4IJ9A

Bovine pka c-alpha in complex with 2-[[5-(4-pyridyl)-1h-1,2,4-triazol-3-yl]sulfanyl]-1-(2-thiophenyl)ethanone
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Accounting for Conformational Variability in Protein-Ligand Docking with NMR-Guided Rescoring
pubmed doi rcsb
source organism Bos taurus
total genus 104
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ij9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ij9A02
3UP2A 4NFMA 2XF0A 3WIGA 3G90X 3MH1A 4D2SA 2ETRA 5HTBA 4F08A 4G3CA 4I3ZA 3R00A 3N4TA 4DEGA 3CEKA 3PA3A 3GCSA 1VR2A 4FVPA 3GU7A 5IH5A 3AD5A 4EWHA 4D2PA 2QOQA 2QO9A 3D7ZA 3ZBFA 5IUGA 3OS3A 2J5FA 3PFQA 3G51A 4GU9A 3Q2MA 4LRKA 3GCUA 3JYAA 5AR5A 3NYVA 3C5IA 3TV4A 1M17A 1RW8A 4TWCA 3PZEA 1Q97A 1YXXA 4YGAA 3WZKA 4ZLYA 3SOAA 4WRSA 4X0MA 3OBGA 2RGPA 2VD5A 1E1XA 2CGUA 3FMHA 4NW5A 3Q4CA 3THBA 1G8SA 2OH0E 4NJ3A 4HGEA 4XJ0A 4EJNA 4UMUA 5CAQA 1TQPA 3MY1A 4DE4A 5ACKA 5EH0A 2E9VA 5HIBA 2G9XA 3LXKA 2OKRA 3KXHA 5HU9A 3QXPA 3DAKA 4JJRA 4EONA 4USFA 5KKRB 4DCAA 1TQIA 4DHFA 3T9TA 3ERKA 4BI0A 2WHBA 5JFXA 3HA6A 4O7WA 3BKBA 1CMKE 2O65A 4BRXA 3EH9A 1P14A 2UW6A 4QMYA 2R0UA 3LFFA 1IAHA 3K54A 3K3IA 3R2BA 5EQYA 5L6WL 4HZSA 3MVJA 5CZIA 3DBFA 2VWZA 3L8SA 4EJ7A 4DGMA 1TVOA 3PZHA 5JFWA 3QRJA 5IA3A 4FIIA 5BYZA 4QYEA 4G16A 3CGOA 5LWNA 4L52A 5EKOA 2HXQA 3OEFX 3AC8A 3ORTA 3R22A 4FTLA 5C9CA 4A9TA 3ZM9A 3MH2A 4X6RA 2Y9QA 3V5WA 4RIWA 4C61A 4IM0A 3WI6A 2WMXA 4DEDA 5IH4A 5AP0A 5JSMA 4NYEA 4Y73A 3LCKA 4WBBB 4F9AA 4C4GA 3P0MA 3LW0A 3NCZA 2KTYA 3RPVA 4DN5A 4YURA 2BROA 4F64A 3PG3A 4PTCA 5L2QA 2PVHA 1SM2A 2G2FA 3NZ0A 5EG3A 5HBHA 3V6SA 1Z9XA 4QMSA 4OTFA 1AGWA 5HKMA 3DKOA 4OR5A 3KRWA 4QMXA 5EKNA 2ACXA 5E1SA 1CDKA 2ZV7A 4UXQA 4MQ2A 4LM5A 3FUPA 4HNIA 4G17A 4FKGA 3QQGA 4BGHA 1IA8A 3QRUA 2IG7A 5FGKA 2WMVA 1OVEA 3RAIA 1H8FA 2W1CA 2WGJA 3QTSA 3IO7A 4X7QA 2GFSA 2RIOA 1YOJA 5E7RA 4WG4A 1SNXA 3FZRA 4EWQA 3H4JA 2VTLA 5GJGA 4XNEA 3CGFA 5BPYA 2IVUA 4KIQA 4MX9A 4X2GA 4AW1A 4HCVA 4W8DA 3AGLA 4BFMA 4BDJA 4FT5A 4YLKA 4DFLA 1YOMA 4CG8A 4LL0A 4MNFA 4RJ5A 5AP1A 2RSVA 4NL0A 1H01A 5HO8A 1GIJA 4FKTA 4U5JA 5I9ZA 1FVRA 4YJRA 3MYGA 3VQHA 5AX3A 4UY9A 3OY1A 2O2UA 2FH9A 5CSWA 3RTPA 4C7TA 3ZDIA 4XV9A 3LMIA 4AN2A 2PE0A 4DT8A 2PVNA 3ZLWA 3QQLA 1PXMA 4EK3A 4YPSA 5GINE 3HDNA 5DRBA 2A1AB 3W16A 1L8TA 5ANDA 4AACA 3GI3A 1JPAA 3ZDUA 4O81A 1MP8A 4FX3A 4L3PA 4JDJA 1WBOA 3V8SA 5J5TA 1QPCA 1HCKA 2VNYA 4O21A 5CX9A 2QLQA 4C38A 3VVHA 5A9UA 4H36A 5HE2A 3P4KA 4J8MA 2UVZA 2C6KA 5EOLA 4EH3A 2IZSA 2QD9A 3LCTA 5FXQA 4A9SA 4E73A 3BQCA 4F09A 3PY3A 4TWPA 3D83A 3NLBA 4ZSJA 3UG1A 3EJ1A 4F70A 4DFNA 3OEZA 1DM2A 1RJBA 3VUHA 5FTQA 5FUTA 2R5TA 1REJA 2VX3A 4MD9E 3BYOA 4KABA 4NCTA 4YLLA 5LMAA 2H6DA 4ENXA 3L1SA 4E1ZA 4IB3A 4OAUC 3BHYA 2XNNA 4FNXA 5I9XA 4FG9A 1J7IA 3DKCA 3E8EA 4YJQA 3EIDA 5BVOA 4EL9A 3I1AA 3FXZA 3H9OA 5LVNA 5E8TA 3ENMA 3OVVA 4QQTA 2QOCA 4BYIA 3E8DA 4PL5A 3BE2A 3FMMA 3ZLYA 5AR4A 1X8BA 5LVPA 4BCFA 4BCJA 5AV1A 4ASXA 4IM3A 3TTJA 4K8AA 4HCUA 4EC9A 3DCVA 3LFBA 3HUBA 4ANMA 3S4QA 4S31A 1PXJA 4A4XA 4Q9ZA 2J0LA 1Q24A 5K5XA 4WG5A 5J87A 1RQQA 3C4FA 3CJFA 4EYMA 3EL7A 4AT3A 3UPZA 4JAJA 2GNGA 5KE0A 3U87A 3KEXA 1KOAA 2VTQA 3QRKA 4GIHA 5IEVA 2O0UA 4KBCA 3R83A 4DAWA 3RWQA 3FLNC 4ZLZA 4O7LA 4HPUE 4EUUA 4QP3A 2OW3A 5GHVA 2VWIA 3RBWA 4A4OA 3UZTA 3AXWA 4LUDA 2UV2A 4RPVA 2YEXA 3EWHA 1JLUE 3I79A 4D4SA 4F99A 2I0YA 2QO7A 4QYHA 1PF8A 3MFUA 4ZMFA 4ITJA 2XIKA 3D5XA 1OM1A 3QKMA 3HV7A 4PF4A 4BTFA 3NYNA 3E64A 4E5BA 4L43A 5IPJA 3DK6A 4R7IA 4RC4A 3UPXA 3FMDA 4J1RA 4JG7A 1VEBA 3HAVA 4RRVA 2IJMA 3R1QA 3KMUA 4I5PA 5CWZA 3DJ6A 3C9WA 3TZ7A 5A54A 4R5SA 4IZAA 3JVRA 4FL1A 3DAEA 3ETAA 3IW7A 4F6WA 1URCA 2X7FA 5KMMA 3EQRA 3UVPA 2QOHA 5DWRA 3O2MA 3FZPA 4ZLOA 5CAOA 3KVWA 1BKXA 5L2TA 4FG8A 5T3QA 4ZSLA 2UZBA 3QQFA 1BI7A 1JSTA 2A0CX 3C4WA 3QTXA 4FZAB 3BLRA 4ALVA 3LXLA 5HU3A 2R64A 2BZHB 4KRDA 3LFQA 1APME 4LQMA 5DT0A 3LZBA 3SA0A 5AV4A 1IA9A 4HYIA 1JWHA 2GFCA 3MA3A 4U43A 2BAJA 5JRQA 3WILA 4RG0A 3VBTA 2EWAA 4BCPA 5BVDA 5L2WA 1XQZA 5BUEA 3DXQA 3BWFA 2J9MA 4OTGA 1XH4A 2WTVA 3SXFA 1E1VA 3ZYAA 3ZXTA 5KNJA 4GK2A 4DCEA 1YWVA 2WQNA 4XG2A 5CSHA 3ZSGA 4GVAA 1OECA 2OXXA 5L3AA 4BBEA 1CKJA 3KXNA 3PXRA 4IX3A 3F3UA 2HOGA 4J71A 5B7VA 4O7YA 5HE0A 3VWAA 5IQIA 4FG7A 2J0JA 4X6QC 4E6AA 4X2NA 3ORPA 4AGWA 4G2FA 4ZTRA 2RFEA 3TTIA 4F6UA 2JIUA 3MTFA 3UVQA 4AZEA 5HTCA 5I3OA 5HD7A 1CSNA 2W05A 3KULB 1M2QA 4BB4A 3DV3A 1W98A 1YKRA 4AZFA 4W4XA 4FYOA 4F0IA 1NT2A 5C03A 5IH6A 2WQEA 4DTBA 4D4YA 3UIMA 3MPMA 3TIZA 4BDCA 4BCIA 3F2NA 4KSQA 5CXHA 1Y6BA 4YSMA 2C69A 1T46A 4L44A 3R7VA 2R3OA 4I0TA 3UOLA 4CMUA 2CKQA 3E62A 3AMYA 4OBPA 2QNJA 3POZA 5HVJA 3JXWA 1YI6A 4ID7A 1TQMA 3MDYA 4DFYA 3QA0A 2B53A 4IX4A 4F1MA 5L4QA 2XNOA 3IDPA 4NJDA 2YCSA 4TTHB 3ODZX 2H9VA 3L8VA 2C4GA 2YZAA 2BILB 1YWRA 1R0EA 1ZOGA 4IVAA 4J96A 3PG1A 2B54A 4FEXA 2HZNA 3PVGA 4E3CA 2EUFB 2O64A 3WYYA 4USDA 3HP5A 1WVXA 4FGRA 3R8MA 4L9IA 4XP2A 2QOFA 4WBOA 3VJNA 3BHVA 2QR8A 5FM3A 3ZLXA 3F6XA 1MRYA 2BR1A 5E8YA 2W1HA 3V01A 3PWDA 4PDOA 4C4JA 3UO6A 2CLXA 2PMNX 4MXZA 3VIDA 3MFTA 2GQRA 4FTIA 5C1QB 2YABA 4TT7A 5HNBA 3UE4A 