4I5CA

The jak1 kinase domain in complex with inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
290
structure length
279
Chain Sequence
VDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPNHIADLKKEIEILRNLYHENIVKYKGICTNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK1
publication title Novel triazolo-pyrrolopyridines as inhibitors of Janus kinase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 279
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i5cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i5cA01
2JKMA 5CEIA 5FBOA 4XBRA 2QR7A 5AMNA 3UMWA 3ANQA 4UXQA 5D10A 4M67A 1GIIA 2F49A 3FZSA 2P3GX 4PNKA 2VTPA 3OCSA 3ZMMA 4UEUA 1OVEA 2OBJA 2WIPA 5CASA 4ASXA 3GFEA 4NZWB 5E8VA 4AA4A 4WRGA 4C33A 4N57A 2Q0BA 1Q62A 2JBPA 3CJFA 4KBCA 4Q2AA 4TKSA 5AIRA 2EU9A 4L45A 4PMTA 4BBEA 4C8BA 3NW7A 3V3VA 4IACA 5JFVA 2C6TA 1GIHA 4JRVA 2W1GA 4DH3A 5IQBA 3OF0A 2OI4X 1UKIA 4YO4A 3DXQA 3AMYA 4PL5A 2G1TA 2ZV9A 3EKKA 4OGRA 4XG3A 4TYJA 1T46A 5F94A 2XNOA 5IG1A 1X8BA 4K8AA 5FRIA 2I0HA 4FNZA 4GKIA 2BIKB 3F88A 4X7QA 2XYUA 1ZZLA 3LCSA 1ZYCA 4AQCA 3QHRA 4CSVA 1MQ4A 4ACDA 4A9RA 5BYLA 3P9JA 1LEZA 5DGZA 2WHBA 2BAKA 5H8GA 2HENA 2R3KA 4F1TA 2HAKA 4RT7A 3DS6A 4QMQA 2R3RA 4NYEA 3ZSHA 4ERKA 3SXSA 4FIEA 3UJGA 5EYKA 4IVAA 4DG2E 4FKSA 4TZRA 3BEAA 4O0TA 3UOLA 3T3VA 4QNAA 3QKKA 5FLFA 3WI6A 4FIIA 4MK0A 4Q9SA 2GNHA 3U6JA 2ZOQA 4IX4A 3O51A 5AP1A 5M09A 2OH4A 3ZO1A 3TKIA 5DR9A 3U6HA 2BHHA 3VUHA 4AN2A 5JFWA 5L2WA 1QMZA 1WCCA 2R3NA 1H1QA 4YURA 3L8VA 2Z60A 3C1XA 2OU7A 4IE9A 5DPVA 4EQMA 4YR8A 4RC2A 3O0GA 1G8AA 5EI8A 3VIDA 4O27B 4I0TA 5FDXA 4PTGA 3FL5A 4FV4A 1OECA 2OFUA 4ZY6A 4RFYA 2ITTA 3V5JA 4TWPA 2B0QA 3LJ2A 4I92A 2RSVA 4RJ4A 3TNWA 2B9HA 5DA3A 3KXMA 4HVSA 2F4JA 3PZEA 5C8NA 5IMEA 4DTAA 4XP2A 2Z7LA 4J71A 4L52A 4WO5A 1URCA 4K11A 4I4FA 3OTVA 3BHVA 4I1ZA 4FSYA 3RCDA 1ZOEA 4U0IA 2JKOA 2PSQA 1YW2A 3QCQA 5F95A 4AFJA 2VAGA 2JD5A 2X0GA 3VQUA 3K2LA 5CU6A 3GC8A 4IMYA 2R3JA 5I5ZA 5HEZA 3Q4ZA 5K3YA 3UIBA 4ZIMA 3VS3A 3SRVA 4IANA 2PZPA 2VTAA 3PA3A 4HZRA 4BBFA 4QMVA 3F7WA 4A4OA 1H0VA 1U5RA 3L9PA 4IIRA 4DA5A 1T45A 3W32A 4PDYA 3GC9A 3CQUA 2PE0A 2GNJA 3OEFX 3PXZA 4R1YA 2OW3A 2RFSA 3HV7A 2VNYA 3DKGA 4WUAA 4PPBA 1YXVA 2F7ZE 3WZJA 3G15A 1AGWA 1NXKA 5FEEA 3O96A 4MF1A 4X3FC 2IZRA 4FKOA 5C8MA 4ERWA 1XH9A 2YA9A 3DQXA 4ZOGA 3THBA 2PHKA 5CAOA 4U43A 5EDPA 4JJRA 4S30A 3UIMA 3VW6A 1F5QA 5KCVA 5LVPA 3PDTA 2XNEA 3G90X 3MVLA 3QYZA 2JFMA 5KZ0A 4QPAA 3ZFYA 3D15A 2VTOA 4QMLA 3RM7A 3PVWA 2JDRA 3F5GA 1QL6A 1YOJA 3HDNA 3VBXA 5FBNC 2F57A 3DBCA 4KINA 4FTAA 4BCOA 5IUGA 4FV2A 4KIPA 2IZTA 3A2CA 4C35A 1KE8A 3SQQA 2IPXA 5FGKA 3U9CA 2P2HA 4M0YA 3LLAA 5JKGA 5AP6A 3OEZA 4C4GA 3VS0A 4DEHA 3HUBA 3QTZA 3Q9YA 4GIIA 3O8PA 2W4OA 4IX6A 1IASA 3U8WA 4O6EA 1BUHA 4GU6A 4B99A 4CRSA 4O0SA 3ERKA 1Q8WA 3KK9A 3NUXA 3NCZA 4IZAA 4WD5A 4E6CA 2PVYA 1YWRA 3PP1A 1GOLA 3GU5A 5IA4A 5CSHA 2WTVA 3BBWA 4L3PA 5E4HA 2W4KA 4NU1A 3EN5A 3QCYA 4EHGA 3LLTA 4ACMA 3MI9A 4X2GA 5EFQA 2Z7RA 1IR3A 3E92A 5C1QB 2X39A 3H3CA 5CI6A 2P2IA 1OBGA 4CGAA 4A9SA 5EHOA 3FZTA 1DM2A 3OTUA 4O7LA 3TN8A 3UE4A 3TDWA 3R28A 2BIYA 4MQ1A 5GNKA 3QAME 3V04A 4IVCA 3N4TA 2Y8OA 5C01A 1GJOA 3KN6A 3LXLA 5FM3A 3R8LA 2CHLA 4BKYA 3BV2A 3L1SA 3VBWA 4GU9A 3W33A 4UMQA 4EOJA 3MA6A 4IM0A 4II5A 4O0YA 4IWQA 5LCJA 3QZFA 4MKCA 3Q4UA 1XJDA 3KULA 1K2PA 4Y95A 4G6LA 3UYTA 1YOLA 4YC8A 2VV9A 3S0OA 3P86A 2C69A 4FTOA 4BDGA 3ENMA 3NLBA 3P7AA 4PMSA 3ZM9A 3D9VA 2W1FA 5M4IA 3W18A 4G2FA 2HZIA 2J6MA 3CBLA 4YNOA 3FKNA 5LVNA 5IQHA 4RIXA 2PVFA 2B9JA 2ONLA 5HCXA 4AZTA 4O2PA 4MAOA 2GNIA 4EC9A 2CDZA 3E87A 4W9WA 1YXSA 1U59A 1Q97A 2XIZA 4E4NA 2JAVA 4DT9A 3NNWA 2REIA 2PUPA 4GJ3A 3DU8A 5CX9A 4EZ5A 5EHLA 1B38A 3MTFA 4UMPA 2WGJA 2BKKA 3H9RA 5CAQA 4AOTA 4BCJA 5KMNA 3UVRA 4RRVA 3KXXA 2PE1A 3MS9A 3MDYA 5AUXA 2QOLA 3PSDA 4HYUA 3MPTA 3ZXTA 3VS5A 2HYYA 3PLAE 4DCAA 2JIUA 5A4TA 3DLZA 3AC1A 4RIWB 4G34A 1UNHA 5TE0A 2ESMA 4LYNA 2O63A 4O7SA 5AR4A 5HCYA 1CMKE 5ANJA 4TYHB 3CKWA 5CF8A 3MJ1A 1REJA 2XIYA 3RAIA 1P2AA 3IDCA 3R7VA 3S1HA 2QD9A 4FK6A 5DOSA 5IPJA 1W8CA 5EKOA 3MBLA 2V55A 4IVBA 5AUYA 4ANBA 4X6RA 2W05A 3CR0A 3GP0A 3GC0A 5BVKA 3NMUF 3UC4A 2ITQA 1MQBA 3HMOA 4C61A 3FV8A 5HLWA 4JDKA 1UNLA 4XX9A 2GFSA 4WA9A 3DOGA 3FMJA 4NTSA 5HICA 5HO6A 4P2KA 1FOTA 3CTHA 4XP3A 3GCPA 4DF3A 4L42A 1SVEA 4UYAA 1QPJA 4CFNA 3NYOA 2OFVA 4FV0A 3R7OA 2QOFA 3CY3A 4LGHA 4Q5HA 4BDHA 4X2KA 4ASEA 4G3CA 3G6HA 4G3FA 2ZAZA 3H0ZA 3E8CA 4MD7E 3TZMA 3R9RA 4FT5A 2OJGA 3TM0A 4L46A 3H9FA 1XH8A 2Y4IC 3L8PA 2W1DA 5T68A 5BVOA 5ITAA 4YZMA 2R3MA 2LAVA 4AGDA 5GJFA 1O9UA 3V6RA 4F9YA 3RGFA 4QTAA 5AP2A 3RALA 4IB5A 2V22A 5C27A 5FEQA 3IW5A 4WG5A 1IEPA 4O91A 4OUCA 4FICA 3PFQA 4BIBA 4J98A 3Q52A 4FOCA 3OROA 3GQLA 5HO7A 4ZY4A 3QTSA 4DN5A 3I7BA 4CFMA 4BYIA 4XEYA 1J3HA 5CSVA 5B2KA 2XJ2A 3FMKA 3JS2A 3FHRA 4EZ3A 3Q5IA 3R1YA 3R2YA 4KUJA 4YJSA 2J0KA 4WNKA 4OAUC 3PXYA 2RIOA 2YIWA 3R83A 4XG2A 4AN3A 1E1VA 5JN2A 4D1SA 4NEUA 2XYNA 4BDFA 3A7IA 4XNEA 3ZRMA 3I0QA 4DINA 2WQBA 2WMWA 3RK5A 1OBDA 5CEMA 1WBWA 3FXZA 4DFNA 1SYKA 5IEYA 3CPBA 3AG9A 4UMUA 3R1NA 2IN6A 2UW3A 3PY0A 3B2WA 2XNMA 3GVUA 3LKMA 1K3AA 