA 2VTLA 3BEAA 4FE2A 2C5YA 4AW5A 3EQIA 2C6KA 1H24A 5ETIA 1WBWA 1IASA 1IAHA 1LUFA 2XJ2A 2C3JA 4EZ7A 3D2IA 3GOKA 3OT3A 2GHLA 5K5NA 4O7TA 2YWPA 4QTBA 2DS1A 3QTUA 5HZNA 4RX8A 5EI6A 1JNKA 5KMIA 4XG4A 5D12A 2QURA 4MWHA 3FL5A 2GDOA 4IB1A 1H0VA 3COMA 3EQGA 4OT5A 1YI6A 4EOOA 2PTKA 3R02A 4QQTA 5JT2A 4X0MA 1XH7A 4XV9A 4FICA 3F5XA 4BTJA 3CQUA 4E8AA 5FRIA 2W1DA 4EH4A 4QP2A 3PPKA 5TO8A 2YM4A 4ANMA 1YXUA 1XQZA 2O2UA 5HKMA 5IG1A 4UWCA 3QTQA 3E8CA 4FZFB 4HVHA 1F5QA 1YXXA 4H1JA 4TYHB 4YR8A 4C37A 1BLXA 3C5UA 5HO7A 2BAKA 3C5IA 2YIRA 1YDRE 5LVNA 4S30A 1OL2A 4AACA 3FSFA 5HNBA 3OZ6A 4CEGA 2PUPA 5HCYA 3OEFX 4FEWA 3BHVA 3UMWA 3FUPA 4TN6A 4BWXA 4ZZOA 3QTSA 4APPA 2IVVA 1KOAA 4FBXA 3CKWA 4G16A 2PY3A 1CSNA 3L9MA 1ZYDA 4EQUA 1REKA 3AD5A 4JBPA 3PXFA 4DGLC 3LFDA 2P2HA 4QNYA 3TG1A 3QQFA 4Z9LA 4D2PA 5KMMA 5E1SA 3R9RA 2IVTA 4RJ8A 2HCKA 1KUTA 5G6VA 4YHTA 2X6EA 2FSTX 3VHKA 4J7BA 2RG5A 1B38A 4X2FA 3WYYA 2PMIA 1YHSA 5LARA 4WA9A 3PXYA 5ETAA 4XCUA 1W98A 2YAAA 4OTHA 4BYJA 3QLGA 3HP2A 1GNGA 2NRYA 1YQJA 2ZDUA
chains in the Genus database with same CATH superfamily
2FSLX 5IU2A 2IVUA 1H1SA 4TWPA 3QQJA 4BDBA 4GCJA 1JKTA 3FDNA 3S1HA 2VTHA 4FV1A 5L3AA 5HO8A 4DYMA 5FBOA 5IA5A 1K3AA 2OIQA 5AP5A 3S3IA 1Z9XA 3FLNC 4GVJA 2WQOA 3PZHA 1WVXA 1Q4LA 2A2AA 3ZEPA 1XHAA 2CN5A 2PVRA 3UMXA 4YP8A 3H4JA 2J0KA 1KOBA 3DBQA 3R04A 3CQWA 4D4SA 3V5LA 3ZFMA 3PJ8A 1OMWA 2C69A 4DBXA 4PF4A 4GU9A 3VF8A 4FKSA 2XBAA 5DYJA 3CY3A 3RKBA 3PXZA 4M68A 2QOQA 4KNBA 4DGMA 2YZLA 5HBEA 4XMOA 4PX6A 4YZMA 1BI8A 4LQMA 4E1ZA 4PTCA 3U4WA 3OFMA 4FOBA 5DBXA 4KRCA 3SRVA 4IVAA 3V8SA 4HVGA 4C2VA 3MB6A 2GSFA 3FZTA 3QZIA 2XNBA 5DEYA 3OBGA 3R30A 4TKSA 2BAQA 4MKCA 1YI3A 3KRXA 4BIDA 2R3IA 3DBCA 4IAIA 4L6QA 4AW0A 4CQEA 5KMOA 3Q32A 2I0YA 3OW4A 1FOTA 2E9PA 3LM5A 1M17A 4GW8A 4QMLA 2X9EA 5KMLA 2XNNA 2VNWA 3DBEA 3SLSA 2R0IA 2BFXA 