4IJ9A

Bovine pka c-alpha in complex with 2-[[5-(4-pyridyl)-1h-1,2,4-triazol-3-yl]sulfanyl]-1-(2-thiophenyl)ethanone
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
337
structure length
335
Chain Sequence
b'SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Accounting for Conformational Variability in Protein-Ligand Docking with NMR-Guided Rescoring
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 104
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ij9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ij9A02
3A7JA 4PNKA 4J8MA 4NM7A 4MD7E 3RI1A 2X7OA 3OW3A 1YW2A 4CV8A 5D1JA 3TACA 1RDQE 3G33A 3GFEA 4EHGA 3F69A 4FZAB 3Q9WA 2NO3A 3KF4A 1XWSA 3E93A 3FZOA 3Q4CA 4IB3A 3WARA 4BZDA 4DEHA 5JQ8A 3OZ6A 3DB8A 3LJ0A 3A7GA 1Q62A 3I0OA 3EQPA 1FGKA 2UV2A 2QO9A 2UW0A 4FKGA 1SVHA 4D58A 3DBQA 5CU2A 2I0EA 5HESA 4Y8DA 3PXZA 2ITPA 3EN4A 5DHJA 3TXOA 2R3MA 2VTHA 4L01A 1UNHA 3UOJA 3JYAA 3TI1A 4J7BA 5C4LA 4EEVA 3FLSA 5HNIX 1SNUA 4FYNA 5LCJA 2W17A 3DK7A 3MY5A 4MHAA 4UN0C 2CGXA 2WZJA 4G5PA 1AD5A 3Q4UA 1QPCA 4WRGA 4ZSGA 1FGIA 5HI2A 4C62A 2QKWB 5K4IA 2SRCA 3TUCA 3R9DA 2HCKA 5EHYA 5KMIA 1PXJA 1H24A 5KE0A 2UZUE 1Q5KA 5DT3A 4MXZA 3EWHA 3FXZA 4TXCA 4OT6A 2ZV8A 4S33A 2WMWA 3DOGA 1O6KA 2YA9A 3LPBA 5D7VA 5DR2A 3ORIA 2QVSE 5E9EA 1QMZA 1AQ1A 3UBDA 3D5VA 3KU2A 5CEMA 3KN5A 4C4IA 4E93A 2YIQA 3FC2A 5EW9A 2B53A 2UVZA 3TNHA 3P4KA 3SAYA 3RCDA 2ZJWA 3H30A 4FKTA 4BDCA 5A4EA 5HZNA 4HYIA 1CKJA 2ZB1A 4CLIA 4I1ZA 2NRYA 2XIKA 2VTSA 5CS6A 3DXQA 3H4JA 4G6NA 5J1WA 4E6DA 2YHVA 4RG0A 3KCFA 5HU9A 3GU5A 4R1YA 4MVFA 5IA5A 1YVJA 3SC1A 3QD4A 1JKSA 4EJ7A 1GNGA 5FTQA 3BHUA 4WNOA 4CCUA 4DH5A 5CU4A 3HP5A 4NEUA 3VN9A 2YM4A 4U5JA 4XV3A 3LIJA 1QL6A 5ANJA 5BVKA 5IA0A 2YM6A 3QD3A 4FV8A 4HYUA 5EG3A 4R1VA 4IZAA 3HAVA 4CFFA 4WOVA 5K5NA 3ZSIA 3S00A 2ITTA 2C0IA 4M14A 4I5HA 4R5YA 3T9TA 1OITA 1Q4LA 2VO3A 4QP6A 4XG2A 2XF0A 4HVHA 4USEA 5LWMA 3LLTA 3MY1A 2VX1A 3V04A 3BELA 5FBNC 3VRZA 4BYJA 3UQFA 4QTDA 4MBJA 5CALA 4JDKA 3ZS5A 2OU7A 1OMWA 3QCSA 1OKYA 3ORLA 3TV4A 2F2CB 5FRIA 4PWNA 5EDQA 1MP8A 4QTCA 4O0SA 5AP2A 2WKMA 4CXAA 3MA6A 3TWJA 2WMUA 3R0TA 3KY2A 4IWPA 4QPSA 2E9OA 4FVRA 3V5WA 3VS0A 4FR4A 3QTQA 3D4QA 3D0EA 2XUUA 4LL0A 4RGJA 3LXKA 4S31A 5CVGA 2JEDA 4K77A 5EDPA 5E8SA 5HO8A 4OBQA 3ZUUA 3U6IA 3GQIA 4GK4A 4CZYB 4KS7A 2QU6A 3VUKA 2IWIA 4F0FA 3NUXA 3Q6UA 5KKRB 1F5QA 2REIA 1XH7A 4IMYA 2W7XA 2XRUA 3IONA 5I9YA 1APME 5CT0A 3KFAA 4KD1A 3NRMA 2BRHA 5C1QB 1WBPA 3IDBA 1IA9A 1JNKA 1WBSA 3E64A 3C4XA 5LVPA 2YZLA 3PY3A 4NK9A 2XK9A 3TM0A 3A7IA 4BCNA 4F1MA 3Q2JA 1H00A 1QPJA 3EKKA 4ACMA 2PUNA 3TNIA 1ZWSA 2VO6A 1PMNA 4IWOA 4QT1A 5I9UA 3V6SA 3OOMA 3WBLA 5A54A 3IW4A 4OGRA 4PL5A 2C6TA 5ITAA 4RZWA 2P0CA 1XH4A 4RWIA 2FA2A 2O63A 3CR0A 3I7CA 4V05A 3ZO3A 2O5KA 4AN3A 3ETAA 3PPKA 4ARKA 4AE6A 3F5UA 2GFSA 2XKFA 3FQHA 4UV0A 3TNQB 4UY9A 5HX6A 2F4JA 4FYOA 2RFNA 4JAIA 3JVSA 4XLVA 5IZFA 3OTUA 4L53A 4TY1A 2W1IA 4U6RA 3HV3A 5DFPA 2JKOA 2A2AA 4KB8A 2ZM3A 5CLPA 4BWKA 5LOHA 1RW8A 3BQCA 4C0TA 3HRFA 2WU6A 3AMBA 4FSRA 4F09A 3O7LB 5BYYA 4CT2A 4FTAA 4FSTA 4OR5A 4GW8A 3S0OA 4RC4A 3DKGA 3OCBA 4MNEB 5M07A 4HPTE 3WF9A 2QOFA 2PULA 4WSQA 4YO6A 3SOCA 4JBPA 4HYHA 4PV0A 4NSTA 4RWKA 1H26A 4OTQA 2RF9A 1XO2B 3FBVA 1Q3DA 3CE3A 3NDMA 3W18A 3EL7A 3RZFA 5ANEA 4I92A 2VUWA 5B0XA 2WQNA 3LXNA 3R04A 4LV5A 5FBOA 3CQWA 3R02A 4WD5A 2XBJA 4FG9A 1JQHA 1V0PA 3OD6X 4FICA 3NNWA 1R78A 4FBXA 3TN8A 4EKKA 4LV8A 4KSPA 4DFNA 4XHKB 3WZKA 4BVUA 4KWPA 1ZYCA 1MUOA 4FG7A 5JZNA 3NAXA 4N6ZA 3EN6A 4IE9A 2OH4A 5HEZA 5KHXA 3NVMB 1NY3A 3NGAA 4S32A 1FVTA 4I4FA 1FOTA 3LFCA 5B7VA 5JGDA 3NZ0A 3C51A 4Q9SA 4FV2A 4GCJA 3K5VA 2FYSA 4ZY5A 3VW6A 1BI8A 3LVPA 3PZHA 4J53A 3QRUA 4W9WA 1CKIA 4FNYA 2ZOQA 3VHEA 1KE8A 5CVHA 3PXKA 3AQVA 1MRVA 2J0LA 3COIA 4L68A 4BBFA 5CAVA 4Q5HA 3C4CA 3HV5A 4QPAA 5AV1A 3V8WA 3FUPA 4AZEA 3O51A 4MD8E 1SZMA 1PRYA 4GG7A 4HJOA 3ANQA 4QP4A 1YDRE 3UNZA 5IA2A 2FO0A 3HA8A 4FKIA 4EYJA 2PMIA 2QKRA 2XM9A 4IQ6A 3UIXA 3NYXA 1H1SA 3VUTA 3QFVA 3QL8A 3V5PA 3ET7A 5HBEA 4B99A 2CPKE 4ZTLA 3V51A 5EM6A 3VUIA 2AC3A 3NUSA 1JSVA 3UNKA 4QO9A 5DNRA 4C61A 3TZ9A 4P90A 1Q8TA 2X4ZA 2X0GA 4UWBA 3OT3A 4YSJA 2C5VA 5IQEA 4MNEA 4I0RA 5AMNA 3GCVA 4IX5A 2QHMA 4U97A 3HGKA 4PNIA 4ASZA 4FV9A 1Y8GA 4U3YA 5BVOA 1RQQA 4U79A 3QBNA 3RK7A 1TQMA 3LXPA 4UZHA 2UW4A 3F88A 3PY1A 5HE2A 4MBIA 5HCXA 3WE8A 3COHA 3NCGA 3IDPA 4XRJA 4TTHB 2CLQA 4RFMA 3KRXA 1G3NA 2WMAA 5KO1A 3VS7A 1CTPE 2QURA 3VBVA 3F6XA 2PUIA 4BTJA 3L9NA 4GT5A 3MFUA 3RNIA 5HTBA 1UNLA 4X6QC 5CZHA 4O86A 2YN8A 2YLFA 1CSNA 2PPQA 3RAWA 4ZZNA 1JWHA 4XP0A 4L00A 3R7IA 2GMXA 1Q24A 4YMJA 1E1XA 3MVMA 1T46A 4HYSA 2GNGA 3FZ1A 3GGFA 4YJTA 3HDNA 4AA4A 5HVJA 4D9TA 4NWMA 4NYEA 3FMMA 4IJPA 2IW9A 3U87A 5TF9A 4F9BA 1SYKA 3BYUA 1BX6A 3UZRA 3QCYA 4CMOA 2Y0AA 2I0YA 3BKBA 4AGCA 4FV0A 4I5PA 2X1NA 2BMCA 2R7BA 3RPVA 4P5QA 2GHGA 3I81A 3FPQA 2W1HA 2C47A 1IEPA 4FT9A 2WHBA 5J79A 3VQUA 4APCA 3MVJA 3NUNA 4NIFB 4L46A 4JXFA 2PZIA 3Q9ZA 2VWZA 3KCKA 4MYGA 3BU5A 1JVPP 1R0EA 4XV1A 2JFMA 4BI1A 5EQYA 1ZOEA 4JG6A 2VWWA 2BAQA 3F3ZA 4PRJA 4LOPA 5E4HA 4PMSA 2WFYA 4A7CA 3UIUA 4BRXA 3W55A 4D2SA 3V5JA 