4M69B 4FKVA 2BUJA 1FMOE 4BI0A 2C6IA 4PX6A 3BRBA 5HNIX 3FC2A 2J7TA 1KWPA 3CCNA 3R8VA 1JSTA 4DBNA 1FGKA 3K5VA 2QOBA 5KMOA 4BTKA 4E8AA 4J99A 1V0BA 3COHA 3ALOA 3SAYA 5IQEA 3FZOA 4I5MA 4QP8A 4H58A 4EL9A 1IAJA 2BZIB 3HDMA 4YLLA 1MUOA 5ANIA 1WBOA 3EQGA 4ANQA 3KQ7A 4F9CA 4FEUA 3OW4A 3LOKA 2PY3A 5IH4A 1UU7A 2C6LA 3QGYA 2C30A 3RP9A 3FI8A 5IA5A 5C03A 4ZZMA 4RC4A 5DEYA 2YDKA 3A4PA 1O6YA 4A9YA 4PV0A 5BX0A 5E8XA 3QZGA 4DFLA 3AD5A 4B6LA 3C4XA 4YJPA 4QP9A 3QFVA 4CEGA 3FC1X 2UW8A 3HMPA 1OL2A 4ALVA 4JXFA 4H05A 3AC5A 4B8LA 2CGWA 1ATPE 3IK3A 1GZNA 2VWIA 4XV9A 5CXZA 4CKRA 4O7YA 5M51A 3QUDA 2WNTA 4AP7A 4K77A 3K54A 3Q3BA 3WOWA 4FZ7A 2ZM1A 4CV8A 2YIXA 4JG7A 2UUEA 3KMUA 1PXIA 5B2LA 4IH8A 3R9NA 4RGJA 5EI2A 4UBAA 2VWVA 1RJBA 4YHTA 5D7VA 4YZDA 1PXOA 3DQWA 4RFZA 4RSSA 2PVJA 2W1ZA 3QZHA 4QTEA 4X2NA 2UZBA 3P5KA 4BTFA 4TWOA 2YLEA 3MN3A 3CD8A 4HNFA 3AC4A 2W96B 4G16A 2XNNA 5J1VA 3Q60A 2J2IB 4UWCA 4DE4A 3FLNC 5H9BA 4DGGA 3CTJA 5J79A 2VWZA 3KB7A 3P08A 4R7HA 3VBVA 4NCTC 5HIBA 3SG9A 4ITHA 2XIXA 5E1EA 5TR6A 3JVSA 4EWQA 3RWQA 3UVQA 1H8FA 2EB2A 4BTJA 4QYGA 3NUAA 5CTPA 2ERKA 3QRJA 5K9IA 3QD3A 4HPTE 4I93A 1GIJA 2PMIA 3FXWA 3GEQA 3I7CA 3LCTA 3ORPA 4NJ3A 4GSBA 2R3LA 3KXNA 1ZRZA 2J90A 4FSNA 5CNNA 4WNOA 5HX6A 4NFMA 5C9CA 1JKSA 5J95A 3PIZA 1M14A 4UMRA 3VUGA 2R2PA 3DKOA 3QD0A 4BGGA 5IQDA 1KV2A 4CFUA 2XNBA 4C02A 3ZLYA 3QBNA 5AR2A 3HVCA 3TV6A 5K5NA 2V7AA 4U45A 1PMEA 3B8QA 1JQHA 4GUEA 4IX5A 3TIZA 4ALWA 3FSKA 3F2NA 5ETCA 2ZM3A 5BNJA 4AACA 4QQTA 3FDNA 4QNYA 3U51A 3DJ6A 4XG4A 2G15A 2WMUA 4E5WA 4EORA 5CEQA 5KBQA 3CIKA 4JL9A 4I3ZA 4RPVA 3OP5A 2X4FA 3COMA 4MD8E 3WF5A 2PZRA 3HL7A 4F70A 5IQGA 3MVMA 2VZ6A 2C6EA 1Q8UA 3DZOA 4KBKA 2BMCA 2BR1A 2O64A 3PE1A 4LRMA 1CKPA 1TQIA 4IWDA 4WG3A 2X9FA 4NIFA 3MTLA 3Q53A 5GZAA 4O7TA 5AP0A 4MXOA 2G01A 3HMNA 1W0XC 4BDAA 4EHZA 2OKRA 3QQUA 4FTIA 2X8DA 3DTWA 3QD2B 1O6KA 2UVYA 2I0VA 3POZA 3QTIA 2JDOA 4FT9A 5F1ZA 5FG8A 2B55A 3SXFA 4YJUA 4ZJJA 1A06A 3JXWA 4KS8A 3EZVA 5AR8A 3B2TA 4L6QA 3TZ7A 3HV4A 2JIVA 2XKCA 2BTRA 4WSYA 3CE3A 3KRJA 4IADA 4U42A 3LMIA 2YM8A 2QOIA 2B54A 4FT7A 1R0PA 4KIOA 3WIGA 4DEBA 4L7FA 3TUBA 3R73A 4CVAA 3HA6A 3CD3A 2XNGA 3V01A 3PTGA 3D7TB 4O0WA 5IA2A 3GCVA 1SZMA 2EUFB 3MFSA 3QD4A 5DRDA 2UW4A 5CAVA 1PMVA 3PJ2A 1PYXA 2CCHA 4TNDA 2Z2WA 3KXGA 3QTWA 3II5A 4LOOA 3TCPA 2B1PA 5JFSA 3IONA 3GOKA 4RJ7A 2JGZA 4R3PA 3S2PA 4F4PA 5HNGA 3K3JA 3LAUA 2C6OA 4I6FA 3PXRA 5I9UA 1M7NA 4BDJA 4BCKA 4FBXA 5L8LA 5D11A 5BVWA 1OITA 5A4CA 4D1XA 1Y57A 4ZZOA 2QU5A 4O0RA 3G33A 4RZWA 2O8YA 4AOJA 2ITPA 1PXNA 5AM6A 4ASDA 5J7HA 5C4LA 5CEOA 2Z7QA 3V6SA 5TKDA 3OWPA 3R7YA 2CKQA 3TZ8A 5JZJA 3NZ0A 4DEAA 3HP5A 5B2MA 3NIZA 4Y8DA 3TZ9A 2CLXA 1O6LA 1OL6A 4JBVA 1W98A 2E9PA 2YIRA 2C5NA 3LW0A 3PPZA 3QQLA 4QQ5A 3BU5A 2BAJA 4EONA 3UP7A 4CTBA 4L3LA 3ORMA 3C50A 4IVDA 3DA6A 4RJ3A 2YCSA 2XVDA 3ZYAA 4CXAA 4GVJA 1WZYA 3F61A 5AV2A 2XCHA 3MB6A 2BTSA 4CKIA 4DGMA 3F6XA 1ND4A 1XR1A 2YISA 3RWPA 4D2PA 4A9TA 2QVSE 3GOPA 3OOGA 4K6ZA 4KA3A 5J9LA 3C5IA 1B6CB 1P4OA 3TJDA 5M56A 1Y8GA 3WBLA 2FSTX 4XUFA 1YI3A 2PVLA 5E8UA 3RHKA 1M7QA 4CZTA 5F4NA 2CKEA 4GVAA 4GIHA 4YTHA 3RI1A 3FQEA 2WQOA 4ANNA 4BZDA 2WU7A 4MBJA 1Q99A 4X3FA 3RBWA 4D58A 4BTMA 3TI1A 3NRMA 3QQGA 4W8EA 4TL0A 2BFXA 3UIUA 2CGVA 1NY3A 3WIKA 2IVVA 4M97A 4DC2A 4Z9LA 4BWPA 3FMNA 4CYIA 3NPCA 2VX1A 2YM4A 4G3GA 1KUTA 3POOA 3R8MA 4FV7A 4ZSEA 3DBDA 5AAEA 4AW0A 1QCFA 3F7ZA 2XNPA 3I81A 3Q96A 4YC3A 4HYSA 2Y9QA 4GK2A 3R04A 3HYHA 3LCKA 2AUHA 3HX4A 3NS9A 2XCKA 2ZVAA 4AT3A 5DH3A 1I09A 4Z3VA 2W5AA 5FTGA 5EOBA 2UZUE 2EWAA 2XKDA 4EK8A 4E5AX 1PKDA 4HW7A 1PHKA 1KV1A 2JDVA 2J0IA 3FYJX 4EHVA 2GNGA 2QLQA 1SM2A 1WVXA 2UZEA 4GUBA 4JX3A 3NR9A 3FPQA 3UQGA 4PDPA 1ZY4A 2GSFA 3OZ6A 4Y73A 4F7LA 2J51A 3LIJA 3BWJA 1JKKA 3N4UA 2CNQA 2EVAA 2JBOA 2B4SB 3DXNA 2FSMX 4IHPA 1PW2A 2XB7A 3LFEA 3WF6A 4XRLA 4EBWA 5CSPA 4R78A 4B7TA 4E6QA 3BWFA 3F5XA 2ITZA 3DT1A 3OOMA 4ZTQA 2GS2A 2PPQA 5DHJA 4XMOA 2YAKA 2C6MA 3VVHA 2J50A 3HECA 1BYGA 4QQCA 1W7HA 3VNTA 5EQEA 2X6DA 4UXLA 4ZXTA 5GJGA 4U5JA 1IA9A 4JR3A 4IJ9A 3FLWA 4ZTSA 1R3CA 1ZYJA 2E9OA 3QHWA 5DRBA 5IH5A 4L3JA 2OO8X 4P4CA 1LPUA 4KWPA 3DK6A 4TYHA 2FSLX 5BVNA 2PVNA 3GNIB 2YM5A 3KREA 2W1IA 4OLIA 2QO9A 3E5AA 2PVKA 3FMMA 3GGFA 3UOHA 1Q3DA 3I6UA 3U4UA 4DGLC 2ZYBA 3EL8A 4O21A 1DI8A 5DYJA 3KXHA 4G3DA 4FTLA 4FZAB 2YDJA 3L8XA 1H0WA 2JIIA 3DAEA 5KX8A 3MH1A 4JOAA 1OPJA 4RX5A 3O17A 3VUIA 1J1CA 1RW8A 4QP3A 2X2MA 3RJCA 5CU0A 2E9NA 4YHJA 3O7LB 4AZFA 4YGAA 3ZZEA 2Q83A 1GNGA 4Z7GA 3NW6A 4JRNA 1CKIA 2QURA 2R3FA 2UW5A 5DT4A 4UN0C 4XV1A 3K5UA 4DH1A 2HY0A 3AQVA 2QHNA 5KUPA 3UZTA 2XF0A 4QP6A 4LL0A 5HBJA 4JVGA 3EJ1A 5IH6A 3FUPA 4JQ7A 5IDNA 4ZK5A 1G3NA 3GCUA 5A3XA 2YJRA 4EOMA 1KE6A 3FJQE 4APCA 5JGAA 2EXMA 3QLGA 1L8TA 2C3KA 3NCGA 3W2QA 4DGOA 5B7VA 3UYSA 1LP4A 3TNHA 3WYYA 2VNWA 3BEGA 5CI7A 3F66A 4AU8A 3L9NA 4RLLA 3MYGA 4YLKA 4J96A 4DG0E 3VHKA 4NT4A 3DDQA 3LJ0A 3VBYA 3GENA 5E91A 4I5CA 4IZ5A 4EOQA 5CF4A 2XJ0A 4KSQA 4OTWA 4ZJIA 4AGWA 3IW8A 3GU6A 5HQ0A 5D12A 3Q6WA 4BKJA 2BRBA 2OG8A 4BWXA 4BVUA 5BPYA 1P5EA 3L8SA 4K18A 5IDPA 3SA0A 2GQRA 4F7SA 2OZAB 3KXZA 5GJDA 5HVJA 4EQUA 3U9NA 5JZNA 1W82A 4ACGA 