4IJ9A

Bovine pka c-alpha in complex with 2-[[5-(4-pyridyl)-1h-1,2,4-triazol-3-yl]sulfanyl]-1-(2-thiophenyl)ethanone
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accounting for Conformational Variability in Protein-Ligand Docking with NMR-Guided Rescoring
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 104
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ij9A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ij9A02
1SYKA 2Z7SA 3NNUA 2CCIA 2VD5A 2HK5A 5AJQA 5D7AA 4X2JA 3V8SA 4TYIA 3QQHA 5J1WA 3UNZA 4F1TA 4A9RA 2ERZE 5HORA 2JAVA 3Q04A 4QTCA 3GFWA 4CFUA 4FSYA 3Q2JA 1NVSA 5C1QB 4H05A 3SX9A 1JSUA 5AUVA 4FMQA 4EOMA 2W9ZB 2WMWA 2GNJA 4FIIA 1G3NA 1QPDA 1G5SA 2GNGA 4JQEA 3GOPA 3UQCA 4GW8A 1ZYSA 4IAKA 1GIIA 1L3RE 4DFUA 4EJ7A 2W5BA 2YIQA 3FXZA 4QOXA 5IQEA 1YOJA 3A99A 3G9LX 2WU6A 5J87A 1BI8A 2J6MA 1M2QA 2XNPA 3NAXA 5I5ZA 5LCJA 4FSZA 3NZ0A 4D5HA 2RG6A 3S00A 3ID6C 1Y8YA 4U5JA 4XG4A 3V51A 4EK5A 3BI6A 4KRCA 4DEIA 4GRBA 3FJQE 2B52A 1YHWA 2VU3A 4XG9A 1UWJA 4GMYA 1FMOE 3S2PA 5KMLA 4FBXA 4Y85A 3V5QA 4EH7A 5JQ5A 2F2UA 3JXWA 1SM2A 4DYMA 2C6OA 3EN5A 3NIEA 3PJCA 4RPVA 4F9AA 3MVJA 5BVOA 5LVPA 2J0JA 3KVXA 4IHPA 3W8QA 1QMZA 4K18A 3VHKA 5CLPA 4B9DA 3C0GA 4DLIA 4USEA 3IDPA 5DIAA 4XBRA 5DR2A 1ZARA 3AC1A 3P79A 5TOZA 2QO2A 2QURA 4W4WA 2BVAA 3OT3A 4Y72A 4LI5A 4ZJIA 4LUDA 3HX4A 5HKMA 3RCDA 2CGXA 3R04A 4HZSA 5LVLA 2HIWA 3WBLA 3COKA 3GU6A 4MD9E 3SOAA 5L8KA 2J50A 5C4KA 3QA8A 5EQEA 2C6DA 4GH2A 2E9NA 2BALA 2B0QA 4IAZA 5CVHA 1JPAA 4RX8A 3LKMA 3MWUA 4PUZA 4F09A 5CSVA 5CI7A 4FNZA 2HW6A 2X8IA 4S31A 3ACJA 1FGKA 2FO0A 4M67A 2W5HA 3F3ZA 4FZDB 4NM7A 3TG1A 4YURA 2ITPA 3QZGA 1YQJA 2YIXA 4HPUE 3RAKA 4BCJA 4YHJA 4WRGA 4KBKA 2G2FA 3O96A 4M97A 3I6WA 1DI9A 3T9IA 4WT6A 2G01A 3IECA 3PJ3A 3OD6X 2ITUA 2WEIA 4YHFA 4E5BA 3FZRA 4CFFA 4QPMA 3MESA 4KAOA 3CPBA 4BGQA 2EUFB 4M69A 4FA2A 4CV8A 5CYIA 4O0TA 3OT8A 5IUHA 5FLFA 3AG9A 2W1IA 5CSWA 3TV4A 4UMUA 3BQRA 2QR8A 2X4FA 3EWHA 4OTGA 5BMMA 4YO4A 1GZOA 4XG7A 4BKJA 4DCAA 4O82A 4BCGA 4WG5A 3NMUF 5FDPA 1FVRA 3GU5A 2ONLC 4JIKA 4U7ZA 5IISA 4OTQA 4K8AA 4CYJA 5L8LA 4IMYA 4YPDA 5JMSA 4UN0C 5CZHA 1JVPP 4R6VA 2F7ZE 2GNHA 5DRBA 2EU9A 2BZIB 2X8DA 2Y7JA 3QLFA 4OTIA 2YIYA 5IEXA 4O6EA 4ZTRA 4G3EA 1L8TA 1OI9A 4MQ1A 2R3LA 1JAMA 4TZRA 3ZLWA 3FMNA 3GUBA 4XUFA 4XV9A 4C34A 2DYLA 2O2UA 4XYFA 5C8NA 4G6OA 4IX6A 3ZZWA 5IA2A 2PE2A 3C4EA 4KS7A 4GYIA 1DS5A 3HMMA 3FZTA 5AP5A 4ZS0A 4R3CA 2IW8A 4CTBA 3W2SA 4IAAA 4B4LA 4D55A 3FSKA 3TEIA 4BICA 1JQHA 4DTKA 4QP9A 3OG7A 2CCHA 1PMNA 4EOJA 2QO9A 5DT0A 1BL6A 4KABA 2WTVA 2GFSA 2XKEA 3IW5A 3PE2A 3BV3A 3NW5A 4UALA 4NFMA 2XK4A 5HBJA 4J8MA 3SGCA 3FL5A 3QRJA 1R78A 4BZOA 4NIFB 2XIRA 4FEQA 3I0OA 2VWYA 3FKNA 5JQ8A 3OC1A 1Q8TA 2C6TA 5T6KA 3R9OA 2JD5A 2UZVA 3EFLA 4Z7HA 2J0LA 3NIZA 1H27A 4GT4A 4Y5HA 5HE2A 2XIKA 3KXMA 4XLIA 4C3RA 3BU3A 3P78A 3NUAA 1PYEA 3ZDIA 2WELA 2WTJA 3HA8A 3ODZX 5LOHA 1H25A 3HEGA 2P2HA 4MNEA 3R7EA 4TL0A 1XWSA 1OVEA 1KV2A 3BYOA 3VS3A 2UZTA 2R3MA 3RINA 2WMBA 5I4NA 5FM2A 2HWPA 4I0RA 2HW7A 4RLKA 1M2RA 2R64A 2OI4X 3EH9A 3TIZA 5E91A 3E3BX 5AUWA 3W10A 4FT0A 3KU2A 4DN5A 2XA4A 3ALNA 4U8ZA 5CNNA 2R3GA 3MVMA 4FYOA 5AX3A 2BTSA 4IZAA 5EOBA 5HZNA 5M07A 4TW9A 5HQ0A 2WMXA 5M06A 2NNWB 2X8EA 4CNHA 4ACDA 1GAGA 4FNXA 3IOKA 2DQ7X 2VWXA 3ZEWA 2R3KA 3HLLA 4YP8A 3R8PA 4ZZOA 3HNGA 5TKDA 2FA2A 2V7OA 3G0FA 4QTDA 1WVXA 2BZJA 4QMMA 4QQ5A 1X8BA 1GZKA 2OZOA 4JX7A 1ZOEA 5FXQA 2GSFA 3BPRA 1W0XC 2PE1A 2W99B 2Y6MA 4PPCA 4QTEA 5BMSA 2HENA 5AUXA 1ZY4A 3ORTA 3B2WA 3AGLA 4CFWA 4YUQA 3I81A 5DBXA 5KX8A 5HCZA 5FP5A 3GXLA 5I0BA 2XKCA 1YDRE 5GZ9A 3CIKA 4QP1A 5HO6A 2R3QA 2G15A 4I92A 4FIGA 2O64A 4MH7A 5JN2A 5HO8A 3MH3A 4YJOA 5DEWA 2UW9A 3GBZA 4LQMA 3VBQA 4AOTA 5HU9A 3CKXA 4HYHA 3RI1A 1IRKA 4X6QC 4E20A 1DM2A 4ITJA 3G15A 2XJ2A 2JAMA 4BTMA 4FEWA 3AC8A 5D10A 