3SKCA 2PY3A 2V55A 3NYVA 4B6LA 2W5HA 3LFAA 1WBOA 4L44A 2OF2A 3R30A 2HENA 4ITJA 4ANOA 4BDKA 3ACKA 4JRVA 4O0XA 5B2KA 5ACKA 5HG7A 3GEQA 2WEIA 1P2AA 2Y4IB 2QU5A 3O23A 2ITOA 1PKGA 4PL3A 4I22A 1ZYLA 3DBDA 2YERA 3LE6A 4IZYA 4RC2A 4RQVA 3QWJA 3VBTA 1ZZLA 1OUYA 5CXZA 1KV1A 1K2PA 3DNDA 2IVTA 4G6OA 4AZTA 4R3CA 3MPMA 4FTNA 4AW2A 2IO6A 4D4VA 3IOPA 3PPZA 4G34A 4O7SA 2XRWA 4AT4A 3UYSA 2WTWA 3SW4A 5KMOA 4EH4A 4GVAA 3BEGA 4WSYA 2HXQA 4JNWA 5JZJA 1OL2A 5HO6A 4IAIA 4F7NA 4U8ZA 5AP3A 3R1YA 4DFXE 4OTWA 2F7ZE 2ITXA 2GTNA 3EJ1A 2P3GX 3Q5IA 4DG3E 4EUUA 3OXTA 2X7FA 3R8VA 3NSZA 3O0GA 5AR8A 3KXXA 5IA1A 3HYHA 5DA3A 4FNXA 5DVRA 5J7BA 1FPUA 5KMJA 2VTLA 4RX9A 3TL8A 3KB7A 5HLWA 4RFYA 1KE9A 4L8MA 4FX3A 4HZSA 3SQQA 4F64A 4NFMA 4NIFA 2WTVA 2XCKA 2JGZA 5CAOA 2QOOA 2RIOA 3VC4A 5FWKK 5D9HA 3P08A 3Q9YA 4CKRA 4QQ5A 3KREA 4XOYA 3QC9A 1IG1A 4K2RA 4FTMA 5EI8A 2BTRA 5LJJA 2PMLX 4IVBA 4I6BA 4BYIA 4DH3A 4I24A 1ZARA 4M84A 2VU3A 3R8ZA 5AP5A 2B9JA 4G16A 2A0CX 2Z2WA 5M06A 3FHRA 4A07A 4G1WA 3QLGA 5FTOA 4AE9A 4YGAA 3BIZA 1GIIA 2ITNA 4ZJVA 3R22A 3DJ5A 4GFOA 4U44A 5J87A 4GJ2A 4FKWA 4U42A 3D83A 1FMKA 3LKMA 3DXPA 3EQHA 3ZXTA 4MNFA 3K2LA 3E8EA 5AUYA 1KV2A 3HUCA 3ORTA 4QTAA 5F20A 3T8OA 4EOLA 3R7VA 3FHIA 3FV8A 2WNTA 4ERWA 3ANRA 1UU7A 5D12A 3GC7A 1VZOA 2B9HA 2C6OA 3WIGA 1YXXA 2R0IA 5HG8A 5A14A 4OTRA 4YNEA 1XJDA 5A4QA 3GC0A 3ORKA 3UPZA 4F6SA 3PE2A 1FQ1B 3IECA 4BDFA 4S30A 5L2TA 4PDSA 3RPRA 4EZ7A 4CVAA 2NNWB 1JLUE 4CRSA 2YCQA 4QYFA 5CVFA 4ACDA 3Q2MA 4O7NA 5AM7A 5CEPA 3GCSA 3R8PA 1VYZA 5BNJA 3ZZEA 3ZXZA 4WNPA 4FSMA 4N0SA 3U6JA 4TL0A 3UIMA 5E1SA 3N51A 2XIZA 2KULA 4XG8A 4TT7A 3W1FA 2WQBA 2BIYA 3OEFX 4GT3A 4AGUA 3ZONA 4C4GA 4CNHA 5EHOA 4IDTA 4IDVA 1WCCA 2PMNX 4XP3A 2G2IA 4GMYA 2DS1A 2VO0A 4AX8A 5E8YA 4BGGA 1XHAA 1YWNA 2YDJA 4RSSA 2UW7A 4EOOA 4I20A 3IQ7A 5IEVA 3TUBA 5KHWA 1WVXA 1H1RA 3PIXA 1W98A 3QXPA 2WMTA 4UB7A 2QG5A 1NW1A 2XEZA 5HE0A 4F9WA 3L1SA 3PRIA 2WO6A 2EXCX 3TIYA 3OXIA 4C57A 4FV5A 1VYWA 1GAGA 4XG9A 4UMRA 1V0BA 2E9PA 5L6OA 2R9SA 4KBKA 4UMQA 3WILA 2V7OA 3G6HA 4FKQA 3WYXA 1YDTE 5ETIA 2WGJA 4HPUE 4M68A 4QMXA 3ZM4A 1PXLA 3QQKA 5K4JA 4C4HA 5FTGA 2F49A 3VS5A 4D4RA 4XNEA 2UZWE 4FT0A 4ZZOA 4DFZE 3C9WA 3Q4TA 1ZOGA 2W4KA 3GFWA 4J95A 5A3XA 3DS6A 2PU8A 4FGRA 3LM5A 2NP8A 3REPA 4RVTA 1BL6A 2OG8A 4EH2A 4GKIA 4L52A 3QQLA 3F7WA 5IQAA 2ZV7A 1DI8A 4GRBA 4O0WA 1CMKE 2HZNA 4UEUA 2J7TA 2QQ7A 2QC6A 4L7SA 3N9XA 4E5WA 3DZQA 1KSWA 3CKWA 3TUDA 2GQRA 5CSPA 5AR2A 4LM5A 5CNOA 4X2GA 3ZUTA 3QF9A 3LMHA 3R21A 5EOBA 5FLFA 4IXPA 5CWZA 4IB1A 5GINE 3FMEA 3HMNA 2UZDA 2J0IA 2PSQA 3MW1A 3ORXA 2ZM1A 3VS4A 3CXWA 4PY1A 4D5KA 5DN3A 1GJOA 3FXXA 2GPHA 4RRVA 1OPJA 4E4NA 3LQ8A 5EM8A 3ZUVA 5IQHA 3F9NA 4D0XA 1ZAOA 4Q5EA 5E1EA 2F7XE 4ZJJA 4YZCA 5L8KA 4GT4A 4HNIA 4RA5A 5H2UA 2YAKA 5LVNA 3L8PA 3I5ZA 4CV9A 1G8SA 3BGZA 3VS2A 3ZLWA 4QTBA 3NIZA 3KRJA 2QOHA 4MXAA 3IW7A 3QKLA 4AZVA 4PMPA 2QO7A 2J4ZA 2GNLA 2H8HA 5HLNA 4GJ3A 2IPXA 1S9JA 4RIWB 1U46A 4II5A 4A9SA 4I5CA 2OZAB 2F9GA 4O0YA 4B8LA 3C13A 2PK9A 3QZIA 1G5SA 4LMUA 4XS2A 4BHZA 5IUGA 4ZTRA 3SXSA 5JK3A 4R6VA 3D5XA 4O2ZA 3E8DA 3AT3A 3KULB 3P1AA 4DINA 4IAYA 3R83A 4BTFA 3JS2A 3OCGA 3I79A 2X81A 4YC6A 3P7CA 5CYIA 3OWLA 3JPVA 2WELA 3BE9A 5BUIA 2BPMA 4H1JA 2QODA 2XKEA 4BF2A 3OS3A 4DG0E 1OM1A 1NVQA 4OTPA 5J7HA 4FEXA 3L8VA 1JBPE 5JQ5A 4AT3A 2IJMA 5I3RA 4AAAA 5DGZA 3IKAA 4BCGA 1PF8A 4FKUA 3ZOSA 3KVWA 4AW1A 5DI1A 4JBQA 4D2RA 1Q8UA 2DYLA 2IZUA 3E3BX 3L8XA 4GV1A 2RFEA 4I41A 4J96A 5E8XA 2UZNA 3E8CA 3VBQA 2PZ5A 4IEBA 3VS6A 5JFSA 2VWVA 3MDYA 2X4FA 4ITHA 3LCDA 4GSBA 3E5AA 3P79A 4GUEA 3KK9A 3DAKA 4BDHA 3ROYA 4FA2A 4O22A 4YHTA 2YACA 3A8WA 3P0MA 5IDPA 4ANSA 4U9AA 1FVVA 4YJVA 3C0HA 3ID6C 4QQJA 4LUEA 3DAEA 3L8SA 3FLNC 4W9XA 3FKOA 2QG7A 3DT1A 2X39A 3CEKA 2I0HA 3EQIA 5E91A 2RFSA 3ERKA 2ZDUA 2FSMX 2GHLA 2ZYBA 4JRNA 2IW8A 5HCYA 4BN1A 4Y85A 4NM0A 4V01A 4NTTA 1XBAA 2YITA 4JVGA 2OKRA 3NR9A 3Q3BA 4E4XA 4KKEA 2JIVA 4GVJA 2Z8CA 2VWXA 2O65A 2PVYA 3ZC6A 4RIWA 3WE4A 4IADA 1V1KA 2I6LA 4C36A 3SA0A 3PDTA 2OZAA 3OW4A 3PXFA 1J1BA 5L8LA 3P9JA 2R3GA 5IPJA 5HVYA 5EKNA 3CBLA 2UVXA 2G9XA 5C8KA 4BCOA 2VNWA 5CZIA 2H9VA 3KULA 4HGTA 4NM3A 3W32A 3DB6A 4DG2E 1SNXA 4X2JA 3FE3A 4E6QA 5M4IA 3ULZA 5KX8A 2W1GA 4TRLA 3BI6A 3BZ3A 2VX0A 2ZV2A 4RWJA 3DTCA 3F2AA 3QQGA 3UDBA 2RFDA 5AIRA 1QPEA 3LCKA 2JDSA 4YURA 2ZMDA 3Q04A 3Q53A 3NPCA 3CIKA 3RAHA 5GZ8A 4DFUA 1OVEA 3LMIA 3Q5ZA 4AZFA 3FLQA 3H0YA 4A9RA 3H9OA 3E63A 3UE4A 5C26A 4C4FA 4UWCA 3THBA 2WOUA 3LJ2A 4OBOA 4ANMA 4F65A 3EMGA 3QCXA 4FEQA 1UVRA 2RG6A 4FGBA 4EK3A 1R1WA 3QRKA 4BCMA 2CKQA 4DFBA 3BEAA 2WTJA 3UC3A 3QTWA 4O7YA 2ITUA 3DKFA 3ROCA 3HDMA 4IB0A 4C37A 1GIHA 4GH2A 4E5AX 4ALVA 3C5IA 1UNGA 3WYYA 2BAJA 2Y4PA 3R7UA 5H3QA 3O8UA 3W2QA 3ZSGA 1GIJA 1MQ4A 3KRRA 5F1ZA 4ANNA 2VO7A 4YJSA 1DAYA 2VTNA 2A27A 3DA6A 4DITA 4R7HA 4ZZMA 4EOQA 4BFMA 5AP0A 2H96A 3MS9A 4X0MA 4EQMA 2HZ0A 5F9EA 3UO4A 4BDAA 4HVIA 4DCAA 4GYGA 3QGYA 1ZRZA 1H01A 2PTKA 3O17A 3PRFA 4MQ2A 2ONLC 4FTCA 2HK5A 4G31A 5ACBC 4AQCA 2CKOA 3NMUF 3GC9A 3MH3A 2CN5A 4PP9A 3HRBA 1L8TA 4ENXA 5AFVA 3FZSA 1S9IA 2UZLA 2W05A 3PJ2A 3MB7A 3WZJA 3CTJA 4JLCA 5DRBA 4ASDA 