2AYPA 4XG7A 3HEGA 3A7HA 3DB6A 5D41A 2GNFA 2WTKB 4FG8A 4R3CA 4AWIA 4AZSA 2XEZA 4FODA 4UZDA 2A2AA 4C4EA 1SNXA 2C1BA 4BCNA 5DIAA 3IW4A 3SV0A 3KMWA 1GAGA 2WEVA 4LOQA 3UODA 3V5TA 3D7ZA 4DFXE 3GXLA 4XS2A 3GU8A 3BBTB 3F3WA 4AFEA 2I0YA 4D9TA 1XO2B 4QD6A 2C5OA 4EJ7A 4EH7A 4M69A 4DH7A 4FYOA 2ITWA 1Q8TA 1CM8A 1SVGA 2GHLA 4NM3A 4CLIA 3T3UA 4JLCA 5CNOA 3BHUA 3UZPA 5FXQA 3H10A 5AV1A 2BVAA 1FMKA 4O83A 3LCOA 1MRYA 2QOOA 4GYGA 4BDCA 5LWMA 4BCPA 4RLKA 4RWIA 1A48A 1H01A 3CTQA 2F2UA 4FV5A 3NNVA 4K9YA 1SNUA 2XEYA 3HV5A 1YI6A 3ORIA 4GT3A 3JR1A 3FI4A 3SKCA 4DCEA 3D2IA 5DR2A 4LRKA 4E73A 2BRHA 4PDOA 4DEIA 3HLLA 2F9GA 5KMKA 4R6VA 3SW7A 4Y83A 5DNRA 3ALNA 3DLSA 2XH5A 3Q9WA 5EDRA 4HGLA 4MHAA 3FZPA 4ITJA 4LM5A 4H3PA 3ZDUA 5DT0A 4QPSA 4U41A 3U55A 1Z5MA 4G1WA 2WTJA 3BI6A 3NWWA 3AD6A 3QXPA 4FTUA 3L9LA 4L68A 4F0GA 1Q4LA 4UWYA 3ORNA 4BHZA 2Y7JA 1Y8YA 2IW8A 2UZOA 1CDKA 1DI9A 1UU3A 3IOPA 3MH2A 4BC6A 4RA4A 5FD2A 5J7BA 5EHYA 4FR4A 4JG8A 4IB3A 3SDJA 3ZDIA 4AW1A 3EQCA 4OTQA 2O3PA 3HAMA 2HCKA 2GHGA 1OM1A 4O2ZA 2XK3A 2PMNX 2R64A 4ZJVA 1OKYA 2GTNA 3BYUA 2B52A 3MH0A 4O0XA 3KKVA 4JQ8A 5ICPA 5AV3A 5A46A 5FXSA 4IZ7A 4FV1A 3W1FA 3ZBXA 4DH8A 3IDBA 4YZ9A 3COIA 5HZNA 5GZ9A 4EYMA 3DXPA 5L2IA 4RIYB 3KF4A 4CMOA 3VW8A 4IFCA 2IW9A 4I5HA 4FSUA 3KA0A 2A27A 1Y91A 2RF9A 3LHJA 5ETFA 3IKAA 5I9ZA 2VTSA 4PPAA 1LEWA 3CPCA 3QCSA 4HYIA 4NKSA 5DR6A 5J5TA 5HOAA 4A4XA 3U54A 3QA8A 3HV6A 5E1SA 1YWNA 4I6HA 5HGIA 4R7IA 4L44A 3CLYA 3NNUA 3R6XA 1JOWB 1YXTA 2QONA 4RQKA 4FTJA 2VWWA 4UX9A 5KHWA 4ID7A 3I1AA 3RHXA 5BUIA 4KSPA 4YJTA 1URWA 3IS5A 3V5LA 4CCUA 5L6OA 3PJ1A 5AWMA 5M53A 5DT3A 2PU8A 5DBXA 4UB7A 3TL8A 3SG8A 1ZWSA 1U54B 2BAQA 4I0RA 4MCVA 4M15A 5I4NA 4MX9A 5LVLA 3UOKA 1ZZ2A 4E4MA 3W2RA 1XBCA 3VO3A 5IUHA 4O7ZA 4D1ZA 4BY9E 3BE2A 3EIDA 3D5UA 3FMEA 2CNUA 4YSMA 3HMMA 3D94A 3OHTA 2XZSA 4D28A 2PVRA 4HZSA 4EHEA 2CKOA 5ANGA 4FOBA 2VTLA 3O50A 4C3PA 3R8UA 4CNHA 3AT4A 3C4ZA 4BF2A 4EK5A 4FMQA 2Y4PA 1F3MC 4QTDA 1KE9A 3A7JA 4FSQA 3VJOA 5FDPA 4AOIA 2RFEA 4FL1A 4CYJA 4NCTA 1GY3A 3VF9A 2ZV7A 4CG9A 3UBDA 3D14A 2VTQA 2CKPA 4JX7A 4UYNA 3AT2A 5EOLA 1TQPA 3IG7A 2VU3A 5K4IA 1Z57A 2J0MB 3A99A 3BGPA 4P5ZA 5CVHA 2J5FA 3B8RA 2OLCA 1YRPA 3KRXA 2FA2A 2RL5A 4Y85A 1H28A 4QYEA 2WQMA 2VO7A 5DEWA 5HO8A 5C26A 4C38A 4M66A 4J97A 2FYSA 2H9VA 4AE6A 4C36A 4LGGA 2OXYA 5C4KA 2WTDA 3ULIA 3LFSA 3Q9ZA 3OS3A 3QC9A 1SVHA 4CQGA 2VWUA 1U4DA 2IWIA 3QRTA 4U80A 1OIQA 1MP8A 3OWLA 4RFMA 4RVLA 5IQAA 3JYAA 2XIKA 5IQIA 4IAZA 3F3TA 4FL2A 2WTCA 5HNBA 1Q61A 3JPVA 1KSWA 4BB4A 4F6WA 5IISA 5HU3A 4G9RA 2PUNA 1FVVA 3VS7A 2YHVA 4N6ZA 2OJ9A 3S4QA 1OB3A 5KE0A 3ZRLA 5GIPE 3NAYA 4MNFA 2BDWA 2QI8A 5BVDA 2E2BA 3QWKA 3FSFA 4I20A 2O65A 4EI4A 3RPYA 4BCIA 5CT0A 2X7OA 5ETAA 1J7LA 4D5HA 5EM6A 3WE8A 2UW9A 2HK5A 2O5KA 2GQGA 5CSXA 3CS9A 4KKGA 4D2VA 4FKWA 4J95A 3KFAA 2YIQA 3R7EA 4EOKA 2WMTA 1UKHA 4FKRA 4AX8A 4Z16A 2ZV2A 4KKHA 5JEBA 3PJ3A 3W2PA 5LARA 4MH7A 4E93A 3FY0A 2O0UA 5KZIA 5LWNA 3I0OA 2PL0A 5CQWA 3HNGA 3WF7A 5BUJA 4RG0A 3ZOSA 3ZO4A 5HVYA 4YU2A 3PJCA 2ITOA 4XG8A 4F9WA 2H34A 3ORTA 4AZVA 1BI7A 3DNEA 5HU9A 4W4YA 2UZTA 4FZ6A 4QMXA 3OT8A 3T8OA 3UTOA 2PTKA 4LMUA 4TW9A 4PMMA 4DAWA 4F7JA 2ETMA 3W8LA 5E7RA 3GU4A 4C4IA 4F08A 2GFCA 5IMXA 3UMXA 4OTGA 2IJMA 1ZMWA 4JDHA 2OK1A 3Q5ZA 3PJ8A 4LUDA 5B0XA 2ZV8A 1L3RE 4IC8A 4U3YA 3KCFA 5KMLA 2BPMA 2VX3A 3QZIA 2QHMA 2VTTA 3SW4A 5JT2A 3E3PA 5EYCA 4GS6A 1H4LA 1XWSA 1ZAOA 3FY2A 3MFTA 3QTUA 3SOAA 2G9XA 4NSTA 4GK4A 1UU9A 3R30A 1JNKA 1QPDA 5DLSA 4ANSA 3TJCA 3O8UA 1SMHA 5IEXA 4QP1A 1H1SA 3EQRA 1B39A 2QO7A 5L2QA 5A6OA 5EM8A 4FG7A 4L7SA 4V01A 5AR7A 4BICA 3E63A 4S2ZA 4C2WA 5AAGA 4B4LA 3Q32A 4CFFA 3W2CA 2JEDA 3UO6A 4I24A 3G2FA 2GHMA 3CJGA 4C4JA 5EYDA 3ITZA 4D2RA 3QF9A 4V0GB 3O71A 3FXXA 2PZ5A 4OT6A 4O7VA 3UO5A 4IJPA 3ZONA 3O7LD 1BLXA 3EN4A 2PVMA 4QO9A 3TV4A 1LR4A 1CTPE 2G2HA 3AMAA 5KNJA 1ZMUA 2YZLA 4FEVA 4F9AA 4CKJA 3CSVA 2P4IA 3ZTXA 3Q9XA 1OL1A 4GW8A 5AX9A 3DB8A 4M14A 5HG9A 2C1AA 2B7AA 3MGYA 3QL8A 4OTFA 4ZEGA 1ZYDA 2OJJA 4X6QC 3T9IA 5L2TA 2RGPA 2DYLA 4AS0A 4F6SA 1A9UA 2I1MA 2LGCA 2XIRA 2YM7A 4O0VA 2FVDA 4FC0A 1YHVA 3AC8A 4QTCA 4YZNA 3EZRA 4GH2A 1ZOGA 3ZUTA 5HD4A 4MXZA 5M07A 2UZVA 4YHFA 3ZCLA 3VS2A 4ALUA 4YTIA 3N4VA 4MXYA 3CGFA 4QMUA 5I9WA 2PUIA 4M7IA 1VEBA 4QOXA 4MQ2A 3BV3A 4R1VA 2OIBA 3LE6A 3E62A 3EQIA 5JGBA 4NWMA 4DTBA 2WZJA 2XJ1A 3AXWA 3OXTA 5EG3A 4F1OA 3EQBA 3TDVA 4U40A 4PUZA 4USEA 3ID6C 3O2MA 3BGZA 3WZEA 5KMMA 3C4WA 4GCJA 5M06A 1OKZA 5E92A 4UALA 5JK3A 2YCQA 4QMSA 1KE5A 5CU2A 4C3FA 4MVFA 3C4EA 2C0IA 4TNBA 5H8BA 2X9EA 3I79A 3COKA 3ODZX 5EKNA 3UP2A 3U4WA 3NUPA 3WZUA 3R9OA 4YNEA 3FZ1A 3C13A 3VF8A 2VUWA 5E90A 3FKOA 3ULZA 4KIKB 3F5PA 4FSZA 3S3IA 4XH6A 4PMPA 4ORKA 4FV9A 4MBLA 1H27A 1FVTA 1OIRA 1PKGA 2BALA 3QUEA 1NA7A 3HGKA 4NUSA 5I9XA 2VO3A 2G2FA 5HE0A 2GS7A 4PF4A 4RWLA 4YSJA 3CY2A 5KKRB 3BGQA 3KRLA 4FKIA 1HCLA 4G31A 3TKUA 3R8PA 4U81A 2OIQA 1PXJA 3MB7A 4HNIA 1XH7A 4BBMA 3HMIA 4ZP5A 2IVTA 3IDPA 1DAYA 3IW6A 4P90A 4FG9A 4EOIA 3GB2A 4WRSA 3NNXA 4A7CA 3BYVA 3HUCA 1GZOA 4E3CA 2HWOA 3Q4CA 1M2QA 1WBSA 5HG5A 3KEXA 4QTBA 3W55A 5I3RA 1HOWA 2DUVA 1OPLA 4N4SA 3GUBA 2F2CB 3VBQA 3ANRA 