5IISA 5CX9A 5EI2A 3JY9A 3KK8A 2BHEA 2XIYA 4ZZMA 3VRYA 2IVSA 4IWOA 2I1MA 3FMLA 4I22A 3KMMA 3FY0A 3NW7A 5DT3A 5EYKA 5AX3A 4M67A 3LVPA 4BHZA 5L2QA 3P7CA 3BHHA 2VX0A 3PP1A 3UVPA 4BI2A 4UMRA 2J4ZA 5AA9A 3UDZA 3NVMB 5B7VA 5AV0A 3KF7A 3SV0A 5B2LA 4HCUA 1VYZA 4XV3A 5HCZA 4IJPA 3Q9ZA 2QG5A 4APCA 4DH3A 4D9TA 3WILA 4I5CA 4BDDA 4ZAUA 3R28A 3BLRA 3EQDA 2Y4PA 1M2RA 4IDVA 3IQ7A 1RE8A 3ZLWA 3NW6A 2I0EA 4PV0A 4EK4A 5IQHA 4FT7A 3W2RA 4XBRA 2E9NA 4MXCA 4YLLA 4RLLA 2WIHA 4C4HA 3OWLA 4G5PA 1OB3A 1XH9A 4HVDA 1TFFA 2C0IA 3T3VA 3L1SA 3AKJA 3E7VA 4ZXTA 5AP4A 4M13A 1QL6A 4AA0A 3NNVA 4A9RA 3Q60A 2C5VA 4YJVA 1H00A 3VVHA 3DKCA 3ALOA 4MTAA 1W2DA 3PJ2A 3GT8A 3LCSA 2IG7A 3P7BA 3T8OA 4FV7A 3SW4A 2UZDA 1URCA 3E7OA 2V7AA 3ALNA 4FSUA 4BHNA 3HAMA 5LQFA 4QMZA 4DEEA 2Y4IB 2W5AA 4BDAA 2CCHA 3QC4A 5FBNC 4YU2A 4FTAA 4TZRA 5M4UA 2H9VA 4DG0E 4EOKA 4QYEA 1IA9A 4C33A 3IS5A 1ZYJA 1YDTE 4KSPA 4MXAA 4TYGA 5EOLA 4O7RA 2OBJA 3TIZA 4IACA 4PMTA 4WT6A 3LMHA 4QPSA 3F88A 4FUYA 1KWPA 3C13A 3S4QA 4GYIA 4PP9A 2A0CX 2JGZA 3G0EA 4UMQA 4W4XA 4QO9A 3DJ5A 3FHRA 2C4GA 5E8WA 4ZY4A 4ZS4A 3MVJA 2IW9A 3VUHA 4I6LA 3G0FA 5A46A 4XEYA 3NUUA 3MH2A 4JL9A 5EDRA 3W2PA 2JDOA 5EYCA 3BELA 2UW5A 3D7ZA 1OKWA 3KRLA 4XS2A 3JVSA 3H30A 4IANA 5H2UA 2R3NA 4ONAA 3O7LD 4FKIA 2G01A 5EOBA 1SVEA 3QRTA 4AA4A 4YC6A 4AE9A 5JQ8A 1PXNA 1XH4A 3OCSA 4YO6A 4CLJA 4CKIA 4MF1A 4AT3A 1JKSA 5CEMA 3H0ZA 3NNUA 5J79A 2W1ZA 5EK7A 3ZBXA 2F7ZE 3TJDA 3GENA 5LMBA 1ZZLA 3QGWA 4FJVA 3BHTA 1PKGA 3C1XA 2BIKB 2B4SB 3BIZA 4PRJA 2Z7LA 4AWIA 3LXLA 3QTRA 2ZJWA 2HK5A 2W17A 3BQCA 4FTMA 4CFXA 5IF1A 3O51A 2W5HA 4WO5A 2WKMA 1JSVA 5GZ9A 5LVOA 3I0QA 4QMSA 1O9UA 2XF0A 2XIRA 3WF7A 3U55A 1Q8YA 3W2CA 4LRKA 5E8ZA 2XK6A 3F3ZA 4IIRA 2VAGA 3WF8A 4GG5A 4I92A 3R1SA 3DXPA 3F61A 3P5JC 4BCNA 4U3YA 2HWPA 1OUYA 3DDQA 4JBOA 2XS0A 3EFJA 3IG7A 4MQ1A 4AGWA 3AT2A 