1KOBA 3LXLA 4JIKA 1TVOA 3G90X 3TNPC 4J97A 4TN6A 4QYYA 4ZY4A 4JX3A 3F3TA 4G3EA 3ZLXA 4EYMA 2XNNA 5KCVA 5M55A 2PVKA 4JR3A 5AUTA 1BUHA 4D4YA 1NVRA 4O82A 4MCVA 3QRJA 1W8CA 3NW7A 4AOTA 4AP7A 5A46A 3EN9A 2BAKA 4OTFA 4F08A 5AR4A 2QR7A 4NCTA 3EL8A 5A9UA 3E7VA 2XEYA 3QA8A 3G0FA 1J3HA 2JLDA 2VWUA 4A9YA 2WQOA 4IBMA 2C6DA 3PVGA 3AC1A 1A06A 3DJ6A 4FSUA 4ZS0A 3R9NA 3TTIA 4F0IA 2R3JA 3WZDA 3V01A 2CNQA 1H07A 3QUDA 4RIOA 5D7AA 4ORKA 4LL5A 3FMJA 2W1DA 3BHVA 4J71A 5HU3A 5IH6A 2GQSA 5GZ9A 3NVKI 4PP7A 4AN2A 4IM0A 2XM8A 3Q96A 3R73A 3BHHA 4EK6A 4USFA 1A9UA 2PMOX 4JIAA 2YCSA 5ICPA 2XNEA 3OMVA 4R8QA 3PSCA 3AMAA 4XBRA 5FEDA 3OY3A 1B39A 2RGPA 3OEZA 2V5QA 5IF1A 5B2MA 2YEXA 4DEAA 5C4KA 2OGVA 5GNKA 3UP2A 2GSFA 2B54A 3DJ7A 4YUQA 2WQEA 2BRNA 5I0BA 3UQGA 5F95A 3VBYA 2OLCA 3MIAA 2JKKA 2J90A 4Z55A 1Q97A 2FB8A 3GP0A 3VBXA 4BDGA 3O2MA 4TNBA 2JAVA 4ACHA 1E9HA 2B9IA 4X3FB 5IISA 4GK3A 2OF4A 3NUYA 4UXQA 4FL1A 1H1QA 4FV4A 1R0PA 4IM3A 4XG6A 5HIBA 3RK5A 3ORNA 3NNUA 3EH9A 3EN7A 3QQHA 2XKCA 5CQWA 2B4SB 4B8MA 3AC3A 5JH6A 4L3LA 3F5GA 4R3PA 3RTPA 3AC2A 3ZEWA 1MRUA 3ZSHA 3SHEA 3DY7A 1XQZA 4IANA 3FC1X 3VUHA 4DGOA 5EM5A 4Y73A 3SG8A 5HD7A 3LQ5A 1H1PA 4Q9ZA 3UMXA 5KMNA 4MK0A 1PMEA 4DN5A 4U3ZA 4F1OA 2JDVA 2H6DA 2P33A 2OIDA 2VTTA 3UO6A 2IZRA 2I7QA 4V0GB 1H27A 1Q3WA 3CY3A 4QTEA 5IH4A 2W9ZB 2WTKC 4I0TA 3CLYA 4G3DA 3TZ7A 3FDNA 3U51A 3FYKX 4YJRA 2IZTA 4K11A 2R3QA 3ZTXA 1JKKA 1ATPE 5IEXA 4RLKA 5AR5A 3GCUA 3ZU7A 3RPOA 2OZOA 3W2CA 2VTAA 4U41A 2GQGA 4I6QA 5LMKA 3K3JA 2OIQA 2GTMA 4XYFA 3H9FA 3DTWA 4FF8A 3PG1A 3VWAA 4EOSA 5L6WL 2J0JA 5H8GA 3EFJA 4AU8A 3RVGA 5EOLA 2YM5A 5LXMA 1H8FA 2UW9A 3F3VA 3ZO2A 2XYNA 3RHXA 2RL5A 3TTJA 4BCIA 2QI8A 1U5RA 2YCFA 4XMOA 5LWNA 2Z02A 3OF0A 3TV6A 3P23A 1XKKA 4X3FA 2UW5A 5G1XA 3QX2A 5AV0A 4C35A 2RKUA 3UVRA 3PYYA 5L4QA 4QP8A 3F3UA 5EW3A 3TZ8A 1OKWA 1M2RA 5BVEA 2IVVA 3PXRA 4JG8A 1YOMA 4F0GA 4CKJA 1ND4A 4HVSA 3CSVA 1BLXA 2XVDA 2GS7A 5FEQA 5M4UA 5I3OA 1NVSA 3UQCA 4AUAA 4BKZA 4UMUA 4RJ7A 3MV5A 3NS9A 1I44A 4BL1A 3QTZA 4IH8A 3IW6A 4XUFA 5L2SA 2XK4A 1YHVA 5KBRA 4OAUC 2B52A 4W4XA 4O7ZA 3ZO4A 4A9UA 5DMZA 1YWRA 2PE0A 3R2BA 1OIUA 4QP1A 4ERKA 1H4LA 4A06A 4KS8A 3LAUA 2BUJA 4M7IA 3ATSA 3MIYA 3OFMA 1X8BA 3PJ1A 3ORPA 4FTUA 3D14A 2HXLA 4V0GA 4BBEA 4CLJA 2UZVA 4QQTA 3UZPA 2JBPA 5JN2A 5KBQA 3SX9A 5IQFA 1PXMA 2VD5A 3V5TA 1B38A 4DGGA 2F57A 5I9WA 3A8XA 4PPCA 2CLXA 4C7TA 3A7HA 3MY0A 4NW6A 4U43A 3EB0A 4L67A 3R28A 4NJ3A 3F3WA 5LARA 5BVDA 4WT6A 1Q41A 1OIYA 1YOJA 2BZJA 5AADA 4XX9A 1ZYSA 1OL1A 2PE2A 5G6VA 3OTVA 4WIHA 3U8WA 2FSOX 5AUXA 3DQXA 1SVEA 3F7ZA 4B9DA 2BR1A 2C1BA 4IWQA 5K3YA 3I0QA 2UUEA 3PZEA 3EZVA 4X3JA 4ASEA 4AWIA 4LGDA 4BDDA 2Z7RA 2CJMA 3EHAA 5A6OA 3VRYA 5M57A 3K54A 4BCKA 4J98A 4RFZA 1WFCA 2UZBA 4YJQA 2GNIA 2QLQA 4JT3A 4MX9A 4CSVA 3FI8A 3LM0A 4YJOA 5EI2A 3BWJA 3GC8A 4FL3A 2HZIA 4MXOA 4KKHA 4TZRA 4QMQA 1OKZA 5IG1A 3QA0A 3QD0A 4KIKB 1YHSA 4IJ9A 5IUIA 5BYZA 3ZFYA 1WBWA 4QMOA 5CY3A 4NJDA 2UW3A 1H0WA 4M69B 4KIQA 4Y46A 5ANGA 2P2IA 4G3GA 3TEIA 2AYPA 4N70A 4OTGA 2Y8OA 3EQGA 4BR3A 4YPDA 4N6YA 3PSDA 3QUPA 4O1OA 1WBVA 3PXQA 3U54A 3NIEA 5LCKA 4AGDA 4NUSA 3L9MA 4YJNA 4DGNA 3Q52A 3EFLA 4IFCA 5A4CA 2GHMA 4M67A 3QQUA 3KA0A 5JEBA 2IG7A 2CCHA 4UALA 3QALE 5CEIA 5HBHA 4YZ9A 3BGQA 3WIKA 5CI7A 4NTSA 1OIQA 4QP7A 5DEYA 5JRQA 4GUBA 2XB7A 5IQCA 3LOKA 4WNMA 1ZYJA 2G2HA 2ESMA 2C6EA 3CTHA 1GZKA 4FK3A 4GU9A 2VN9A 4M8TA 4WG4A 3QHRA 4YZDA 3VBWA 1H28A 1OIRA 4EUTA 2GS6A 1KOAA 2OIBA 2BRBA 2WIPA 3LCOA 4BBMA 4CTCA 4K8AA 4EJNA 2G15A 3CJGA 2R3KA 4IX6A 3C50A 4FTLA 4C2WA 5BMSA 4ZXTA 4CTBA 5KMMA 3HV7A 4O0RA 2Y6MA 1ZMUA 3GU7A 5CSVA 3HMIA 5FGKA 1J7UA 1YXUA 1U54B 3FMHA 4U81A 4PF4A 5AIKA 4D1ZA 3N4TA 3ZBXA 4O81A 3TKIA 4FV6A 1AGWA 1J7LA 2O8YA 5CF8A 2JDOA 3MTFA 4U45A 5AP1A 1UV5A 3LW0A 4RQKA 1OUKA 3EQCA 4QMMA 4GIIA 4TYIA 3MH2A 3S3IA 4TWPA 4Q2AA 3FMLA 4QMUA 4O1PA 3PA5A 4WKQA 4QRCA 3UIBA 4MXXA 4ASXA 1E1VA 3FZRA 4C58A 4DGMA 1YI3A 5L2IA 4MF1A 4KIKA 4M15A 5CEKA 2X2LA 2O3PA 5CEQA 1YXTA 4Z9LA 3M11A 2V22A 4ZOGA 3VULA 5I9VA 2Y7JA 2CCIA 2R7IA 3OROA 4M69A 5EYDA 4DFYA 3B8QA 4EBVA 2C3LA 3D2KA 1W0XC 5M4CA 2J0KA 3A2CA 2WMBA 1MQBA 3B8RA 4WG5A 4C34A 2CGWA 1JSTA 2IN6A 3NW5A 1KWPA 1IR3A 4A4OA 4O84A 4R7IA 2WAJA 4FTIA 4BCFA 4W8DA 3II5A 2ZM4A 3EQRA 4G5JA 2X8EA 5DYJA 1DI9A 2PZYA 3NW6A 4E26A 1YXVA 4F63A 3SG9A 5AWMA 3UODA 4YLJA 3BHYA 2GCDA 1PXPA 2IVUA 2BDFA 3GUBA 3G9LX 1XH5A 4BTMA 4QYHA 3TZMA 3NNVA 5FEEA 3RWPA 3T9IA 5DWRA 2BILB 1Q99A 4JX7A 4QPMA 3QXOA 4YBJA 3QU0A 5IDNA 4EOIA 4XV9A 4KA3A 1OGUA 5IEYA 2PZPA 5HVKA 4E7WA 4WHZA 3GBZA 3KMUA 3RALA 3G15A 4G3CA 3A99A 3RZBA 3HL7A 3O8TA 4IHPA 3O50A 4IAZA 1YI4A 3HV4A 2WPAA 4I93A 3VUMA 2R3IA 5E7RA 2XS0A 4FKOA 4O27B 3H9RA 4RIXB 1U54A 4MQ1A 4AOIA 4NH1A 3UVQA 2V0DA 2YWVA 2QNJA 4JDJA 4LGHA 3H10A 2E9VA 3I1AA 3R7YA 1YRPA 4GFGA 5FQDC 4IB5A 5IUHA 4W8EA 1OKVA 4FTKA 4TYGA 5BX0A 4ACGA 4AG8A 3ELJA 4WUAA 2B55A 4OBPA 3VAPA 3D2IA 4IVAA 2BZKB 4KABA 4XRLA 5KKRC 3CKXA 5FXSA 2JIIA 3SDJA 2YISA 5E92A 3POZA 1IAHA 4FEVA 2GNHA 2QHNA 2OWBA 3W2OA 4FI1A 4TW9A 2DWBA 4TYEA 5J9ZA 2B9FA 3C0GA 5EK7A 4CG9A 1KUTA 5GJFA 3PJ3A 5FP6A 4NZWB 3CPCA 4EZ3A 4Y83A 