3ANQA 2VTJA 4GEOA 5AUWA 1J3HA 4IB1A 2X2MA 2FB8A 3G6HA 1Q61A 2GS6A 2EVAA 4A07A 4L8MA 4I92A 3W2SA 1YDRE 3IONA 4EOIA 4GKIA 4P2KA 5HE1A 2WEVA 3KGAA 4CFVA 4K33A 2XNMA 3GOPA 4QNYA 5FEQA 3BV2A 3KXXA 4XH6A 3Q9ZA 3SW4A 3O96A 4AAAA 2UZUE 3DBQA 5M4IA 5TKDA 4EORA 5AV2A 4YUQA 2QC6A 3ACKA 4FK3A 3LJ0A 3BQRA 3QLFA 4I5HA 4MHAA 4QYYA 1JKKA 3ZZEA 4OTIA 1XO2B 4QMQA 3TDVA 3BGQA 3DQXA 4XV3A 4BN1A 3II5A 4EZ7A 5HLWA 2QR7A 3HMNA 3OT3A 5HTIA 3S00A 1NVRA 1PHKA 2O3PA 3CTHA 4RVLA 3FZ1A 4TYJA 4X2FA 4X3FA 4BHZA 1W7HA 2YLEA 2BVAA 3FSKA 4JX3A 4EKKA 2ITYA 4GK3A 2XNGA 5AV0A 3SGCA 2C0OA 3BBWA 3IDBA 3PWYA 1BYGA 1WBSA 4F9BA 1U46A 3ZUTA 4GKHA 4FMQA 4M0YA 4I0SA 3RWPA 4BZNA 2JKKA 3GC8A 1WVYA 5CXZA 3NUAA 4EHGA 2F49A 2LAVA 5CVFA 3ZCLA 3I6UA 2ITVA 2C47A 2XIZA 4JAIA 3BWJA 3EQBA 3BIZA 4XOYA 4FICA 4LOOA 4HVHA 2QQ7A 5DI1A 4NTSA 3IOPA 4DG3E 3UIUA 2F7EE 5DGZA 1J1BA 2C30A 5AEPA 4BKZA 5G1XA 3RCDA 4O0WA 3IG7A 5C01A 3UNJA 4E7WA 2XYUA 2PVLA 3IOKA 2WMRA 5FP5A 4NM3A 1WBVA 4D4RA 3QUPA 2YISA 3Q5ZA 2C6IA 3UOKA 2C6MA 2BALA 5D7AA 2CKPA 4FT0A 3G0FA 4UN0C 4IVBA 3REPA 1U4DA 4ZZOA 4FNWA 4BYJA 1XH8A 3NRMA 3MY0A 3OOMA 4XX9A 4ASZA 1XBAA 2J51A 1W8CA 3VO3A 2OJIA 4IFCA 2C5XA 4GK4A 4BDFA 3OT8A 1G3NA 4DFUA 3CKXA 2WMTA 1U54B 3B2WA 2C6LA 5CYIA 2PY3A 4GT5A 4NU1A 5A14A 3L9PA 5HO7A 4QYGA 3A8WA 3T9IA 4U42A 2PZRA 5AWMA 2OSCA 4RLKA 3SW7A 1E9HA 5EI8A 2QOLA 3V8WA 2X39A 3OHTA 3ORMA 3T3UA 5JT2A 4TY1A 5HCZA 1URWA 2V0DA 3PPKA 3QRTA 5CEQA 3GT8A 4KS8A 3NSZA 5A4QA 4IIRA 5I0BA 1S9IA 4ZMEA 2GNFA 5EFQA 5E91A 4BDEA 5DOSA 3B8QA 4CKJA 3RHXA 5AR8A 4CEGA 4QD6A 5ANKA 3OXZA 5M53A 1IAJA 4O96A 3D2KA 5K0KA 3AC4A 4AW2A 4DH1A 2P0CA 2PZYA 4C3FA 3G6GA 3W10A 4EH7A 3JR1A 2LGCA 4FV2A 4KBAA 4HCTA 3OUKA 4HGLA 5K3YA 3BI6A 2BAKA 4EEVA 1MQ4A 5B2MA 5EM6A 4AA5A 3FMEA 4R78A 2PMLX 1YRPA 2J6MA 4ZY6A 2FSTX 2W9ZB 3A99A 4JI9A 3ORLA 3OUNB 1O6YA 3QWKA 3TKUA 4F7NA 4NFNA 2R3IA 2R7IA 4G6NA 4DC2A 1ND4A 3FEGA 4O7VA 4RJ4A 2XEYA 2V55A 4FK6A 3GOKA 3LMGA 4QMOA 5I5ZA 3MTLA 5HG9A 4I20A 1KE9A 2F2CB 3IW6A 4BBFA 1OBDA 4FEVA 5M06A 4IANA 2VTAA 2ZDTA 2X8EA 1ZYJA 4K6ZA 4QTDA 3VJOA 3NCGA 2WQOA 3UO5A 4CMOA 3ID6C 3C0IA 3R30A 5CEKA 3HMPA 3ZHPC 3FY2A 4II5A 1FGKA 3UDBA 4FEQA 1ZZ2A 4PP9A 3RAHA 5ETCA 2CCIA 4EC8A 2XKCA 2QOIA 2X7GA 3FL4A 1UNGA 2CHLA 1BX6A 1FVTA 1XH7A 4RIXB 4RFYA 1SZMA 4W9WA 3VW6A 4U8ZA 5KMJA 5JFVA 3D5VA 4EQCA 5HIDA 5CU4A 2B52A 4Q5HA 5FBNC 3RVGA 2X8IA 4MYGA 4BCQA 5DLSA 3F66A 3ULIA 4Y46A 5C8KA 4QPMA 5IDPA 3W55A 1SMHA 3C4ZA 4X3FB 5GZ9A 1ZLTA 3LM5A 3HX4A 2IW6A 4L00A 2WU6A 5LOHA 1WZYA 2CLQA 3DTWA 4KIOA 5M55A 3QTUA 2WMBA 1WAKA 1R0PA 3WBLA 3ZRKA 4CFXA 2PHKA 4QP8A 4DBNA 2ZM1A 4RFZA 2UW4A 4U80A 3N51A 2HYYA 3R9HA 1OKYA 1Q3WA 2NP8A 4BDKA 4ZTNA 5DIAA 3G9NA 2GHMA 2VWWA 3EFKA 4APPA 1WVWA 3DNDA 3QCSA 4H3QA 3E93A 3V5QA 2WTWA 3W8LA 5M57A 3S0OA 3GCVA 3U6JA 3VS0A 4K1BA 4RSSA 3TNWA 5DG5A 2XCHA 1GIIA 4ZZNA 4DA5A 3BHUA 3UMXA 3MIYA 2PVYA 2JC6A 3Q2JA 1JNKA 2P55A 5FRIA 1EH4A 3NUSA 4CZTA 4L68A 1YOLA 4R7HA 3ENHA 3EL8A 5BMMA 3QC9A 4YPDA 4GL9A 4HYHA 5LWMA 3E5AA 3RK7A 2OH4A 3ZU7A 2XIXA 2O5KA 2OWBA 4FKIA 4BDBA 3KB7A 2JFLA 2X0GA 3I6WA 4AE6A 5CF5A 5L8KA 2W96B 4I41A 4N4SA 1OKZA 3I7BA 3OTVA 5JN2A 3NPCA 2PL0A 3I81A 2UW7A 5C4KA 3BLQA 2PYWA 5IQDA 2XS0A 3O8TA 4CFMA 4GFMA 1AQ1A 2OF4A 4JDKA 4DFZE 1VZOA 3WF6A 4NEUA 2VU3A 4V01A 5CEPA 3VHKA 3C7QA 4C59A 4E8AA 1Y91A 3BU3A 3V8TA 3QTRA 1ZYDA 4AA4A 4FVRA 3F3TA 3PA4A 1JSVA 4A4LA 3CJGA 3QZFA 4CG9A 4IJPA 3S2PA 5M4UA 3DLSA 3IDCA 4IACA 4AXAA 4PMSA 3LKMA 1SVGA 2OF2A 4O82A 4WOVA 1M2RA 3EQHA 4E4LA 2YWPA 4OT6A 4O27B 4JQEA 4BDIA 3VBXA 1K3AA 4RWKA 1J7UA 4Y5HA 3LCDA 2UZVA 2GNIA 3MIAA 4O0UA 5ANIA 5EDQA 2I0VA 3UGCA 4D55A 4EZ5A 3RAKA 2B9FA 1JAMA 4XYFA 3U51A 3QAME 3R28A 4LI5A 3IW4A 3VBQA 1KSWA 3A4OX 4D58A 1DS5A 3BV3A 4GJ2A 2J7TA 3WF5A 2R3NA 4L3LA 4Z55A 4KKGA 4Z7HA 4M3QA 1S9JA 3QKKA 2XK9A 3BYSA 2JDVA 4FT9A 5C4LA 5J79A 4FL2A 4YJOA 5CU3A 5IA2A 3KY2A 4BBMA 2PPQA 1SNUA 1ZAOA 3GUBA 4O0SA 5ANJA 5EQPA 4PMMA 3AQVA 3JVSA 1KE5A 5K4IA 1VYWA 2OFUA 3FPQA 4R7BA 2WAJA 4IXPA 5AUZA 3UQCA 1OZ1A 4IBMA 2ZOQA 3A4PA 5BNJA 4RZVA 4E4MA 5JKGA 3CS9A 2E9OA 5FTGA 2YFXA 2XJ0A 4ORKA 4XV1A 2XRWA 4RFMA 5KCVA 4K77A 3UMWA 2YHVA 5KMNA 2ONLA 5M4CA 4DEIA 2WIPA 2PZIA 4WNKA 4C62A 3RPOA 3FC2A 4UALA 4DITA 2NRUA 2XMYA 2YM6A 5LARA 4ZS4A 2PZ5A 1NW1A 5DR6A 2VO6A 3FDNA 3QRIA 3HEGA 1GJOA 1J1CA 2WMWA 3VRZA 2FUMA 4NIFB 5EHLA 2YM4A 2CN8A 3R21A 4O7TA 4ERKA 2VTNA 4LV5A 4ZAUA 5IA1A 4PL3A 2BPMA 3DBCA 2W4OA 2XKDA 4FSQA 4ARKA 3PRFA 2PTKA 3LXPA 2Q0NA 2QU5A 3VUKA 1PMEA 1Q99A 2VWVA 2XKFA 3B8RA 4CYIA 4IX6A 1SVEA 2C5OA 3QF9A 3HECA 3QTIA 3EMGA 4IC8A 4QP9A 1J91A 2ITTA 4U7ZA 4XEYA 3VN9A 3BEAA 4EOKA 2W1DA 2PUIA 3DK7A 1W0XC 3HKOA 4MTAA 3NGAA 4U45A 4AG8A 2IVTA 2Y4IB 4ACCA 3LQ8A 4F4PA 4I22A 3SG9A 4O0VA 2W1ZA 4N6YA 4XG6A 5GIOE 5IQAA 1OL1A 5IUHA 1GZOA 3SDJA 3TT0A 4GVJA 2JIIA 4YJPA 4ZP5A 5A4LA 4PP7A 5IQGA 2W06A 2XCKA 3CPBA 3MWUA 4JBPA 5HVKA 4NTTA 2ZV2A 4QP7A 5IA5A 3FV8A 2E9NA 2R3HA 3QQHA 4OBOA 2V7OA 5AR2A 2OJGA 2ZMCA 1CTPE 4O91A 4QMVA 1FOTA 3KCFA 4FTKA 4ALUA 5D11A 3Q5IA 4S2ZA 5LVOA 1UNLA 4A7CA 3KF7A 5CAVA 2F4JA 4J98A 1XKKA 3BHHA 