3MIAA 4AUAA 5D7VA 5M56A 4FV9A 4TRLA 4GKHA 3SG9A 4XV2A 1IASA 3LXPA 1ZOGA 5KHXA 3MH2A 2W9FB 3SKCA 4ZTSA 3MA6A 3QQGA 5GINE 4QMLA 5H8EA 4DGGA 4HVGA 3NAYA 4ANNA 1CKIA 4RWKA 4EYMA 3ULIA 4EK8A 5KMJA 3N4UA 5KUPA 4WSQA 2VTPA 4XRJA 5AP3A 4M12A 5E1EA 3FPQA 3GGFA 4MVFA 4V0GB 4YNOA 5CALA 4NZWB 5CAVA 2C5NA 4AX8A 5LMKC 5LMKA 4AA0A 3MFSA 3ZZEA 2I40A 4DC2A 3S1HA 2R3JA 1XH9A 2ETRA 3SLSA 3A8XA 5DHJA 4HVSA 4BCHA 4N4SA 5IU2A 2VTRA 4EH5A 1J7UA 4CLIA 3CPCA 4BY9E 3MPTA 3EQDA 4DH3A 3DQWA 2CMWA 3PVUA 2PUNA 4H3QA 3CY2A 2C6IA 2X2KA 3ZONA 2X4ZA 4HVHA 3FMDA 4NKSA 4F6SA 4RA4A 3R7GA 4LOOA 2BZHB 4ACMA 4BDIA 2GS7A 5HTBA 3F7ZA 3KMWA 3UPZA 5JFWA 5C27A 4BR3A 5JGAA 3EIDA 3TZ8A 3QTRA 4C59A 1PKGA 3L9PA 2GPHA 3W16A 3QD2B 4K33A 2Y0AA 5G1XA 4DLJA 4YLLA 3ZS5A 4R5YA 4HYSA 1YOMA 2X6DA 4OBPA 3ZYAA 3TWJA 2X9EA 4LV5A 1RE8A 4BZDA 4G3FA 5I3RA 4EH8A 2WMTA 5DNRA 2PE0A 4XP3A 3D7ZA 4AQCA 5EDQA 4V01A 1R3CA 3V3VA 2OJ9A 2Y6OA 2WHBA 3LE6A 4BKZA 1ZMVA 3ZLYA 1UNGA 3UP2A 3P7BA 3U55A 5CEPA 5B7VA 3DTCA 2OJIA 1NVRA 2VTTA 4I6BA 3IOPA 4FL3A 5EI8A 2QKRA 3OBJA 3L8PA 4L67A 4RC2A 2RIOA 3P9JA 1FINA 3L8SA 1H1SA 1O6YA 3FKOA 3R9NA 3H0YA 4DH7A 3MJ1A 5DLSA 2FUMA 5ANOA 5EK7A 3VS7A 3ZUVA 4BHZA 3DAEA 4HGSA 2YDJA 4ID7A 4Z7GA 4YJSA 4D5KA 3RZFA 3LFFA 4QMTA 4ZAUA 5DGZA 4RVLA 2UW3A 3O7LD 5CQWA 4EWHA 1P4FA 4D0XA 4X2KA 2HAKA 1U54B 2V62A 4JDIA 4W4YA 3UZTA 2XNNA 1PXLA 2XJ1A 4HVIA 3EQCA 3PDTA 3F3UA 2O8YA 2WZJA 3ERKA 4GJ2A 4I0SA 1YW2A 4F0GA 3ATSA 4QMOA 4YC8A 2DUVA 5CY3A 1ZXEA 4FT9A 4H39A 5GJDA 4H58A 2QOHA 4TY1A 3RM6A 3JS2A 4F64A 1GOLA 4ZJVA 4EOIA 2Z7RA 2PWLA 2NO3A 4AZWA 2YHVA 3G9NA 3LCDA 3O50A 4O91A 5ETAA 2O5KA 4L8MA 3IDCA 3BIZA 3NLBA 3RZBA 2OFUA 4DTBA 4QT1A 1WBVA 4RC3A 4AGWA 3QFVA 3KRJA 1UU9A 4M8TA 1UKIA 4DFYA 3EQHA 3KF7A 2P55A 4O7VA 1VEBA 4U45A 2XK6A 2X81A 3HUCA 3ORIA 4BCKA 1ZYCA 2OW3A 3L9LA 4EBWA 2RFSA 5LMAA 4KIQA 5IQGA 3O2MA 5FM3A 5JFXA 4X2NA 2OIQA 4E1ZA 1QL6A 5A9UA 4UYAA 3V6SA 4B0GA 4C2WA 1RJBA 4S2ZA 5A4EA 1YDSE 3RALA 5FEQA 2UVXA 3FLZA 5CENA 4RT7A 3LFEA 2QNJA 2YIWA 1Q97A 3QRUA 4AT3A 4ZOGA 4QYYA 1TVOA 3BHTA 5IA0A 5E8YA 3R9RA 4NT4A 5K3YA 1H07A 4IZ7A 4LRKA 3VULA 3WE4A 1PXKA 2YM3A 3R71A 4KSQA 3VUIA 3OCBA 3O17A 3GEQA 3QX4A 4KIKA 4BWKA 3A7HA 4QMVA 4JAIA 4AZSA 5LVOA 3AC3A 3A4OX 2XK8A 2OLCA 3RMFA 2BR1A 3OEZA 4F7JA 2YCQA 2PY3A 2BCJA 4LFIA 1MQ4A 2OGVA 4FSRA 4TWPA 2CKEA 4G9CA 2CNVA 3SHEA 3NGAA 5CU2A 5FBNC 4ANBA 4UY9A 4O21A 2F2CB 4YJUA 3UMXA 2B9JA 1HOWA 4H3PA 3VC4A 3WYXA 3QL8A 4AS0A 4BCQA 4IDVA 4CRLA 4A9UA 4TYGA 5CAQA 4N6ZA 5CAPA 2JFMA 3A7JA 3COHA 4P4CA 4PL5A 4ZZNA 3FMJA 1BMKA 2YM5A 4F1MA 5IMXA 4ALVA 4WUNA 2B55A 2XVDA 3PWYA 3LFCA 3OS3A 3OWKA 3QUEA 1KE9A 4FK3A 3VNTA 4NL0A 3JYAA 4XJ0A 3PUPA 1PMVA 3QCYA 4BN1A 4BI0A 3M11A 2R3PA 4FTUA 4RIWB 3RHKA 2YFXA 3PTGA 3PXQA 2RL5A 1FGIA 4LV8A 3VS4A 4A07A 1MQBA 3KRRA 3CJFA 4EHZA 4EOOA 3NUSA 1QPEA 5A4CA 4C4FA 3H0ZA 3Q9ZA 3BYMA 4ZK5A 2OJFE 4FL2A 2W1HA 4IBMA 3G5DA 4GU6A 4D2PA 5FXSA 1I44A 3DK3A 3R01A 4U97A 4ZJJA 2BAKA 4YTIA 5JKGA 3FLYA 5IQIA 3A8WA 3DGKA 3OXTA 4RVMA 4E93A 5BVEA 3Q2MA 4NK9A 2ZM1A 2GHGA 2UZDA 2ZMCA 4OTFA 4I1ZA 3NVKI 4XHKB 4KIKB 3TTJA 4LGHA 1CTPE 1UWHA 3EQPA 3Q9XA 3VAPA 5AV4A 2YWPA 5KZIA 2PZYA 3CTHA 4X3FB 3TTIA 4Z16A 4FZAB 2PVKA 3FDNA 5CF5A 2CGVA 5DA3A 5LCKA 5AP4A 3M42A 4UB7A 4GCJA 2PVFA 4RGJA 1YWVA 3R2BA 3MH1A 4IE9A 3H9OA 2BKZA 4O38A 2C68A 4BCMA 1W82A 4J97A 4LOPA 5CZIA 4QYEA 5AP6A 2X7OA 4MD8E 4QP7A 1U4DA 1BL7A 4YHTA 3IG7A 4GUBA 5CF4A 3ZRLA 4ACGA 2ZOQA 3R8VA 5AR7A 3MY5A 3MFTA 3VBVA 4IC7A 5HLWA 1P5EA 1BI7A 2W1ZA 3C7QA 2BUJA 5EKOA 4FKIA 3E7OA 3F6XA 3DJ7A 4O6LA 4RSSA 3KCKA 4HVDA 2WMQA 5AUTA 2G2IA 4OT5A 3NRMA 3KKVA 4JDJA 4BIEA 4FKGA 5HIEA 4TYHA 4UMQA 3VS2A 3I79A 3PWDA 4RIYB 3LW0A 2J90A 4ZTNA 4ASZA 1YI6A 3WF8A 3UC4A 4LRJA 1U5RA 4FV3A 3DKOA 4IEBA 3SRVA 3ZBFA 5CXZA 1OL1A 1WFCA 5AP2A 4NWMA 3BLRA 