2LGCA 4FIJA 3AC5A 1STCE 1DM2A 2WMQA 4KIOA 1NXKA 4YBKA 3HECA 2WMRA 3TNWA 2QOQA 5AUUA 4QMTA 5D11A 2VTQA 2XKDA 5L2WA 3R6XA 3QYZA 4XH6A 1P5EA 3PVWA 2OFVA 5HG5A 3ALOA 3CQEA 4H39A 4D2VA 5K5XA 3WZEA 4ANLA 3D5UA 4U80A 4BI2A 4EZ5A 3BX5A 3R8LA 3ZM9A 1YDSE 3HKOA 2XNOA 3PVBA 3DU8A 3OC1A 1OECA 1L3RE 4MF0A 1Z5MA 1UKHA 2H34A 3AD6A 4I23A 3HZTA 3P78A 5AR7A 3LJ1A 5ETFA 1VR2A 5BQ0A 1UU8A 5J1VA 3R01A 3HAMA 3D5WA 2J51A 2EU9A 2Q0BA 3DKCA 3T3UA 2PUPA 3BU3A 3E87A 2C69A 3UNJA 4D55A 5LQFA 3DK6A 5HNBA 5EFQA 3S1HA 3V8SA 4M12A 3QGWA 4YPSA 3DAJA 5FM2A 3RINA 4DC2A 4RBLA 4RIXA 3H0ZA 3ZLSA 3AD4A 4EWHA 4IAFA 2XBAA 3ZC5A 3DGKA 4RVKA 3N4VA 4DFLA 2HAKA 4IM2A 3UG1A 3WOWA 5FXQA 4ZP5A 4UXLA 5CF4A 4IACA 3DDPA 3I5NA 3QZFA 2QOIA 4O91A 4O6LA 4PTGA 1Z57A 1T45A 3OVVA 5EQEA 3UJGA 4RVMA 3ATTA 4NFNA 2EVAA 3F66A 4BGQA 4QQCA 2QONA 4ZSLA 4FKJA 4P5ZA 4O7WA 3A7FA 1WAKA 2ETKA 4D2PA 3SW7A 4NM5A 4LFIA 4A4XA 3OCSA 4TWNA 4DAWA 3FLZA 4G3FA 4P7EA 3S2PA 3VVHA 2OW3A 5CX9A 5AUVA 1REKA 3SXRA 3ZMMA 3RP9A 3EIDA 4NKAA 1XR1A 4S34A 4I6HA 5TOZA 2UZEA 4FT5A 3TIZA 5HHWA 1ZY4A 1LP4A 4KBCA 2VTJA 3QX4A 1R39A 3QYWA 2OSCA 1SMHA 2FSLX 2CSNA 2ETRA 3VQHA 1BMKA 4J8NA 1H1WA 1LPUA 3GB2A 3NYNA 3W2RA 3CPBA 2QOCA 3WF6A 3ZRKA 5I9XA 3BWFA 4F9AA 4G9CA 3BCEA 2I0VA 2O0UA 2HY0A 5M08A 2P4IA 4CFXA 3LFBA 3MPAA 1U5QA 2PVHA 4G6LA 4FKLA 3SRVB 3QRIA 4FZFB 2ACXA 1LUFA 2NRUA 5C8MA 4RMZA 2W96B 5FG8A 2X9FA 5HTIA 4FIGA 4C02A 3BLQA 2I1MA 3FI3A 3KK8A 4PDYA 4O0TA 4CCBA 1ERKA 4I21A 4R3RA 4F4PA 5J5SA 3RAKA 2HZ4A 2EWAA 2OJGA 2R3RA 3ORMA 4AW5A 2YCRA 4H3PA 3UOHA 3MBLA 2FUMA 3AGMA 2OBJA 4U0IA 5AA8A 4EH5A 4YZBA 5TR6A 4RJ5A 2YJSA 4R5SA 2ZB0A 2VZ6A 3R7OA 4QYEA 2X6EA 1JSUA 4OTHA 4WA9A 3LFQA 5KMKA 1ZMWA 4RJ8A 2QCSA 1OL7A 4FG8A 4P2KA 1Q8ZA 3ZZWA 3DK3A 5ETCA 4HVDA 3NAYA 4XG3A 3SXFA 4MBLA 1P4OA 3B2TA 4OUCA 3PLAE 5GIPE 2JITA 5AA9A 2XIRA 5DH3A 4S2ZA 3Q32A 5AAEA 4BIEA 4RPVA 2JDRA 3LZBA 2QOBA 3NUUA 3MSSA 4JAJA 4UWYA 4JOAA 4WBOA 4AA0A 4EK5A 4CYJA 2R64A 3CS9A 3D7ZA 1Y6BA 1PYXA 3NLBA 5A6NA 5HBJA 5IA3A 3NUPA 3ENMA 1VJYA 3OT8A 3FXWA 3BV3A 5CSXA 4DBXA 2R4BA 3DQWA 2ZVAA 3PP0A 3RPSA 3MH1A 3KKVA 5J5TA 3IW8A 1YQJA 2UW8A 4PX6A 1P4FA 5CAUA 4GS6A 4E73A 4E6CA 3ACJA 2ZMCA 4OTDA 3S95A 3SRVA 3DV3A 4G2FA 2XK6A 4FSYA 3VIDA 3GI3A 3AC8A 3HRCA 3U9CA 3KRLA 4O7LA 1Y8YA 2A4LA 3R9OA 3WZUA 4EH6A 2YIRA 4BDJA 2BFYA 1PXNA 4QP3A 3ZH8A 4APPA 4ZMFA 2YJRA 4JBVA 5DT0A 4C8BA 3KQ7A 3AG9A 4BI0A 3C4WA 3VS1A 4D1XA 3ORZA 4FTJA 4FUYA 2GU8A 1ZYDA 2HELA 4O38A 3QTXA 3ZCLA 5JFXA 1FMOE 3E8NA 4Z3VA 2XMYA 5EKOA 2PZRA 3G5DA 3OXZA 2PVMA 3PXYA 3IG7A 3RHKA 3AC4A 3VF8A 3F61A 4H58A 4GFMA 3DDQA 4O21A 5TT7A 3RJCA 5HLPA 5CF6A 4EH3A 3HEGA 3SLSA 3ZEPA 2Y4IC 5JFVA 3E3PA 1J91A 4LOQA 4FTTA 3C4EA 2BKKA 5HOAA 2C3JA 1UWJA 3DCVA 4RA4A 2OO8X 4CGAA 2PWLA 4ZTQA 3VUDA 4YSMA 4RX5A 3O8PA 5D41A 5CF5A 3ZYAA 2R3PA 3RBWA 5JGAA 3AMYA 4MXYA 2J0MB 3MFSA 5DR9A 3OWPA 3QKKA 5TO8A 2QLUA 2XH5A 2ERZE 3RAIA 4BC6A 3LCSA 5CTPA 4HCTA 4QMPA 3MA3A 1H08A 2VTRA 2ERKA 1WBNA 2C4GA 4OLIA 4ZTSA 4DEDA 5LMBA 2WMXA 4L45A 4TPTA 2JFLA 3UGCA 2PVJA 3I7BA 2CDZA 3EFWA 2W99B 2C5XA 2Z60A 3DNEA 3GT8A 4I94A 4ZSEA 3R9HA 4F6WA 4RT7A 4EK8A 2BROA 4C33A 5L2QA 1PY5A 2J5FA 2W1FA 5T68A 4CFWA 2XJ2A 3MPTA 4XP2A 3E92A 1PKDA 3MFTA 3CP9A 4FL2A 2XCHA 1PXKA 3BLRA 3C0IA 1YOLA 3LFFA 2BCJA 3TDWA 1BYGA 3D9VA 3BYMA 4XEYA 4MD9E 5EQPA 4PL4A 5DT4A 1RJBA 4HVGA 3FMDA 5HD4A 2JIUA 3IOKA 2VTIA 1URWA 1YWVA 3BGPA 2J50A 5AUZA 4YU2A 4FVPA 2RG5A 3IGOA 5E8VA 4PPAA 5L8JA 4BWXA 3LLAA 2OI4X 3D15A 4RJ6A 1NA7A 3UO5A 5AV3A 2B1PA 1G8AA 2CKEA 4LRMA 3FQSA 3VF9A 4O7TA 4D9UA 3G0EA 2ZAZA 5DRDA 5HE1A 3VUGA 4RZVA 2E9NA 4W4WA 4CFUA 3JR1A 2VRXA 5H8BA 3UC4A 3FL4A 4CKIA 4AOJA 3QWKA 4D2TA 1JOWB 4AN9A 4FE2A 1IA8A 3PJCA 1XH6A 1PMUA 1R3CA 2C5YA 2W1EA 3R00A 4XOZA 4XJ0A 4YHJA 3ZO1A 1ZXEA 2GDOA 3VO3A 3EQBA 3AOXA 4EH9A 2HIWA 3FZPA 4FZDB 3QKMA 1M7NA 4KIPA 4BCHA 4LRKA 4BKYA 2E2BA 2R3HA 5KZIA 4A9TA 4HW7A 4FKRA 3U55A 5CEOA 1DS5A 5AJQA 2W5BA 1OPLA 1Y91A 1YHWA 5CU6A 3PA4A 4K6ZA 4ZTHA 4GYIA 3ZHPC 4F1TA 5CAQA 4O0UA 4AFJA 4AFEA 4CD0A 4IAKA 4ONAA 4EI4A 4NKSA 3FSKA 5JRSA 5B2LA 3LMGA 4HCUA 4IIRA 4WRSA 3JUHA 5BUJA 1JPAA 1OL5A 4QMZA 5GJDA 5M09A 3RKBA 4FZ7A 4FIFA 1UA2A 4J1RA 5BPYA 3HNGA 4D0WA 3RGFA 4TNDA 5CASA 3DLSA 4I3ZA 2C1AA 3VS3A 2X2KA 5BMMA 4DF3A 4AGWA 4HGLA 5F4NA 2OJFE 1O9UA 3KXZA 4PMMA 3HA6A 2CKPA 5KZ0A 2WXVA 2HY81 3BBTB 5DIAA 1XH8A 4NL0A 5D10A 4DYMA 3ZFMA 1REJA 3DZOA 3QQJA 3FEGA 5EI6A 2Q0NA 5DLSA 3MH0A 3P7AA 5GZAA 2YAAA 2WTDA 5LVMA 3KL8A 5EM7A 4XBUA 3LHJA 1PW2A 1W83A 4U7ZA 1QCFA 4M0YA 3DKOA 3KXNA 4KRCA 3MWUA 3E7OA 4PTCA 2X8IA 3BQRA 3BE2A 5T6KA 4KBAA 2NPQA 4DTBA 3EOCA 2PVNA 4G17A 5EH0A 2PL0A 4PDPA 5CENA 4RC3A 2ITZA 3MJ1A 4CYIA 5IQDA 3LQ3A 3LFEA 3FKLA 3R9RA 2BZIB 4D2WA 4IZ7A 1IRKA 2C68A 3RWQA 4JDHA 1QPDA 5HX8A 3KEXA 4GU6A 4X21A 1TKIA 1EH4A 3DPKA 3LFDA 4YP8A 5HNGA 5BVWA 4H1MA 4DH1A 5BVNA 5IQGA 2BRMA 1J1CA 2EB2A 5AAGA 1JKLA 3U9NA 4BDIA 3OBGA 4YTFA 2G2FA 4EHEA 2OJIA 3IGGA 4HCVA 4DE4A 2HWPA 4DA5A 2BDWA 2WOTA 5A4LA 4YTIA 2DUVA 3NEWA 3IS5A 4OT5A 2I40A 2WEVA 3ZDIA 5HGIA 3FKNA 4PDOA 3KC3A 5FXRA 3QAME 4K18A 4KSQA 4L9IA 4C3RA 1O6YA 