3OXTA 4HOKA 2FA2A 5BVFA 4ERWA 5BVNA 1CKPA 2UW8A 4U40A 3W32A 3KK8A 5I4NA 2JLDA 2OZAB 4ALWA 2BIKB 3KXZA 3DFAA 4E6CA 4CCUA 4GMYA 2BFXA 4MXAA 4UZHA 5J9YA 3G15A 1A06A 4G3FA 3UO4A 4JXFA 1ZOEA 5LXMA 2AC5A 3FI8A 5AP2A 4C4HA 3PSDA 4BDAA 3WZJA 2C6OA 4XRLA 1H07A 2A19B 3KRXA 1NXKA 4I0RA 4M66A 1OITA 3FQHA 2PVKA 4JOAA 3WE8A 4AZWA 4DBXA 4O6EA 4AUAA 4I5MA 3DB6A 3KN6A 3LQ5A 2PZPA 3HRFA 3TUBA 1NY3A 3VUTA 2BTSA 3I0QA 4FV7A 2GPHA 5GJFA 4E6DA 2FGIA 4IEBA 3OD6X 4BWKA 4D0XA 1FGIA 2UZWE 2ZM3A 3GB2A 3IQ7A 4IADA 4L42A 2WMQA 3JS2A 3FQEA 4BVUA 1KV1A 5HLNA 3FMJA 5JK3A 2HCKA 2P3GX 4W4WA 5HG8A 1OPKA 4AOTA 2XJ2A 3L8PA 4FTTA 3V04A 4DFXE 3C4EA 2BFYA 3OP5A 4BWXA 3P7AA 2VWYA 3ORXA 4XLIA 3L9MA 3COHA 3PDTA 2YITA 4GV1A 2IW8A 3RNIA 4QQCA 2W4KA 3TKHA 5AA8A 1OL5A 3F5GA 3ZO3A 3F69A 4GFOA 4UMRA 2HWPA 3HVCA 3FZTA 3DDPA 1UV5A 4PNIA 3EZRA 1Q4LA 3FL5A 3M11A 5CLPA 1U5RA 2Z02A 3NW6A 3R7GA 4YO4A 3KK9A 4R3CA 3VS5A 1H1RA 3SLSA 1R39A 2FVDA 5EM8A 4JLCA 1VYZA 2UW9A 1IRKA 1ZY5A 2C0IA 4GIIA 2C3JA 1FVVA 1JQHA 2VV9A 3DT1A 3KULA 4FOCA 3RK5A 5GZAA 3OG7A 1OL7A 1YHVA 2JBOA 3LCOA 3CQWA 4XG9A 5C8NA 1GZKA 2VO3A 5CU6A 4RC2A 3KXGA 3VS2A 4KIPA 2R3PA 3FI2A 2O8YA 4QP2A 3IECA 4FTUA 5GJDA 3TJCA 3M2WA 4LOPA 4RX9A 2R0IA 3HLLA 4AT4A 2HY81 1ZXEA 5GZ8A 1XR1A 5A4EA 3HMIA 2UZNA 3GBZA 4YJUA 1YI3A 4BI1A 3EHAA 3NUPA 3WZEA 4TRLA 1Q62A 4D2WA 2Q83A 2CGXA 1LEWA 2HENA 1QPJA 3FMNA 3NNVA 4FKOA 4QMWA 3W2OA 2JD5A 4WSYA 3BGPA 3LLTA 4Y85A 2VRXA 4YZMA 4AGUA 5IEYA 4EHVA 2F57A 1KOBA 1Q5KA 4YJSA 5LMBA 4IC7A 2BAQA 2DUVA 3CP9A 2ETKA 2VWXA 4Y95A 5AV3A 2Y8OA 3CKWA 4YHJA 3R7EA 1W84A 3NW5A 4ZXTA 3PY0A 3W2QA 3R0TA 3UQGA 2XK4A 3LQ3A 2RG6A 3QCYA 4BGGA 4XLVA 2WTKB 3I5ZA 5BX0A 5JQ8A 1YWNA 4G34A 4IZ5A 3FQSA 3TZ8A 4YNOA 4OAVB 3NDMA 2WB8A 2YIQA 3CLYA 3C51A 4RBLA 2V5QA 4RMZA 3LFEA 3C5UA 4FZFB 5HX6A 4IM2A 4BCHA 3PPZA 2PMIA 4NH1A 3I4BA 4YR8A 5LCKA 2JAMA 2GQSA 4U79A 4FV3A 4WUNA 5FEEA 3PVUA 5M09A 5HOAA 2R3QA 2X6EA 3LCSA 3OCSA 5HNGA 3TG1A 3AG9A 5JFSA 3O7LD 5TT7A 3ZSHA 2W1FA 2XK8A 4OGRA 5AAGA 3HV6A 1BI8A 4B9DA 4PMPA 2UUEA 2XH5A 3DQWA 4MBJA 2G2IA 3Q52A 4FKUA 1V0OA 3MVMA 3NAYA 4IB0A 4EH5A 3EN4A 3LFNA 4XCUA 5HHWA 3ZLSA 4CV9A 3R1NA 2YJRA 4UB7A 4KKHA 4TYIA 3NYOA 5CNNA 2Z2WA 5FDPA 5D1JA 3RNYA 4BIEA 4L46A 1XH9A 1H00A 5CENA 4ZOGA 1OBGA 4QMNA 3FC1X 4FTRA 5L6PA 2PWLA 3P86A 3LFCA 4OT5A 2JBPA 4O0YA 4AW0A 3QTQA 4J99A 4FKWA 4S32A 4ZTMA 3MI9A 3TV6A 2FO0A 4WRGA 5CY3A 4ZJIA 5AX9A 4B8MA 3A8XA 4C33A 5LCJA 4AF3A 5GIPE 4JBQA 3EQPA 4ZS0A 2R3FA 1F3MC 4RX7A 5AUVA 5TF9A 2VTPA 3AC3A 1YQJA 3LM0A 3MN3A 3HYHA 1WCCA 3ORZA 4FSMA 2XKEA 4UYNA 4CFWA 3QBNA 3QC4A 2WTCA 3VS4A 3LFSA 2NRYA 4FTCA 4GU6A 4NKAA 5KZIA 4U6RA 3HRCA 4HYSA 4ZTQA 3A62A 1MUOA 2OO8X 4M14A 4C37A 3V3VA 1QCFA 4FTAA 5BYYA 1UKHA 2EXMA 3DZOA 4FTMA 3P7CA 3NVMB 4B8LA 4F1OA 1V0BA 2IVSA 1PXKA 3ROYA 2GSFA 3NWWA 4I6FA 4WG3A 5CI7A 3MY5A 3QZIA 3W8QA 4FGBA 3EN7A 4FF8A 2V22A 3SOCA 1FQ1B 5H8GA 4GYGA 4EK5A 1DAWA 1MQBA 2RFNA 3HDMA 5EHOA 1GIHA 5H2UA 2W17A 4FOBA 3AT4A 4ENYA 1XBCA 1U54A 2IWIA 3QQUA 1NVSA 2E9PA 3V6RA 4BDGA 2ETMA 3ZEWA 4Z16A 3S1HA 3H9FA 2XIRA 3NIEA 4RT7A 4I6HA 1V0PA 4O0TA 2A2AA 4FSTA 4RVTA 3OC1A 5CI6A 3FLSA 3LIJA 4PPCA 3GQIA 2AYPA 2I0EA 3AOXA 2Z7LA 2G2HA 1M52A 1ZYCA 5DEWA 3V5JA 2GHGA 3DPKA 5HESA 2ITXA 4V04A 3GVUA 5I9YA 4IH8A 3F2RA 2OICA 2BRHA 2QKRA 5LVLA 3DXNA 5EHYA 2X2LA 3WF8A 3I60A 2ESMA 3UIBA 4PDSA 4ZTHA 4DLJA 3R2YA 1PKGA 5KMLA 3DTCA 3GQLA 4IAYA 4RX5A 2X81A 5FLFA 2WTIA 4NUSA 4TXCA 3H30A 5J5SA 5CVHA 4DTAA 2XP2A 4KB8A 3R71A 5FQDC 5E8UA 3CSVA 5TE0A 3OW4A 5EM5A 2Y0AA 3ORIA 3UYSA 1OIYA 2QU6A 5IG1A 5EYKA 4BIDA 1G5SA 4Y5QA 3PVWA 4BCNA 3GU6A 3MV5A 4ZJJA 1Y8YA 4HJOA 4D5HA 2XM9A 5AAEA 3FI3A 1IEPA 4EH2A 1FBNA 4FIFA 1B39A 4BTMA 2GNHA 4F9YA 3RK9A 3E3PA 5JEBA 3QU0A 2ZYBA 5C27A 4C3RA 2DWBA 3G5DA 4D1ZA 3R04A 4MKCA 1PJKA 1O6LA 5D10A 3RCJA 4ZSAA 4FIEA 4LL5A 2XNPA 2OIDA 4PRJA 1Q41A 2VNWA 4QTAA 5HO6A 3W2CA 2FSMX 3KREA 3OWLA 3COIA 4H39A 3R9DA 4ASEA 2CKEA 4H05A 4NSTA 4GT3A 2HK5A 2BCJA 2PVJA 3Q04A 1O6KA 5DMZA 1STCE 2QOOA 3JY9A 4FIJA 4QO9A 4JG8A 1PY5A 1TKIA 5BYLA 3AT3A 1LUFA 4O2ZA 1MRUA 3MB6A 3OCBA 4G3DA 3IGOA 4C36A 5HCYA 1FMKA 4RIXA 3F3WA 1UU9A 2J5EA 1OI9A 3A2CA 3TIYA 3EYHA 1BL7A 3MPAA 4G9CA 4MK0A 4JVGA 3QALE 3QYWA 3KMMA 1ZY4A 5JZNA 2OIBA 2QONA 3MJ2A 3D0EA 2HY0A 3C4CA 4QP6A 3UBDA 3GGFA 3KU2A 4PQNA 2ERZE 3MA6A 2Z7SA 4HZRA 2UVYA 4PUZA 3V5PA 4I23A 4G6OA 2QO2A 2JKOA 3GEQA 4YHFA 4IAIA 2JGZA 3AT2A 4YC8A 3F2AA 3FSFA 2Y7JA 4WD5A 5F95A 4ZIMA 4A9YA 4BKJA 4ZJVA 5C8MA 1VJYA 2JFMA 3A60A 4HVIA 5H3QA 2XA4A 2R3JA 3Q9WA 4OUCA 2OIQA 3O8UA 4P7EA 3TACA 3QWJA 4Z7GA 1HCLA 4YTIA 3LAUA 4EOLA 4E26A 3R73A 2CGVA 3JPVA 4JBVA 3MSSA 3E7VA 4WO5A 5IKWA 3ODYX 4YHTA 2W5BA 5DR9A 3DKFA 3EFLA 3Q9YA 5KUPA 2UZDA 4CMTA 4DH3A 3H10A 2ZAZA 2W1GA 4F9WA 4ZY4A 2B4SB 4FR4A 4DG2E 4FSRA 3GP0A 3UNKA 2AUHA 2W0JA 4QMUA 3VULA 3ZRMA 4S34A 3TXOA 2XB7A 5D12A 3KN5A 1Q8YA 4AX8A 5AIRA 4M0ZA 3H0ZA 5HG7A 4K0YA 5E1EA 4J8NA 5A46A 4FNYA 3OMVA 3PPJA 4X3JA 4IJ9A 2QOKA 2RF9A 4D1XA 2E2BA 5LMKA 4BIBA 4U3YA 5CSPA 1NVQA 3A7FA 1UVRA 4ANOA 1Q8ZA 3AC5A 1H28A 4K9YA 3R1YA 5HCXA 2CKOA 5TOZA 4E4XA 4WA9A 