2JKKA 3E93A 1OKVA 4DTAA 3ZLXA 2AUHA 1JSTA 2J0IA 4PMPA 4BKYA 3ITZA 1ZMUA 4Y95A 5L2QA 3UJGA 4U41A 2FVDA 2GTNA 4D2SA 3AT4A 3FYJX 4YSJA 3BX5A 3R8LA 3CP9A 2LGCA 3KL8A 4OUCA 4OLIA 3BBTB 5ANDA 5IH5A 3W2OA 1OUKA 4YJTA 2UVZA 1YWRA 3GC8A 4K1BA 2F57A 2OF2A 4E8AA 4IH8A 4EH3A 4NH1A 3SV0A 1PRYA 4I5PA 2Z02A 2KULA 4KNBA 3DZQA 2P33A 3GI3A 3LQ8A 3LJ1A 3Q52A 4WUAA 3A2CA 3TJDA 3RWPA 4O81A 3B2TA 3EL7A 3ZC5A 5EW8A 4WIHA 1KE6A 3R00A 2JIVA 1IAHA 3DS6A 5HLPA 3QD3A 2J2IB 5CSXA 4FV8A 2J0KA 5CQUA 1WVYA 2VO7A 2WGJA 4L3PA 4AZVA 2XRWA 3THBA 4FOBA 4B7TA 3TUDA 4E26A 2RGPA 3OBGA 2JIUA 3ORKA 2OH4A 3OUKA 4AZTA 2C6KA 3MTFA 4J8NA 2W17A 4RFYA 3QZFA 1OPKA 3MTLA 3MA3A 4RFMA 4X21A 4AE9A 4IZYA 4IB1A 4KBCA 4NTTA 4DAWA 5I9YA 2BMCA 2OFVA 3SXFA 4TN6A 3I60A 4TXCA 3MY1A 1Q4LA 3CD3A 3MVHA 3QHRA 1WAKA 4M68A 4M0ZA 2QG5A 2VX1A 4D2WA 4II5A 3PJ8A 2C5XA 3VJOA 4ZTMA 1H0WA 2IZSA 4HYIA 3OXIA 4ZP5A 3NPCA 4UEUA 3WZJA 3QQJA 1LR4A 3RWQA 4A7CA 3K3IA 3NCGA 4FKSA 2H9VA 3UYTA 4NYEA 2XCHA 3GCQA 1O9UA 2CDZA 4BTFA 3FQHA 3D15A 4K9YA 4YZ9A 4CFNA 2Y8OA 5HHWA 2PUUA 4N6YA 2XNBA 2UVYA 4EKKA 5CAUA 3U54A 1YHSA 3BBWA 2BRHA 3Q3BA 4RC4A 3LIJA 4R8QA 3K3JA 4YBJA 2BHHA 1OBDA 3PJ1A 3RVGA 5AUUA 4QPSA 3DDPA 4GIIA 2PVNA 3DV3A 4B8MA 2ETMA 3BHHA 3CR0A 3O8UA 5GZAA 3R2YA 2VTNA 3KMMA 4O2PA 3K2LA 1H1QA 5K0KA 4USFA 3HA6A 2UZBA 3HECA 3RK5A 3UVRA 3V01A 4AN9A 5BYYA 3I5NA 4YO6A 4BC6A 4AA4A 3R22A 1Y91A 3QBNA 3U4WA 1OM1A 2YLFA 3G6HA 3OWPA 1Y6BA 4WHZA 5FWKK 3PPZA 4AF3A 5BVFA 4Q5HA 5JGDA 4RFZA 1MRYA 4YC6A 5A46A 2ITTA 1H24A 3RPRA 3LHJA 2HCKA 1DAYA 2WFYA 4FVPA 5DG5A 4ENXA 3SD0A 5HX8A 4X7QA 2PULA 1Q8WA 3LFSA 4AU8A 3NUUA 4ANMA 4U3ZA 4RVKA 2R3OA 4FTMA 4AXAA 4NCTC 3H9FA 3C4CA 3ODYX 4UWCA 1FBNA 4RIXB 4UYNA 4HGTA 4YZNA 3VQUA 3OUNB 2B9FA 3CTQA 4S34A 5GIOE 2R9SA 3IS5A 4ZSLA 4L9IA 4FSTA 4O0UA 2REIA 4PMTA 4TWNA 4MF0A 3DXQA 3DT1A 3C0HA 3HKOA 3OVVA 4I22A 3OOMA 2BILB 4B8LA 4NFNA 3CKWA 2E9OA 3VW8A 2GQSA 3GU4A 3AGMA 3KREA 2C6MA 2XBJA 5HIBA 4ACCA 4FZFB 3W32A 3ZSHA 5EQYA 1AD5A 1HCLA 3GENA 3LQ3A 2V22A 4U44A 5DRDA 2XIYA 3PA3A 4P7EA 4QNAA 4YJRA 3C13A 5IDNA 4PDOA 2X2LA 2G1TA 4Z55A 2R4BA 2FYSA 3F2NA 4O0XA 1H0VA 5F9EA 4YBKA 4J98A 4G2FA 4DCEA 5LVNA 2JBPA 4BB4A 3RAHA 3NW6A 3REPA 2IZUA 3DKCA 3SW4A 4FL1A 3UIBA 2WQNA 2ZDUA 3KA0A 5AM7A 4BRXA 4CZUA 4FTLA 4H36A 3GFEA 5HD4A 3H9RA 3OOGA 2OG8A 3LVPA 3ROCA 4GUEA 4DBNA 3P7AA 3H30A 4V0GA 2WAJA 3ZXZA 2R0UA 2QOBA 3EZRA 2W1EA 4X3JA 4JX3A 5HESA 4OT6A 4AOJA 5F4NA 2A4LA 3D83A 2F4JA 3DY7A 3HDNA 1OIQA 4RJ5A 3RJCA 3D14A 2VTLA 3NNXA 2XM9A 4YJVA 3MB6A 5AFVA 3PSBA 4U6RA 5L2IA 2PTKA 2WTIA 3PA5A 4MF1A 4CFXA 2V5QA 4E7WA 4N0SA 4GVAA 1UNLA 5IEYA 4CT2A 4O7YA 2JC6A 2B4SB 4JG6A 3L1SA 5HNGA 3ZDUA 1REJA 3U9NA 2CGUA 3VUGA 3TT0A 2B53A 2R3RA 3FL4A 3GNIB 4ZLZA 4DFXE 4IADA 4W8DA 2RF9A 1G8SA 2JDRA 3QD0A 4F4PA 1IR3A 4IWPA 1OIYA 4YJPA 1PF8A 4PF4A 3T8OA 2YACA 1YI4A 2J7TA 3P08A 4F70A 4EUUA 4ORKA 1GIJA 3A61A 1WMKA 3GU8A 2A1AB 5E8TA 5HCXA 3VHEA 5KMNA 5AR3A 5BYZA 4G9RA 4L44A 1OL5A 2X6EA 3C51A 3QRIA 4I20A 4F65A 3CY3A 2XNEA 2R3HA 3F82A 3G90X 4NTSA 5CVGA 4L52A 3N4TA 2VTIA 4K77A 1XJDA 4FG7A 5EM6A 1PJKA 5FXRA 1KWPA 3G33A 3QWKA 4KIOA 4FIJA 4FT3A 5DFPA 2QOOA 2BIKB 2W96B 3FY2A 1LEZA 3V8WA 3CXWA 5CSHA 5KKRB 4N70A 1S9IA 2IVTA 4HCUA 3Q5IA 4KWPA 5DVRA 4C4IA 1REKA 5LXMA 4B99A 4PNKA 2EWAA 5JRQA 2PUPA 2XJ0A 3PXZA 3UYSA 2OIBA 1R1WA 3NW7A 4O0WA 1H08A 4MXXA 4JXFA 2HY0A 4QTAA 2KTYA 5FBOA 4WOVA 1UKHA 3TN8A 4GK4A 5BVKA 4C7TA 4IAIA 3CTJA 4ANQA 2C5YA 2WTKC 4FV1A 4QMUA 5ANJA 4A4OA 4EOQA 3GCPA 3OZ6A 5IH4A 2EB2A 3ANRA 4PY1A 3PLSA 5DWRA 2C5OA 4TKSA 4E6DA 1CKJA 1PXNA 2A2AA 2PK9A 5FEDA 5JFSA 2VAGA 3ULZA 2BAJA 4FKPA 1SVGA 1VYWA 2W1GA 3ENHA 3TV7A 5JSMA 3FI3A 3FMLA 3QUDA 5E8WA 4PQNA 2OK1A 4CGAA 3D5XA 2XNMA 4IDTA 3HV6A 2IN6A 4IWQA 3ZEPA 4IM2A 5CU6A 4L00A 5I9UA 4DGNA 4FV7A 3R8UA 1Q41A 3OY1A 