2W9FB 5ANDA 4TYHB 4RLLA 4E3CA 4EKLA 3T3VA 5ANIA 4TWCA 1ZOHA 5DR6A 5AUWA 4DTKA 3SGCA 3F5PA 2OICA 5C27A 3FJQE 1YI6A 2EXMA 5JGBA 3BLHA 1OPKA 2YLEA 3M1SA 4J52A 4IX3A 4MWHA 3U4WA 3GOKA 3UVPA 4QD6A 5HG9A 4PPBA 4I6FA 2XNPA 1M14A 4L42A 5HE3A 4M0ZA 3FL5A 5EYMA 3ZRLA 1XBCA 4FEUA 4IFGA 5CU0A 2CGUA 4C59A 4ZY6A 1OZ1A 2KTYA 1Y57A 2ITYA 1FVRA 2G01A 3RM6A 3MJ2A 3V5QA 3GU6A 4IAAA 3GCPA 3CQUA 4ITIA 2HW7A 2XK3A 4D4SA 3ODYX 1PMVA 5CNNA 1GZ8A 4F99A 3A4PA 4NU1A 4QMNA 5AR3A 3OY1A 1OL6A 2WU7A 2XJ1A 3IK3A 3Q4ZA 3NCZA 2C3KA 4F9CA 4CMUA 1WVYA 3UP7A 2YDIA 3DBEA 3QHWA 4M13A 5C9CA 3ULIA 2XK8A 5I9ZA 4L6QA 4H3QA 5IKWA 1M52A 2ZDTA 3CGFA 1Q61A 3W10A 2B0QA 4FTQA 3BV2A 4ZSAA 5CANA 2J5EA 3QCQA 1PHKA 3FI4A 4FV3A 4JQ7A 1OBGA 5AP7A 4BICA 4EOPA 4FKSA 5AV4A 2BALA 1Q8YA 3Q9XA 4R78A 2UW6A 3PUPA 4LUDA 4E8AA 1URCA 2OK1A 1CM8A 2JDTA 4C4JA 5CU3A 2Y6OA 4I5MA 2J6MA 3A62A 5DPVA 5T3QA 4E4MA 3BHTA 3V6RA 3R8UA 3R71A 3JY0A 3F2NA 4FTRA 4TYHA 2PVRA 5TKDA 4N4SA 2XJ0A 4UBAA 4ZTNA 3L9LA 4YC8A 5EYCA 3R7EA 4IW0A 4BY9E 3QTUA 2Y9QA 1F0QA 1GOLA 3BU6A 4V04A 3KXMA 4BDBA 3RM7A 3JXWA 5DBXA 1UWHA 2X2MA 1BKXA 2C30A 2FVDA 3EYHA 4X2KA 2BVAA 5AAFA 3RK9A 4ZLZA 3V3VA 4CZTA 5F94A 4FSWA 1Z9XA 2OXDA 2VGOA 4K1BA 5BYLA 4RJ4A 3W33A 4HOKA 3CD8A 4NCTC 3QTRA 4HGEA 4RWLA 3PIYA 3R7GA 2YFXA 5TE0A 4W4VA 1F3MC 4YZNA 5J9LA 4O7RA 2WTCA 2XNGA 3F82A 2CNVA 2ITWA 4P4CA 2G1TA 2Z7SA 3MFRA 3QTSA 4L7FA 3R1NA 3QZHA 1UKIA 4MH7A 4QMWA 3I6WA 2YM7A 4F7LA 2W4OA 3V8TA 2GNJA 3L9PA 3IW5A 3GQLA 5HQ0A 1DAWA 2C6LA 2QO2A 1GZOA 2V62A 3ITZA 3PG3A 3QRTA 4IVDA 2BHHA 4FNZA 4BZOA 4FT3A 1I09A 2CGVA 4PQNA 5M56A 4EORA 5HICA 3AD5A 3IPHA 1Y6AA 4JQEA 3QD2B 4TKSA 4EC9A 2WIHA 3SD0A 2HW6A 2O64A 4AA5A 4EH7A 3VJOA 2W1CA 3POOA 4BGHA 3AT2A 3EKNA 3G51A 3WF8A 3IO7A 3PVUA 2BFXA 5FDXA 1SVGA 5I5ZA 4X2NA 4EH8A 3I6UA 1B6CB 1H0VA 3G9NA 4Z16A 5L3AA 2QOLA 2YIWA 4FODA 3U6HA 2OXXA 4Y95A 4BCJA 3RPYA 2JD5A 3UOLA 3CJFA 4HNFA 3D94A 1IAJA 4MWIA 1K9AA 2F7EE 4GKHA 2PE1A 1KE6A 1FINA 4ANBA 4F7SA 3M2WA 5AEPA 1OBDA 4UZDA 4JG7A 3TDVA 4GL9A 3QLFA 4KKGA 3PPJA 5JT2A 3EFKA 2JC6A 5M51A 4OAVB 3SVVA 3MTLA 2BIKB 3ZLYA 1A48A 1WBTA 4QOXA 4YTCA 4JL9A 4BIDA 5AM6A 5IMXA 4RX7A 3KGAA 1OB3A 5ETAA 4AXAA 4F6UA 2QR8A 3HVCA 4CFNA 3TG1A 4QP2A 1P14A 3O71A 3WF5A 3OWKA 4DCEA 3FQEA 4I0SA 5EW8A 5I4NA 2IVSA 4FUXA 5FD2A 3QC4A 3W16A 4ALUA 1Q8WA 2VTOA 1ZMVA 3UG2A 4LGGA 4BIBA 1OI9A 3EYGA 5K9IA 3KXHA 5AX3A 4FOCA 3DXNA 4WNKA 5J8IA 3KVXA 5AP4A 3QQFA 4TYJA 3LCTA 5IMEA 4ZIMA 1UU3A 5C8NA 3GOPA 3C5UA 4EBWA 5LMKC 4XG7A 3HP2A 3PIZA 5DG5A 2X6DA 4FSQA 2FH9A 4FMQA 5IU2A 3OUKA 5AX9A 3NNXA 2OJJA 5JKGA 4BTKA 4R7BA 4UMPA 4FT7A 2HWOA 2HYYA 3FMKA 2X8DA 4GK2A 1J7IA 1JKTA 3HUBA 4IX4A 3DFCB 2OXYA 2X7GA 5EHLA 4QMVA 3FI2A 1WMKA 4EQUA 2YM8A 2VNYA 4X3FC 4QP9A 2WMVA 4BB4A 3MESA 4USDA 4X6RA 4ZAUA 3VHKA 4DH7A 3OWJA 1K3AA 4IZ5A 3PLSA 3W8QA 4EOMA 3FY0A 1NT2A 2JKMA 4FIIA 3PTGA 5KUPA 3TKHA 4F70A 3R2YA 3C4ZA 4FZ6A 4X7QA 4KUJA 2F2UA 4CQEA 4FNWA 3F5XA 4W4YA 3PJ8A 4EHVA 3FPMA 4IC7A 4JS8A 2XK7A 4B4LA 4Y5HA 4GEOA 4J99A 4BZNA 3KRWA 5M4FA 4Z7HA 3COKA 1GY3A 2XIXA 3R1QA 4DBNA 3DBCA 3G2FA 2AC5A 3GENA 4FV1A 3PSBA 3NWWA 2HOGA 4DEGA 5M44A 4C2VA 2UZTA 2VX3A 2VTMA 2C0OA 4FK6A 1M17A 2BTSA 4ID7A 2C0TA 4CEGA 3MYGA 2BZHB 2FSTX 2ITVA 4M3QA 4AZWA 2JAMA 2CMWA 3ZRMA 5IH5A 4F7JA 1KE5A 5IQBA 3FMNA 5JFWA 4CG8A 2C5OA 4H3BA 3P7BA 5E8WA 5H8EA 1H25A 4XCUA 4XG4A 1CDKA 3BRBA 2P55A 2AUHA 4FOBA 3SV0A 3ZFXA 5EDRA 2R3OA 4FSNA 4CMTA 5A4TA 1YKRA 2BHEA 4WO5A 4AACA 3UYTA 4IC8A 4NW5A 3UOKA 1CKPA 3OUNB 3BYSA 2B7AA 4QNYA 5CSHA 5J9YA 3E62A 2P2HA 3OHTA 4X2FA 2XA4A 2ITQA 2R3FA 2WQMA 1VEBA 3BYVA 3FYJX 3OG7A 3QTIA 1PXIA 1M7QA 4EQCA 2OH0E 2GFCA 3KF7A 5FM3A 4ANQA 4LQMA 5DEWA 3TKUA 3HX4A 2W06A 4M97A 5GJGA 3U4UA 4AW0A 4BHNA 5BVFA 5HTCA 4UX9A 1M2QA 2VGPA 3PE1A 4YLLA 4LOOA 3DBFA 1LEWA 2XIYA 3ALNA 5HO7A 4RVLA 3BBWA 4C3PA 2VAGA 2YDKA 4L43A 2EUFB 3A4OX 3KMWA 3ZDUA 3I60A 4H05A 2VWYA 3B2WA 2BRGA 4A4LA 2GS2A 2Z7LA 3W2PA 4BDEA 4DH8A 4DT8A 2PVLA 2VWBA 2OJ9A 2GNFA 2WD1A 4AT5A 1MRYA 3W8LA 2O2UA 4EOJA 4PUZA 3UZTA 4ZSJA 3AGLA 4CFVA 2QD9A 4F9YA 5K0KA 3EQFA 4LMNA 2E9UA 3NYOA 4D5HA 4BCQA 3GXLA 4JR7A 4FVQA 4MTAA 3OP5A 4FV7A 4U40A 4JBOA 3AT4A 2R0UA 3AXWA 4KRDA 4AS0A 3RCJA 2BKZA 3K5UA 1BL7A 4E6AA 5HIDA 2XZSA 3WI6A 3OBJA 2V7AA 3O7LD 5E8TA 3F2RA 3A61A 4DTAA 4MAOA 2PHKA 2ONLA 5GIOE 2R3NA 2UZOA 4MKCA 4CFMA 3DFAA 2PYWA 3DLZA 4DT9A 1ZZ2A 1JAMA 4CT1A 5HORA 2J9MA 2ETMA 4YO4A 5CXHA 2JBOA 4LG4A 3GU4A 5IQIA 1HCLA 4B7TA 5CI6A 1BI7A 3LFSA 4CZUA 2YZAA 5DE2A 3SOAA 3H3CA 1LR4A 2XYUA 3CGOA 3R1SA 4FKPA 4HGSA 4QMYA 4L3JA 4ENYA 5FDPA 3FLWA 3NUAA 4BKJA 4YNOA 4WBBB 3P86A 5FUTA 3PP1A 5IA4A 3UPXA 3BPRA 5H9BA 5CQUA 3HMOA 4TWOA 3MN3A 3ODZX 4DHFA 2C6KA 2C6MA 5L6PA 3RNYA 1W84A 4DEEA 5BUEA 2Z7QA 5FP5A 4EWQA 4LI5A 2YM3A 3OCTA 5E90A 2XNMA 3GNIB 2EXEA 4FIEA 4O0VA 4C38A 4UYNA 3M42A 3Q60A 2YWPA 3I4BA 3FZTA 4G9RA 3FLYA 1IASA 2XP2A 3ZBFA 4M66A 4O6EA 3E88A 4XV2A 4K0YA 3R8MA 5CAPA 3HMMA 5JMSA 3Q6WA 2WTKB 5KMLA 3K3IA 4DLJA 5M53A 2XNBA 4RIYB 4E5BA 4YR8A 3ENHA 5HIEA 4JI9A 2A19B 2C3IB 4O96A 5ANKA 3TT0A 2IW6A 2WMSA 3R63A 4YZMA 4EK4A 5CT7A 3D7TB 4DEIA 