2J4ZA 4QOXA 4X2JA 2YJSA 4DEBA 4FKJA 5K5NA 3O0GA 4BCOA 3MVHA 1RE8A 2RG5A 5E90A 4MXYA 3D5UA 3R8UA 3BYMA 4M15A 3F3VA 1FPUA 2F2UA 2WO6A 3OWPA 4IVDA 3SRVB 3SXRA 3VBWA 2YIXA 4FC0A 4R3RA 2GQGA 4YLJA 3ZO4A 1ZYLA 3QCQA 4BF2A 2EB3A 2HW7A 1GAGA 3GFWA 4C02A 5CEOA 4M97A 1OL2A 2WFYA 2XBAA 3QQJA 2OI4X 5I9VA 2V7AA 3UQFA 4NKSA 3GU5A 2RFDA 4H58A 5E8ZA 4H3PA 4S33A 5TO8A 2I0HA 3RPYA 4AZSA 2NO3A 5BQ0A 5J8IA 3CE3A 4JRNA 3GC7A 4BCKA 3A61A 1A48A 5FEDA 4F1TA 4M69B 5IQHA 5E8VA 5EW9A 3HGKA 1R78A 3A7HA 5LQFA 5CTPA 5FBOA 3TUCA 4U41A 2ITOA 1H25A 4TYGA 4L67A 4CYJA 4E20A 3BYVA 4HVGA 4G9RA 2CSNA 3DFCB 3SV0A 3VUGA 4QTEA 5K9IA 4O0RA 5HD4A 2GTMA 5M08A 2AC3A 3AGMA 5FXSA 2I7QA 3Q9XA 4LGGA 4CFNA 2DQ7X 3PIXA 4TYEA 4CV8A 4DH5A 3V5TA 1ZMWA 5AR7A 2VGOA 5FTOA 4D1SA 4BTKA 4LMUA 5T68A 4CQGA 1KE7A 2BRGA 4P5ZA 4KRCA 3CTJA 4BI2A 5E9EA 3ZFMA 1WMKA 5DE2A 4X3FC 3TNIA 3WARA 4JR3A 2W99B 4QT1A 4B4LA 4EK6A 5IQFA 3QFVA 4H1JA 3BGZA 4HGTA 4RWJA 3VF9A 2EU9A 4AT5A 5CEIA 4DINA 4EOQA 2IZUA 4OTQA 5L2IA 4FSZA 4FTJA 4YTCA 3NUXA 4IQ6A 4AQCA 4CNHA 5E8WA 4ZY5A 3BE9A 3HP2A 3P7BA 3DOGA 3DGKA 5D7VA 3OW3A 4IWOA 5FP6A 3FYJX 3AD6A 3M1SA 1BMKA 4R5YA 5CS6A 5AIKA 3UIXA 4NIFA 5CF4A 4DF3A 2R3LA 1YHWA 2C0TA 3PSBA 3EKNA 2R3MA 5IQBA 3F7WA 2JEDA 4UWBA 4UWYA 3PY1A 4UZDA 2OZOA 4YJVA 3RAWA 4FKQA 4ZTLA 5CAUA 5AP5A 4DT9A 5J9LA 4KKEA 5J95A 4AFEA 3HZTA 3UOHA 2OXYA 1GOLA 4QQJA 1XHAA 2C6DA 3ZEPA 4DGNA 5CALA 3L9LA 2QODA 5J1VA 5AFVA 3PA5A 2YDJA 2ZMDA 3TNPC 3ZTXA 4ANNA 3TL8A 1M2PA 4O1OA 4YBJA 5E92A 4AOJA 1JKLA 1OIUA 3MW1A 4DGGA 3GCQA 1CM8A 3ZS5A 4FBXA 3OF0A 4USEA 3MGYA 5KMOA 3HV4A 3VC4A 1XH5A 2XBJA 3DS6A 2CN5A 1IR3A 2XYNA 3Q6WA 4Q5EA 4JNWA 4RJ7A 3N4VA 4LFIA 3ZMMA 1H08A 2GTNA 4R8QA 2YDKA 3LE6A 4WNMA 5HIEA 5DYJA 2XK7A 3VUDA 3ITZA 3F88A 4LRJA 2CMWA 4YZDA 3VQUA 2HIWA 2H8HA 2ZB0A 4GT4A 4TYHA 4XBRA 5DEYA 4Y83A 4YBKA 1YXSA 4PL4A 2EXEA 2VTRA 4FNZA 5L2SA 3UOJA 3A7JA 3C50A 5CEMA 2HWOA 2PSQA 5IUIA 3SHEA 4RJ8A 4CLJA 4CKIA 2VN9A 4YU2A 3RP9A 5J7BA 3KMWA 1K2PA 3T3VA 3QGYA 1DAYA 3Q53A 2P33A 2OZAA 1QPDA 3DBDA 5IMEA 4C34A 3D7TB 1UA2A 2IZTA 4MBLA 3ROCA 2QCSA 4FA2A 1PMVA 2REIA 1GY3A 1DI8A 2X8DA 3CQUA 3UZRA 2PUNA 3PVBA 2GNJA 3PXQA 4ZSGA 3BCEA 3OXIA 3MJ1A 4LGDA 1NA7A 2WNTA 4N6ZA 3W2PA 4E5AX 3BEGA 3S3IA 2ITUA 3IPHA 3CPCA 4JDHA 1V1KA 2ERKA 1AD5A 2HZ4A 4IDVA 3ANRA 3ULZA 3ZZWA 4H3BA 3UP7A 3HMOA 3E63A 3SX9A 4TNDA 2JDRA 4MXOA 3L8XA 3LVPA 2BKKA 2YIRA 4MQ1A 4DGOA 4EK8A 4D9TA 3QKLA 4FI1A 5A3XA 4JIAA 3GCPA 1OIQA 1JBPE 4YZBA 3DBEA 4IZ7A 5I3RA 4NW6A 4BC6A 3DDQA 3ZSIA 3SG8A 1I09A 3AMBA 4EQMA 5BVWA 4KBKA 4L45A 1JVPP 2GDOA 3PTGA 4RVMA 5B2KA 4O2PA 4FTNA 4RX8A 3RALA 2YM7A 2OFVA 2XK6A 2HXLA 4KD1A 4C35A 3FMLA 4HNFA 4EH8A 4U0IA 5H9BA 5F20A 3QZHA 4FSUA 3RM7A 4ACHA 4F6SA 4F9CA 3FKOA 2UZLA 2OU7A 4QYFA 5ETAA 4IAZA 2Z60A 3UZPA 2BMCA 2ZV8A 4KIKA 2DS1A 3NNWA 3LHJA 3SD0A 2B7AA 2B9HA 5FD2A 3O51A 4FV8A 2P2IA 3P79A 4J7BA 3R1SA 5HG5A 1OMWA 4CQEA 4O7ZA 4BDHA 2VAGA 3KL8A 5ICPA 2W5HA 5CT0A 2B55A 3G9LX 4YTHA 5DBXA 1OPJA 2WMSA 3SC1A 1PYEA 2W1IA 4J97A 3FI4A 4FV5A 5AM7A 4FKLA 4HPTE 1OKWA 3DXPA 1JKSA 3DKGA 4RC3A 4XS2A 5AP6A 2J0MB 3O50A 4R3PA 1UU3A 4AN9A 3IKAA 2ITZA 2VTIA 4QMMA 2BUJA 4LOQA 3QUDA 3PXZA 3JY0A 4EOMA 5KHWA 3R7OA 2BTRA 3ZO2A 3NS9A 4A9UA 1PXLA 3AC2A 4IVCA 4IX5A 3ORKA 4KA3A 4LUEA 3MFSA 5CZHA 4HVDA 4N70A 4GJ3A 2QHNA 4IFGA 4LGHA 5A4TA 5IZFA 4FEWA 3MESA 2PVRA 4KS7A 4MD7E 4DLIA 5KKRC 1ERKA 1W83A 4J95A 3VBVA 4NWMA 1H26A 1RDQE 2YAKA 3CTQA 2V62A 3PXYA 2YDIA 5FM2A 2VTTA 4L01A 3OTUA 4CXAA 3WE4A 4H1MA 4K11A 3FLYA 5I9WA 1I44A 3OCTA 2W4JA 3PP1A 1XH6A 2YM8A 3LJ1A 3HNGA 4YC6A 2R7BA 2YA9A 5HBEA 3D9VA 1Y6AA 2WPAA 1G8AA 3CCNA 2JDTA 4TL0A 3COKA 4E5WA 2X2KA 4XV2A 3ZC5A 3FXXA 1UNHA 4UX9A 4CFFA 1J7LA 4AWIA 3FHIA 4AU8A 3PE2A 4MXXA 4I1ZA 4ZK5A 3U8WA 2I6LA 2X1NA 4TYHB 4PDYA 3C1XA 3D2IA 1M7NA 3ZFYA 3CR0A 4IWQA 4LYNA 5AUYA 5DPVA 3E7OA 4C2WA 4BR3A 5FG8A 4F63A 4RJ6A 5IDNA 5A4CA 5JGAA 4Q2AA 1LPUA 2HAKA 4RA4A 4EI4A 1GZNA 5EDRA 3FLZA 3EN6A 2QOBA 4TWNA 2UVXA 4GUBA 3R7YA 4CVAA 3S95A 5EQEA 2VGPA 2VX0A 5IA4A 2ZB1A 4UXLA 2QURA 3EQIA 4C58A 3TV7A 3NVKI 5F9EA 3ACJA 3C4XA 3PXKA 4BY9E 4EH6A 5AA9A 3GFEA 4FZ6A 3R63A 4MCVA 3IGGA 2IO6A 3F5XA 3DU8A 4CCBA 2YWVA 1ZARA 4ANLA 4IWDA 3I0OA 4I4EA 4OTDA 4M13A 4BZOA 2ZDUA 4BKYA 4F7LA 3F3ZA 2VTOA 4L6QA 3FWQA 4FT7A 3QQKA 4O22A 5AJQA 2OK1A 3WOWA 4ACGA 2BDWA 5HEZA 1PXOA 5L8JA 2YIWA 4MNEB 5J7HA 3EQFA 3G0EA 3OWJA 2XZSA 3OWKA 4X2KA 3R9NA 2IVVA 4BDDA 2BRNA 3MBLA 2YAAA 1H24A 3EFJA 4RIYA 3H9RA 4UWCA 3ZUUA 3G2FA 4C0TA 4FKRA 3RHKA 4F0GA 2CCHA 4KUJA 4L7SA 3G33A 4LMNA 4GS6A 4Q9SA 4FODA 3GU8A 4P90A 4V0GB 5EK7A 4CSVA 4C3PA 3R8ZA 3VS1A 2PULA 4PTGA 4Y72A 3BU5A 3QTZA 4JX7A 4YSJA 4K18A 5LJJA 2KULA 3MVLA 2FSLX 4IHPA 4TN6A 2G1TA 4KIKB 2ONLC 1QPEA 3U9CA 1ZZLA 4ASDA 5EM7A 4FV0A 4BCMA 5HX8A 5KMIA 2ZV9A 4XG4A 4OTRA 5EW3A 3TZMA 4U97A 2PE1A 5IISA 1PYXA 4ZZMA 5M07A 3POOA 4AA0A 3D94A 4XP0A 1LR4A 4BTJA 4R77A 4R1VA 3F5PA 3P08A 3P5KA 3L9NA 3P78A 4U81A 2R3RA 3FMKA 3VAPA 3SVVA 3QL8A 2UZEA 3FPMA 4QMTA 3W1FA 3ATSA 5DVRA 2GU8A 5KMKA 4PV0A 3P1AA 4W4VA 1Z57A 3O23A 3TUDA 1SYKA 5K4JA 3PIZA 3DB8A 3Q60A 