4O22A 3OWLA 4X2GA 2FSTX 4FTKA 5HG9A 3BGPA 4G31A 5T3QA 4NW6A 3LAUA 4A4XA 2AC5A 3FZSA 4TT7A 3BHYA 5BVWA 3IONA 4I3ZA 1JKKA 5HNIX 3OMVA 2EVAA 3BZ3A 2C3KA 1ZY5A 3BLHA 3QALE 4GYGA 3UZRA 5KCVA 2J0MB 1SZMA 5AV2A 4O7LA 4PL4A 3E8DA 3PPKA 5M44A 2I6LA 5HI2A 3F66A 3EL8A 2VRXA 4RA5A 5J5TA 1Q8UA 3F2AA 4IB3A 5ACBC 3ZFMA 3ALOA 3EFWA 3MFRA 1PXPA 4IVAA 5HD7A 4UXQA 3KN5A 1F0QA 3ZXTA 1OPLA 4QP6A 5K5XA 2ITQA 4XG6A 5CF6A 3HL7A 4ZLOA 4PDPA 3PP0A 4BZNA 3AD5A 5IUIA 2VUWA 3HVCA 4FNWA 2W0JA 4DITA 2VO0A 4RJ3A 4KSPA 3TACA 1E9HA 2IWIA 4KINA 4MXCA 4WA9A 3KB7A 3I6UA 3QQUA 4K11A 2ZV8A 3EKNA 3IW6A 4OTRA 2V0DA 4CKIA 2BDFA 4B6LA 1JWHA 3ZFXA 4AW5A 3E7VA 4BDJA 1KE8A 5JFVA 1OL6A 2XMYA 5IH6A 4D4VA 2ITXA 3O23A 1E1VA 4NCTA 2QOLA 4CD0A 3VBWA 5KBRA 2DWBA 4BCOA 2OXXA 4AACA 4CMTA 5EM8A 3TL8A 1LPUA 4RRVA 2J5EA 4Z3VA 1W83A 4M66A 4ZEGA 1T45A 4UWBA 2V55A 4Q2AA 3VF9A 4E4NA 4JL9A 2XNOA 3PFQA 5G6VA 5LARA 2RFNA 5AV3A 5CASA 1H1PA 4O86A 5M4FA 3E3PA 4L42A 3AC5A 3HRCA 4TNDA 3OWJA 4UV0A 3VBXA 3ZUUA 4ANOA 1BUHA 1ZZLA 4GV1A 4A9YA 5JEBA 4F9WA 3IGOA 2OKRA 5LWMA 5IQCA 2BRGA 4UWYA 4EQCA 4YC3A 1H01A 3LZBA 1ZRZA 2GQGA 2WMAA 1WBSA 4L53A 3D5WA 3KXZA 2Y4IC 4FTRA 2ZM3A 3ZC6A 1SVEA 4F63A 4J1RA 3PP1A 4L3LA 2JKOA 5AV0A 5C9CA 2HZ4A 3WYYA 4MX9A 2XCKA 3R30A 4D2VA 4AGDA 3Q4TA 2YCRA 3QCSA 3R8ZA 3CGOA 5J9YA 4RVTA 3FLNC 2HXLA 3C0IA 2VNWA 5IMEA 1YVJA 2HZIA 5AX9A 5BQ0A 2XK7A 3EZVA 3QLGA 3S4QA 2CHLA 2A0CX 3FBVA 1Z5MA 3S95A 3UOKA 4RJ8A 1YRPA 1ERKA 3QKMA 3R1QA 5J5SA 2IW9A 5DOSA 2GNIA 3HGKA 2C1BA 1W98A 3DOGA 3G2FA 2WKMA 3FEGA 2R3NA 3HUBA 1B39A 1WBWA 4QQJA 4RMZA 1OPJA 5FP6A 3PXYA 4AA5A 4CCUA 3UNKA 4MD7E 4FT5A 2Q0BA 2BHEA 4EEVA 4OTWA 2VV9A 4G3CA 4DFBA 1AQ1A 5AR5A 3WE8A 3FHRA 4L3JA 5T68A 3AMBA 3FXXA 3ZBXA 2WNTA 4IW0A 2F7XE 2PVYA 3QRKA 1TQIA 2XP2A 1W7HA 2I0EA 4DG0E 3FPMA 4KUJA 2JFLA 5ACKA 4IVDA 3K54A 4WRSA 3II5A 3OP5A 4FC0A 5E8UA 5FD2A 5GNKA 2WMUA 3BYVA 3QTZA 2C3JA 3DBCA 4JNWA 4ZTHA 2IG7A 3Q6WA 2C69A 3N4VA 1R0PA 2ZJWA 3KULB 5JZJA 4FKQA 3NYXA 4O1OA 4BI2A 4I21A 2ETKA 4EOLA 3MW1A 3PA4A 2R7BA 2OF4A 3GP0A 3E8CA 4EOKA 4C58A 5F95A 4U81A 3EN9A 4FSMA 3LFDA 1OKYA 2J4ZA 2PZPA 3JPVA 4ZXTA 5A4TA 4CQEA 3ORZA 4Y8DA 3RPOA 4C36A 3VJNA 1GNGA 4CLJA 4DEEA 1PYXA 2XNGA 2R7IA 5A14A 3Q4UA 3HRBA 4YZMA 5GIPE 4APPA 2PVMA 2YDIA 5EM5A 4D1XA 2ZM4A 3P1AA 4JLCA 4DT9A 4BGGA 2WQEA 4F9YA 2Q0NA 2HY81 5JK3A 2IZTA 5J9LA 4BBEA 4I23A 4IX3A 4BCPA 4QMXA 4GEOA 3BE2A 5ETFA 5I3OA 4I6QA 4R3PA 3BGQA 2WTKB 3QYZA 4FG9A 4BDGA 4ZSJA 4EOPA 2QOFA 5IA4A 2NRYA 1RW8A 4WD5A 3FLWA 2BKKA 3PRIA 2YAAA 5L8JA 5TO8A 3N51A 3ORNA 4JOAA 4MWIA 2RG5A 4QTBA 3B8QA 3RBWA 4UBAA 4IXPA 2ZV2A 4TNBA 3F5UA 4A9TA 4X2FA 3MPAA 4BCIA 2XUUA 3BCEA 2ZAZA 3W55A 3CC6A 5CT7A 3NX8A 1V0OA 1TQMA 2JLDA 4FTCA 4EHVA 4KRDA 5DN3A 4BIBA 2P4IA 2YM6A 4O0RA 4V05A 5E8VA 5C8MA 5IA3A 3TJCA 2W06A 4QYFA 3TUBA 2XIZA 3BELA 4FGBA 3NUYA 3VUHA 4CMOA 4G3GA 5HU3A 4YTFA 5K4JA 2VN9A 3FMEA 5L6PA 2BFYA 4FR4A 4MBLA 3ZSIA 4CT1A 4X3FA 2YITA 4JAJA 5L2SA 3SG8A 3NDMA 3UPXA 4BGHA 5LQFA 2CPKE 3BHUA 4AN3A 3OF0A 4LG4A 4M0YA 2GS2A 1BX6A 4O0VA 3P86A 3RPYA 4GVJA 3RAWA 5HE3A 3RPVA 3UO6A 1Q3DA 3FLQA 2YWVA 4RWLA 4BBFA 5HVKA 4BVUA 2C47A 2PZRA 3QD4A 3TNHA 1URCA 3LM5A 3SVVA 5EW9A 4C3FA 3AD4A 1CSNA 5K5NA 1M7QA 3LFQA 3Q32A 3TZMA 4FODA 3NCZA 2E2BA 5C01A 4ALUA 1J7IA 4TWCA 3OCTA 3LLTA 4BYJA 3S3IA 3O7LB 3GC9A 2JITA 4E4XA 4G17A 5B0XA 3CBLA 3ORXA 5B2KA 3VS6A 3ZU7A 1V0BA 4MEDA 4WNPA 1KUTA 2W5AA 3A62A 4J71A 4CTCA 4D2TA 2GQRA 2PMNX 4TYHB 5I9VA 5JRSA 5BYLA 3GB2A 2ZB1A 4WNMA 5CAOA 4IB0A 3QHWA 4HOKA 4HZRA 5M4CA 4JT3A 2I7QA 4C33A 5L3AA 4ANSA 2IJMA 3CE3A 2DS1A 3WZKA 3QQLA 4C8BA 4NIFA 4QP3A 3PE1A 5ITAA 2C6EA 1GZ8A 2CLQA 2YABA 5EI2A 4EUTA 2CNQA 4CMUA 1GY3A 3V6RA 2G9XA 4I4EA 4UZDA 1A48A 2UW7A 1XHAA 3ORPA 1Q61A 1J3HA 1OZ1A 4DE4A 3D2KA 2HZ0A 4K6ZA 1UA2A 3ETAA 2VWUA 1Q62A 