3DB6A 3FAAA 3FMKA 5FXSA 1T45A 3BL7A 1OL6A 5GIPE 5DG5A 3R8LA 5M51A 5AMNA 3AT4A 3KA0A 2BZJA 2VTOA 3GQLA 4C7TA 3HV5A 1RQQA 2UZVA 4RFYA 5I3OA 3VUDA 5M44A 2YCRA 4O7NA 4QD6A 3O5AA 3CTQA 3HRBA 3W8LA 5M07A 2JLDA 4RPVA 4JI9A 4NKSA 3ZO3A 2ONLC 4I4EA 2JIUA 4BZDA 2OFUA 1G8SA 5HBHA 4FYNA 2UW6A 2R3FA 4A07A 4IW0A 1UWHA 1LPUA 4HJOA 4XP2A 5IA1A 5KBRA 4Q9SA 4RA5A 2YLEA 1JAMA 3REPA 2WXVA 3L8VA 2ZV9A 1PXLA 3FI4A 4IAZA 5AR7A 4EHEA 4F6WA 4II5A 1OECA 1SYKA 3LFNA 2B9FA 3CPCA 4FSWA 4LRJA 4NM3A 3BLAA 4FKGA 4O7WA 4Z3VA 3NCZA 3NMUF 3TN8A 3T9IA 3R1NA 1H1RA 4O91A 4GU6A 5AV4A 3HV6A 4OR5A 3VUIA 2ZMDA 3FI3A 4JVGA 3VHEA 3KCKA 5BUEA 4FSQA 3EFKA 5TF9A 4CSVA 4FGRA 4DHZA 1HCLA 4E6QA 2AUHA 2OJGA 3EMGA 3W1FA 2Z7SA 3OXIA 3PXKA 4EWQA 2C0OA 4HPTE 1TVOA 4ANNA 4ZJJA 4QQ5A 5K4IA 3ZOSA 1AD5A 2WEVA 3MWUA 2FB8A 3R2BA 3BCEA 5CLPA 3A7HA 3W10A 4BDHA 3HYHA 1NVRA 1SZMA 5CENA 1ZYLA 4BL1A 4QP4A 3MPTA 4QMWA 5C1QB 5DGZA 2ETKA 4TYIA 1PYXA 1RW8A 1TQPA 3DXNA 3MJ1A 4CFUA 5KMKA 2QU5A 1Q24A 2YM3A 5A3XA 5E9EA 3O8PA 3W55A 2FVDA 4N6ZA 4EHVA 1G8KA 2ITYA 3NVKI 3ZM4A 2BDWA 3AQVA 2J50A 5IQFA 3PSBA 3A61A 3NYNA 3QKKA 4O0SA 3R7OA 4IZ7A 4GL9A 4LOPA 3MY5A 3RAWA 2O63A 4PL3A 3ZMMA 3U4UA 3Q5IA 4FKOA 4AFJA 4F7SA 4OBOA 4PL5A 3TKHA 4BTKA 3L8SA 4JRVA 4A9TA 2VD5A 2AQXA 2X8DA 3OTUA 1YXVA 4O4BB 4F70A 5EW9A 5CU3A 3FXXA 2GMXA 4FNXA 4U40A 2A1AB 3QQUA 2OXDA 2J6MA 2FGIA 4N0SA 3ZXTA 3ITZA 4FL3A 2C3KA 5A54A 3A7GA 4X3FB 1UNGA 4NM0A 2QI8A 4K11A 5FWKK 4FZ6A 3GFEA 4I5MA 2V55A 5JQ5A 3W0NA 2Y6OA 2GQSA 4YJTA 3N4UA 2JAVA 1H4LA 3UC4A 4FEQA 4P7EA 4RX7A 2BFYA 3FY2A 2VTNA 4JDHA 4CKJA 1YHVA 3BKBA 1IRKA 4L68A 4Y83A 3UDTA 5IEXA 4IAKA 2VUWA 5DHJA 3R22A 5HG9A 2PUIA 4DFYA 4IZAA 4QMPA 3RWPA 2JFLA 2ITOA 4G3FA 4K8AA 2CGXA 1PXIA 4FNZA 4Q2AA 3SAYA 4BKYA 4F9AA 5EQPA 3OWJA 2VTTA 3GU6A 4GIHA 2WMSA 1OBDA 4FKQA 3BQRA 3AC2A 1U5RA 4B6LA 4FODA 