5AR3A 2XVDA 3F9NA 5AADA 2NPQA 3ET7A 3FZSA 4QMLA 4CD0A 4PNKA 3UYTA 2ITQA 3AD4A 3BHTA 3PLSA 3LFAA 3MFRA 4L3JA 4XHKB 3RM6A 5CSVA 3LOKA 4O6LA 5AP7A 2QG7A 4JG6A 5CU2A 3TM0A 2WTKC 2JITA 4AE9A 2C6EA 5IEXA 2VUWA 1ZWSA 2J2IB 3NEWA 2CNQA 3DLZA 4JBOA 5EYMA 3DA6A 4FV6A 1UWHA 4ITIA 4EYJA 1OL6A 3E92A 4GFGA 2PVMA 3LFDA 2WMUA 4FSWA 4MXCA 4Y8DA 3E87A 2C3IB 3QGWA 4TW9A 1ATPE 3MPTA 4EZ3A 2YZLA 4CFUA 2OGVA 5E4HA 2YCFA 3N9XA 4ANBA 2UW5A 3BZ3A 1Q8WA 4DTKA 4CRLA 1YDSE 4G3GA 3PE1A 2C6TA 1XJDA 5JRSA 4S30A 4JDIA 3UVRA 4FZDB 4MH7A 4HW7A 3O17A 5E8SA 3Q4TA 3GU4A 4MWHA 1F0QA 3FYKX 2YN8A 4BWPA 3EQCA 3D5WA 4C2VA 4XG3A 1KWPA 4QP1A 1B38A 1P4FA 3OCGA 4X21A 1XBBA 4YMJA 4KINA 3IS5A 2C3KA 3NMUF 4FSNA 5DNRA 1UU8A 5CF6A 2X6DA 2ITWA 2VO7A 3OOGA 4M12A 2OXDA 3RINA 4MEDA 3CC6A 1WBTA 5IF1A 4YJNA 2J0KA 1YDTE 2Y6MA 4WKQA 1CKIA 1YHSA 2R3GA 3EB0A 3NUUA 5BMSA 3UTOA 5CANA 5ANEA 5IMXA 2XNEA 2XJ1A 2HZIA 4QMPA 4G5JA 4RQVA 1R1WA 3PRIA 2X9FA 3BRBA 3ZOSA 3COMA 2YM3A 3T8OA 4JQ7A 2CPKE 1OIRA 5F4NA 4FV1A 3QYZA 3ZH8A 3U54A 3LMHA 1GNGA 3DY7A 3TJDA 3Q96A 3R02A 5BUIA 5IQEA 2PMOX 1BLXA 3QX4A 4FV4A 4IDTA 2VZ6A 1PXNA 3IW8A 5CASA 4RIWB 2BZKB 3TN8A 3RPRA 4RLLA 3FBVA 3V5LA 5I9UA 1A9UA 3KF4A 3FKLA 4RIYB 3GENA 5EDPA 3R8LA 3NAXA 4ACDA 2G15A 1PXPA 3N4UA 5HGIA 4LG4A 4DEAA 3HL7A 3KRJA 3D14A 4D0WA 3GC9A 1U59A 4YO6A 3E3BX 2PK9A 4UEUA 2Y6OA 4ANQA 2FSOX 2GS7A 3F5UA 3H3CA 2VTMA 1PKDA 4EHEA 3A7IA 2NNWB 2PU8A 3BPRA 1P4OA 4TNBA 2I40A 1XWSA 2RL5A 5HI2A 4QMZA 2YIYA 2X4ZA 2OJJA 4JQ8A 1H1PA 3F7ZA 1Y57A 2R2PA 3WIKA 3HAMA 1M14A 1BUHA 3QD4A 3CBLA 4B6LA 1WBPA 2VTHA 2Z7RA 2YM5A 1IASA 3ZUVA 2I1MA 2YCQA 3PLAE 2DYLA 2IW9A 3TNQB 3LPBA 3MH3A 3OY3A 4NCTC 4RGJA 1Q3DA 3MB7A 5TR6A 3SRVA 4WHZA 4E93A 4Z3VA 5H8EA 3RI1A 2JIVA 4YZCA 2HZ0A 3FZOA 4QRCA 4V05A 4NM5A 5JMSA 1LP4A 2R3KA 4FV9A 4GW8A 2C1AA 4O38A 4PX6A 3NNXA 5ACBC 4O7SA 3FAAA 4PTEA 5M56A 3QZGA 1HOWA 1Z5MA 4GUEA 4M69A 4R6VA 4DH8A 3PJ3A 1ZMVA 3VRYA 1JOWB 4QTCA 4PPAA 5FXRA 5HVYA 4LV8A 2OJFE 2ZJWA 1R3CA 3DJ5A 2A27A 2OG8A 3AC1A 3LXNA 3O8PA 3QX2A 5AP4A 5T6KA 5EOBA 1B6CB 4DGLC 4EH9A 2VO0A 4YTFA 2W1EA 4TWOA 3F61A 1PMNA 1WBNA 3IK3A 1KE8A 5B0XA 3EZVA 4WT6A 5C26A 4OTPA 4BCGA 3U4WA 5AP3A 3RGFA 2ZVAA 4WUAA 4R1YA 2JAVA 5DT4A 5ITAA 3V51A 2XIYA 5HLPA 2E9UA 3ZONA 4RQKA 3WF9A 2J90A 2XM8A 3BYUA 5BVEA 4MF1A 3C0HA 4MD8E 2JDOA 5DR2A 3VBYA 2CDZA 5CU0A 3EQGA 4MF0A 3SXSA 2P2HA 3TDWA 2UW3A 4CGAA 4FKVA 4AOIA 3R6XA 4RVKA 3VF8A 1P5EA 3QA8A 4W8EA 3AMAA 3KXMA 4EOSA 5LVMA 3I7CA 4W9XA 3U6IA 3PJ2A 4NM7A 4PPBA 1H1WA 4UV0A 4EK4A 3C0GA 2GNLA 4JL9A 2VWUA 2VX1A 3U4UA 1P2AA 4NT4A 2WOUA 3HMMA 2BRBA 3RPSA 4O7NA 4JT3A 4D9UA 1OUKA 2C3LA 5A6NA 3RZBA 4N57A 4PDPA 3PIYA 3PP0A 3FLQA 3IW5A 5HNIX 3SKCA 5AUXA 3TKIA 4IWPA 3EKKA 5K0XA 4GSBA 2BKZA 3DAJA 2ZM4A 3EN9A 2X7OA 4QPAA 3LLAA 2CNUA 4FYNA 2BZIB 3E88A 4UBAA 5CQWA 4RWIA 4O1PA 2ITNA 4QQ5A 1H0WA 3OROA 3OBJA 4L53A 2XNBA 2B0QA 4NZWB 5G6VA 4FVQA 2XEZA 5GNKA 4A9RA 3KRLA 2QVSE 4F7JA 4FTOA 4IB5A 5HE3A 1KV2A 3EOCA 3CY2A 2J0IA 3VUMA 4B0GA 3WF7A 4EOPA 3CY3A 3WZDA 1BL6A 1FINA 3LJ2A 2GMXA 3HRBA 4CZYB 3EN5A 2WZJA 3NIZA 4FTQA 2RKUA 4RJ3A 3D15A 3UODA 3Q4ZA 2EB2A 4DYMA 4APCA 2YLFA 5IU2A 2O63A 5DH3A 5JGBA 4CZUA 4M7IA 3QTWA 5DA3A 4Z9LA 2BZJA 2J50A 4UMTA 4RA5A 4C8BA 3NR9A 4G31A 3FJQE 4CRSA 3BX5A 3HV5A 3PYYA 5F94A 3QD0A 4UMPA 3R9RA 3D7TA 5EI6A 3R01A 4MWIA 4ONAA 2YACA 3FE3A 3KCKA 3KRRA 3KVXA 4O7RA 4MAOA 2C5VA 5M4FA 2BDFA 4P5QA 5M51A 3E8NA 4ACMA 4D2VA 3M42A 4HGSA 3QHWA 4GG7A 2PUUA 3CIKA 4FKPA 2WIHA 4BL1A 1JSUA 2IPXA 2CGWA 4FKSA 3K3JA 4MVFA 1K9AA 2F7ZE 3Q4UA 4KAOA 4L7FA 3BBTB 2F9GA 3CD8A 5B2LA 3VS6A 2PUPA 1H0VA 4D4VA 4DFBA 1UWJA 4GYIA 2GHLA 3W33A 3R7UA 2WMAA 4ANSA 5E8XA 2G01A 3R8VA 1ZRZA 3VS7A 3TNHA 2WQBA 2WD1A 5KX8A 2ITPA 5DRDA 4I4FA 1PXIA 4QPSA 2X9EA 4AFJA 4A06A 4JR7A 4CKRA 2Q0BA 4WNOA 4U44A 4LRMA 2GCDA 2X4FA 4OBQA 4I93A 4IE9A 3KA0A 4J52A 5JGDA 2BIYA 3QD3A 4IAAA 5F1ZA 3R9OA 2UZOA 3GXLA 3CQEA 4EOOA 3K5VA 2R4BA 2CNVA 4AS0A 4K2RA 4O0XA 2XUUA 3UNZA 5HICA 3U55A 1YXVA 2XRUA 3FHRA 3P23A 2BDJA 2WTDA 1ZOHA 1PMUA 4G5PA 3PUPA 2Z8CA 3FY0A 2QLUA 3FKNA 3PJCA 2B9IA 2WKMA 1IG1A 1OB3A 3GC0A 2F7XE 2JKQA 3VW8A 3OZ6A 5HBJA 4GRBA 3U6HA 3EFWA 2C5YA 1PRYA 1L3RE 4KNBA 4RIOA 2R9SA 2IN6A 2SRCA 3ATTA 3U9NA 1Y8GA 3NYXA 1H1SA 4C4IA 4D28A 3ZM4A 3W2RA 4B99A 4PY1A 4AW5A 2BRMA 4OW8A 3WZUA 4QP4A 4OTHA 4C57A 4HVSA 4WNPA 2YCRA 3UC4A 4CTBA 4YP8A 4JS8A 1YVJA 2IZRA 4FIHA 1QMZA 3CXWA 4J53A 4XP3A 3HUCA 3BLHA 4CLIA 5J1WA 4YJTA 3QHRA 1H4LA 3TZ9A 4YNEA 2W5AA 4O83A 4QTBA 5DN3A 5ANGA 2C5NA 4GG5A 3EYGA 3OFMA 4M8TA 3QUEA 1U5QA 3ALOA 5KBQA 1DI9A 2A4LA 4DEHA 4DEEA 3ALNA 2WTJA 4CTCA 4I24A 4I6QA 5CAPA 3Q6UA 4I6BA 1M7QA 4D2RA 5CF8A 3BELA 3HV3A 2GS2A 4XG8A 4E6QA 3TI1A 4GH2A 4PWNA 3BU6A 5ETFA 4EKLA 4F65A 1MRVA 1LEZA 4RWLA 3TWJA 5JQ5A 5HORA 4OLIA 1PW2A 4XG7A 1KE6A 5DHJA 4M68A 5AM6A 5AAFA 4KWPA 1YXTA 3KC3A 3MH0A 4FZ7A 1H1QA 3H0YA 3PXFA 4N0SA 5L6OA 3DZQA 4I94A 5LMKC 1OKVA 3O7LB 4TZRA 3HA8A 4DH7A 4PMTA 4GCJA 1SVHA 2B1PA 5CNOA 3RKBA 4O86A 3I5NA 3DK3A 4YC3A 5HQ0A 1KUTA 3ZO1A 4F0FA 5CSXA 3KKVA 3DNEA 3FXWA 3NW7A 3ELJA 4XOZA 4JRVA 3E8CA 3ORNA 