3FEGA 3OWJA 5BYZA 5H2UA 3VHEA 2WOTA 3ZHPC 5A9UA 3LPBA 5M4UA 4IFGA 3MH3A 4O96A 1QPEA 4O22A 3KULB 4OTIA 5ACKA 3EQFA 3L9MA 5M4FA 4IAAA 1BI8A 2OH0E 3E8NA 5M44A 5D9HA 4FA2A 2EB3A 2QKRA 2QQ7A 4O6LA 2WXVA 1XQZA 4FTNA 4D2TA 3C9WA 3ROCA 5CF6A 2XK8A 5DN3A 4BZOA 4QRCA 1ZARA 4RIXB 1H08A 5IF1A 5GINE 2CGUA 2VX0A 4EUTA 5KMJA 4RX9A 3FI3A 5CY3A 5ANOA 2QNJA 3VS6A 3OW3A 4C59A 1H1RA 4CTCA 4HVHA 3LVPA 5CENA 3QC4A 4UWBA 1PMNA 3BX5A 1QPCA 3NYXA 4EWHA 3V5QA 1REKA 2QCSA 3I4BA 5ANDA 3RPVA 3VS1A 1ERKA 4EH4A 3EKNA 3I6WA 2JFLA 4RJ5A 4BWKA 2V62A 2PUUA 3DJ5A 4OTDA 3RPOA 2BDJA 5AEPA 2X8IA 3E3BX 2OJFE 4JR7A 3G51A 4BYJA 3ZZWA 4EJNA 5CU4A 1YOMA 5CVFA 1WBNA 4ZMFA 4RZVA 5AADA 1YQJA 4NW6A 3QYWA 3C0IA 2NPQA 4XG9A 3FHIA 4A9UA 3DFCB 5CXHA 4S31A 5H8EA 1U46A 3FE3A 3QX2A 4BR3A 2QOQA 4KRCA 4QMMA 4FX3A 4GK3A 3WF9A 3RPRA 3MPMA 4DFUA 4ZS4A 4FKTA 2VD5A 4XLIA 5E8WA 5F20A 4O7RA 3UNKA 3AT3A 3DAKA 4ANOA 5JFXA 3M42A 4X21A 3TG1A 3ZLWA 3RPSA 2IZSA 2BZKB 5TT7A 4HGTA 3VQHA 2R0UA 4J7BA 4C4HA 5CZIA 3KCKA 3QGWA 3ATSA 3NUNA 4ASZA 5A4EA 3LFNA 5AM7A 5HESA 3VULA 4LMNA 4GFOA 2VRXA 1M2RA 4UMTA 2F7XE 4DEDA 5LOHA 1V0OA 4PTEA 3R7IA 4FV3A 3ACKA 1DS5A 4V05A 3R7UA 1TVOA 4GFMA 3A61A 4E6AA 2XA4A 3ZC5A 5I3OA 5JGDA 2C0OA 2W4JA 3OD6X 4FTCA 4FIFA 4USDA 3GFWA 5EM5A 1YXUA 5HVKA 5HTCA 3OCBA 4FEQA 4TRLA 3FPMA 5TF9A 2AC3A 4ZTRA 4D4YA 1FGIA 4U6RA 3FLSA 3E8EA 3MVJA 1FINA 5GHVA 4AGCA 3ORXA 3FAAA 4YJVA 3CGOA 3ZS5A 1EH4A 3RCJA 5HKMA 2QKWB 3D83A 3G0FA 3GBZA 4HOKA 5CF5A 2OICA 1G8SA 2ETRA 1STCE 4XV2A 4EC8A 4EOSA 4M8TA 1KE7A 3RAHA 4F6UA 5A6NA 3LXPA 5AP7A 2C47A 2X2KA 4RIYA 3E93A 5HIEA 3HA8A 4HPUE 2RG6A 4QP7A 1RE8A 5M08A 1YXXA 4XG6A 4CLJA 4YTFA 4QMNA 4DLIA 3FZRA 4IC7A 2R3QA 3R1QA 4NH1A 5LMBA 3E7OA 4K33A 3VUDA 2QOCA 4GG7A 3CC6A 3BELA 3F5UA 3MFRA 4DHFA 3D5XA 5EDQA 5J9ZA 5CANA 4YJRA 3PWYA 4RIOA 2ITUA 1PF8A 4WBOA 4U8ZA 2WMAA 3VUTA 3OMVA 4MXXA 3RINA 3C0GA 4I41A 4ANLA 5HI2A 1U54A 3DNDA 4YJOA 2QO2A 5FM2A 4H1JA 4F63A 2G2IA 2UW7A 2CLQA 3VUMA 4ZZNA 4H1MA 1IA8A 1CKJA 2CPKE 2C3JA 2X6EA 3DBEA 4IQ6A 4EH6A 2QG7A 4EK4A 3UPZA 4CFVA 2R7BA 4ARKA 5IA1A 5DI1A 4GV1A 2CGXA 3CQEA 1R78A 4MNEB 1VYWA 4ENYA 3C4FA 4QYHA 2WKMA 1PXMA 1Q24A 5HBEA 5ANEA 5HLNA 3FKLA 4AF3A 3PZHA 3PXQA 2YCFA 2NP8A 2C68A 4L00A 3MW1A 5EH0A 4F65A 3EL7A 2VTNA 2YZAA 3DDPA 4IZYA 4FV8A 5HG7A 5T3QA 4C57A 1BL6A 4HVGA 1W83A 3TACA 5KHXA 4JNWA 3PXKA 4WKQA 2HZNA 4YO6A 4LUEA 2WELA 5H3QA 4RIWA 2XK7A 3HRCA 4AAAA 4AA0A 2J0LA 4KAOA 4W9XA 3BYMA 5ANKA 3HRBA 3RK7A 2W1CA 2JDSA 4LFIA 4E6DA 4P5QA 4A07A 1TKIA 2UW6A 4MWHA 3BU6A 4PNIA 4QYYA 4YPDA 5EW8A 2IG7A 4YUQA 3BHYA 3R71A 3VRYA 3PRIA 2ZB1A 3QLFA 1OMWA 5LMAA 4DBXA 2R5TA 4Q9ZA 3EMGA 1RQQA 2ZB0A 3BQCA 2XMYA 3FLYA 3KVXA 1BL7A 4M3QA 4ONAA 4AE9A 4D55A 4DLJA 4EOPA 3IGOA 3TUCA 4R5YA 3LZBA 3PG3A 1PMUA 3QALE 3OWKA 2VGOA 3KRRA 4M84A 3FWQA 4OBPA 3TWJA 4AT5A 4PRJA 2ACXA 2UW0A 4FSMA 5CEPA 3H4JA 3AGMA 4FNWA 4BN1A 4X3JA 4D4SA 2BDFA 1OKVA 2FH9A 2IW6A 3NYNA 3CQWA 4NM5A 5E8YA 4D4VA 1MRUA 4FTQA 4EKKA 4QMZA 3RAKA 3U6IA 3MV5A 4JDIA 2WTKC 4FGBA 1NVQA 4RWKA 5AV4A 1XBBA 3UOJA 3P7BA 2VWBA 4WUNA 1YKRA 3SD0A 4IAYA 4FKLA 2I7QA 3KL8A 4PQNA 4DEGA 3SVVA 1PYEA 5EQPA 3KY2A 4IEBA 3UNZA 2JLDA 3A8WA 1S9JA 4ZTNA 3REPA 3RZBA 3DCVA 4L53A 5IA0A 5LXMA 4YBKA 5J87A 2UVZA 3JY9A 3MA3A 4E7WA 2C0TA 3LQ8A 1JBPE 5TO8A 4XYFA 1JKLA 4QMPA 4G6OA 3R2BA 3SOCA 2YLFA 2UZWE 5LCKA 2CCIA 4EZ7A 4FKUA 2VTHA 3R1SA 3TNIA 3PRFA 4G9CA 2W5HA 3WILA 2A4LA 4C4FA 2ZDTA 3QRUA 1UU8A 4RJ8A 2WB8A 4C0TA 4IDVA 3KGAA 5BMSA 2C6DA 2KTYA 2Q0NA 4QYFA 4GKHA 2YN8A 4O1PA 3UG2A 1H07A 4GMYA 4NFNA 5AUUA 5BYYA 1VZOA 3FI2A 4G6NA 3WZDA 2HELA 2E9UA 5CZHA 4A06A 3R01A 5JSMA 2QLUA 2CMWA 4U79A 5L2SA 4M13A 2W9ZB 4BDKA 4BI1A 2I6LA 4NW5A 4Q5EA 2VWXA 4RBLA 3TNQB 4D5KA 3NUYA 3V5PA 4LI5A 2GTMA 3FLZA 1JPAA 4KS7A 1CSNA 4QT1A 3UO4A 1LUFA 3T9TA 4EEVA 5LQFA 3PUPA 1H24A 5L8KA 3ORLA 5JQ8A 5KMIA 3C4CA 3HKOA 3HRFA 5FTOA 3MPAA 2X1NA 4YC6A 2QOKA 4GG5A 3NEWA 4NIFB 1APME 2YM6A 4HCVA 2YDIA 3W8QA 1YDTE 5C8KA 4FIGA 2DS1A 2XP2A 2ZJWA 3OUKA 2GQSA 3DV3A 1YVJA 4OBOA 2W5BA 4CV9A 3FQHA 4GT5A 2BFYA 5JMSA 4C62A 4HYHA 3RK9A 4RX7A 4V0GA 4YJNA 3LXNA 3PVUA 3DAJA 4N70A 2OZOA 3ZUUA 3DY7A 4Z7HA 5A54A 1JSVA 4KBAA 5IA3A 3KC3A 4JT3A 1S9IA 2ERZE 4X2FA 5L8JA 3VN9A 3BYOA 2QR8A 3IECA 2P0CA 1UA2A 3PXFA 5E8ZA 2ETKA 4C37A 1HCKA 1UVRA 4JG6A 3TKHA 4ZLYA 2WMVA 2UZLA 5G1XA 4W4XA 2V5QA 2HY81 2W0JA 4GJ2A 1XH5A 1I44A 3RNYA 5CVGA 4YLJA 4PY1A 2I0EA 5AA9A 2R3HA 5IQCA 2V7OA 3P7CA 3VJNA 4D2WA 2CNVA 2OIDA 4IAIA 5EYMA 3R9HA 1R1WA 2UVXA 3DKFA 3D5WA 1UWHA 4J8NA 1OL7A 2VTRA 4MXAA 3AMBA 3ZU7A 3SHEA 2UV2A 3G9LX 3Q2MA 4U44A 3P0MA 4EH2A 3LFFA 1YHSA 4OT5A 3H0YA 1BX6A 3LM0A 2QOHA 3V5WA 4NK9A 4O38A 4BI2A 4DT8A 5FXRA 2OGVA 4PWNA 1M52A 3QU0A 4TYIA 2NO3A 2VTIA 3EQPA 4TPTA 2C3IB 4E4LA 3EWHA 4JDJA 3QQHA 3QQKA 4H39A 3MVHA 4CMUA 3DBFA 3EFLA 3NX8A 1PY5A 3E88A 5J9YA 1BKXA 3WZKA 5K0KA 5CAUA 1DAWA 3M2WA 2JKQA 4I5PA 3H9OA 5LMKC 3Q4TA 4FSTA 4FT3A 4ZSJA 2PULA 3U87A 3ETAA 4KIKA 5HD7A 2QODA 3R63A 3BZ3A 2J5EA 4IDTA 4EBVA 3SXRA 2RFNA 4YJQA 4CFXA 4LRJA 2GPHA 1WBTA 3LJ1A 4UV0A 4TYGA 1WVWA 3EN9A 4FV6A 1H1WA 1YDSE 2XS0A 2J9MA 5J5SA 