1WVWA 4DEBA 1GZNA 4ZLOA 3C1XA 2Q83A 3KXGA 3HLLA 4PTEA 1PJKA 3UMWA 2R3LA 3EZRA 2DQ7X 4BWPA 4KAOA 4FSZA 4QMLA 3A60A 4O7VA 2BDJA 5HKMA 5AV2A 3GVUA 3MGYA 4YJUA 4ZEGA 4EHZA 1W7HA 2ZV9A 1YXSA 3G6GA 2QOKA 2VTPA 4FTOA 4QMSA 2C6IA 4GIHA 3UTOA 4D28A 4H36A 2C5NA 3PWYA 4MXCA 4JJRA 3LFNA 2R5TA 4DGLC 3BYOA 4CRLA 4ZMEA 4WUNA 4Y72A 4WG3A 3FY2A 2FGIA 3CTQA 3GCQA 5ANOA 2W0JA 3JY9A 5C03A 2PVFA 4QYGA 1SM2A 1TQPA 3P5KA 3HV6A 4E1ZA 4YHFA 2W4JA 1ZY5A 4FC0A 2R2PA 1W82A 3EQDA 1UU9A 3FAAA 3VNTA 4E4LA 4DLIA 4EONA 3QUEA 4JQ8A 4OW8A 4ZK5A 3TJCA 3MB6A 5HCZA 3V5LA 3JVRA 3O96A 3TCPA 4KINA 4NT4A 3WF7A 4O83A 4K33A 3RMFA 1KE7A 3MVHA 3HMPA 3W2SA 4N57A 4R77A 3CD3A 4BCPA 4JDIA 3FSFA 3IDCA 3CCNA 4B0GA 4ZLYA 4QNAA 3S4QA 3PY0A 3TV7A 2JKQA 1V0OA 4KNBA 4UMTA 3VJNA 5LVOA 3C7QA 3PWDA 3KN6A 4C3FA 2YIXA 1U59A 2X9EA 4PMTA 5LVLA 4AZSA 1O6LA 1XH9A 4XLIA 4L3PA 5EYKA 5GHVA 4FEWA 4K9YA 4IVCA 4RIYA 4OTIA 5KNJA 4RX8A 1LEZA 3MVLA 1TQIA 1RE8A 1PXOA 5CSWA 4Y5QA 2WTIA 3D7TA 1XBBA 4CQGA 4E20A 4LYNA 5LMAA 2CN8A 4ALWA 2UVYA 3C4FA 3EN5A 5DOSA 4ACCA 2VWIA 4YLKA 1HOWA 2IZSA 4FKVA 5E8ZA 4ZJIA 4EL9A 4FIHA 3PA3A 2J2IB 2CNUA 3PFQA 5E8UA 4ZTMA 4UYAA 3CY2A 4EC8A 2A1AB 4RJ3A 1U4DA 1PYEA 2WB8A 3VW8A 2W5AA 4Z7GA 5J95A 3NX8A 3TJDA 4AF3A 1ZLTA 3QZGA 4IWDA 2OFUA 2VV9A 2PUUA 4I4EA 4C4EA 3N4UA 3KMMA 4O2PA 1HCKA 2CHLA 3COMA 4YC3A 2LAVA 2EB3A 3CC6A 4EOKA 5JSMA 5AP6A 4YJPA 1FBNA 1WZYA 3GU8A 4GG5A 2W1ZA 4ZS4A 5K0XA 3FWQA 4YTHA 3OOGA 4MEDA 1M2PA 4HZRA 2RSVA 2YABA 3MI9A 5C01A 4D1SA 4LRJA 2YIYA
chains in the Genus database with same CATH superfamily
3A7JA 4PNKA 4J8MA 4NM7A 4MD7E 3RI1A 2X7OA 3OW3A 1YW2A 4CV8A 5D1JA 3TACA 1RDQE 3G33A 3GFEA 4EHGA 3F69A 4FZAB 3Q9WA 2NO3A 3KF4A 1XWSA 3E93A 3FZOA 3Q4CA 4IB3A 3WARA 4BZDA 4DEHA 5JQ8A 3OZ6A 3DB8A 3LJ0A 3A7GA 1Q62A 3I0OA 3EQPA 1FGKA 2UV2A 2QO9A 2UW0A 4FKGA 1SVHA 4D58A 3DBQA 5CU2A 2I0EA 5HESA 4Y8DA 3PXZA 2ITPA 3EN4A 5DHJA 3TXOA 2R3MA 2VTHA 4L01A 1UNHA 3UOJA 2ZFYA 3JYAA 3TI1A 4J7BA 5C4LA 4EEVA 3FLSA 3NFFB 5HNIX 1SNUA 4FYNA 5LCJA 2W17A 3DK7A 3MY5A 4MHAA 4UN0C 2CGXA 2WZJA 4G5PA 1AD5A 3Q4UA 1QPCA 4WRGA 4ZSGA 1FGIA 5HI2A 4C62A 2QKWB 5K4IA 2SRCA 3TUCA 3R9DA 2HCKA 5EHYA 5KMIA 1PXJA 1H24A 5KE0A 2UZUE 1Q5KA 5DT3A 4MXZA 3EWHA 3FXZA 4TXCA 4OT6A 2ZV8A 4S33A 2WMWA 3DOGA 1O6KA 2YA9A 3LPBA 5D7VA 5DR2A 3ORIA 2QVSE 5E9EA 1QMZA 1AQ1A 3UBDA 3D5VA 3KU2A 5CEMA 3KN5A 4C4IA 4E93A 2YIQA 3FC2A 5EW9A 2B53A 2UVZA 3TNHA 3P4KA 3SAYA 3RCDA 2ZJWA 3H30A 4FKTA 4BDCA 5A4EA 5HZNA 4HYIA 1CKJA 2ZB1A 4CLIA 4I1ZA 2NRYA 2XIKA 2VTSA 5CS6A 3DXQA 3H4JA 4G6NA 5J1WA 4E6DA 2YHVA 4RG0A 3KCFA 5HU9A 3GU5A 4R1YA 4MVFA 5IA5A 1YVJA 3SC1A 3QD4A 1JKSA 4EJ7A 1GNGA 5FTQA 3BHUA 4WNOA 4CCUA 4DH5A 5CU4A 3HP5A 4NEUA 3VN9A 2YM4A 4U5JA 4XV3A 3LIJA 1QL6A 5ANJA 5BVKA 5IA0A 2YM6A 3QD3A 4FV8A 4HYUA 5EG3A 4R1VA 4IZAA 3HAVA 4CFFA 4WOVA 5K5NA 3ZSIA 3S00A 2ITTA 2C0IA 4M14A 4I5HA 4R5YA 3T9TA 1OITA 1Q4LA 2VO3A 4QP6A 4XG2A 2XF0A 4HVHA 4USEA 5LWMA 3LLTA 3MY1A 2VX1A 3V04A 3BELA 5FBNC 3VRZA 4BYJA 3UQFA 4QTDA 4MBJA 5CALA 4JDKA 3ZS5A 2OU7A 1OMWA 3QCSA 1OKYA 3ORLA 3TV4A 2F2CB 5FRIA 4PWNA 5EDQA 1MP8A 4QTCA 4O0SA 5AP2A 2WKMA 4CXAA 3MA6A 3TWJA 2WMUA 3R0TA 3KY2A 4IWPA 4QPSA 2E9OA 4FVRA 3V5WA 3VS0A 4FR4A 3QTQA 3D4QA 3D0EA 2XUUA 4LL0A 4RGJA 3LXKA 4S31A 5CVGA 2JEDA 4K77A 5EDPA 5E8SA 5HO8A 4OBQA 3ZUUA 3U6IA 3GQIA 4GK4A 4CZYB 4KS7A 2QU6A 3VUKA 2IWIA 4F0FA 3NUXA 3Q6UA 5KKRB 1F5QA 2REIA 1XH7A 4IMYA 3UDZA 2W7XA 2XRUA 3IONA 5I9YA 1APME 3O5AA 5CT0A 3KFAA 4KD1A 3NRMA 2BRHA 5C1QB 1WBPA 1TFFA 3IDBA 1IA9A 1JNKA 1WBSA 3E64A 3C4XA 5LVPA 2YZLA 3PY3A 4NK9A 2XK9A 3W0SA 3TM0A 3A7IA 4BCNA 4F1MA 3Q2JA 1H00A 1QPJA 3EKKA 4ACMA 2PUNA 3TNIA 1ZWSA 2VO6A 1PMNA 4IWOA 4QT1A 5I9UA 3V6SA 3OOMA 3WBLA 5A54A 3IW4A 4OGRA 4PL5A 2C6TA 5ITAA 4RZWA 2P0CA 1XH4A 4RWIA 2FA2A 2O63A 3CR0A 3I7CA 4V05A 3ZO3A 2O5KA 4AN3A 3ETAA 3PPKA 4ARKA 4AE6A 3F5UA 2GFSA 2XKFA 3FQHA 4UV0A 3TNQB 4UY9A 5HX6A 2F4JA 4FYOA 2RFNA 4JAIA 3JVSA 4XLVA 5IZFA 3OTUA 4L53A 4TY1A 2W1IA 4U6RA 3HV3A 5DFPA 2JKOA 2A2AA 4KB8A 2ZM3A 5CLPA 4BWKA 5LOHA 1RW8A 3BQCA 4C0TA 3HRFA 2WU6A 3AMBA 4FSRA 4F09A 3O7LB 5BYYA 4CT2A 4FTAA 4FSTA 4OR5A 4GW8A 3S0OA 4RC4A 3DKGA 3OCBA 4MNEB 5M07A 4HPTE 3WF9A 2QOFA 2PULA 4O4BB 4WSQA 4YO6A 3SOCA 4JBPA 4HYHA 4PV0A 4NSTA 4RWKA 1H26A 4OTQA 2RF9A 1XO2B 3FBVA 1Q3DA 3CE3A 3NDMA 3W18A 3EL7A 3RZFA 5ANEA 4I92A 2VUWA 5B0XA 2WQNA 3LXNA 3R04A 4LV5A 5FBOA 3CQWA 3R02A 4WD5A 2XBJA 4FG9A 1JQHA 1V0PA 3OD6X 4FICA 3NNWA 1R78A 4FBXA 3TN8A 4EKKA 4LV8A 1OGYA 4KSPA 4DFNA 4XHKB 3WZKA 4BVUA 4KWPA 1ZYCA 1MUOA 4FG7A 5JZNA 3NAXA 4N6ZA 3EN6A 4IE9A 2OH4A 5HEZA 5KHXA 3NVMB 1NY3A 3NGAA 4S32A 1FVTA 4I4FA 1FOTA 3LFCA 5B7VA 5JGDA 3NZ0A 1ST0A 3C51A 4Q9SA 4FV2A 4GCJA 3K5VA 2FYSA 4ZY5A 3VW6A 1BI8A 3LVPA 3PZHA 4J53A 3QRUA 4W9WA 1CKIA 4FNYA 2ZOQA 3VHEA 1KE8A 5CVHA 3PXKA 3AQVA 1MRVA 2J0LA 3COIA 4L68A 4BBFA 5CAVA 4Q5HA 3C4CA 3HV5A 4QPAA 5AV1A 3V8WA 3FUPA 4AZEA 3O51A 4MD8E 1SZMA 1PRYA 4GG7A 4AAYA 4HJOA 3ANQA 4QP4A 1YDRE 3UNZA 5IA2A 2FO0A 3HA8A 4FKIA 4EYJA 2PMIA 2QKRA 2XM9A 4IQ6A 3UIXA 3NYXA 1H1SA 3VUTA 3QFVA 3QL8A 3V5PA 3ET7A 5HBEA 4B99A 2CPKE 4ZTLA 