4E4LA 3DKFA 3OCGA 4EH6A 3QRIA 2VO7A 4U3ZA 4RX9A 2J5FA 3RNYA 2VRXA 4LL0A 4CZUA 3DZQA 3H9FA 4HYIA 5ANJA 4U41A 2XKFA 3DK7A 4WBBB 5M55A 3WZDA 2Q83A 4CZTA 4EHZA 2VTSA 3G6HA 2B52A 4IFGA 3ELJA 3OT8A 4FKVA 4YNEA 4FX3A 1W82A 5DOSA 3WF5A 3Q2MA 4A9YA 2JKMA 2VZ6A 4FV6A 4JG6A 4A4OA 3PUPA 5JKGA 2IZRA 3ORMA 5K3YA 2QC6A 2I0VA 2XM9A 2ZDTA 3O0GA 4XHKB 2Z8CA 3HZTA 2UW8A 4Y46A 3G9LX 5H3QA 2PULA 4RMZA 1XR1A 2IW6A 3QUEA 4ALVA 2OJFE 3MVMA 3O23A 3O71A 4NZWB 1H0WA 3QX4A 4W8EA 1WAKA 2QOKA 3UVQA 2CNUA 4V04A 3VW6A 5EHOA 3Q5ZA 4E73A 1M7NA 3KMUA 4EWHA 4DDIA 4NKAA 3U6IA 5A4CA 5CVFA 2YLFA 3TNPC 5D7AA 4DH7A 1BI7A 4FYOA 1UKHA 1WMKA 4GFOA 4K18A 4L3PA 4IX4A 4DHIB 3AD6A 4XG8A 3AC5A 4LGGA 4N70A 1M2PA 3L8XA 2A27A 4MK0A 1QPCA 3ZFYA 3Q9YA 3KCFA 3MA6A 2PVYA 3DZOA 2HYYA 2IPXA 2YCFA 4QQJA 2OICA 4QOXA 5EHLA 1PY5A 4QMXA 4YSMA 5H8BA 4FZAB 3RK9A 3OOMA 4AZEA 3QWJA 5CZHA 3NCGA 3PLSA 4C38A 2FH9A 2X7FA 4F65A 3FPQA 3FKNA 1VR2A 3GXLA 3ANRA 4K33A 3RVGA 4F08A 4LV5A 2V22A 2WOUA 4YJUA 5FM3A 2C47A 4FTNA 4RBLA 1SM2A 3Q4CA 4X2KA 3ZLXA 5HIEA 4R78A 4LRMA 4NM5A 1FVVA 3ZO1A 2BVAA 3E88A 4CFFA 1Y57A 3NIEA 3ORIA 4RA4A 4A9UA 4O0VA 1ZY4A 5CF6A 4FVQA 2BILB 2XA4A 3NRMA 1UU7A 5CSHA 5BVWA 4D1XA 4FEXA 4DG2E 5C27A 3IDBA 3OC1A 1UNHA 5B2KA 4M8TA 4KS7A 5ANEA 3E87A 3CCNA 1YOMA 4UZHA 3FHIA 4ALUA 4D2TA 3D5WA 2YIWA 5HX8A 4D1SA 5A6NA 3CR0A 2VX1A 4BB4A 4D2WA 4IX6A 5E8UA 3ERKA 1REJA 4UWBA 3QL8A 3TTIA 2V62A 5KHWA 2ZVAA 4NIFB 3C51A 3R7IA 2BZHB 3P9JA 4I1ZA 3HKOA 5JZNA 3RALA 3W2OA 2J51A 3QZGA 4AP7A 5IMXA 2WTWA 3IK3A 4KIOA 4ZIMA 3HA8A 4ZY6A 2W0JA 5EKOA 1O6KA 1LP4A 4HGSA 2REIA 4TYHA 3UE4A 3VBTA 2J5EA 2X7GA 3LXKA 4F1OA 4F0FA 2R3MA 2BTRA 4YSJA 3W0OA 4QMMA 2J0LA 1FINA 5HCXA 4EOSA 3HGKA 2RL5A 5LVPA 3LHJA 3N9XA 2J0JA 3DAKA 3NWWA 4K1BA 4R7HA 4NFNA 4DINA 5CI7A 3SOCA 4WIHA 2WMQA 1QMZA 3POZA 4FG7A 4KB8A 3RTPA 4RSSA 