3M1SA 2NRYA 4CT2A 3DK3A 4EOOA 5L6WL 4AXAA 2YFXA 4EQCA 1UNGA 3BU3A 1R0EA 3LFAA 3IO7A 4O84A 3OY3A 4LQMA 4FIHA 4X3FB 1VR2A 3IQ7A 4FNXA 3UQCA 2IVSA 1Y6AA 2B9FA 4IXPA 4I6BA 3GC7A 5AAFA 1UWJA 4D4RA 5LJJA 3QQJA 2ZM4A 2NNWB 2HZ0A 3DGKA 3NGAA 4LG4A 4JQEA 4K0YA 3FMHA 4BCQA 4OTRA 3OXZA 4C2VA 2UZDA 2OWBA 4FVQA 4CFWA 4E4XA 1NVRA 3DK7A 1OL5A 3GQIA 4F99A 2Z8CA 5DE2A 2FGIA 5AUWA 2I40A 3ET7A 3F2RA 3MY1A 1OKWA 3ODYX 3H30A 2VTMA 4N6YA 4IB1A 3QKLA 1OIYA 2A0CX 4FTTA 2ITYA 4S34A 3M11A 2C5XA 2HIWA 3HAVA 3Q2JA 5CLPA 2YIYA 4EH9A 2W06A 3D2KA 3WARA 2BHEA 1IG1A 2C3LA 3P23A 4PTCA 4RVKA 4E1ZA 2GMXA 5IU2A 4MWIA 1FQ1B 2R3GA 5FWKK 3HP2A 4FI1A 4ZY5A 3LMHA 1KOAA 5AUTA 4JIKA 5TOZA 3G5DA 3BLHA 3IW7A 3NUSA 3DPKA 4IM2A 3RM6A 4GEOA 2H96A 1BMKA 2CSNA 4WT6A 3TEIA 4O1OA 4Y5QA 2XK6A 3BHTA 5AP4A 2WTIA 4FUYA 4YP8A 4YTCA 4O0UA 1JLUE 1FVRA 3OXIA 4FVPA 3D7TA 4OAVB 4F64A 4R77A 4N0SA 5CEKA 4MXCA 2WQNA 4FKPA 3A4OX 4BKZA 5JRSA 2H8HA 2Y0AA 1XBAA 3P1AA 4RA5A 4CZYB 5FEDA 3BHHA 3FBVA 1KOBA 3EN7A 3ENHA 1PXKA 3ZBFA 4FF8A 4PP7A 4USFA 4BCMA 2YITA 4E20A 3RNIA 4ZTMA 2Z02A 3TIYA 4TY1A 4C7TA 5EQYA 1R39A 1JWHA 3NW5A 2BCJA 2PVHA 3EFWA 4DFZE 2FB8A 3EN6A 4S33A 2EXEA 3V8TA 1H00A 4RC3A 3QRKA 3MIYA 3ZSIA 1J7IA 3W16A 2NRUA 1M17A 4QMYA 4BCFA 2WMQA 4V04A 2WMRA 4MTAA 4HCTA 4J52A 3LFQA 3LQ5A 4DH5A 3S95A 2C6KA 4L8MA 3ELJA 3PIXA 4AA5A 1ZYLA 3SC1A 3NAXA 1YI4A 4ZSGA 4M0ZA 4I0SA 3AC3A 5AJQA 4FKJA 3A8XA 3W2OA 1WBPA 3EFKA 4J8MA 2HW7A 3D4QA 2WD1A 3ZSGA 1NT2A 2Y6OA 3IOKA 4BHNA 2A19B 4EH8A 2VWYA 4BDDA 3O23A 4FNYA 2X7GA 3VC4A 2FUMA 4BIEA 3VS4A 4TWCA 2X7FA 4LGDA 3EFJA 2GU8A 4IW0A 4K1BA 4FKQA 4OBQA 4XJ0A 2JC6A 2R3OA 3OBGA 4KKEA 4BDIA 3PE2A 4FEXA 4D2SA 1Y6BA 4KNBA 4FZFB 4TTHB 4W4VA 3QCXA 4B8MA 4O86A 2ITNA 5GZ8A 1ZLTA 1H1PA 5CQUA 4X0MA 3OG7A 5HIDA 3PWDA 3PYYA 3WF8A 5AA8A 4ZAUA 3BPRA 5L4QA 1OZ1A 4U97A 3VUKA 5BUEA 5DWRA 4U9AA 4YBJA 1AQ1A 5DMZA 3AOXA 5ETIA 1YWVA 3QUPA 5EK7A 2WQEA 3UG1A 2W7XA 1J7UA 5J8IA 3QXOA 3R8ZA 3KVWA 4NTTA 2RG5A 2JAMA 4W4WA 1OGUA 4IBMA 4L43A 1TQMA 3UC3A 5HBHA 2WO6A 4OTHA 3GI3A 1NVSA 2J4ZA 1XH6A 3EB0A 4EUUA 2OXDA 4FSRA 3I5NA 3TTIA 3DTCA 3G9NA 2OSCA 1K9AA 3TV7A 5K0XA 4ZTHA 2X8EA 4ZLZA 4HJOA 3BLRA 2XK4A 2ZMDA 2PMLX 4JBPA 3R0TA 3QA0A 5K5XA 3DZQA 4RMZA 3E64A 3LFBA 1VJYA 3Q6UA 4WIHA 3UNJA 3CEKA 2B9IA 3MWUA 2Y4IB 3E8DA 4PP9A 4DYMA 4NJDA 4AGUA 3ZRKA 3NUUA 4QQJA 1YHWA 4F9BA 4HVIA 2BKZA 2PZYA 4MNEA 4OR5A 5AUZA 2VN9A 3OC1A 3SRVB 4B0GA 2VTJA 3CXWA 4QMWA 5FTQA 3WE4A 5BVFA 3SLSA 4C58A 3LFDA 3LXKA 4APPA 3W2SA 2H6DA 4L01A 3MIAA 4JIAA 4LV5A 4CQEA 5AUVA 3OCTA 5FP6A 5KKRC 4XP0A 1JKTA 3F69A 4TXCA 4ZS0A 3PP0A 4TN6A 2J0JA 3VRZA 4ACCA 2XRUA 4OW8A 4YZCA 3K3IA 1H26A 4L9IA 4DTKA 2R3PA 4U3ZA 2XBJA 2JITA 4IX3A 3DKCA 2IVUA 4QP2A 3BYSA 2P33A 3PVGA 3BKBA 1WBVA 1J91A 1Q5KA 2PZIA 3PPKA 1Q41A 3DJ7A 5AR5A 3ZEWA 1Q8YA 5I9VA 3IPHA 3UZRA 1JAMA 5A4QA 3KMMA 4EK3A 4AZWA 4E26A 2YERA 4IAKA 2YABA 3GCSA 3MFUA 1NW1A 3QRIA 4RQVA 4NM7A 4O7WA 4AUAA 3PSCA 3BE9A 4PL3A 4KIQA 5FQDC 1OIUA 3TTJA 3ZXZA 3EOCA 5K4JA 4KRDA 4B9DA 4HVDA 3LM5A 4BFMA 3QTXA 4AT4A 3QTQA 3WYXA 5AV0A 3JVRA 3KF7A 5BQ0A 1PXPA 1G5SA 2R7IA 4ZMEA 4HGSA 5GIOE 1GZ8A 4DFBA 3JY0A 1ZMVA 4BGHA 3ZEPA 4S32A 5HLPA 2ONLC 4FE2A 2Z7SA 2CN8A 1P4FA 3KU2A 3O8TA 4LL5A 5HE3A 3R7GA 4UZHA 4RVMA 5BVEA 4PL4A 3TT0A 2AC5A 2RKUA 4QP4A 5E8SA 3HV3A 3D5VA 5M4CA 3FL4A 2ZDUA 2PYWA 4DITA 1U5QA 2R0IA 2XKEA 4KD1A 1FBNA 5CT7A 4FEWA 5AP3A 4UY9A 4ZTLA 4EYJA 2XRWA 3KRWA 4FUXA 1W84A 2C5VA 2FSOX 2PWLA 4J53A 4Y46A 5HE2A 4FTMA 4D0WA 5EW3A 3RMFA 1VYZA 4XLVA 1ZXEA 3ATTA 3GT8A 4H3BA 2WPAA 4F0FA 4F09A 3PLSA 3ZFMA 5KO1A 1WFCA 4BRXA 4FKGA 4RX8A 1H25A 4BGQA 3AC2A 4R8QA 1IRKA 4CZUA 5BMMA 4WBBB 3I5ZA 4FVRA 3VBTA 4C34A 4FSWA 4MEDA 2HOGA 1Q8ZA 2UZNA 5DVRA 3FLQA 3MESA 3AGLA 1WAKA 2IZUA 2W1HA 5HG8A 4OTPA 3ROYA 5EM7A 2DWBA 2IO6A 4G17A 4I23A 4FL3A 4GT4A 4IAFA 2CJMA 3C7QA 1ZY5A 4TYEA 3LQ3A 4H36A 4PPCA 5AIKA 3PY3A 2OZAA 4LV8A 4LOPA 2OF4A 3OFMA 1Q3WA 2X4ZA 1J1BA 2XM9A 4IWPA 4K2RA 2EXCX 2KULA 3HZTA 2OJIA 4MF0A 5HTIA 4BCGA 3NVKI 5LVOA 5AX3A 4D0XA 4F0IA 2VGPA 2W9FB 2PK9A 3QX4A 4DG3E 4JI9A 1XH4A 2XM8A 2SRCA 2YEXA 4JAIA 4QPMA 2WMXA 4FTRA 3R9DA 4AZEA 3FQSA 5CSWA 4BDEA 2BRGA 2PE2A 1Z9XA 3F3ZA 3PA4A 4J1RA 3TXOA 3AD4A 4WOVA 2HW6A 4IWOA 5CU3A 2BILB 2JDTA 4CT1A 1FPUA 5HHWA 3N51A 5HTBA 4GYIA 3EQDA 4XRJA 4YZBA 4HCUA 3RTPA 2C5YA 2V0DA 1WMKA 4F7NA 4M68A 4FYNA 4WSQA 5HE1A 2HWPA 2WEIA 4FGRA 2YWPA 3RVGA 1V1KA 2WU6A 4PDSA 3N9XA 5E9EA 3BIZA 2C4GA 1OPKA 4I22A 3RZFA 2YWVA 3TUDA 4FTKA 4NL0A 4DEEA 4FZDB 3UVPA 3FYKX 4JBQA 1P14A 4Y5HA 1JVPP 4ZSLA 3S00A 1E9HA 5M55A 2JKKA 4I94A 4M12A 5T6KA 4CRLA 2ITVA 3PSBA 4H3QA 2WIHA 2GDOA 4KABA 5DFPA 3IGGA 4GFGA 4NM0A 3DBQA 2O2UA 2YCRA 4FT0A 3W10A 3RKBA 2GCDA 4XOYA 2WMBA 2WTWA 4BZNA 5HX8A 5CYIA 4O81A 2P55A 2XUUA 3FMLA 4G3EA 4I4EA 3TNPC 4R7BA 3BCEA 3OUNB 4EOLA 2B53A 3R22A 2A1AB 3PIYA 3MJ2A 4ACHA 4BL1A 3C5UA 3A60A 4RWJA 5I9YA 4WG4A 3F9NA 1RDQE 1XKKA 5I0BA 3R21A 2W1EA 3ZFXA 3ZM4A 2OF2A 4C3RA 4WHZA 3P4KA 3RAWA 4JBOA 5D1JA 3QKMA 4CCBA 2Y6MA 3UIXA 5CAPA 5IZFA 2GS6A 5AR3A 1IAHA 1UV5A 2YJSA 3ZC6A 2R4BA 5AFVA 5G6VA 3Q04A 4I21A 1AD5A 1OUKA 4ZLOA 3VWAA 