3V51A 5EM6A 3VUIA 2AC3A 3NUSA 1JSVA 3UNKA 4QO9A 5DNRA 4C61A 3TZ9A 4P90A 1Q8TA 2X4ZA 2X0GA 4UWBA 3OT3A 4YSJA 2C5VA 5IQEA 4MNEA 4I0RA 5AMNA 3GCVA 4IX5A 2QHMA 4U97A 3HGKA 4PNIA 3W0OA 4ASZA 4FV9A 1Y8GA 4U3YA 5BVOA 1RQQA 4U79A 3QBNA 3RK7A 1TQMA 3LXPA 4UZHA 2UW4A 3F88A 3PY1A 5HE2A 4MBIA 5HCXA 3WE8A 3COHA 3NCGA 3IDPA 4XRJA 4TTHB 2CLQA 4RFMA 3KRXA 1G3NA 2WMAA 5KO1A 3VS7A 1CTPE 2QURA 3VBVA 3F6XA 2PUIA 4BTJA 3L9NA 4GT5A 3MFUA 3RNIA 5HTBA 1UNLA 4X6QC 5CZHA 4O86A 2YN8A 2YLFA 1CSNA 2PPQA 3RAWA 4ZZNA 1JWHA 4XP0A 4L00A 3R7IA 2GMXA 1Q24A 4YMJA 1E1XA 3MVMA 1T46A 4HYSA 2GNGA 3FZ1A 3GGFA 4YJTA 3HDNA 4AA4A 5HVJA 4D9TA 4NWMA 4NYEA 3FMMA 4IJPA 2IW9A 3U87A 5TF9A 4F9BA 1SYKA 3BYUA 1BX6A 3UZRA 3QCYA 4CMOA 4I6LA 2Y0AA 2I0YA 3BKBA 4AGCA 4FV0A 4I5PA 2X1NA 2BMCA 2R7BA 3RPVA 4P5QA 2GHGA 3I81A 3FPQA 2W1HA 2C47A 1IEPA 4FT9A 2WHBA 5J79A 3VQUA 4APCA 3MVJA 3NUNA 4NIFB 4L46A 4JXFA 2PZIA 3Q9ZA 2VWZA 3KCKA 4MYGA 3BU5A 1JVPP 1R0EA 4XV1A 2JFMA 4BI1A 3AKKA 1ZOEA 5EQYA 4JG6A 2VWWA 2BAQA 3F3ZA 4PRJA 4LOPA 5E4HA 4PMSA 2WFYA 4A7CA 3UIUA 4BRXA 3W55A 4D2SA 3V5JA 3SKCA 2PY3A 2V55A 3NYVA 4B6LA 2W5HA 3LFAA 1WBOA 4L44A 2OF2A 3R30A 2HENA 4ITJA 4ANOA 4BDKA 3ACKA 4JRVA 4O0XA 5B2KA 5ACKA 5HG7A 3GEQA 2WEIA 1P2AA 2Y4IB 2QU5A 3O23A 2ITOA 1PKGA 4PL3A 4I22A 1ZYLA 3DBDA 2YERA 3LE6A 4IZYA 4RC2A 4RQVA 3QWJA 3VBTA 1ZZLA 1OUYA 5CXZA 1KV1A 1K2PA 3DNDA 2IVTA 4G6OA 4AZTA 4R3CA 3MPMA 4FTNA 4AW2A 2IO6A 4D4VA 3IOPA 3PPZA 4G34A 4O7SA 2XRWA 4AT4A 3UYSA 2WTWA 3SW4A 5KMOA 4EH4A 4GVAA 3BEGA 4WSYA 2HXQA 4JNWA 5JZJA 1OL2A 5HO6A 4IAIA 4F7NA 4U8ZA 5AP3A 3R1YA 4DFXE 4OTWA 2F7ZE 2ITXA 2GTNA 3EJ1A 2P3GX 3Q5IA 4DG3E 4EUUA 3OXTA 2X7FA 3R8VA 3NSZA 3O0GA 5AR8A 3KXXA 5IA1A 3HYHA 5DA3A 4FNXA 5DVRA 5J7BA 1FPUA 5KMJA 3UDSA 2VTLA 4RX9A 3TL8A 3KB7A 5HLWA 4RFYA 1KE9A 4L8MA 4FX3A 4HZSA 3SQQA 4F64A 4NFMA 4NIFA 2WTVA 2XCKA 2JGZA 5CAOA 2QOOA 2RIOA 3VC4A 5FWKK 5D9HA 3P08A 3Q9YA 4CKRA 4QQ5A 3KREA 4XOYA 3QC9A 1IG1A 4K2RA 4FTMA 5EI8A 2BTRA 5LJJA 2PMLX 4IVBA 4I6BA 4BYIA 4DH3A 4I24A 1ZARA 4M84A 2VU3A 3R8ZA 5AP5A 2B9JA 4G16A 2A0CX 2Z2WA 5M06A 3FHRA 4A07A 4G1WA 3QLGA 5FTOA 4AE9A 4YGAA 3BIZA 1GIIA 2ITNA 4ZJVA 3R22A 3DJ5A 4GFOA 4U44A 5J87A 4GJ2A 4FKWA 4U42A 3D83A 1FMKA 3LKMA 3DXPA 3W0MA 3EQHA 3ZXTA 4MNFA 3K2LA 3E8EA 5AUYA 1KV2A 3HUCA 3ORTA 2X0PA 4QTAA 5F20A 3T8OA 4EOLA 3R7VA 3FHIA 3BL7A 3FV8A 2WNTA 4ERWA 3ANRA 1UU7A 5D12A 3GC7A 1VZOA 2B9HA 2C6OA 3WIGA 1YXXA 2R0IA 5HG8A 5A14A 4OTRA 4YNEA 1XJDA 5A4QA 3GC0A 3ORKA 3UPZA 4F6SA 3PE2A 1FQ1B 3IECA 4BDFA 4S30A 5L2TA 4PDSA 3RPRA 4EZ7A 4CVAA 2NNWB 1JLUE 4CRSA 2YCQA 4QYFA 5CVFA 4ACDA 3Q2MA 4O7NA 5AM7A 5CEPA 3GCSA 3R8PA 1VYZA 5BNJA 4FJVA 3ZZEA 3ZXZA 4AQKA 4WNPA 4FSMA 4N0SA 3U6JA 4TL0A 3UIMA 5E1SA 3N51A 2XIZA 2KULA 4XG8A 4TT7A 3W1FA 2WQBA 2BIYA 3OEFX 4GT3A 4AGUA 3ZONA 4C4GA 4CNHA 5EHOA 4IDTA 4IDVA 1WCCA 2PMNX 4XP3A 2G2IA 4GMYA 2DS1A 2VO0A 4AX8A 5E8YA 4BGGA 1XHAA 1YWNA 2YDJA 4RSSA 2UW7A 4EOOA 4I20A 3IQ7A 5IEVA 4QDEA 3TUBA 5KHWA 1WVXA 1H1RA 3PIXA 1W98A 3QXPA 2WMTA 4UB7A 2QG5A 1NW1A 2XARA 2XEZA 5HE0A 4F9WA 3L1SA 3PRIA 2WO6A 2EXCX 3TIYA 3OXIA 4C57A 4FV5A 1VYWA 1GAGA 4XG9A 4UMRA 1V0BA 2E9PA 5L6OA 2R9SA 4KBKA 4UMQA 3WILA 2V7OA 3G6HA 4FKQA 3WYXA 1YDTE 5ETIA 2WGJA 4HPUE 4M68A 4QMXA 3ZM4A 1PXLA 3QQKA 5K4JA 4C4HA 5FTGA 2F49A 3VS5A 4D4RA 4XNEA 2UZWE 4FT0A 4ZZOA 4DFZE 3C9WA 3Q4TA 1ZOGA 2W4KA 3GFWA 4J95A 5A3XA 3DS6A 2PU8A 4FGRA 3LM5A 2NP8A 3REPA 4RVTA 1BL6A 2OG8A 4EH2A 4GKIA 4L52A 3QQLA 3F7WA 5IQAA 2ZV7A 1DI8A 4GRBA 4O0WA 1CMKE 2HZNA 4UEUA 2J7TA 2QQ7A 2QC6A 4L7SA 3N9XA 4E5WA 3DZQA 1KSWA 3CKWA 3TUDA 2GQRA 5CSPA 5AR2A 4LM5A 5CNOA 4X2GA 3ZUTA 3QF9A 3LMHA 3R21A 5EOBA 5FLFA 4IXPA 5CWZA 4IB1A 5GINE 3FMEA 3HMNA 2A98A 2UZDA 2J0IA 2PSQA 3MW1A 3ORXA 2ZM1A 3VS4A 3CXWA 4PY1A 4D5KA 5DN3A 1GJOA 3FXXA 2GPHA 4RRVA 1OPJA 4E4NA 3LQ8A 5EM8A 3ZUVA 5IQHA 3F9NA 4D0XA 1ZAOA 4Q5EA 5E1EA 2F7XE 4ZJJA 4YZCA 5L8KA 4GT4A 4HNIA 4RA5A 5H2UA 2YAKA 5LVNA 3L8PA 3I5ZA 4CV9A 1G8SA 3BGZA 3VS2A 3ZLWA 4QTBA 3NIZA 3KRJA 2QOHA 4MXAA 3IW7A 3QKLA 4AZVA 4PMPA 2QO7A 2J4ZA 2GNLA 2H8HA 5HLNA 4GJ3A 2IPXA 1S9JA 4RIWB 1U46A 4II5A 4A9SA 4I5CA 2OZAB 2F9GA 4O0YA 4B8LA 3C13A 4DDGA 2PK9A 3QZIA 1G5SA 4LMUA 4XS2A 4BHZA 5IUGA 4ZTRA 3SXSA 5JK3A 4R6VA 3D5XA 4O2ZA 3E8DA 3AT3A 3KULB 3P1AA 4DINA 4IAYA 3R83A 4BTFA 3JS2A 3OCGA 3I79A 2X81A 3AKJA 4YC6A 3P7CA 5CYIA 3OWLA 3JPVA 4AXFA 2WELA 3BE9A 5BUIA 2NYAA 2BPMA 4H1JA 2QODA 2XKEA 4BF2A 3OS3A 4DG0E 1OM1A 3TMOA 1NVQA 4OTPA 5J7HA 4FEXA 3L8VA 1JBPE 5JQ5A 4AT3A 2IJMA 5I3RA 4AAAA 5DGZA 3IKAA 4BCGA 1PF8A 4FKUA 3ZOSA 3KVWA 4AW1A 5DI1A 4JBQA 4D2RA 1Q8UA 2DYLA 2IZUA 3E3BX 3L8XA 4GV1A 2RFEA 4I41A 4J96A 5E8XA 2UZNA 3E8CA 3VBQA 2PZ5A 4IEBA 3VS6A 5JFSA 2VWVA 3MDYA 2X4FA 4ITHA 3LCDA 4GSBA 3E5AA 3P79A 4MUQA 4GUEA 3KK9A 3DAKA 4BDHA 3ROYA 4FA2A 4O22A 4YHTA 2YACA 3A8WA 3P0MA 5IDPA 4ANSA 4U9AA 1FVVA 4DHJA 4YJVA 3C0HA 3ID6C 4QQJA 4LUEA 2AEGA 3DAEA 3L8SA 3FLNC 4W9XA 3FKOA 2QG7A 3DT1A 2X39A 3CEKA 2I0HA 3EQIA 5E91A 2RFSA 3ERKA 2ZDUA 2FSMX 2GHLA 2ZYBA 4JRNA 2IW8A 5HCYA 4BN1A 4Y85A 4NM0A 4V01A 4NTTA 1XBAA 2YITA 4JVGA 2OKRA 3NR9A 3Q3BA 4E4XA 4KKEA 2JIVA 