2BFXA 2FH9A 3MGYA 3R7IA 3UDBA 3DU8A 3Q9WA 2VO6A 2JGZA 3VWAA 4IC8A 5M08A 4XG3A 4MNEB 5BX0A 3C4XA 4ASDA 2UZUE 2UZNA 5CT0A 3FI8A 3LCOA 3IW8A 3ACKA 3AC2A 3TCPA 3W8LA 1G8AA 3TI1A 4DEHA 4C4JA 5IEVA 4R1YA 3FC1X 4J99A 5HVYA 3PVGA 3QC4A 3U51A 3SC1A 3E88A 1H8FA 5LVMA 4PV0A 5HOAA 3CCNA 4EWQA 3QX2A 4OAVB 4FKLA 1JKTA 4DH8A 1V1KA 4KD1A 5HIDA 2XKDA 4AT4A 3Q5ZA 1Y8GA 4EYJA 1OL2A 4D4SA 5H8BA 1JOWB 5E7RA 3RTPA 3LCSA 4X0MA 4YSMA 1WBNA 5M55A 3EN4A 4DFNA 4M69B 4BIDA 3C9WA 5EQPA 4OAUC 4TYEA 5AV1A 4G34A 3H4JA 3DK6A 2C0IA 3RCJA 2UW6A 4FTQA 2F49A 2ITYA 1PKDA 5E92A 2PVHA 4NM5A 4QQTA 3EN7A 3DTWA 4PNIA 4MBJA 3SA0A 5AADA 4WKQA 4BCFA 2OWBA 4ZY5A 5LWNA 3HV3A 2OO8X 3MBLA 3PRFA 4MWHA 3D94A 2W1DA 3MIYA 3QYWA 2WQMA 3C1XA 4JS8A 3MH0A 4RQKA 1LP4A 3BYUA 4R7IA 3PVWA 4FTOA 4BL1A 4JVGA 3GCSA 4YMJA 5HTCA 5IPJA 3RP9A 3QRTA 3U6JA 3LLAA 3TKIA 4YJNA 2PVJA 4NW5A 1WBOA 2AYPA 5EHYA 4QP4A 4G3DA 3FZPA 5L2TA 3V5JA 3KQ7A 1Q24A 4GSBA 4L7SA 5A6NA 2OZAB 1VJYA 3JVRA 4DGLC 3KCFA 5FG8A 1VYZA 3CQWA 4IX4A 3ZHPC 2FSOX 3WI6A 3GQLA 3LMHA 2VTJA 2QG7A 3BYSA 5EOLA 5E8ZA 2UZLA 5HICA 4KBAA 1OL7A 5LJJA 3RK9A 2P0CA 2CJMA 1M2PA 3NYVA 2UW0A 5HG5A 4DGOA 1Q3WA 4XMOA 1U59A 4FEVA 3NYNA 5JT2A 1P2AA 4QYGA 4MTAA 4A4LA 4QMYA 4RIXA 3D2IA 3UG1A 5D1JA 5FGKA 3M2WA 3BGZA 4KA3A 2PZIA 3CLYA 4XOZA 3KXGA 5C8KA 1IA8A 3JVSA 4XX9A 3HMIA 3B8RA 4ZY4A 2R3IA 1CMKE 5FDXA 3FZ1A 4TYJA 4I41A 4AW2A 1ZYLA 3SXSA 3P23A 3EJ1A 3NR9A 2Z7LA 5JZNA 3T3VA 5CANA 4CFVA 4JR3A 3A7FA 5KMIA 4F9CA 4FEUA 5EYDA 4JBVA 2JBOA 5DR9A 2JDOA 4FOCA 3QWJA 2GHMA 4HNIA 2X2MA 4RQVA 5AWMA 5TT7A 4CSVA 1W8CA 2QVSE 3E92A 3GOKA 5IG1A 3HV4A 3ZFYA 4I6FA 4ZSGA 4P5ZA 4JQ7A 4FGRA 3QTUA 3F5XA 2WPAA 1OIUA 3SAYA 4M84A 4O27B 4I24A 3QAME 4E3CA 2OZAA 2VWVA 3ELJA 3H10A 1MP8A 1ZZ2A 3NS9A 5ANIA 5EDPA 5AIRA 5EG3A 4YJQA 4U40A 3E8NA 1XH4A 2I0VA 4IVBA 4QMWA 3D9VA 3ZO4A 4RIOA 3TNWA 3QTWA 1KOAA 4ONAA 4EHEA 4BTKA 2WTWA 2ITVA 4C3PA 2PSQA 4O2ZA 4F7NA 2XKFA 3ANQA 2H6DA 4CV9A 5AMNA 4BDAA 4F99A 3WZUA 2ESMA 3M1SA 4FTIA 3UC3A 3VRYA 4PMSA 3VBYA 3KFAA 1M52A 3C50A 1ZOHA 2OIDA 3EMGA 3MJ2A 4OBOA 3R7OA 4ARKA 1OBGA 4E4LA 3JUHA 3OTUA 4H1JA 3EYGA 2XK9A 4FV5A 4MAOA 3RAIA 4L7FA 2Z7QA 1BLXA 2LAVA 2PPQA 2ZVAA 3U87A 4JR7A 3HMOA 5HCYA 4V04A 3WF9A 4X3FC 3VQHA 3QGWA 1GZNA 2XYNA 4FKRA 4FKJA 4DF3A 3WF6A 1XR1A 4HYUA 4NM3A 3BLQA 4USDA 5F94A 5LMBA 3R1YA 3D7TB 3NEWA 4EZ3A 5E9EA 2YA9A 3IK3A 5D9HA 3BKBA 2VWWA 5IQDA 1VZOA 4R78A 3AD6A 3R7UA 2ZDTA 2BRMA 2NP8A 4UXLA 2C6LA 1UVRA 2GU8A 5J7BA 1O6KA 2UUEA 4FVQA 4JBQA 4ZZMA 3W2PA 1UU3A 4FUYA 2GHLA 4H1MA 5A4LA 2CKOA 1SNXA 3KXHA 3P5KA 3P7CA 4I5CA 3NNWA 4HCTA 4ZIMA 2C0TA 4EONA 5DEYA 5A6OA 4IAYA 3EOCA 5FTOA 1J7LA 4O7TA 2C0OA 5JH6A 4ZSAA 4DINA 2X0GA 3DB8A 5IA1A 4P5QA 5B2LA 3SOCA 2VWIA 4J96A 2PVRA 5HGIA 1LEWA 4J7BA 4AP7A 2QQ7A 4APCA 4FVRA 3DZOA 4EK3A 4U43A 4HGEA 3PVBA 4GKIA 4FIFA 2YLEA 5F20A 2Z60A 1F5QA 1PHKA 3GC0A 2WD1A 1Q8ZA 3LFNA 4RWIA 3LMIA 2BDJA 4IIRA 5HVJA 2QHMA 4YU2A 5HBEA 2IVSA 3UG2A 4BYIA 5CXHA 5K0XA 2GNFA 2QU6A 4CKJA 4HW7A 2BAQA 4ERKA 3UMWA 3PG1A 1YXVA 3PY0A 3F88A 4BI1A 4D28A 2QLQA 1S9JA 3AT3A 5HTIA 1NA7A 3AMAA 2XS0A 4IZ5A 5H8GA 2HELA 2WMRA 4H3BA 4IJPA 3GCUA 3DBQA 1YOLA 2E9PA 3TDWA 4RBLA 3IQ7A 3R7VA 2VTMA 2PMOX 5AA8A 5CU0A 3FI2A 1FMKA 3OHTA 3R8MA 2JDSA 2PMIA 2WIHA 3DBDA 3L8XA 3CS9A 4FV2A 4GIHA 4O0SA 3KY2A 5E4HA 4GS6A 4OBQA 3TV6A 1OIRA 4PDSA 4D2RA 3DQXA 3VIDA 3AQVA 2UW5A 4Q9SA 4U3YA 3DFAA 1CDKA 5FTQA 3HV5A 4AFJA 2VGPA 4CYIA 2EB3A 2VX3A 3NUPA 5A54A 5M09A 5AP1A 4QP2A 2W4JA 4O0YA 3QCXA 3PSDA 4WNKA 4ZSEA 3R1NA 4LGGA 4FKWA 1APME 3D4QA 3ENMA 1CKPA 1RQQA 3NWWA 2A27A 3DK7A 3TNQB 3EFKA 2NRUA 4FNYA 1SVHA 1PXIA 2H34A 3DXNA 4FSUA 4FYNA 4HGLA 4RIWA 4JG8A 3DNEA 1FVTA 3E87A 3G0EA 4KS8A 4RJ7A 4Y5QA 5GHVA 5KZ0A 3R9DA 3U4UA 3W2QA 4CG8A 3KMUA 4GT3A 5CEQA 5DYJA 4LRMA 4FKTA 3DBEA 4JJRA 2C3LA 1U54A 