5HG5A 2CKPA 5AV3A 2XRWA 3UP7A 4XJ0A 3B2TA 4QTAA 5CI6A 3UNZA 3DLZA 1H1QA 4DH1A 2XALA 3OMVA 1M7QA 5D7VA 3B2WA 5HO6A 3Q52A 4C4EA 4DFLA 2QO7A 4MX9A 3OXZA 3DK6A 4BCFA 4OTFA 4C2WA 2CLQA 3PA3A 4AT5A 4CNHA 4BFMA 2BDJA 5HG7A 5IA0A 4YLJA 5AUZA 2PE2A 2XB7A 2QOFA 4YBJA 4JQEA 4YJNA 3PG3A 4JDIA 2YFXA 1W0XC 2OZAB 2RFDA 3PRIA 4TYEA 5FGKA 5HVKA 5JGAA 2WNTA 3GBZA 4KKEA 4N6YA 3SD0A 5BNJA 2QHMA 4M7IA 4ARKA 4C02A 1H26A 4L46A 4C57A 3ROCA 3UO5A 4UX9A 2WPAA 3ORNA 3NFGB 4C58A 4BYIA 2F57A 1STCE 4D0XA 1QPEA 2BCJA 5CSPA 3FQSA 3ZSHA 3NNXA 4C4GA 4ZTHA 2QLQA 3AGLA 3TKIA 3ETAA 3CE3A 4FKUA 3NS9A 3VUTA 5BUJA 2WB8A 5HEZA 1ST4A 4QMNA 5CY3A 2G2IA 2R3OA 5JRQA 4PPCA 4FTOA 3G9NA 4DFXE 5BVOA 2B55A 3UPZA 2E9VA 4R7IA 3ZM9A 4JG8A 3EFWA 2C68A 1VEBA 2XK9A 3O17A 4FTQA 4O1OA 4AZTA 1VYWA 4EKKA 1PMVA 4BRXA 4O27B 3POOA 4ZZNA 3V01A 1J7UA 1H27A 4FNYA 4GV1A 4I0SA 2XH5A 1UU8A 2OJ9A 2YM7A 3ZRLA 3UOLA 3HMOA 5KZIA 3U8WA 2Z02A 3WYXA 1VZOA 3HVCA 3THBA 3DV3A 5HTCA 2GFCA 5JFVA 4UEUA 3NAYA 3K54A 4GSBA 2C6DA 3ZO2A 1H1WA 4CTCA 4EI4A 4LG4A 3VQUA 3SG8A 4MBLA 4E93A 1VJYA 4FSYA 4HCTA 4WSQA 4M15A 1QPDA 2G9XA 3V5JA 4M12A 5DWRA 5JRSA 5BMMA 1ZOHA 4TYJA 2WTKC 4FTIA 4NUSA 5K0KA 4E6CA 4EOQA 5LWNA 4IADA 5HG8A 3FZPA 4R5YA 3LCDA 2P55A 3ZU7A 3QRUA 4CV8A 2PUUA 3P79A 4EL9A 4P4CA 5AP7A 3M1SA 4OTQA 4USEA 2XKEA 2WO6A 4IQ6A 5CT0A 3RAIA 3R21A 4ZTMA 5GZAA 5KNJA 2WFYA 2YERA 4MBJA 4R7BA 1LR4A 5IQIA 2HY0A 4FL2A 2GNJA 3R0TA 4LM5A 3V3VA 4ZTLA 2VO3A 3D9VA 4C4FA 4C4IA 5LXMA 3QCXA 3AD4A 1R78A 3O96A 4YJOA 4ZJVA 5HE1A 3EN4A 2OSCA 3LCKA 3NYXA 4FUXA 3V5WA 3NR9A 3WARA 5C4KA 4QT1A 4RQVA 3I79A 2JBOA 4IWQA 4XH6A 3VS1A 3ZDUA 4RJ5A 4L44A 4KBAA 4HYHA 3TIYA 2XNGA 3IO7A 2Z2WA 3D0EA 4NYEA 3A4PA 2SRCA 1OUKA 4JBVA 3FXZA 2ITZA 2IJMA 1ZYCA 3D7TB 3COKA 2C1AA 2PZIA 3HMIA 3MTLA 3V5TA 2QD9A 4AGCA 3NUXA 5JFSA 2ZV2A 2W96B 5E4HA 3QQKA 1IG1A 