2WOTA 3FLWA 5CT7A 2QG5A 2C1BA 3VNTA 4UYAA 4B7TA 5KHXA 4JIKA 1JKTA 2WEIA 5H8BA 5A6OA 5AUUA 1F5QA 4EHZA 2WELA 4F7SA 1REKA 1Q8TA 2XK3A 3A7GA 2CJMA 4TPTA 4FUYA 1Q8UA 3UC3A 5EYCA 5D9HA 3PJ1A 4WSQA 3QD2B 2QKWB 4BZDA 2W7XA 4G1WA 2VTSA 2OBJA 4U3ZA 4IZYA 2OLCA 1QL6A 4FUXA 4TKSA 5BUJA 1H27A 2FYSA 4AGCA 3MS9A 5CVGA 4EOJA 5IA0A 4C4FA 4E4NA 3ZC6A 4XRJA 1UKIA 1YXUA 2EXCX 3QXOA 3QLGA 4FSYA 5KZ0A 4D5KA 5JH6A 4MBIA 1W82A 4EH4A 4BGQA 2UW0A 3EQDA 3NNUA 4ITHA 4IMYA 3Q32A 4MNEA 2W9FB 3NUYA 4IAKA 4ZTSA 4BICA 4EBVA 3Q3BA 3VUIA 1YI4A 2RFSA 3RMFA 2HELA 4EQUA 3JUHA 4FL3A 5DFPA 4KSPA 3TEIA 1OUYA 5J9ZA 4OTWA 4QNAA 3D4QA 4I21A 4AP7A 5DT3A 3DJ7A 5EI2A 5BVKA 4NM0A 4P4CA 3PJ8A 5EW8A 4IW0A 2B9JA 1UU7A 3O71A 1T45A 4V0GA 2YERA 4XBUA 5KO1A 1ZMUA 2H34A 3KQ7A 5ANOA 4I5CA 1YW2A 4UMQA 4AZVA 2JKMA 3QCXA 4U9AA 3GNIB 4C4EA 3TCPA 4EUTA 3B2TA 5ETIA 4CT2A 5AMNA 3NUNA 3RZFA 3VHEA 3ZXZA 3VS3A 4FE2A 4AN3A 5CQUA 2C68A 3RJCA 2H96A 3R8PA 5L8LA 2Y4PA 3WYXA 4ZEGA 1GZ8A 5AUTA 5HZNA 5IQCA 3KFAA 1OGUA 2VWBA 4NK9A 4IAFA 4YZNA 5FDXA 3P9JA 4CT1A 5KBRA 2PE2A 2WQMA 4FIGA 3UG2A 3NX8A 1WBWA 5D41A 3K5UA 4BHNA 2BHEA 2OJ9A 2P4IA 2PVFA 4WIHA 4YZ9A 4ZSEA 2HW6A 5EYDA 2WXVA 3R7IA 1ZYSA 3ZFXA 2WU7A 4O84A 3SQQA 4FT3A 4M84A 4D2TA 4XMOA 4DG0E 1FMOE 3ZBXA 4XUFA 1O9UA 3CD3A 4HYUA 4M67A 4G6LA 4RZWA 4AGDA 3ZRLA 3F82A 5M44A 2Z7QA 4FEUA 3PSCA 4W4YA 2UZTA 2Y4IC 2JDSA 4G3EA 3SAYA 5JZJA 2BHHA 2QHMA 3C13A 5FWKK 3UJGA 3W18A 4AZTA 4EBWA 1OPLA 2QI8A 3K2LA 1WFCA
chains in the Genus database with same CATH superfamily
3UP2A 4NFMA 2XF0A 3WIGA 3G90X 3MH1A 4D2SA 2ETRA 5HTBA 4F08A 4G3CA 4I3ZA 3R00A 3N4TA 4DEGA 3CEKA 3PA3A 3GCSA 1VR2A 4FVPA 3NFGB 3GU7A 5IH5A 3AD5A 4EWHA 4D2PA 2QOQA 2QO9A 3D7ZA 3ZBFA 5IUGA 3OS3A 2J5FA 3PFQA 3G51A 4GU9A 3Q2MA 4LRKA 4QEBA 4F78A 3GCUA 3JYAA 5AR5A 3NYVA 3C5IA 3TV4A 1M17A 1RW8A 4TWCA 3PZEA 1Q97A 1YXXA 4YGAA 3WZKA 4ZLYA 3SOAA 4WRSA 4X0MA 3OBGA 2RGPA 2VD5A 1E1XA 2CGUA 3FMHA 4NW5A 3Q4CA 3THBA 1G8SA 2OH0E 4NJ3A 4HGEA 4XJ0A 4EJNA 4UMUA 5CAQA 1TQPA 3MY1A 4DE4A 5ACKA 5EH0A 2E9VA 5HIBA 2G9XA 3LXKA 3AKKA 2OKRA 3KXHA 5HU9A 3QXPA 3DAKA 4JJRA 4EONA 4USFA 5KKRB 4DCAA 1TQIA 4DHFA 3T9TA 3ERKA 4BI0A 2WHBA 5JFXA 3HA6A 4O7WA 3BKBA 1CMKE 2O65A 4BRXA 3EH9A 1P14A 2UW6A 4QMYA 2R0UA 3LFFA 1IAHA 3K54A 3K3IA 3R2BA 5EQYA 5L6WL 4HZSA 3MVJA 5CZIA 3DBFA 2VWZA 3L8SA 4EJ7A 4DGMA 1TVOA 3PZHA 5JFWA 3QRJA 5IA3A 4FIIA 5BYZA 4QYEA 5BV3A 4G16A 3CGOA 5LWNA 4L52A 5EKOA 2HXQA 3OEFX 3AC8A 3ORTA 3R22A 4FTLA 5C9CA 4A9TA 3ZM9A 3MH2A 4X6RA 2Y9QA 3V5WA 4RIWA 4C61A 4IM0A 3WI6A 2WMXA 4DEDA 5IH4A 5AP0A 5JSMA 1OGYA 4Y73A 4NYEA 3LCKA 4WBBB 4F9AA 4C4GA 3P0MA 3LW0A 3NCZA 2KTYA 3RPVA 4DN5A 4YURA 2BROA 4F64A 3PG3A 4PTCA 5L2QA 2PVHA 1SM2A 2G2FA 3NZ0A 5EG3A 5HBHA 3V6SA 1Z9XA 4QMSA 4OTFA 1AGWA 5HKMA 3DKOA 4OR5A 3KRWA 4QMXA 5EKNA 2ACXA 5E1SA 1CDKA 2ZV7A 4UXQA 4MQ2A 4LM5A 3FUPA 4HNIA 4G17A 4FKGA 3QQGA 4BGHA 1IA8A 3QRUA 2IG7A 5FGKA 2WMVA 1OVEA 3RAIA 1H8FA 2W1CA 2WGJA 3QTSA 3IO7A 4X7QA 2GFSA 2RIOA 1YOJA 5E7RA 4WG4A 1SNXA 3FZRA 4EWQA 3H4JA 2VTLA 5GJGA 4XNEA 3CGFA 5BPYA 2IVUA 4KIQA 4MX9A 4X2GA 4AW1A 4HCVA 4W8DA 3AGLA 4BFMA 4BDJA 4FT5A 4YLKA 4DFLA 1YOMA 4CG8A 4LL0A 4MNFA 4RJ5A 5AP1A 2RSVA 4NL0A 1H01A 5HO8A 1GIJA 4FKTA 4U5JA 5I9ZA 1FVRA 4YJRA 3MYGA 3VQHA 5AX3A 4O4BB 4UY9A 3OY1A 2O2UA 2FH9A 5CSWA 3RTPA 4C7TA 3ZDIA 4XV9A 3LMIA 4AN2A 2PE0A 4AXFA 2PVNA 4DT8A 3ZLWA 3QQLA 1PXMA 4EK3A 4YPSA 5GINE 3HDNA 5DRBA 2A1AB 3W16A 1L8TA 5ANDA 4AACA 3GI3A 1JPAA 3ZDUA 4O81A 1MP8A 4FX3A 4L3PA 4JDJA 1WBOA 3V8SA 5J5TA 1QPCA 1HCKA 2VNYA 4O21A 5CX9A 2QLQA 4C38A 3VVHA 5A9UA 4H36A 5HE2A 3P4KA 4J8MA 2UVZA 2C6KA 5EOLA 4EH3A 2IZSA 2QD9A 3LCTA 5FXQA 4A9SA 4E73A 3BQCA 4F09A 3PY3A 4TWPA 3D83A 3NLBA 4ZSJA 3UG1A 3EJ1A 4F70A 4DFNA 3OEZA 3P5JC 1DM2A 1RJBA 3VUHA 5FTQA 5FUTA 2R5TA 1REJA 2VX3A 4MD9E 3BYOA 4KABA 4NCTA 4YLLA 5LMAA 2H6DA 4ENXA 3L1SA 4E1ZA 4IB3A 4OAUC 3BHYA 2XNNA 4FNXA 5I9XA 4FG9A 1J7IA 3DKCA 3E8EA 4YJQA 3EIDA 5BVOA 4EL9A 3I1AA 3FXZA 3H9OA 5LVNA 5E8TA 3ENMA 3OVVA 4QQTA 2QOCA 4BYIA 3E8DA 2A98A 3BE2A 3FMMA 4PL5A 5AR4A 1X8BA 3ZLYA 4BCFA 5LVPA 4BCJA 5AV1A 4ASXA 4IM3A 3TTJA 4K8AA 4HCUA 4EC9A 3DCVA 3LFBA 3HUBA 4ANMA 3S4QA 4S31A 1PXJA 4A4XA 4Q9ZA 2J0LA 1Q24A 5K5XA 4WG5A 5J87A 1RQQA 3C4FA 3CJFA 4EYMA 3EL7A 4AT3A 3UPZA 4JAJA 2GNGA 5KE0A 3U87A 3KEXA 1KOAA 2VTQA 3QRKA 4GIHA 5IEVA 2O0UA 4KBCA 3R83A 4DAWA 3RWQA 3FLNC 4ZLZA 4O7LA 4HPUE 4EUUA 4QP3A 2OW3A 5GHVA 2VWIA 3RBWA 4A4OA 3UZTA 3AXWA 4LUDA 2UV2A 4RPVA 2YEXA 3EWHA 1JLUE 3I79A 4D4SA 4F99A 2I0YA 2QO7A 4QYHA 1PF8A 3MFUA 4ZMFA 4ITJA 2XIKA 1VLRA 3D5XA 1OM1A 3QKMA 3HV7A 4PF4A 4BTFA 3NYNA 3E64A 4E5BA 4L43A 5IPJA 3DK6A 4R7IA 4RC4A 3UPXA 3FMDA 4J1RA 4JG7A 1VEBA 3HAVA 4RRVA 2IJMA 3R1QA 3KMUA 4I5PA 5CWZA 3DJ6A 3C9WA 3TZ7A 5A54A 4R5SA 4IZAA 3JVRA 4FL1A 3DAEA 3ETAA 3IW7A 4F6WA 1URCA 2X7FA 5KMMA 3EQRA 3UVPA 2QOHA 5DWRA 3O2MA 3FZPA 4ZLOA 5CAOA 3KVWA 1BKXA 5L2TA 4FG8A 5T3QA 4ZSLA 2UZBA 3QQFA 1BI7A 1JSTA 2A0CX 3C4WA 3QTXA 4FZAB 3BLRA 4ALVA 3LXLA 5HU3A 3NFFB 2R64A 2BZHB 4KRDA 3LFQA 1APME 4LQMA 5DT0A 3LZBA 3SA0A 5AV4A 1IA9A 4HYIA 1JWHA 2GFCA 3MA3A 