4HGEA 5KBRA 3V8WA 3PG1A 1M2PA 5AP5A 5CALA 2YACA 2VO0A 2X81A 4I6QA 3UQFA 5IEVA 4D9UA 3OT3A 4O7NA 4F1MA 3UGCA 5IUIA 3NIEA 2BRMA 4EK6A 5F9EA 3UDBA 3LMGA 3G6GA 5CS6A 2VO6A 4DFYA 5E8TA 3GCQA 3ORKA 2GNLA 4MBIA 4MD9E 4NKAA 4JS8A 3C0HA 2F7EE 4AG8A 3SGCA 4RVTA 1WVYA 4TT7A 1PRYA 2BRNA 2WMSA 3KK8A 4G5JA 4L67A 5CWZA 5DG5A 1V0PA 4YPSA 3QTRA 3EYGA 3QQFA 4XBUA 4WNMA 5EI6A 3A7GA 4XV3A 3C51A 3LFCA 5JQ5A 3A7FA 5A4LA 4KB8A 1MRVA 4R3RA 4BCHA 3R00A 4ITIA 2R3IA 3MSSA 3OBJA 4X2JA 3MY5A 2BROA 4QMOA 3BLQA 3ZUVA 3JUHA 3ORZA 1YDRE 2WOUA 3PPJA 2XBAA 1F0QA 2BZHB 3V8SA 5JH6A 2HXLA 4G5PA 3OY1A 4CMTA 2W17A 2WFYA 2ITXA 2YAAA 4IM3A 3E7VA 3ZLSA 4AW2A 4YMJA 4U7ZA 4DGNA 3A62A 3D0EA 2X2LA 3OVVA 3I60A 2W99B 3CKXA 3FMDA 2HXQA 4IB0A 4E5BA 5FP5A 2QU6A 1E1XA 2RFDA 4XOZA 3SX9A 3PY1A 3BQRA 3ZH8A 3QWJA 4BDBA 3NVMB 3GU7A 3OCGA 5LMKA 3CP9A 5HORA 4XCUA 3G0EA 4BIDA 5EW9A 3V51A 3F3VA 3F82A 4AW5A 1PJKA 4ENXA 2CN5A 2PMOX 3EH9A 3P79A 5JRQA 2BZJA 3KN5A 3VAPA 5ACBC 3ACJA 4FIJA 3PA5A 4Z55A 2WAJA 3EQHA 4P7EA 2DQ7X 3PVBA 1GZKA 2XKFA 4R5SA 3ZLXA 4MYGA 3NDMA 5LVMA 4FK3A 1ZOHA 3NSZA 5FUTA 4GRBA 5HCZA 4O82A 5IQFA 3EHAA 5D7AA 3P78A 5IKWA 4A4LA 4JAJA 4WNPA 1OUYA 4CG8A 3EYHA 1JSUA 2HZ4A 3LCDA 4QMTA 4ZSAA 3MY0A 5L3AA 4GL9A 1ZYSA 4W8DA 4EH3A 5L6PA 1XHAA 2FO0A 2QC6A 3NYVA 4XHKB 3DFAA 4Y72A 4AN9A 2E9VA 1OI9A 3R02A 5J1WA 4EKLA 5A14A 3ZO2A 2OXXA 4ANMA 1PXLA 2YM3A 2ZMCA 3F3UA 5M57A 2QG5A 3F2AA 2XK9A 4TWNA 4EH5A 4RJ6A 4CD0A 3UPXA 2R9SA 3ZO3A
chains in the Genus database with same CATH superfamily
2JKMA 5CEIA 5FBOA 4XBRA 2QR7A 4LV7A 5AMNA 3UMWA 3ANQA 4UXQA 5D10A 4M67A 1GIIA 2F49A 3FZSA 2P3GX 4PNKA 2VTPA 3OCSA 3ZMMA 4UEUA 1OVEA 2OBJA 3W0RA 2WIPA 5CASA 4ASXA 3GFEA 4NZWB 5E8VA 4AA4A 4WRGA 4C33A 4N57A 2Q0BA 1Q62A 2JBPA 3CJFA 4KBCA 4Q2AA 4TKSA 5AIRA 2EU9A 4L45A 4PMTA 4BBEA 4C8BA 3NW7A 3V3VA 4IACA 5JFVA 2C6TA 1GIHA 4JRVA 2W1GA 4DH3A 5IQBA 3OF0A 2OI4X 1UKIA 4YO4A 3DXQA 3AMYA 4PL5A 2G1TA 2ZV9A 3EKKA 4OGRA 4XG3A 4TYJA 1T46A 5F94A 2XNOA 5IG1A 1X8BA 4K8AA 5FRIA 2I0HA 4FNZA 4GKIA 2BIKB 3F88A 4X7QA 2XYUA 1ZZLA 3LCSA 1ZYCA 4AQCA 3QHRA 4CSVA 1MQ4A 4ACDA 4A9RA 5BYLA 3P9JA 2AQXA 1LEZA 5DGZA 2WHBA 2BAKA 5H8GA 2HENA 2R3KA 4F1TA 2HAKA 4RT7A 3DS6A 4QMQA 2R3RA 4NYEA 3ZSHA 4ERKA 3SXSA 4FIEA 3UJGA 5EYKA 4IVAA 4DG2E 4FKSA 4TZRA 3BEAA 4O0TA 3UOLA 3T3VA 4QNAA 3QKKA 5FLFA 3WI6A 4FIIA 4MK0A 4Q9SA 2GNHA 3U6JA 2ZOQA 4IX4A 3O51A 5AP1A 3O5AA 2OH4A 5M09A 3ZO1A 3TKIA 5DR9A 3U6HA 2BHHA 3VUHA 4AN2A 5JFWA 5L2WA 1QMZA 1WCCA 2R3NA 1H1QA 4YURA 3L8VA 2Z60A 3C1XA 2OU7A 4IE9A 5DPVA 4EQMA 4YR8A 4RC2A 3O0GA 1G8AA 5EI8A 3VIDA 4O27B 4I0TA 5FDXA 4PTGA 3FL5A 4FV4A 1OECA 2OFUA 4ZY6A 4RFYA 2ITTA 3V5JA 4TWPA 2B0QA 3LJ2A 4I92A 2RSVA 4RJ4A 3TNWA 2B9HA 5DA3A 3KXMA 4HVSA 2F4JA 3PZEA 5C8NA 5IMEA 4DTAA 4XP2A 2Z7LA 4J71A 4L52A 4WO5A 1URCA 3W0MA 4K11A 4I4FA 3OTVA 2X0OA 3BHVA 4I1ZA 4FSYA 3RCDA 1ZOEA 4U0IA 2JKOA 2PSQA 1YW2A 3QCQA 5F95A 4AFJA 2VAGA 2JD5A 2X0GA 3VQUA 3K2LA 5CU6A 3GC8A 4IMYA 2R3JA 5I5ZA 5HEZA 3Q4ZA 5K3YA 3UIBA 4ZIMA 3VS3A 3SRVA 4IANA 2PZPA 2VTAA 3PA3A 4HZRA 4BBFA 4QMVA 3F7WA 4A4OA 1H0VA 1U5RA 3L9PA 4IIRA 4DA5A 1T45A 3W32A 4PDYA 3GC9A 3CQUA 2PE0A 2GNJA 3OEFX 3PXZA 4R1YA 2OW3A 2RFSA 3HV7A 2VNYA 3DKGA 4WUAA 4PPBA 1YXVA 2F7ZE 3WZJA 3G15A 1AGWA 1NXKA 5FEEA 3O96A 4MF1A 3BL9A 4X3FC 2IZRA 4FKOA 5C8MA 4ERWA 1XH9A 2YA9A 3DQXA 4ZOGA 3THBA 2PHKA 5CAOA 4U43A 5EDPA 4JJRA 4S30A 3UIMA 3VW6A 1F5QA 5KCVA 5LVPA 3PDTA 2XNEA 3G90X 3MVLA 3QYZA 2JFMA 5KZ0A 4QPAA 3ZFYA 3D15A 2VTOA 4QMLA 3RM7A 3PVWA 2JDRA 3F5GA 1QL6A 1YOJA 3HDNA 3VBXA 5FBNC 2F57A 3DBCA 4KINA 4FTAA 4BCOA 5IUGA 4FV2A 4KIPA 2IZTA 3A2CA 4C35A 1KE8A 3SQQA 2IPXA 5FGKA 3U9CA 2P2HA 4M0YA 3LLAA 5JKGA 5AP6A 3OEZA 4C4GA 3VS0A 4DEHA 3HUBA 3QTZA 3Q9YA 4GIIA 3O8PA 2W4OA 4IX6A 1IASA 3U8WA 4O6EA 1BUHA 4GU6A 4B99A 4CRSA 4O0SA 3ERKA 1Q8WA 3KK9A 3NUXA 3NCZA 4IZAA 4WD5A 4E6CA 2PVYA 1YWRA 3PP1A 1GOLA 3GU5A 5IA4A 5CSHA 2WTVA 3BBWA 4L3PA 5E4HA 2W4KA 4NU1A 3EN5A 3QCYA 4EHGA 3LLTA 4ACMA 3MI9A 4X2GA 5EFQA 2Z7RA 1IR3A 3E92A 5C1QB 2X39A 3H3CA 5CI6A 2P2IA 1OBGA 4CGAA 4A9SA 5EHOA 3FZTA 1DM2A 3OTUA 4O7LA 3TN8A 3UE4A 3TDWA 3R28A 2BIYA 4MQ1A 5GNKA 3QAME 3V04A 4IVCA 3N4TA 2Y8OA 5C01A 1GJOA 3KN6A 3LXLA 5FM3A 3R8LA 2CHLA 4BKYA 3BV2A 3L1SA 3VBWA 4GU9A 3W33A 4UMQA 4EOJA 3MA6A 4IM0A 4II5A 4O0YA 4IWQA 5LCJA 3QZFA 4MKCA 3Q4UA 1XJDA 3KULA 1K2PA 4Y95A 4G6LA 3UYTA 1YOLA 4YC8A 2VV9A 3S0OA 3P86A 2C69A 4FTOA 4BDGA 3ENMA 3NLBA 3P7AA 4PMSA 3ZM9A 3D9VA 2W1FA 5M4IA 3W18A 4G2FA 2HZIA 2J6MA 3CBLA 4YNOA 3FKNA 5LVNA 5IQHA 4RIXA 2PVFA 2B9JA 2ONLA 5HCXA 4AZTA 4O2PA 4MAOA 2GNIA 4EC9A 2CDZA 4O4DA 3E87A 4W9WA 1YXSA 1U59A 1Q97A 2XIZA 4E4NA 2JAVA 4DT9A 3NNWA 2REIA 2PUPA 4GJ3A 3DU8A 5CX9A 4EZ5A 5EHLA 1B38A 3MTFA 4UMPA 2WGJA 2BKKA 3H9RA 5CAQA 4AOTA 4BCJA 5KMNA 3UVRA 4RRVA 3KXXA 2PE1A 3MS9A 3MDYA 5AUXA 2QOLA 3PSDA 4HYUA 3MPTA 3ZXTA 3VS5A 2HYYA 3PLAE 4DCAA 2JIUA 5A4TA 3DLZA 3AC1A 4LDTA 4RIWB 4G34A 1UNHA 4AXCA 5TE0A 2ESMA 4LYNA 2O63A 4O7SA 5AR4A 5HCYA 1CMKE 5ANJA 4TYHB 3CKWA 5CF8A 3MJ1A 1REJA 2XIYA 3RAIA 1P2AA 3IDCA 3R7VA 3S1HA 2QD9A 4FK6A 5DOSA 5IPJA 1W8CA 5EKOA 3MBLA 2V55A 