4GVJA 2Z8CA 2VWXA 2O65A 3BL9A 2PVYA 3ZC6A 4RIWA 3WE4A 4IADA 1V1KA 2I6LA 4C36A 3SA0A 3PDTA 2OZAA 3OW4A 3PXFA 1J1BA 5L8LA 3P9JA 2R3GA 5IPJA 5HVYA 5EKNA 3CBLA 2UVXA 2G9XA 5C8KA 4BCOA 2VNWA 5CZIA 2H9VA 3KULA 4HGTA 4NM3A 3W32A 3DB6A 4DG2E 1SNXA 4X2JA 3FE3A 4E6QA 5M4IA 3ULZA 5KX8A 2W1GA 4TRLA 3BI6A 3BZ3A 2VX0A 2ZV2A 4RWJA 3DTCA 3F2AA 3QQGA 3UDBA 2RFDA 5AIRA 1QPEA 3LCKA 4LDTA 2JDSA 4YURA 2ZMDA 1TZDA 3Q04A 3NPCA 3CIKA 3Q53A 3RAHA 5GZ8A 4DFUA 1OVEA 3LMIA 3Q5ZA 4AZFA 3FLQA 3H0YA 4A9RA 3H9OA 3E63A 3UE4A 5C26A 4C4FA 4UWCA 3P5JC 3THBA 2WOUA 3LJ2A 4OBOA 4ANMA 4F65A 3EMGA 3QCXA 4FEQA 1UVRA 2RG6A 4FGBA 4EK3A 1R1WA 3QRKA 4BCMA 2CKQA 4DFBA 3BEAA 2WTJA 3UC3A 3QTWA 4O7YA 2ITUA 3DKFA 3ROCA 3HDMA 4IB0A 4C37A 1GIHA 4GH2A 4E5AX 4ALVA 3C5IA 1UNGA 3WYYA 2BAJA 2Y4PA 3R7UA 5H3QA 3O8UA 3W2QA 3ZSGA 1GIJA 1MQ4A 3KRRA 5F1ZA 4ANNA 2VO7A 4YJSA 1DAYA 1W2FA 2A27A 2VTNA 3DA6A 4R7HA 4ZZMA 4DITA 4EOQA 3TYKA 4BFMA 5AP0A 2H96A 3MS9A 4X0MA 4EQMA 2HZ0A 5F9EA 3UO4A 4BDAA 4HVIA 4DCAA 4GYGA 3QGYA 1ZRZA 1H01A 2PTKA 3O17A 3PRFA 4MQ2A 2ONLC 4FTCA 2HK5A 4G31A 5ACBC 4AQCA 2CKOA 3NMUF 3GC9A 3MH3A 2CN5A 4PP9A 3HRBA 1L8TA 4ENXA 5AFVA 3FZSA 1S9IA 2UZLA 2W05A 3PJ2A 3MB7A 3WZJA 3CTJA 4JLCA 5DRBA 4ASDA 1KOBA 3LXLA 4JIKA 1TVOA 3G90X 3TNPC 4J97A 4TN6A 4QYYA 4ZY4A 4JX3A 3F3TA 4G3EA 3ZLXA 4EYMA 2XNNA 5KCVA 5M55A 2PVKA 4JR3A 5AUTA 1BUHA 4D4YA 1NVRA 3PFYA 4O82A 4MCVA 3QRJA 1W8CA 3NW7A 4AOTA 4AP7A 5A46A 3EN9A 2BAKA 4OTFA 4F08A 5AR4A 2QR7A 4NCTA 3EL8A 5A9UA 3E7VA 2XEYA 3QA8A 3G0FA 1J3HA 2JLDA 2VWUA 1VLRA 4A9YA 2WQOA 4IBMA 2C6DA 3PVGA 3AC1A 1A06A 3DJ6A 4FSUA 4ZS0A 3R9NA 3TTIA 4F0IA 3W0QA 2R3JA 3WZDA 3V01A 2CNQA 1H07A 3QUDA 4RIOA 5D7AA 4ORKA 4LL5A 3FMJA 2W1DA 3BHVA 4J71A 5HU3A 5IH6A 2GQSA 5GZ9A 3NVKI 4PP7A 4AN2A 4IM0A 2XM8A 3Q96A 3R73A 3BHHA 4EK6A 4USFA 1A9UA 2PMOX 4JIAA 2YCSA 5ICPA 2XNEA 3OMVA 4R8QA 3PSCA 3AMAA 4XBRA 5FEDA 3OY3A 1B39A 2RGPA 3OEZA 2V5QA 5IF1A 5B2MA 2YEXA 4DEAA 5C4KA 2OGVA 5GNKA 3UP2A 2GSFA 2B54A 3DJ7A 4YUQA 2WQEA 2BRNA 1XMMA 5I0BA 3UQGA 5F95A 3VBYA 2OLCA 3MIAA 2JKKA 2J90A 4Z55A 1Q97A 2FB8A 3GP0A 3VBXA 4BDGA 3O2MA 4TNBA 2JAVA 4ACHA 1E9HA 2B9IA 4X3FB 5IISA 4GK3A 2OF4A 3NUYA 4UXQA 4FL1A 1H1QA 4FV4A 1R0PA 4IM3A 4XG6A 5HIBA 3RK5A 3ORNA 3NNUA 3EH9A 3EN7A 3QQHA 2XKCA 5CQWA 2B4SB 4B8MA 3AC3A 5JH6A 4L3LA 3F5GA 4R3PA 3RTPA 3AC2A 3ZEWA 1MRUA 3ZSHA 3SHEA 3DY7A 1XQZA 4IANA 3FC1X 3VUHA 4DGOA 5EM5A 4Y73A 3SG8A 5HD7A 3LQ5A 1H1PA 4Q9ZA 3UMXA 5KMNA 4MK0A 1PMEA 4DN5A 4U3ZA 4F1OA 2JDVA 2H6DA 2P33A 2OIDA 2VTTA 3UO6A 2IZRA 2I7QA 4V0GB 1H27A 1Q3WA 3CY3A 4QTEA 5IH4A 2W9ZB 2WTKC 4I0TA 3CLYA 4G3DA 3TZ7A 3FDNA 3U51A 3FYKX 4YJRA 2IZTA 4K11A 2R3QA 3ZTXA 1JKKA 1ATPE 5IEXA 4RLKA 5AR5A 3GCUA 3ZU7A 3RPOA 2OZOA 3W2CA 2VTAA 4U41A 2GQGA 4I6QA 5LMKA 3K3JA 2OIQA 2GTMA 4XYFA 3H9FA 3DTWA 4FF8A 3PG1A 3VWAA 4EOSA 5L6WL 2J0JA 5H8GA 3EFJA 4AU8A 3RVGA 5EOLA 2YM5A 5LXMA 1H8FA 2UW9A 3F3VA 3ZO2A 2XYNA 3RHXA 2RL5A 3TTJA 4BCIA 2QI8A 1U5RA 2YCFA 4XMOA 5LWNA 2Z02A 3OF0A 3TV6A 3P23A 1XKKA 4X3FA 2UW5A 5G1XA 3QX2A 5AV0A 4C35A 2RKUA 3UVRA 3PYYA 5L4QA 4QP8A 3F3UA 5EW3A 3TZ8A 1OKWA 1M2RA 5BVEA 2IVVA 3PXRA 4JG8A 1YOMA 4F0GA 4CKJA 1ND4A 4HVSA 3CSVA 1BLXA 2XVDA 2GS7A 5FEQA 5M4UA 5I3OA 1NVSA 3UQCA 4AUAA 4BKZA 4UMUA 4RJ7A 3MV5A 3NS9A 1I44A 4BL1A 3QTZA 4IH8A 3IW6A 4XUFA 5L2SA 2XK4A 1YHVA 5KBRA 4OAUC 2B52A 4W4XA 4O7ZA 3ZO4A 4A9UA 5DMZA 1YWRA 2PE0A 3R2BA 1OIUA 4QP1A 4ERKA 1G8JA 1H4LA 4A06A 4O4DA 4KS8A 3LAUA 2BUJA 4M7IA 3ATSA 3MIYA 3OFMA 1X8BA 3PJ1A 3ORPA 4FTUA 3D14A 2HXLA 4V0GA 4BBEA 4CLJA 2UZVA 4QQTA 3UZPA 2JBPA 5JN2A 5KBQA 3SX9A 5IQFA 1PXMA 2VD5A 3V5TA 1B38A 4DGGA 2F57A 5I9WA 3A8XA 4PPCA 2CLXA 4C7TA 3A7HA 3MY0A 4NW6A 4U43A 3EB0A 4L67A 3R28A 4NJ3A 3F3WA 5LARA 5BVDA 4WT6A 1Q41A 1OIYA 1YOJA 2BZJA 5AADA 4XX9A 1ZYSA 1OL1A 2PE2A 5G6VA 3OTVA 4WIHA 3U8WA 2FSOX 5AUXA 3DQXA 1SVEA 3F7ZA 4B9DA 2BR1A 2C1BA 4IWQA 5K3YA 3I0QA 2UUEA 3PZEA 3EZVA 4X3JA 4ASEA 4AWIA 4LGDA 4BDDA 4DHZA 2Z7RA 2CJMA 3EHAA 5A6OA 3VRYA 5M57A 3K54A 4BCKA 4J98A 4RFZA 3PUFC 1WFCA 2UZBA 4YJQA 3NFGB 2GNIA 2QLQA 4JT3A 4MX9A 4CSVA 3FI8A 3LM0A 4YJOA 5EI2A 3BWJA 3GC8A 4FL3A 2HZIA 4MXOA 4KKHA 4TZRA 4QMQA 1OKZA 5IG1A 3QA0A 3QD0A 4KIKB 1YHSA 4IJ9A 5IUIA 5BYZA 3ZFYA 1WBWA 4QMOA 5CY3A 4NJDA 2UW3A 1H0WA 4M69B 4KIQA 4Y46A 5ANGA 2P2IA 4G3GA 3TEIA 2AYPA 4N70A 4OTGA 2Y8OA 3EQGA 4BR3A 4YPDA 4N6YA 3PSDA 3QUPA 4O1OA 1WBVA 3PXQA 3U54A 3NIEA 5LCKA 4AGDA 4NUSA 3L9MA 4YJNA 4DGNA 3Q52A 3EFLA 4IFCA 5A4CA 2GHMA 4M67A 3QQUA 3KA0A 5JEBA 2IG7A 2CCHA 4UALA 3QALE 5CEIA 5HBHA 4YZ9A 3BGQA 3WIKA 5CI7A 4NTSA 1OIQA 4QP7A 5DEYA 5JRQA 4GUBA 2XB7A 5IQCA 3LOKA 4WNMA 1ZYJA 2G2HA 2ESMA 2C6EA 3CTHA 1GZKA 4FK3A 4GU9A 2VN9A 4M8TA 4WG4A 3QHRA 4YZDA 3VBWA 1H28A 1OIRA 4EUTA 2GS6A 1KOAA 2OIBA 2BRBA 2WIPA 3LCOA 4BBMA 4CTCA 4K8AA 4EJNA 2G15A 3CJGA 2R3KA 4IX6A 3C50A 4FTLA 4C2WA 5BMSA 4ZXTA 4CTBA 5KMMA 3HV7A 4O0RA 2Y6MA 1ZMUA 3GU7A 5CSVA 3HMIA 5FGKA 1J7UA 1YXUA 1U54B 3FMHA 4U81A 4PF4A 5AIKA 4D1ZA 3N4TA 3ZBXA 4O81A 4QEBA 3TKIA 4FV6A 1AGWA 1J7LA 2O8YA 5CF8A 2JDOA 3MTFA 4U45A 5AP1A 1UV5A 3LW0A 4RQKA 1OUKA 3EQCA 4QMMA 4GIIA 4TYIA 3MH2A