4U43A 2BAJA 5JRQA 3WILA 4RG0A 3VBTA 2EWAA 4BCPA 5BVDA 5L2WA 1XQZA 5BUEA 3DXQA 3BWFA 2J9MA 4OTGA 1XH4A 2WTVA 3SXFA 1E1VA 3ZYAA 3ZXTA 5KNJA 4GK2A 4DCEA 1YWVA 4QDVA 2WQNA 4XG2A 5CSHA 3ZSGA 4GVAA 1OECA 2OXXA 5L3AA 4BBEA 1CKJA 3KXNA 3PXRA 4IX3A 3F3UA 2HOGA 4J71A 5B7VA 4O7YA 5HE0A 3VWAA 5IQIA 4FG7A 2J0JA 4X6QC 4E6AA 4X2NA 3ORPA 4AGWA 4G2FA 4ZTRA 2RFEA 3TTIA 4F6UA 2JIUA 3MTFA 3UVQA 4AZEA 5HTCA 5I3OA 5HD7A 1CSNA 2W05A 3KULB 1M2QA 4BB4A 3DV3A 1W98A 1YKRA 4AZFA 4W4XA 4FYOA 4F0IA 1NT2A 5C03A 5IH6A 2WQEA 4DTBA 4D4YA 3UIMA 3MPMA 3TIZA 4BDCA 4BCIA 3F2NA 4KSQA 5CXHA 1Y6BA 4YSMA 2C69A 1T46A 4L44A 3R7VA 2R3OA 4I0TA 3UOLA 4CMUA 2CKQA 3E62A 3AMYA 4OBPA 2QNJA 3POZA 5HVJA 3JXWA 1YI6A 4ID7A 1TQMA 3MDYA 4DFYA 3QA0A 2B53A 4IX4A 4F1MA 5L4QA 2XNOA 3IDPA 4NJDA 2YCSA 4TTHB 3ODZX 2H9VA 3L8VA 2C4GA 2YZAA 2BILB 1YWRA 1R0EA 1ZOGA 4IVAA 4J96A 3PG1A 2B54A 4FEXA 2HZNA 3PVGA 4E3CA 1TFFA 2EUFB 2O64A 3WYYA 4USDA 3HP5A 2XAOA 1WVXA 4FGRA 3R8MA 4L9IA 4XP2A 2QOFA 4WBOA 3VJNA 3BHVA 2QR8A 5FM3A 3ZLXA 3F6XA 1MRYA 2BR1A 5E8YA 2W1HA 3V01A 2NYAA 3PWDA 4PDOA 4C4JA 3UO6A 2CLXA 2PMNX 4MXZA 3VIDA 3MFTA 2GQRA 4FTIA 5C1QB 2YABA 4TT7A 5HNBA 3UE4A 3ANQA 2VTJA 4GEOA 5AUWA 1J3HA 4IB1A 2X2MA 2FB8A 3G6HA 1Q61A 2GS6A 2EVAA 4A07A 4L8MA 4I92A 3W2SA 1YDRE 3IONA 4EOIA 3PUFC 4P2KA 4GKIA 5HE1A 2WEVA 3KGAA 4CFVA 4K33A 2XNMA 3GOPA 4QNYA 5FEQA 3BV2A 3KXXA 4XH6A 3Q9ZA 3SW4A 3O96A 4AAAA 2UZUE 3DBQA 5M4IA 5TKDA 4EORA 5AV2A 4YUQA 2QC6A 3ACKA 4FK3A 3LJ0A 3BQRA 3QLFA 4I5HA 4MHAA 4QYYA 1JKKA 3ZZEA 4OTIA 1XO2B 4QMQA 3TDVA 3BGQA 3DQXA 4XV3A 4BN1A 3II5A 4EZ7A 5HLWA 2QR7A 3HMNA 3OT3A 5HTIA 3S00A 1NVRA 1PHKA 2O3PA 3CTHA 4RVLA 3FZ1A 4TYJA 4X2FA 4X3FA 4BHZA 1W7HA 2YLEA 2BVAA 3FSKA 4JX3A 4EKKA 3BL7A 2ITYA 4GK3A 2XNGA 5AV0A 3SGCA 2C0OA 4AQKA 3BBWA 3IDBA 3PWYA 1BYGA 1WBSA 4F9BA 1U46A 3ZUTA 4GKHA 4FMQA 4M0YA 4I0SA 3RWPA 4BZNA 2JKKA 3GC8A 1WVYA 5CXZA 3NUAA 4EHGA 2F49A 2LAVA 3UDTA 5CVFA 3ZCLA 3I6UA 2ITVA 2C47A 2XIZA 4JAIA 3BWJA 3EQBA 3BIZA 4XOYA 4FICA 4LOOA 4HVHA 2QQ7A 5DI1A 4NTSA 3IOPA 4AXEA 4DG3E 3UIUA 2F7EE 5DGZA 1J1BA 2C30A 5AEPA 4BKZA 5G1XA 3RCDA 4O0WA 3IG7A 5C01A 3UNJA 4E7WA 2XYUA 2PVLA 3IOKA 2WMRA 5FP5A 4NM3A 1WBVA 4D4RA 3QUPA 2YISA 3Q5ZA 3BLAA 2C6IA 3UOKA 2C6MA 2BALA 5D7AA 2CKPA 4FT0A 3G0FA 4UN0C 4IVBA 3REPA 1U4DA 4ZZOA 4FNWA 4BYJA 1XH8A 3NRMA 3MY0A 3OOMA 4XX9A 4ASZA 1XBAA 2J51A 1W8CA 3VO3A 2OJIA 4IFCA 2C5XA 4GK4A 4BDFA 3OT8A 1G3NA 4DFUA 3CKXA 2WMTA 1U54B 3B2WA 2C6LA 5CYIA 2PY3A 4GT5A 4NU1A 5A14A 3L9PA 5HO7A 4QYGA 3A8WA 3T9IA 4U42A 2PZRA 5AWMA 2OSCA 4RLKA 3SW7A 1E9HA 5EI8A 2QOLA 3V8WA 2X39A 3OHTA 3ORMA 3T3UA 5JT2A 4TY1A 5HCZA 1URWA 2V0DA 3PPKA 3QRTA 5CEQA 3GT8A 4KS8A 3NSZA 5A4QA 4IIRA 5I0BA 1S9IA 4ZMEA 2GNFA 5EFQA 5E91A 4BDEA 5DOSA 3B8QA 4CKJA 3RHXA 5AR8A 4CEGA 4QD6A 5ANKA 3OXZA 5M53A 1IAJA 4O96A 3D2KA 5K0KA 4AXDA 3AC4A 4AW2A 4DH1A 2P0CA 2PZYA 4C3FA 3PFYA 3G6GA 3W10A 4EH7A 3JR1A 2LGCA 4FV2A 4KBAA 4HCTA 3OUKA 4HGLA 5K3YA 3BI6A 2BAKA 4EEVA 1MQ4A 5B2MA 5EM6A 4AA5A 3FMEA 4R78A 2PMLX 1YRPA 2J6MA 4ZY6A 2FSTX 2W9ZB 3A99A 4JI9A 3ORLA 3OUNB 1O6YA 3QWKA 3TKUA 4F7NA 4NFNA 2R3IA 2R7IA 4G6NA 4DC2A 1ND4A 3FEGA 4O7VA 4RJ4A 2XEYA 2V55A 4FK6A 3GOKA 3LMGA 4QMOA 5I5ZA 3MTLA 5HG9A 4I20A 1ST4A 1KE9A 2F2CB 3IW6A 4BBFA 1OBDA 4FEVA 5M06A 4IANA 2VTAA 2ZDTA 2X8EA 1ZYJA 4K6ZA 4QTDA 3VJOA 3NCGA 2WQOA 3UO5A 4CMOA 3ID6C 3C0IA 3R30A 4BJJA 5CEKA 3W0OA 3HMPA 3ZHPC 3FY2A 4II5A 1FGKA 4O4DA 4FEQA 1ZZ2A 3UDBA 4PP9A 3RAHA 5ETCA 2CCIA 4EC8A 2XKCA 2QOIA 2X7GA 3FL4A 1UNGA 2CHLA 1BX6A 1FVTA 1XH7A 4RIXB 4RFYA 1SZMA 4W9WA 3VW6A 4DHIB 4U8ZA 5KMJA 5JFVA 3D5VA 4EQCA 5HIDA 5CU4A 2B52A 4Q5HA 5FBNC 3RVGA 2X8IA 4MYGA 4BCQA 5DLSA 3F66A 3ULIA 4Y46A 5C8KA 4QPMA 5IDPA 3W55A 1SMHA 3C4ZA 4X3FB 5GZ9A 1ZLTA 3LM5A 3HX4A 2IW6A 4L00A 4O4FA 2WU6A 5LOHA 1WZYA 2CLQA 3DTWA 4KIOA 5M55A 3QTUA 2WMBA 1WAKA 1R0PA 3WBLA 3ZRKA 4CFXA 2PHKA 4QP8A 4DBNA 2ZM1A 4RFZA 2UW4A 4I6LA 4U80A 3N51A 2HYYA 3R9HA 1OKYA 1Q3WA 2NP8A 4BDKA 4ZTNA 5DIAA 3G9NA 2GHMA 2VWWA 3EFKA 4APPA 1WVWA 3DNDA 3QCSA 4H3QA 3E93A 3V5QA 2WTWA 3W8LA 5M57A 3S0OA 3GCVA 3U6JA 3VS0A 4K1BA 4RSSA 3TNWA 5DG5A 2XCHA 1GIIA 4ZZNA 4DA5A 3BHUA 3UMXA 3MIYA 2PVYA 2JC6A 3Q2JA 1JNKA 2P55A 5FRIA 4DDGA 1EH4A 3NUSA 4CZTA 4L68A 1YOLA 4R7HA 3ENHA 3EL8A 5BMMA 3QC9A 4YPDA 4GL9A 4HYHA 5LWMA 3E5AA 3RK7A 2OH4A 3ZU7A 2XIXA 2O5KA 2OWBA 4FKIA 4BDBA 3KB7A 2JFLA 2X0GA 3I6WA 4AE6A 5CF5A 5L8KA 2W96B 4I41A 4N4SA 1OKZA 3I7BA 3OTVA 5JN2A 3O5AA 3NPCA 2PL0A 3I81A 2UW7A 5C4KA 3BLQA 2PYWA 5IQDA 2XS0A 3O8TA 4CFMA 4GFMA 1AQ1A 2OF4A 4JDKA 4DFZE 1VZOA 3WF6A 4NEUA 2VU3A 4V01A 5CEPA 3VHKA 3C7QA 4O4EA 4C59A 4E8AA 1Y91A 3BU3A 3V8TA 3QTRA 1ZYDA 4AA4A 4FVRA 3F3TA 3PA4A 1JSVA 4A4LA 3CJGA 3QZFA 4CG9A 4IJPA 3S2PA 5M4UA 3DLSA 3IDCA 4IACA 4AXAA 4PMSA 3LKMA 1SVGA 2OF2A 4O82A 4WOVA 1M2RA 3EQHA 4E4LA 2YWPA 4OT6A 4O27B 4JQEA 4BDIA 3VBXA 1K3AA 4RWKA 1J7UA 4Y5HA 3LCDA 2UZVA 2GNIA 3MIAA 4O0UA 5ANIA 5EDQA 2I0VA 3UGCA 4D55A 4EZ5A 3RAKA 2B9FA 1JAMA 4XYFA 3U51A 3QAME 3R28A 4LI5A 3IW4A 3VBQA 1KSWA 3A4OX 4D58A 1DS5A 3BV3A 4GJ2A 2J7TA 3WF5A 2R3NA 4L3LA 4Z55A 4KKGA 4Z7HA 4M3QA 