2I6LA 3I6WA 2CLXA 5DR2A 3BBWA 5FTOA 4XG2A 3QQHA 5AP3A 5KO1A 3KMWA 1W83A 2BKZA 4BDEA 2YIQA 4W9WA 5EQYA 5AADA 4DFUA 4TWCA 4X2NA 4P5QA 5CASA 2YCQA 4U45A 4FT0A 4X2GA 4YBKA 3KXGA 2ZMCA 2WOTA 2EUFB 2ZOQA 3Q4ZA 2LGCA 4I0RA 3W2QA 3ZS5A 4CT2A 3FMDA 2VNYA 3TUDA 4DN5A 3CJGA 4ENXA 2BDFA 4WBOA 2EU9A 4D2VA 4JAIA 2X2MA 4LOOA 2E9UA 3BU3A 4AFEA 3QUDA 4GG7A 4XG9A 2WGJA 4TL0A 3UNKA 4UB7A 4OBPA 3KKVA 4AU8A 4XV1A 4EHGA 3OWPA 2VWXA 4PL4A 4IEBA 3ZDIA 3SGCA 3VNTA 3GC9A 2QHNA 2RFNA 4YPSA 2VWIA 2R3GA 4ZTNA 2OH4A 3GEQA 2E9OA 2DWBA 1G3NA 5ETCA 5AUWA 2J90A 5HD4A 3ODZX 5AP6A 5M53A 2ETRA 2AC3A 2XCHA 3VIDA 3DTCA 4D4VA 2JBPA 4O0UA 4YC3A 5AAEA 1KE8A 5I9WA 2BMCA 4EH8A 2YACA 2ZM4A 2RFEA 5EW3A 2JITA 2VO0A 4GIIA 5JFWA 4EH2A 1BYGA 3UZPA 3BV3A 2PU8A 3EWHA 2BRHA 4RJ4A 4JJRA 3ZZEA 4DEAA 2Q0NA 1NW1A 5IQGA 2YA9A 2H8HA 5L8JA 3ORZA 3QQGA 5J87A 3TL8A 2PZ5A 4L45A 2R3RA 3CP9A 1MQ4A 1KV1A 4HZSA 4O22A 1NVQA 4CLIA 4GKIA 1F0QA 1PXKA 4MNEB 2C6IA 3DBDA 3FYJX 3LQ8A 4QMYA 3DFCB 5IH6A 4W9XA 1OIRA 2BUJA 5IDPA 1ZWSA 3G90X 3W32A 3KFAA 5KE0A 2PUNA 4O0RA 3GCSA 3VS6A 2HW7A 4UMUA 4NJ3A 3RPOA 3QTWA 5FQDC 2YDJA 3V6SA 5KKRC 3GNIB 3IW6A 3C7QA 2OF2A 2ZB0A 2F9GA 2R2PA 4ZSGA 3F7WA 3TZ7A 4AS0A 4O38A 4AG8A 3WF9A 2PVHA 3E8DA 1NXKA 2X6DA 2G15A 2GQRA 3G5DA 1FQ1B 3BYUA 3LJ2A 3C0HA 4FC0A 2CCIA 4FKPA 4IC7A 4ITJA 4RWKA 5HIDA 2PHKA 2UVXA 3V6RA 4YJSA 2FYSA 3Q53A 4GUBA 1Z5MA 4ANQA 5DH3A 2OJJA 3O7LB 3NYOA 4FV8A 4GT3A 4FIEA 4JRNA 3RPVA 4LMNA 3G15A 1OL7A 1I44A 3GVUA 5BVFA 1XMLA 5ANIA 5J1WA 3FPMA 3K2LA 3LCTA 3W0MA 2YM5A 3F3VA 4D55A 4KUJA 2PVJA 3MPMA 3NUNA 3PY0A 5C9CA 3RCJA 3QHRA 3I1AA 1S9JA 4D2RA 5IH4A 2QU6A 2VGPA 3WIKA 4G5JA 3RZFA 5ICPA 4FF8A 4C3FA 4NU1A 2BROA 3IW4A 1U59A 5JEBA 4ZLZA 2OW3A 1H8FA 1OGUA 2PYWA 2PSQA 5CNNA 3C9WA 4BF2A 3N51A 1ZMVA 3L9NA 1OPJA 4EC8A 4L53A 5A9UA 4AW2A 4RRVA 3UOKA 5TKDA 4MD9E 