4IVBA 5AUYA 4ANBA 4X6RA 2W05A 3CR0A 3GP0A 3GC0A 5BVKA 3NMUF 3UC4A 2ITQA 1MQBA 3HMOA 4C61A 3FV8A 5HLWA 4JDKA 1UNLA 4XX9A 2GFSA 4WA9A 3DOGA 3FMJA 4NTSA 5HICA 5HO6A 4P2KA 1FOTA 3CTHA 4XP3A 3GCPA 4DF3A 4L42A 1SVEA 4UYAA 1QPJA 4CFNA 3NYOA 2OFVA 4FV0A 3R7OA 5BV3A 2QOFA 3CY3A 4LGHA 3W0NA 4Q5HA 1XMLA 4BDHA 4X2KA 4ASEA 4G3CA 3G6HA 4G3FA 2ZAZA 3H0ZA 3E8CA 4MD7E 3TZMA 3R9RA 4FT5A 2OJGA 3TM0A 4L46A 3H9FA 1XH8A 2Y4IC 3L8PA 2W1DA 5T68A 5BVOA 5ITAA 4YZMA 2R3MA 2LAVA 4AGDA 5GJFA 1O9UA 3V6RA 4F9YA 3RGFA 4QTAA 5AP2A 3RALA 4IB5A 2V22A 5C27A 5FEQA 3IW5A 4WG5A 1IEPA 4O91A 4OUCA 4FICA 3PFQA 4BIBA 4J98A 3Q52A 4FOCA 3OROA 3GQLA 5HO7A 4ZY4A 3QTSA 4DN5A 3I7BA 4CFMA 4BYIA 4XEYA 1J3HA 5CSVA 5B2KA 3AKKA 2XJ2A 3FMKA 3JS2A 3FHRA 4EZ3A 3Q5IA 3R1YA 3R2YA 4KUJA 4YJSA 2J0KA 4WNKA 4OAUC 3PXYA 2RIOA 2YIWA 1W2CA 3R83A 4XG2A 4AN3A 1E1VA 5JN2A 4D1SA 3PFYA 4NEUA 2XYNA 4BDFA 3A7IA 4XNEA 3ZRMA 3I0QA 4DINA 2WQBA 2WMWA 3RK5A 1OBDA 5CEMA 1WBWA 3FXZA 4DFNA 1SYKA 5IEYA 3CPBA 3AG9A 4UMUA 3R1NA 2IN6A 2UW3A 3PY0A 3B2WA 2XNMA 3GVUA 3LKMA 1K3AA 4M69B 4FKVA 1VLRA 2BUJA 1FMOE 4BI0A 2C6IA 4PX6A 3BRBA 5HNIX 3FC2A 2J7TA 1KWPA 3CCNA 3R8VA 1JSTA 4DBNA 1FGKA 3K5VA 2QOBA 5KMOA 4BTKA 4E8AA 2ZFYA 4J99A 1V0BA 3COHA 3ALOA 3SAYA 5IQEA 3FZOA 4I5MA 4QP8A 4H58A 4EL9A 1IAJA 2BZIB 3HDMA 4YLLA 1MUOA 5ANIA 1WBOA 3EQGA 4ANQA 3KQ7A 4F9CA 4FEUA 3OW4A 3LOKA 2PY3A 5IH4A 1UU7A 2C6LA 3QGYA 2C30A 3RP9A 3FI8A 4BJJA 5IA5A 5C03A 4ZZMA 4RC4A 5DEYA 2YDKA 3A4PA 1O6YA 4A9YA 4PV0A 5BX0A 3PUFC 5E8XA 3QZGA 4DFLA 3AD5A 4B6LA 3C4XA 4YJPA 4QP9A 3QFVA 4CEGA 3FC1X 2UW8A 3HMPA 1OL2A 4ALVA 4JXFA 4H05A 3AC5A 4B8LA 2CGWA 1ATPE 3IK3A 1GZNA 2VWIA 4XV9A 5CXZA 4CKRA 4O7YA 5M51A 3QUDA 2WNTA 4AP7A 4K77A 3K54A 3Q3BA 3WOWA 4FZ7A 2ZM1A 4CV8A 2YIXA 4JG7A 2UUEA 3KMUA 1PXIA 5B2LA 4IH8A 3R9NA 4RGJA 5EI2A 4UBAA 2VWVA 1RJBA 4YHTA 5D7VA 4YZDA 1PXOA 3DQWA 4RFZA 4RSSA 2PVJA 2W1ZA 3QZHA 4QTEA 4X2NA 2UZBA 3P5KA 4BTFA 4TWOA 2YLEA 3MN3A 3CD8A 4HNFA 3AC4A 2W96B 4G16A 2XNNA 5J1VA 3Q60A 2J2IB 4UWCA 4DE4A 3KIOC 3FLNC 5H9BA 4DGGA 3CTJA 5J79A 2VWZA 3KB7A 3P08A 4R7HA 3VBVA 4NCTC 5HIBA 3SG9A 4ITHA 2XIXA 5E1EA 5TR6A 3JVSA 4EWQA 3RWQA 3UVQA 1H8FA 2EB2A 4BTJA 4QYGA 3NUAA 5CTPA 2ERKA 3QRJA 5K9IA 3QD3A 4HPTE 4I93A 1GIJA 2PMIA 3FXWA 3GEQA 3I7CA 3LCTA 3ORPA 4NJ3A 4GSBA 2R3LA 3KXNA 1ZRZA 2J90A 1TZDA 4FSNA 5CNNA 3W0SA 1W2FA 4WNOA 4NFMA 5HX6A 5C9CA 1JKSA 5J95A 3PIZA 1M14A 4UMRA 3VUGA 2R2PA 3DKOA 3QD0A 4BGGA 5IQDA 1KV2A 4CFUA 2XNBA 4C02A 3ZLYA 3QBNA 5AR2A 3HVCA 3TV6A 5K5NA 2V7AA 4U45A 1PMEA 3B8QA 1JQHA 4GUEA 4IX5A 3TIZA 4ALWA 3FSKA 3F2NA 5ETCA 2ZM3A 5BNJA 4AACA 4QQTA 3FDNA 4QNYA 3U51A 3DJ6A 4XG4A 2G15A 2WMUA 4E5WA 4EORA 5CEQA 5KBQA 3CIKA 4JL9A 4I6LA 4I3ZA 4RPVA 3OP5A 2X4FA 3COMA 4MD8E 3WF5A 2PZRA 3HL7A 4F70A 3W0OA 5IQGA 3MVMA 2VZ6A 2C6EA 1Q8UA 3DZOA 4KBKA 2BMCA 2BR1A 2O64A 3PE1A 4LRMA 1CKPA 1TQIA 4IWDA 4WG3A 2X9FA 4NIFA 3MTLA 3Q53A 5GZAA 4O7TA 5AP0A 4MXOA 2G01A 4DDGA 3HMNA 1W0XC 4BDAA 4EHZA 2OKRA 3QQUA 4FTIA 2X8DA 3DTWA 3QD2B 1O6KA 2UVYA 2I0VA 3POZA 3QTIA 2JDOA 4FT9A 5F1ZA 5FG8A 2B55A 3SXFA 4YJUA 4ZJJA 1A06A 3JXWA 4KS8A 3EZVA 5AR8A 3B2TA 4L6QA 3TZ7A 3HV4A 2JIVA 2XKCA 2BTRA 4WSYA 3CE3A 3KRJA 4IADA 4U42A 3LMIA 2YM8A 2QOIA 2B54A 4FT7A 1R0PA 4KIOA 3WIGA 4DEBA 4L7FA 3TUBA 3R73A 4CVAA 3HA6A 3CD3A 2XNGA 3V01A 3PTGA 3D7TB 4O0WA 5IA2A 2XARA 3GCVA 1SZMA 2EUFB 3MFSA 3QD4A 5DRDA 2UW4A 5CAVA 1PMVA 3PJ2A 1PYXA 2CCHA 4TNDA 2Z2WA 3KXGA 3QTWA 3II5A 4LOOA 3TCPA 2B1PA 5JFSA 3IONA 3GOKA 4RJ7A 2JGZA 4R3PA 3S2PA 4F4PA 5HNGA 3K3JA 3LAUA 2C6OA 4I6FA 3PXRA 5I9UA 1M7NA 4BDJA 4BCKA 4FBXA 5L8LA 5D11A 5BVWA 1OITA 5A4CA 4D1XA 1Y57A 4ZZOA 2QU5A 4O0RA 3G33A 4RZWA 2O8YA 4AOJA 2ITPA 2XANA 1PXNA 5AM6A 4ASDA 5J7HA 5C4LA 5CEOA 4O4FA 2Z7QA 3V6SA 5TKDA 3OWPA 3R7YA 2CKQA 3TZ8A 5JZJA 3NZ0A 4DEAA 3HP5A 5B2MA 3NIZA 4Y8DA 3TZ9A 2CLXA 1O6LA 1OL6A 4JBVA 1W98A 2E9PA 2YIRA 2C5NA 3LW0A 3PPZA 3QQLA 4QQ5A 3BU5A 2BAJA 4EONA 3UP7A 4CTBA 4L3LA 3ORMA 3C50A 4IVDA 3DA6A 4RJ3A 2YCSA 2XVDA 3ZYAA 4CXAA 4GVJA 1WZYA 3F61A 5AV2A 2XCHA 3MB6A 2BTSA 4CKIA 4DGMA 3F6XA 1ND4A 1XR1A 2YISA 3RWPA 4D2PA 4A9TA 2QVSE 3GOPA 3OOGA 4K6ZA 4KA3A 5J9LA 3C5IA 1B6CB 1P4OA 3TJDA 5M56A 1Y8GA 3WBLA 2FSTX 4XUFA 1YI3A 2PVLA 5E8UA 3RHKA 1M7QA 4CZTA 5F4NA 2CKEA 3NFGB 4GVAA 4GIHA 4YTHA 3RI1A 3FQEA 2WQOA 4ANNA 4BZDA 2WU7A 4MBJA 1Q99A 4X3FA 3RBWA 4D58A 4BTMA 3TI1A 3NRMA 3QQGA 4W8EA 4TL0A 2BFXA 3UIUA 2CGVA 1NY3A 3WIKA 2IVVA 4M97A 4DC2A 4Z9LA 4BWPA 3FMNA 4CYIA 3NPCA 2VX1A 2YM4A 4G3GA 1KUTA 3POOA 3R8MA 4FV7A 4ZSEA 3DBDA 5AAEA 4AW0A 1QCFA 3F7ZA 2XNPA 3I81A 3Q96A 4YC3A 4HYSA 2Y9QA 4GK2A 3R04A 3HYHA 3LCKA 2AUHA 3HX4A 3NS9A 1ST4A 2XCKA 2ZVAA 4AT3A 5DH3A 1I09A 4Z3VA 2W5AA 5FTGA 5EOBA 2UZUE 2EWAA 2XKDA 4EK8A 3UDSA 3W0PA 4E5AX 1PKDA 4HW7A 1PHKA 1KV1A 2JDVA 2J0IA 3FYJX 4EHVA 2GNGA 2QLQA 1SM2A 1WVXA 2UZEA 4GUBA 4JX3A 3NR9A 3FPQA 3UQGA 4PDPA 1ZY4A 2GSFA 3OZ6A 4Y73A 4F7LA 2J51A 3LIJA 3BWJA 1JKKA 3N4UA 2CNQA 2EVAA 2JBOA 2B4SB 3DXNA 2FSMX 4IHPA 1PW2A 2XB7A 3LFEA 3WF6A 4XRLA 4EBWA 5CSPA 4R78A 4B7TA 4E6QA 3BWFA 3W0QA 3F5XA 2ITZA 3DT1A 3OOMA 4ZTQA 2GS2A 2PPQA 5DHJA 4XMOA 2YAKA 2C6MA 