2EXCX 3WF7A 4X6RA 4O96A 3QUPA 4LL0A 3UIXA 3DBFA 5H2UA 2PU8A 3RNIA 3UO5A 1H00A 4IQ6A 5BNJA 3MFUA 3FMKA 1WCCA 2W4OA 4ITIA 4D9TA 3PYYA 4O7WA 4YGAA 4GK2A 3AMYA 4E5AX 2W05A 4XP0A 4XS2A 3G6GA 2NPQA 3HDMA 2B9HA 1BYGA 4IM3A 5J95A 2O65A 1XBAA 4O7ZA 4EH6A 3F2RA 5AM6A 5GJGA 4ANLA 4O83A 1K3AA 2IPXA 2VTSA 5E8SA 4AGCA 4R3RA 4CZYB 4NEUA 5ETIA 3DLZA 4W9WA 2PUIA 3RPSA 2ZYBA 3VBTA 1Y6AA 4RX9A 3E5AA 4MXYA 4FSQA 3WILA 2I1MA 4IWOA 5TF9A 3ZOSA 4XOYA 4FK6A 5M4IA 4LMNA 2QC6A 5L4QA 1M17A 3O51A 1JKLA 3CD8A 5B2MA 3I1AA 3L9MA 1HCKA 5IDPA 1GIHA 1TKIA 3LPBA 3PXRA 1J91A 2WQBA 3BU6A 2BIYA 1Z57A 4JRNA 4OTHA 3HYHA 4PTEA 5I9XA 1FQ1B 5ICPA 1B6CB 3DAKA 4CCBA 4ZMEA 5KMOA 3FQSA 4R1VA 4UMTA 4AGUA 4EQUA 3FAAA 2XF0A 3PY1A 3NVMB 3C5UA 5AR4A 3ZSGA 3F5GA 4FV4A 5D41A 5IF1A 2CNUA 5CNOA 2HOGA 1SMHA 4FE2A 3CQEA 4R5SA 3WZDA 3VS5A 2UW4A 4NJ3A 4FG8A 2JIIA 4FICA 2Y4IB 5HLNA 3D0EA 1QPCA 1MRVA 4LYNA 2R5TA 3FI4A 3OCSA 3QXPA 3QZHA 5DT4A 4S30A 3ZRKA 4EC8A 2QCSA 4EJNA 3V5TA 3HMPA 5HG8A 5IA5A 2B9IA 2C1AA 4Q9ZA 4C02A 3FUPA 4FT7A 1H4LA 3BRBA 4MCVA 3K5VA 4ASEA 3KK8A 3WIKA 4FV6A 4QO9A 3U9CA 4XH6A 2UW8A 4PTCA 4U80A 5HEZA 3ZM9A 4NUSA 4UZHA 4PMMA 4MXZA 3SW7A 5J8IA 2C3IB 4EHGA 3KGAA 3UO4A 3GU7A 2FSLX 3R7YA 4AG8A 4XNEA 5KNJA 3V8TA 2XBAA 3P4KA 4FIHA 4Q5EA 4HNFA 4M3QA 4WBOA 2A19B 3FZOA 4BDEA 1KSWA 4CVAA 1YXTA 2PMLX 4YLKA 3L9NA 3R1SA 3VS0A 4EK4A 2J5FA 4DEGA 3O8PA 3TNIA 3E64A 2O3PA 3DNDA 3ZO3A 5ANEA 4F1OA 4EZ5A 5JGBA 1XBCA 4C35A 3Q60A 2Y9QA 3LOKA 4Z9LA 3A7IA 3PZEA 2QOQA 3KULA 1STCE 3HAVA 5CS6A 4PP9A 5AEPA 4FSWA 4QYHA 4G6LA 2E9UA 4U42A 4Y73A 4C0TA 1ND4A 4G16A 2I0YA 1NT2A 4EORA 1YXXA 3FXWA 3QC9A 3UQGA 1V0PA 5L2WA 3QF9A 2OU7A 4DFLA 1F3MC 2ZV9A 3VUMA 1NW1A 3MDYA 2H96A 3MV5A 3UQFA 2CKQA 3KRLA 5I9WA 1Q5KA 2BRBA 5H3QA 1XQZA 2WOUA 3F3VA 4PRJA 3UTOA 4AAAA 5M57A 2SRCA 5IQFA 2O63A 4EH9A 2IVUA 2W4KA 3IW4A 1UV5A 3C5IA 2W1CA 3HZTA 4I6HA 3EQIA 4BWXA 3HP5A 4IWDA 3OW3A 3UIMA 3CGFA 1XH7A 1M7NA 4IJ9A 3EB0A 4JRVA 1K9AA 2PL0A 4I93A 2YISA 2O0UA 2YN8A 3C4FA 3DCVA 3POOA 4UX9A 5IZFA 4YLJA 1ZYDA 3NYOA 3R83A 3JY0A 3RK7A 1Y57A 4OW8A 4BHNA 3UODA 2RFDA 4QQCA 3E63A 1ATPE 4FKOA 3RHXA 2YM7A 3FE3A 3ORMA 2XZSA 4QMSA 4FIEA 4DEAA 4QMQA 4CFMA 4E73A 2BDWA 3ZO2A 5BVDA 4K2RA 2E9VA 1M14A 2EXMA 4ERWA 2WTDA 2HYYA 4MKCA 4EBVA 3PG3A 4XBUA 2HWOA 4RZWA 1JNKA 3OXZA 4GK3A 3IPHA 4O84A 3SRVB 2J9MA 3UBDA 5CTPA 4MHAA 4D1ZA 3KRWA 2R2PA 3VUKA 3CSVA 3O8TA 4PDYA 4C62A 3PJ2A 2YM8A 3V04A 5M53A 1JLUE 5HG7A 4QP8A 3HRFA 5DI1A 3VF8A 3W2CA 3DA6A 5A4QA 1EH4A 5AAFA 5KBQA 5FTGA 1KV1A 3R63A 5CU4A 3KXNA 1OITA 1DI8A 1CM8A 1MRUA 2PZ5A 4TPTA 5IKWA 2J51A 2RFEA 3R0TA 4DEBA 4OTPA 2FSMX 1PY5A 3RNYA 3I5ZA 4ZTQA 3PSCA 5J9ZA 5M51A 2X7FA 4FX3A 4LUEA 4LGDA 5C26A 4W9XA 3JR1A 3PIZA 2RSVA 4EI4A 1A06A 3V5PA 5TE0A 2CGWA 2GTMA 3FKLA 3Q9YA 2YAKA 2PYWA 1H26A 3FWQA 3P0MA 2VWZA 3TM0A 1URWA 3GCVA 4ACHA 4CKRA 2W1FA 4R7HA 4GG7A 2YEXA 3ZH8A 1AGWA 2OH0E 3BV2A 3FHIA 3FC2A 4FUXA 4DG3E 2YERA 1NXKA 4AW0A 3BE9A 4EL9A 2OICA 3QTIA 3HP2A 3PIYA 4JDHA 4S32A 4J53A 3F3WA 1B38A 1E1XA 1P14A 2JKMA 3QTXA 4AW1A 3QTSA 2YZLA 5DMZA 1YI3A 2CN8A 2P2IA 2WXVA 1U46A 4QRCA 3NNVA 4WSYA 3UVPA 2ACXA 2WOTA 1OMWA 3UOLA 4YZDA 2UZEA 4BFMA 3UE4A 5FRIA 4ASXA 3TZ9A 3AT2A 4I5HA 3S0OA 1PXJA 2X9FA 2ITZA 4FV0A 1P4OA 3GVUA 3QTQA 4FTNA 3UZPA 4FKUA 5C4LA 4ALWA 5CEIA 3RM7A 4C4HA 2OSCA 3TXOA 5GZ8A 4FF8A 4OTDA 2GS6A 5E1SA 2Z8CA 3MVLA 4KB8A 2XEZA 4PPAA 1TQPA 3GT8A 5CEMA 4G5PA 2ERKA 2X39A 3ZMMA 2CSNA 5HNBA 1ZLTA 3JY9A 2ZMDA 3KC3A 4XLVA 3OEFX 2FB8A 5D11A 3W2RA 3ROYA 4GL9A 1H1RA 3AOXA 1IAJA 4KKGA 3LXKA 1DAWA 5AP0A 4XV1A 3TIYA 2XEYA 3KN6A 4FI1A 4W4VA 3LFBA 4QPAA 3I7CA 2XK3A 3FYKX 1OUYA 2B7AA 4CEGA 4HCVA 4BDBA 4GFMA 4I94A 2OJJA 3TUCA 5AUYA 4E4MA 4GG5A 1JBPE 2GMXA 2W7XA 4XRLA 5EI6A 2YJSA 3KF4A 5BUEA 4RJ6A 5EFQA 3ATTA 3I0QA 4IFCA 5C03A 3DKFA 5IUGA 4YR8A 