3HV7A 3W16A 4CT1A 2IO6A 3HA6A 5CYIA 4BWKA 4HGEA 4UBAA 3PJCA 5CU6A 3TM0A 1K2PA 3DJ7A 4UWYA 3Q9WA 3A2CA 1OL5A 4IM0A 3DQXA 1LEZA 1PKDA 2X9FA 2YZAA 3QC9A 4FG8A 1GZ8A 4IX5A 4QP7A 3AMYA 4W4YA 3R8UA 2VTQA 4BIBA 1J3HA 3NPCA 4CVAA 4PNIA 4NSTA 4JDJA 4EONA 1ZY5A 4HGLA 4HYSA 4FA2A 5HGIA 4WSYA 2LAVA 2GTNA 3MTFA 3FZOA 4CYIA 3KN6A 3P78A 4BICA 4YO4A 4AAAA 4DDGA 4U43A 4X6RA 5L8LA 1UVRA 1KSWA 3OS3A 3P5KA 3UIMA 4D4YA 3H0YA 1OI9A 3PE1A 2ERZE 4FV2A 2IZUA 4M69B 4EJNA 3PLAE 2EB3A 4BCJA 2P3GX 2QOOA 2ZV8A 3DY7A 4I23A 3A7IA 3KGAA 1U4DA 1FVTA 1Y8GA 4EYMA 3Q6WA 3UO4A 3FLSA 3WI6A 3WZUA 4YUQA 1H08A 4EBWA 2BAJA 3MN3A 2UW0A 3WE4A 4S34A 3RPRA 2GNGA 4ZSEA 4MHAA 4U81A 5BMSA 1G8AA 2JAMA 3EQBA 4UZDA 2C6TA 5J5SA 2CPKE 4NTSA 3EN6A 5L4QA 2B7AA 2YHVA 3W2SA 5CF5A 1U54B 3KY2A 4J8MA 3FWQA 2ITVA 2ERKA 2R0UA 4X3FA 4RX5A 5CEIA 4XRLA 5EQEA 5I5ZA 2W4OA 2Y7JA 4XNEA 4G3CA 2DYLA 2CNQA 4G6NA 4RVMA 2GQGA 3BGZA 4FZ7A 5FP5A 5FEQA 4DE4A 5DMZA 1H07A 3DNDA 3R6XA 1FBNA 3F3UA 3EQCA 2VU3A 3BLQA 4RQKA 3R9DA 1V0PA 3FE3A 4NT4A 3DJ6A 3MIYA 5LCJA 4A9SA 2WTJA 1A9UA 4FI1A 4FGBA 5HIBA 3RK5A 3LFEA 3IOPA 2HIWA 2B0QA 4OAUC 4DG3E 1HOWA 5DLSA 4C59A 2VWVA 2JIIA 4EBVA 3QRKA 5L6PA 4L7SA 4FSZA 4ZTSA 5IA2A 3P23A 2B9HA 4N4SA 5EM8A 3OCTA 5JK3A 3ET7A 3C4ZA 3OXTA 3MH1A 4TWOA 4FMQA 2J9MA 2HZ0A 3U87A 5AAGA 1AGWA 4QMQA 3FLZA 2HW6A 4FV3A 4MYGA 4EC9A 5CF4A 4ACCA 2WMBA 3QWKA 5HESA 4WKQA 3LQ5A 4J99A 3B8QA 4EOJA 2J7TA 4O0TA 5FTGA 4ORKA 3NYVA 1P14A 3KULB 4F64A 5DRBA 4ZK5A 5BX0A 3OY3A 2IN6A 3DKOA 1E1XA 4I6HA 5J95A 4BCMA 3F82A 3MVHA 3UZTA 2C6EA 4EQCA 2DUVA 2XM8A 4FTCA 4OGRA 4MXOA 1M52A 1Q41A 2HWOA 2JKQA 2X0OA 3QQLA 5HBJA 2YABA 4KS8A 3GOPA 4DFNA 1JLUE 1UV5A 4U97A 4GJ2A 3GC8A 2O8YA 3ULIA 3TDWA 3NGAA 4YC8A 3QLFA 2W4JA 3MJ2A 2WU6A 1M14A 3VULA 4R6VA 3L9LA 3L9PA 3OEZA 3ID6C 3C0GA 3RPYA 2UZNA 5LJJA 5E8XA 1PXPA 5DR6A 