3VVHA 2J50A 3HECA 1BYGA 4QQCA 1W7HA 3VNTA 5EQEA 2X6DA 4UXLA 4ZXTA 5GJGA 4U5JA 1IA9A 4JR3A 4IJ9A 3FLWA 4ZTSA 1R3CA 1ZYJA 2E9OA 3QHWA 5DRBA 5IH5A 4L3JA 2OO8X 4P4CA 1LPUA 4KWPA 3DK6A 4TYHA 2FSLX 5BVNA 2PVNA 3GNIB 2YM5A 3KREA 2W1IA 4OLIA 2QO9A 3E5AA 2PVKA 3FMMA 3GGFA 3UOHA 1Q3DA 3I6UA 3U4UA 4DGLC 2ZYBA 3EL8A 4O21A 1DI8A 5DYJA 3KXHA 4G3DA 4FTLA 4FZAB 2YDJA 3L8XA 1H0WA 2JIIA 3DAEA 5KX8A 3MH1A 4JOAA 1OPJA 4RX5A 3O17A 3VUIA 1J1CA 1RW8A 4QP3A 2X2MA 3RJCA 5CU0A 2E9NA 4YHJA 3O7LB 4AZFA 4YGAA 3ZZEA 2Q83A 1GNGA 4Z7GA 1G8JA 3NW6A 4JRNA 1CKIA 2QURA 2R3FA 2UW5A 5DT4A 4UN0C 4XV1A 3K5UA 4DH1A 2HY0A 3AQVA 2QHNA 5KUPA 3UZTA 2XF0A 4QP6A 4LL0A 5HBJA 4JVGA 3EJ1A 5IH6A 3FUPA 4JQ7A 5IDNA 4ZK5A 1G3NA 3GCUA 5A3XA 2YJRA 4EOMA 1KE6A 3FJQE 4APCA 5JGAA 2EXMA 3QLGA 1L8TA 2C3KA 3NCGA 3W2QA 4DGOA 5B7VA 3UYSA 1LP4A 3TNHA 3WYYA 2VNWA 3BEGA 5CI7A 3F66A 4AU8A 3L9NA 4RLLA 3MYGA 4YLKA 4J96A 4DG0E 3VHKA 4NT4A 3DDQA 3LJ0A 3VBYA 3GENA 5E91A 4I5CA 4IZ5A 4EOQA 5CF4A 2XJ0A 4KSQA 4OTWA 4ZJIA 4AGWA 2NYAA 3IW8A 3GU6A 5HQ0A 5D12A 3Q6WA 4BKJA 2BRBA 2OG8A 4BWXA 4BVUA 5BPYA 1P5EA 3L8SA 4K18A 5IDPA 3SA0A 2GQRA 4F7SA 2OZAB 3KXZA 5GJDA 5HVJA 4EQUA 3U9NA 5JZNA 1W82A 4ACGA 2AYPA 4XG7A 3HEGA 3A7HA 3DB6A 5D41A 2GNFA 2WTKB 4FG8A 4R3CA 4AWIA 4AZSA 2XEZA 4FODA 4UZDA 2A2AA 4C4EA 1SNXA 2C1BA 4BCNA 5DIAA 3IW4A 3SV0A 3KMWA 3BLAA 1GAGA 2WEVA 4LOQA 3UODA 3V5TA 3D7ZA 4DFXE 3GXLA 4XS2A 3GU8A 3BBTB 3F3WA 4AFEA 2I0YA 4D9TA 1XO2B 4QD6A 2C5OA 4EJ7A 4EH7A 4M69A 4DH7A 4FYOA 3UDZA 2ITWA 1Q8TA 1CM8A 1SVGA 2GHLA 4NM3A 4CLIA 3T3UA 4JLCA 5CNOA 3BHUA 3UZPA 5FXQA 3H10A 5AV1A 2BVAA 1FMKA 4O83A 3LCOA 1MRYA 2QOOA 4GYGA 4BDCA 5LWMA 4BCPA 4RLKA 4RWIA 1A48A 1H01A 3CTQA 2F2UA 4FV5A 3NNVA 4K9YA 1SNUA 2XEYA 3HV5A 1YI6A 3ORIA 4GT3A 3JR1A 3FI4A 3SKCA 4DCEA 3D2IA 5DR2A 4LRKA 4E73A 2BRHA 4PDOA 4DEIA 3HLLA 2F9GA 5KMKA 4R6VA 3SW7A 4DHJA 4Y83A 5DNRA 3ALNA 3DLSA 2XH5A 3Q9WA 5EDRA 4HGLA 4MHAA 3FZPA 4ITJA 4LM5A 4H3PA 3ZDUA 5DT0A 4QPSA 4U41A 3U55A 1Z5MA 4G1WA 2WTJA 3BI6A 3NWWA 3AD6A 3QXPA 4FTUA 3L9LA 4L68A 4F0GA 1Q4LA 4UWYA 3ORNA 4BHZA 2Y7JA 1Y8YA 2IW8A 2UZOA 1CDKA 1DI9A 1UU3A 2XALA 3IOPA 3MH2A 4BC6A 4RA4A 5FD2A 5J7BA 5EHYA 4FR4A 4JG8A 4IB3A 3SDJA 3ZDIA 4AW1A 3EQCA 4OTQA 2O3PA 3HAMA 2HCKA 2GHGA 1OM1A 4O2ZA 2XK3A 2PMNX 2R64A 4ZJVA 1OKYA 2GTNA 3BYUA 2B52A 3MH0A 4O0XA 3KKVA 4JQ8A 5ICPA 5AV3A 5A46A 5FXSA 4IZ7A 4FV1A 3W1FA 3ZBXA 4DH8A 3IDBA 4YZ9A 3COIA 5HZNA 5GZ9A 4EYMA 3DXPA 5L2IA 4RIYB 3KF4A 4CMOA 3VW8A 4IFCA 2IW9A 4I5HA 4FSUA 3KA0A 2A27A 1Y91A 2RF9A 3LHJA 5ETFA 3IKAA 5I9ZA 2VTSA 4PPAA 1LEWA 3CPCA 3QCSA 4HYIA 4NKSA 5DR6A 5J5TA 5HOAA 4A4XA 3U54A 3QA8A 3HV6A 5E1SA 1YWNA 4I6HA 5HGIA 4R7IA 4L44A 3CLYA 3NNUA 3R6XA 1JOWB 1YXTA 2QONA 4RQKA 4FTJA 2VWWA 4UX9A 5KHWA 4ID7A 3I1AA 3RHXA 5BUIA 4KSPA 4YJTA 1URWA 3IS5A 3V5LA 4CCUA 5L6OA 3PJ1A 5AWMA 5M53A 5DT3A 2PU8A 5DBXA 4UB7A 3TL8A 3SG8A 1ZWSA 1U54B 2BAQA 4I0RA 4MCVA 4M15A 5I4NA 4MX9A 5LVLA 3UOKA 1ZZ2A 4E4MA 3W2RA 1XBCA 3VO3A 5IUHA 4O7ZA 4D1ZA 4BY9E 3BE2A 3EIDA 3D5UA 4AAYA 3FMEA 2CNUA 4YSMA 4QDVA 3HMMA 3D94A 3OHTA 2XZSA 4D28A 2PVRA 4HZSA 4EHEA 2CKOA 5ANGA 4FOBA 2VTLA 3O50A 4C3PA 3R8UA 4CNHA 3AT4A 3C4ZA 4BF2A 4EK5A 4FMQA 2Y4PA 1F3MC 4QTDA 1KE9A 3A7JA 4FSQA 3VJOA 5FDPA 4AOIA 2RFEA 4FL1A 4CYJA 4NCTA 1GY3A 3VF9A 2ZV7A 4CG9A 3UBDA 3D14A 2VTQA 2CKPA 4JX7A 4UYNA 3AT2A 5EOLA 1TQPA 3IG7A 2VU3A 5K4IA 1Z57A 2J0MB 3A99A 3BGPA 4P5ZA 5CVHA 2J5FA 3B8RA 2OLCA 1YRPA 3KRXA 2FA2A 2RL5A 4Y85A 1H28A 4QYEA 2WQMA 2VO7A 1ST0A 5DEWA 5HO8A 5C26A 4C38A 4M66A 4J97A 2FYSA 2H9VA 4AE6A 4C36A 4LGGA 2OXYA 5C4KA 2WTDA 3ULIA 3LFSA 3Q9ZA 3OS3A 3QC9A 1SVHA 4CQGA 2VWUA 1U4DA 2IWIA 3QRTA 4U80A 1OIQA 1MP8A 3OWLA 4RFMA 4RVLA 5IQAA 3JYAA 2XIKA 5IQIA 4IAZA 3F3TA 4FL2A 2WTCA 5HNBA 1Q61A 3JPVA 1KSWA 4BB4A 4F6WA 5IISA 5HU3A 4G9RA 2PUNA 1FVVA 3VS7A 2YHVA 4N6ZA 2OJ9A 3S4QA 1OB3A 5KE0A 3ZRLA 5GIPE 4O4EA 3NAYA 4MNFA 2BDWA 2QI8A 5BVDA 2E2BA 3QWKA 3FSFA 4I20A 2O65A 4EI4A 3RPYA 4BCIA 5CT0A 2X7OA 5ETAA 1J7LA 4D5HA 5EM6A 3WE8A 2UW9A 2HK5A 2O5KA 2GQGA 5CSXA 3CS9A 4KKGA 4D2VA 4FKWA 4J95A 3KFAA 2YIQA 3R7EA 4EOKA 2WMTA 1UKHA 4FKRA 4F78A 4AX8A 4Z16A 2ZV2A 4KKHA 5JEBA 3PJ3A 3W2PA 5LARA 4MH7A 4E93A 3FY0A 2O0UA 5KZIA 5LWNA 3I0OA 2PL0A 5CQWA 3HNGA 3WF7A 5BUJA 4RG0A 3ZOSA 3ZO4A 5HVYA 4YU2A 3PJCA 2ITOA 4XG8A 4F9WA 2H34A 3ORTA 4AZVA 1BI7A 3DNEA 5HU9A 4W4YA 2UZTA 4FZ6A 4QMXA 3OT8A 2X0PA 3T8OA 2PTKA 4LMUA 3UTOA 4TW9A 4PMMA 4DAWA 4F7JA 2ETMA 3W8LA 5E7RA 3GU4A 4C4IA 4F08A 2GFCA 5IMXA 3UMXA 4OTGA 2IJMA 1ZMWA 4JDHA 2OK1A 3Q5ZA 3PJ8A 4LUDA 5B0XA 2ZV8A 1L3RE 4IC8A 4U3YA 3KCFA 5KMLA 2BPMA 2VX3A 3QZIA 2QHMA 2VTTA 3TYKA 3SW4A 5JT2A 3E3PA 5EYCA 4GS6A 1H4LA 1XWSA 1ZAOA 3FY2A 3MFTA 3QTUA 3SOAA 2G9XA 4NSTA 4GK4A 1UU9A 3R30A 1JNKA 1QPDA 5DLSA 4ANSA 3TJCA 3O8UA 1SMHA 3BL7A 5IEXA 4QP1A 1H1SA 3EQRA 1B39A 2QO7A 5L2QA 5A6OA 5EM8A 4FG7A 4L7SA 4V01A 5AR7A 4BICA 3E63A 4S2ZA 4C2WA 5AAGA 4B4LA 3Q32A 4CFFA 3W2CA 2JEDA 3UO6A 4I24A 3G2FA 2GHMA 2X0QA 3CJGA 4C4JA 5EYDA 3ITZA 4D2RA 3QF9A 4V0GB 3O71A 3FXXA 2PZ5A 4OT6A 4O7VA 3UO5A 4IJPA 3ZONA 3O7LD 1BLXA 3EN4A 2PVMA 4QO9A 3TV4A 1LR4A 1CTPE 2G2HA 3AMAA