3QU0A 3AC4A 3FY0A 3R73A 3QXOA 5KMMA 5IQHA 3NSZA 1MUOA 5L6OA 4AE6A 2UZOA 1NVQA 4K0YA 3VRZA 4QNYA 4FEXA 4AT5A 4L45A 4J52A 4BDDA 1ZAOA 3PLAE 1GJOA 2XB7A 4C4EA 4I4FA 2ITNA 2VGOA 3PXKA 4PP7A 2ONLA 2BTRA 4WBBB 4ZY6A 2IVVA 4JG7A 5AP7A 4U9AA 3Q4ZA 2HZNA 4NM0A 3MY0A 2C4GA 3F7WA 3H3CA 4S33A 1H28A 4BTJA 4I0TA 3CEKA 3LFAA 2QODA 4IM0A 4ZLYA 4EOSA 5D12A 4P90A 4CQGA 4NU1A 2GDOA 1UU7A 2YM4A 5HX6A 4F6WA 4ITHA 5BPYA 4O7NA 4EK6A 4C2VA 2VWBA 2ZB0A 3DB6A 4XG2A 1PXOA 3KK9A 2JDVA 3W33A 4DG2E 3QCQA 3LXLA 4P2KA 2JDTA 4IAFA 4RZVA 1OB3A 4BDFA 3MI9A 1SNUA 3EN6A 3DKGA 2IW6A 3IDBA 3FLSA 5KE0A 5CSPA 5KMKA 4IB5A 4W8EA 4F9BA 4L6QA 3VO3A 4O7SA 3DJ6A 3TKHA 4QMNA 4NJDA 1R0EA 2R0IA 2C5VA 3FV8A 5E8XA 5EYMA 2WMSA 3SDJA 5K4IA 5FQDC 4JBOA 4L68A 3VW6A 4QMZA 2QHNA 4XP2A 4O7RA 4I5MA 4CRSA 1KE7A 3BHVA 1QCFA 3LJ0A 3KVWA 3G51A 4RJ4A 4W4XA 5CI6A 3DLSA 2QOIA 5F1ZA 4C38A 4EH4A 3W1FA 3OROA 1OKZA 4D1SA 1WBPA 2QR7A 4F7SA 2AC3A 3QQFA 1PXMA 4WG3A 4MBIA 5I9ZA 4N57A 3LCKA 3QGYA 5DPVA 2WO6A 5DT3A 2QO7A 3HAMA 4D4RA 1QPJA 5EH0A 3ET7A 5M4UA 3KRXA 5ANKA 4MXAA 5KKRC 4R77A 4HJOA 3CJGA 4MQ2A 3QZIA 2WQOA 2YCSA 4XCUA 3U6IA 2XH5A 5BUJA 2QOKA 4L01A 4JBPA 4DBXA 2X7GA 3OTVA 3PZHA 3UVQA 4AZEA 4M13A 4C37A 3WZEA 2I0HA 2ZV7A 4D58A 5AA9A 1YDTE 2JEDA 3WOWA 4CXAA 5EHOA 3ORLA 4XEYA 3V5LA 4F0FA 1NY3A 4MNFA 4ZS4A 1OKWA 3MSSA 5CU3A 2BZKB 4RX7A 5HBHA 2WTCA 3DPKA 3V5WA 4PX6A 3IW7A 2ITOA 4IVCA 4LL5A 3T9TA 4BF2A 3C4WA 2Q83A 2VNYA 2FGIA 2YCFA 2OXYA 1IG1A 3ZTXA 2C30A 5EM7A 4CG9A 2CN5A 2YDKA 1U5QA 3LXNA 4PTGA 4FTAA 4RX5A 2VTAA 1VR2A 3R28A 5EYKA 3DJ5A 4UMPA 4AZFA 1J1CA 1H1WA 2G2HA 4TTHB 4YNEA 1FPUA 3QKKA 4ENYA 5CVFA 4C61A 4RLLA 4JDKA 4R7BA 5BVNA 3UGCA 4JIAA 3R6XA 3T3UA 4YTCA 4DGMA 3LCTA 4M7IA 4EQMA 2Z2WA 3R21A 5E90A 3QKLA 3EQGA 2YZAA 1OECA 4LOQA 3A60A 5DE2A 1ZWSA 2EXEA 2X1NA 3PPJA 4MXOA 5ANGA 5AUZA 1KOBA 3UNJA 1FOTA 1I09A 1PMEA 3WIGA 2WB8A 4AOIA 4IANA 3I4BA 2CLXA 1A9UA 5A3XA 5AIKA 5GJFA 4KKEA 4MYGA 2Y4PA 3ZO1A 2OBJA 4E6AA 3POZA 4FTTA 4PPBA 4IX5A 4WO5A 4ZMFA 3BU5A 3BEAA 4DT8A 3ZCLA 3NUNA 3D7TA 4IACA 4D0WA 1PMUA 4MK0A 1YHVA 2B54A 4JI9A 4FZ6A 3F69A 1YWNA 2QONA 3EKKA 2VX0A 4IFGA 2CKPA 4GFOA 4CZTA 4KIPA 2VZ6A 4GFGA 3SXRA 5FUTA 1IA9A 2IZRA 5L6WL 5EYCA 1XBBA 1KE5A 3COIA 3MPMA 3DFCB 4PWNA 2BROA 2P3GX 3LJ2A 4FTJA 5AAGA 4EH2A 1ZMWA 1IEPA 4EC9A 1WVWA 4F6UA 1Q99A 3GC7A 1UNHA 2V7AA 2GCDA 5HE0A 4DEDA 5BUIA 3A4PA 3IKAA 4DH5A 5HO7A 3K5UA 3TNPC 2B1PA 2XM8A 4YZBA 3W18A 4U0IA 3O71A 3COMA 4J95A 4LM5A 2BPMA 2H8HA 2YJRA 4L43A 3N9XA 3D5VA 3E8EA 1RDQE 1YKRA 4OR5A 2VTQA 5CWZA 2YIRA 3LQ5A 4F0IA 4AN2A 1T46A 2VO3A 4G1WA 3MS9A 5FEEA 4FSNA 2XYUA 4D4YA 4Y83A 4BCNA 4C57A 5EHLA 2QD9A 2GNLA 4GU9A 1XKKA 2JKQA 1JKSA 4E6CA 4QMPA 3LMGA 3MN3A 4GJ3A 3RGFA 3TDVA 3C4ZA 4WNOA 1Q8YA 3BEGA 3OCGA 4YPSA 5CEKA 3DDQA 3EHAA 2HXQA 5K9IA 3R9HA 3ZLSA 1J1BA 4A9SA 1O6LA 3D5UA 3UIUA 4DA5A 1JSVA 1W84A 1R39A 3VN9A 4BBMA 2WEVA 4UMRA 2QKWB 2XRUA 4DFZE 3RKBA 4NSTA 5J79A 3VUTA 4PL3A 3Q6UA 3MB7A 3Q4CA 2UZWE 4EKLA 1Z9XA 4FKVA 4F08A 5DH3A 1BKXA 4HPTE 5ETCA 2PVLA 2XIXA 3LM0A 4Y46A 4D9UA 3DAJA 3UOHA 5EDRA 2WIPA 3EFJA 4EZ7A 3L8VA 1XH8A 2QLUA 3NUXA 4U79A 4E5WA 5IQAA 2RKUA 2QOCA 1YXUA 3HMNA 4XG8A 4YTHA 3UP7A 4DHFA 3O0GA 4M14A 5HE1A 3UOJA 4RG0A 2F7EE 4AWIA 3U6HA 4TWOA 3TKUA 4FZ7A 3Q53A 1WZYA 4L46A 3OFMA 3R02A 3GQIA 5KO1A 3MYGA 5DR6A 3ZUTA 4BWPA 2BRNA 4BDCA 5IQBA 4BDKA 1ZYJA 1WBTA 3KEXA 3BQCA 4M15A 5CX9A 4O1PA 3IGGA 4YZCA 4BDHA 3WF5A 1PW2A 4G6NA 2PHKA 3QA0A 2UV2A 3U8WA 1YXSA 2WMVA 3HV7A 3ZM4A 4AFEA 3OW4A 3FMHA 4C4GA 2QI8A 3IO7A 3OY3A 3F9NA 2GFCA 4XV3A 5J7HA 5TR6A 1UU8A 3F3TA 4WG4A 5AR2A 3VVHA 3FQEA 3A7GA 5H9BA 2OXDA 1XH6A 2OJGA 3DXPA 2R3FA 4A06A 3SQQA 2IO6A 3AXWA 5CEOA 2ITWA 3VS1A 3EQBA 3EYHA 3EQRA 5J1VA 3KXXA 3VUDA 3E62A 4ZTLA 2VTHA 4RIYA 3F61A 3ZRMA 4QD6A 3PXFA 1K2PA 1XO2B 3F5PA 4E6QA 5KHWA 3FSFA 3I7BA 4GT5A 4F7LA 3QQKA 1FVVA 3EQFA 4DH1A 1LUFA 2WU7A 3PIXA 4KKHA 3BWJA 3CQUA 2F9GA 2QU5A 3FMMA 3Q96A 5AAEA 3PY3A 4NKAA 5AR8A 4LMUA 4OGRA 4JQ8A 3TZ7A 4G5JA 4RWJA 5CF8A 3BWFA 5EKNA 5EW3A 1XH5A 3WARA 2VTOA 1OGUA