3TV6A 4E6AA 3GCQA 2O5KA 4XOYA 1TZDA 4JS8A 1Q61A 3QD3A 3NEWA 1GZOA 4LV7A 3VJNA 5AP1A 3TEIA 3FMMA 4ZSLA 1WBTA 5AEPA 5I9YA 2WMRA 2VTJA 2ZM3A 3TT0A 3UVRA 4F7NA 3D5VA 3F2RA 3UNJA 4JOAA 4F9YA 3FMNA 3DB8A 3FMHA 4ANBA 3UG2A 3EQRA 3AGMA 4EK5A 3EH9A 2YIYA 3IW8A 3ZC5A 4YHFA 5DR9A 5K0XA 4QTEA 3W0RA 4DTBA 3RAKA 3NLBA 4LUDA 4K9YA 1TKIA 1R39A 3VBWA 2W1FA 4ENYA 1T46A 2UZOA 2Z7RA 3P86A 3R63A 4IVCA 4E5BA 3B8RA 5CT7A 4D9UA 5I9UA 3GCPA 4RT7A 4WNKA 5A14A 1CKPA 3EN7A 4KKHA 4DCAA 4BZNA 4V05A 5M08A 2QOCA 3RCDA 2B54A 4BZOA 3K5UA 1PJKA 2C1BA 3DK3A 4L7FA 1A48A 1HCKA 3U6JA 2A19B 4ZSAA 3MY0A 3RWQA 5ANKA 4ACMA 4BBFA 2CHLA 2CKEA 2V7OA 2Z60A 3FC2A 4NIFA 3DPKA 3LMGA 4JXFA 4X2JA 3KC3A 2QOBA 4YTIA 3QXOA 4B8LA 2YAKA 2C0TA 5K5XA 3R8MA 3TI1A 5DN3A 3ZTXA 3PXQA 2I40A 1OBGA 2VGOA 4LDTA 4BJJB 4QEBA 1KE6A 3A8XA 4O1PA 3SG9A 4MAOA 4DCEA 4PWNA 2WMAA 4J71A 2JDRA 4O4FA 3KU2A 1MP8A 3VS0A 4E7WA 5CAQA 2HZIA 4NM7A 4ZOGA 3LLAA 4DEDA 3HEGA 3QUPA 1PRYA 2VWBA 3QFVA 4UYAA 2HXQA 4RJ6A 4DC2A 4YTFA 1Q8UA 1BL7A 4MXXA 3MFUA 3MH3A 4FRFA 4QQCA 1UU9A 3GB2A 3TZ9A 4H36A 3T9TA 3HRCA 4EUUA 5AM6A 3IONA 4FIGA 5DE2A 3QD2B 5A4QA 1Q99A 5L8KA 4QMUA 2YEXA 3FMEA 4RJ3A 4RIXB 3EN5A 5J8IA 2W9FB 1WCCA 5GNKA 3V5PA 5K4JA 3A7FA 1YI4A 2UUEA 2OXXA 3F5GA 3NDMA 4JMQA 3F6XA 3F3WA 5I0BA 3UGCA 2OWBA 4DGOA 3TUBA 3SW7A 4BCKA 4QP6A 3MI9A 3Q6UA 3PJ3A 4OW8A 1OPKA 1PMNA 2EXMA 3QKLA 3TZMA 5IDNA 2OZAA 1GY3A 3PVGA 4OTIA 3SKCA 3U9NA 1IA8A 4HNIA 1H01A 5AP2A 3TUCA 5IQAA 2QOHA 4S33A 4QP3A 3NUYA 4WHZA 3CXWA 2XP2A 3WF6A 2ITQA 5B0XA 1RDQE 4QYFA 4QMVA 1TQIA 4Z16A 5FDPA 3KRWA 4YTHA 5EM7A 1M2QA 3IW7A 4FKLA 4BVUA 4D1ZA 4DBNA 4Y5QA 1GIJA 4G3GA 4IZYA 5LMKA 1JVPP 2W4KA 2Z7QA 5BVKA 3EL7A 2PE0A 3JR1A 5I4NA 4AN9A 3IGOA 3QKMA 4QP1A 4QYGA 3CLYA 1KE7A 4TY1A 3WBLA 4DT8A 3MBLA 5HHWA 5L2WA 2NO3A 4UYNA 3MFSA 3QU0A 3MESA 4JIKA 5ANOA 4FR4A 5FP6A