1S9JA 3QKKA 2XK9A 3BYSA 2JDVA 4FT9A 5C4LA 5J79A 4FL2A 4YJOA 5CU3A 5IA2A 3KY2A 4BBMA 2PPQA 1SNUA 1ZAOA 3GUBA 4O0SA 5ANJA 5EQPA 4PMMA 3AQVA 3JVSA 1KE5A 5K4IA 1VYWA 2OFUA 3FPQA 4R7BA 2WAJA 4IXPA 5AUZA 3UQCA 1OZ1A 4IBMA 2ZOQA 3A4PA 5BNJA 4RZVA 4E4MA 5JKGA 3CS9A 2E9OA 1G8KA 2YFXA 2XJ0A 4ORKA 5FTGA 4XV1A 2XRWA 4RFMA 5KCVA 4K77A 3UMWA 2YHVA 5KMNA 2ONLA 5M4CA 4DEIA 2WIPA 2PZIA 4WNKA 4C62A 3RPOA 3FC2A 4UALA 4DITA 2NRUA 2XMYA 2YM6A 5LARA 4ZS4A 2PZ5A 1NW1A 5DR6A 2VO6A 3FDNA 3QRIA 3HEGA 1GJOA 1J1CA 2WMWA 3VRZA 2FUMA 4NIFB 5EHLA 2YM4A 2CN8A 3R21A 4O7TA 4ERKA 2VTNA 4LV5A 4ZAUA 5IA1A 4PL3A 2BPMA 3DBCA 2W4OA 2XKDA 4FSQA 4ARKA 3PRFA 2PTKA 3LXPA 2Q0NA 2QU5A 3VUKA 1PMEA 1Q99A 2VWVA 2XKFA 3B8RA 4CYIA 4IX6A 1SVEA 2C5OA 3QF9A 3HECA 3QTIA 3EMGA 4IC8A 4QP9A 1J91A 2ITTA 4U7ZA 4XEYA 3VN9A 3BEAA 4EOKA 2W1DA 2PUIA 3DK7A 1W0XC 3HKOA 4MTAA 3NGAA 4U45A 4AG8A 2IVTA 2Y4IB 1W2FA 3LQ8A 4ACCA 4I22A 4F4PA 4O0VA 2W1ZA 4N6YA 4XG6A 5GIOE 5IQAA 1OL1A 5IUHA 1GZOA 3W0PA 3SDJA 3TT0A 4GVJA 2JIIA 4YJPA 4ZP5A 5A4LA 4PP7A 5IQGA 2W06A 2XCKA 3CPBA 3MWUA 4JBPA 5HVKA 4NTTA 2ZV2A 4QP7A 5IA5A 3FV8A 2E9NA 2R3HA 3QQHA 4OBOA 2V7OA 5AR2A 2OJGA 2ZMCA 1CTPE 4O91A 4QMVA 1FOTA 3KCFA 4FTKA 4ALUA 5D11A 3Q5IA 4S2ZA 5LVOA 1UNLA 4A7CA 3KF7A 5CAVA 2F4JA 4J98A 1XKKA 3BHHA 3OXTA 4HOKA 2FA2A 5BVFA 4ERWA 5BVNA 1CKPA 2UW8A 4U40A 3W32A 3KK8A 5I4NA 2JLDA 2OZAB 4ALWA 2BIKB 1TZDA 3KXZA 3DFAA 4E6CA 4CCUA 4GMYA 2BFXA 4MXAA 4UZHA 5J9YA 3G15A 1A06A 4G3FA 3UO4A 4JXFA 1ZOEA 5LXMA 2AC5A 3FI8A 5AP2A 4C4HA 3PSDA 4BDAA 3WZJA 2C6OA 4XRLA 1H07A 2A19B 3KRXA 1NXKA 4I0RA 4M66A 1OITA 3FQHA 2PVKA 4JOAA 3WE8A 4AZWA 4DBXA 4O6EA 4AUAA 4I5MA 3DB6A 3KN6A 3LQ5A 2PZPA 3HRFA 3TUBA 1NY3A 3VUTA 2BTSA 3I0QA 4FV7A 2GPHA 5GJFA 4E6DA 2FGIA 4IEBA 3OD6X 4BWKA 4D0XA 1FGIA 2UZWE 2ZM3A 3GB2A 3IQ7A 4IADA 4L42A 2WMQA 3JS2A 3FQEA 4BVUA 1KV1A 5HLNA 3FMJA 5JK3A 2HCKA 2P3GX 4W4WA 5HG8A 1OPKA 4AOTA 2XJ2A 3L8PA 4FTTA 3V04A 4DFXE 3C4EA 2BFYA 3OP5A 4BWXA 3P7AA 2VWYA 3ORXA 4XLIA 3L9MA 3COHA 3PDTA 2YITA 4GV1A 2IW8A 3RNIA 4QQCA 2W4KA 3TKHA 5AA8A 1OL5A 3F5GA 3ZO3A 3F69A 4GFOA 4UMRA 2HWPA 3HVCA 3FZTA 3DDPA 1UV5A 4PNIA 3EZRA 1Q4LA 3FL5A 3M11A 5CLPA 1U5RA 2Z02A 3NW6A 3R7GA 4YO4A 3KK9A 4R3CA 3VS5A 1H1RA 3SLSA 1R39A 2FVDA 5EM8A 4JLCA 1VYZA 2UW9A 1IRKA 1ZY5A 2C0IA 4GIIA 2C3JA 1FVVA 1JQHA 2VV9A 3DT1A 3KULA 4FOCA 3RK5A 5GZAA 3OG7A 1OL7A 1YHVA 2JBOA 3LCOA 3CQWA 4XG9A 5C8NA 4AXCA 1GZKA 2VO3A 5CU6A 4RC2A 3KXGA 3VS2A 4KIPA 2R3PA 3FI2A 2O8YA 4QP2A 3IECA 4FTUA 5GJDA 3TJCA 3M2WA 4LOPA 4RX9A 2R0IA 3HLLA 4AT4A 2HY81 1ZXEA 5GZ8A 1XR1A 5A4EA 3HMIA 2UZNA 3GBZA 4YJUA 1YI3A 4BI1A 3EHAA 3NUPA 3WZEA 4TRLA 1Q62A 4D2WA 2Q83A 2CGXA 1LEWA 2HENA 1QPJA 3FMNA 3NNVA 4FKOA 4QMWA 3W2OA 2JD5A 4WSYA 4JMQA 3BGPA 3LLTA 4Y85A 2VRXA 4YZMA 4AGUA 5IEYA 3KIOC 4EHVA 2F57A 1KOBA 1Q5KA 4YJSA 5LMBA 4IC7A 2BAQA 2DUVA 3CP9A 2ETKA 2VWXA 4Y95A 5AV3A 2Y8OA 3CKWA 4YHJA 3R7EA 1W84A 3NW5A 4ZXTA 3PY0A 3W2QA 3R0TA 3UQGA 2XK4A 3LQ3A 2RG6A 3QCYA 4BGGA 4XLVA 2WTKB 3I5ZA 5BX0A 5JQ8A 1YWNA 4G34A 4IZ5A 3FQSA 3TZ8A 4YNOA 4OAVB 3NDMA 2WB8A 2YIQA 3CLYA 3C51A 4RBLA 2V5QA 4RMZA 3LFEA 3C5UA 4FZFB 5HX6A 4IM2A 4BCHA 3PPZA 2PMIA 4NH1A 3I4BA 4YR8A 5LCKA 2JAMA 2GQSA 4U79A 4FV3A 4WUNA 5FEEA 3PVUA 5M09A 5HOAA 2R3QA 2X6EA 3LCSA 3OCSA 5HNGA 3TG1A 3AG9A 5JFSA 3O7LD 5TT7A 3ZSHA 2W1FA 2XK8A 4OGRA 5AAGA 3HV6A 1BI8A 4B9DA 4PMPA 2UUEA 2XH5A 3DQWA 4MBJA 2G2IA 2IEWA 3Q52A 1V0OA 4FKUA 3MVMA 3NAYA 4IB0A 4EH5A 3EN4A 3LFNA 4XCUA 5HHWA 2XAMA 3ZLSA 4CV9A 3R1NA 2YJRA 4UB7A 4KKHA 4TYIA 3NYOA 5CNNA 2Z2WA 5FDPA 5D1JA 3RNYA 4BIEA 4L46A 1XH9A 1H00A 5CENA 4ZOGA 1OBGA 4QMNA 3FC1X 4FTRA 5L6PA 2PWLA 3P86A 3LFCA 4OT5A 2JBPA 4O0YA 4AW0A 3QTQA 2AEGA 4J99A 4FKWA 4S32A 4ZTMA 3MI9A 3TV6A 2FO0A 4WRGA 5CY3A 4ZJIA 5AX9A 4B8MA 3A8XA 4C33A 5LCJA 4AF3A 3AKJA 5GIPE 4JBQA 3EQPA 4ZS0A 2R3FA 1F3MC 4RX7A 5AUVA 5TF9A 2VTPA 3AC3A 1YQJA 3LM0A 3MN3A 3HYHA 1WCCA 3ORZA 4FSMA 2XKEA 4UYNA 4CFWA 3QBNA 3QC4A 2WTCA 3VS4A 3LFSA 2NRYA 4FTCA 4GU6A 4NKAA 5KZIA 4U6RA 3HRCA 4HYSA 4ZTQA 3A62A 1MUOA 2OO8X 4M14A 4C37A 3V3VA 1QCFA 4FTAA 5BYYA 1UKHA 2EXMA 3DZOA 4FTMA 3P7CA 3NVMB 4B8LA 4F1OA 1V0BA 2IVSA 1PXKA 3ROYA 2GSFA 3NWWA 4I6FA 4WG3A 5CI7A 3MY5A 3QZIA 3W8QA 4FGBA 3EN7A 4FF8A 2V22A 3SOCA 1FQ1B 5H8GA 4GYGA 4EK5A 1DAWA 1MQBA 2RFNA 3HDMA 5EHOA 1GIHA 5H2UA 2W17A 4FOBA 3AT4A 4ENYA 1XBCA 1U54A 2IWIA 3QQUA 1NVSA 2E9PA 3V6RA 4BDGA 2ETMA 3ZEWA 4Z16A 3S1HA 3H9FA 2XIRA 3NIEA 4RT7A 4I6HA 1V0PA 4O0TA 1ST0A 2A2AA 4FSTA 4RVTA 3OC1A 5CI6A 3FLSA 3LIJA 4PPCA 3GQIA 2AYPA 2I0EA 3AOXA 2Z7LA 2G2HA 1M52A 1ZYCA 5DEWA 3V5JA 2GHGA 3DPKA 5HESA 2ITXA 4V04A 3GVUA 5I9YA 4IH8A 3F2RA 2OICA 2BRHA 2QKRA 5LVLA 3DXNA 5EHYA 2X2LA 3WF8A 3I60A 2ESMA 3UIBA 4PDSA 4ZTHA 4DLJA 3R2YA 1PKGA 5KMLA 3DTCA 3GQLA 4IAYA 4RX5A 2X81A 5FLFA 2WTIA 4NUSA 4TXCA 3H30A 5J5SA 5CVHA 4DTAA 2XP2A 4KB8A 3R71A 5FQDC 5E8UA 3CSVA 5TE0A 3OW4A 5EM5A 2Y0AA 3ORIA 3UYSA 1OIYA 4DHZA 2QU6A 5IG1A 5EYKA 4BIDA 1G5SA 4Y5QA 3PVWA 4BCNA 3GU6A 3MV5A 4ZJJA 1Y8YA 4HJOA 4D5HA 2XM9A 5AAEA 3FI3A 1IEPA 4EH2A 1FBNA 4FIFA 1B39A 4BTMA 2GNHA 4F9YA 3RK9A 3E3PA