chains in the Genus database with same CATH superfamily
1SYKA 2Z7SA 3NNUA 2CCIA 2VD5A 2HK5A 5AJQA 5D7AA 4X2JA 3V8SA 4TYIA 3QQHA 5J1WA 3UNZA 4F1TA 4A9RA 2ERZE 5HORA 2JAVA 3Q04A 4QTCA 3GFWA 4CFUA 4FSYA 3Q2JA 1NVSA 5C1QB 4H05A 3SX9A 1JSUA 5AUVA 4FMQA 4EOMA 2W9ZB 2WMWA 2GNJA 4FIIA 1G3NA 1QPDA 1G5SA 2GNGA 4JQEA 3GOPA 3UQCA 4GW8A 1ZYSA 4IAKA 1GIIA 1L3RE 4DFUA 4EJ7A 2W5BA 2YIQA 3FXZA 4QOXA 5IQEA 1YOJA 3A99A 3G9LX 2WU6A 5J87A 1BI8A 2J6MA 1M2QA 2XNPA 3NAXA 5I5ZA 5LCJA 4FSZA 3NZ0A 4D5HA 2RG6A 3S00A 3ID6C 1Y8YA 4U5JA 4XG4A 3V51A 4EK5A 3BI6A 4KRCA 4DEIA 4GRBA 3FJQE 2B52A 1YHWA 2ZFYA 2VU3A 4XG9A 1UWJA 4GMYA 1FMOE 3S2PA 5KMLA 4FBXA 4Y85A 3V5QA 4EH7A 5JQ5A 2F2UA 3JXWA 3W0SA 1SM2A 4DYMA 2C6OA 3EN5A 3NIEA 3PJCA 4RPVA 4F9AA 3MVJA 5BVOA 5LVPA 2J0JA 3KVXA 4IHPA 3W8QA 1QMZA 4K18A 3VHKA 5CLPA 4B9DA 3C0GA 4DLIA 4USEA 3IDPA 5DIAA 4XBRA 5DR2A 2IEWA 1ZARA 3AC1A 3P79A 5TOZA 2QO2A 2QURA 4W4WA 2BVAA 3OT3A 4Y72A 4LI5A 4ZJIA 4LUDA 3HX4A 5HKMA 3RCDA 2CGXA 3R04A 4HZSA 5LVLA 2HIWA 3WBLA 3COKA 3GU6A 4MD9E 3SOAA 5L8KA 2J50A 5C4KA 3QA8A 5EQEA 2C6DA 4GH2A 1ST4A 2E9NA 2BALA 2B0QA 4IAZA 5CVHA 1JPAA 4RX8A 3LKMA 3MWUA 4PUZA 4F09A 5CSVA 5CI7A 4FNZA 2HW6A 2X8IA 4S31A 3ACJA 1FGKA 2FO0A 4M67A 2W5HA 3F3ZA 4FZDB 4NM7A 3TG1A 4YURA 2ITPA 3QZGA 1YQJA 2YIXA 4HPUE 3RAKA 4BCJA 4YHJA 4WRGA 4KBKA 2G2FA 3O96A 4M97A 3I6WA 1DI9A 3T9IA 4WT6A 2G01A 3IECA 3PJ3A 3OD6X 2ITUA 2WEIA 4YHFA 4E5BA 3FZRA 4CFFA 4QPMA 3MESA 4KAOA 3CPBA 4BGQA 2EUFB 4M69A 4FA2A 4CV8A 5CYIA 4O0TA 3OT8A 5IUHA 5FLFA 3AG9A 2W1IA 5CSWA 3TV4A 4UMUA 3BQRA 2QR8A 2X4FA 3EWHA 4OTGA 5BMMA 4YO4A 1GZOA 4XG7A 4BKJA 4DCAA 4O82A 4BCGA 4WG5A 3NMUF 5FDPA 1FVRA 3GU5A 2ONLC 4JIKA 4U7ZA 5IISA 4OTQA 4K8AA 4CYJA 5L8LA 4IMYA 4YPDA 5JMSA 4UN0C 5CZHA 3W0RA 1JVPP 4R6VA 2F7ZE 2GNHA 5DRBA 2EU9A 2BZIB 2X8DA 2Y7JA 3QLFA 4OTIA 2YIYA 5IEXA 4O6EA 4ZTRA 4G3EA 1L8TA 1OI9A 4MQ1A 2R3LA 1JAMA 4TZRA 3ZLWA 3FMNA 3GUBA 4XUFA 4XV9A 4C34A 2DYLA 2O2UA 4XYFA 5C8NA 4G6OA 4IX6A 3ZZWA 5IA2A 2PE2A 3C4EA 4KS7A 4GYIA 1DS5A 3HMMA 3FZTA 5AP5A 4ZS0A 4R3CA 2IW8A 4CTBA 3W2SA 4IAAA 4B4LA 4D55A 3FSKA 3TEIA 4BICA 1JQHA 4DTKA 4QP9A 3OG7A 2CCHA 1PMNA 4EOJA 2QO9A 5DT0A 1BL6A 4KABA 2WTVA 2GFSA 2XKEA 3IW5A 3PE2A 3BV3A 3NW5A 4UALA 4NFMA 2XK4A 5HBJA 4J8MA 3SGCA 3AKLA 3FL5A 3QRJA 1R78A 4BZOA 4NIFB 2XIRA 4FEQA 3I0OA 2VWYA 3FKNA 5JQ8A 3OC1A 1Q8TA 2C6TA 5T6KA 3R9OA 2JD5A 2UZVA 3EFLA 4Z7HA 2J0LA 3NIZA 1H27A 4GT4A 4Y5HA 5HE2A 2XIKA 1G8KA 3KXMA 4XLIA 4C3RA 3BU3A 3P78A 3NUAA 1PYEA 4DDGA 3ZDIA 2WELA 2WTJA 3HA8A 3ODZX 5LOHA 1H25A 3HEGA 2P2HA 4MNEA 3R7EA 4TL0A 1XWSA 1OVEA 1KV2A 3BYOA 3VS3A 2UZTA 2R3MA 3RINA 2WMBA 5I4NA 5FM2A 2HWPA 4I0RA 2HW7A 4RLKA 1M2RA 2R64A 2OI4X 3EH9A 3TIZA 5E91A 3E3BX 5AUWA 3W10A 4FT0A 3KU2A 4DN5A 2XA4A 3ALNA 4U8ZA 5CNNA 2R3GA 3MVMA 4FYOA 5AX3A 3NFGB 2BTSA 4IZAA 5EOBA 5HZNA 5M07A 4TW9A 5HQ0A 2WMXA 5M06A 2NNWB 2X8EA 4CNHA 4ACDA 1GAGA 4FNXA 3IOKA 2DQ7X 2VWXA 3ZEWA 2R3KA 3HLLA 4YP8A 3R8PA 4ZZOA 3HNGA 5TKDA 2FA2A 2V7OA 3G0FA 4QTDA 1WVXA 2BZJA 4FRFA 5BV3A 4QMMA 4QQ5A 1X8BA 1GZKA 2OZOA 4JX7A 1ZOEA 5FXQA 2GSFA 3BPRA 1W0XC 2PE1A 2W99B 2Y6MA 4PPCA 4QTEA 5BMSA 2HENA 5AUXA 1ZY4A 3ORTA 3B2WA 3AGLA 4CFWA 4YUQA 3I81A 5DBXA 5KX8A 4F78A 4AXDA 5HCZA 5FP5A 3GXLA 5I0BA 2XKCA 1YDRE 5GZ9A 3CIKA 4QP1A 5HO6A 2R3QA 2G15A 4I92A 4FIGA 2O64A 4MH7A 5JN2A 5HO8A 3MH3A 4YJOA 5DEWA 2UW9A 3GBZA 4LQMA 3VBQA 4AOTA 5HU9A 3CKXA 4HYHA 3RI1A 1IRKA 4X6QC 4E20A 1DM2A 4ITJA 3G15A 2XJ2A 2JAMA 4BTMA 4FEWA 3AC8A 5D10A 3MIAA 3KIOC 4AUAA 5D7VA 5M56A 4FV9A 4TRLA 4GKHA 3SG9A 4XV2A 1IASA 3LXPA 1ZOGA 1XMMA 5KHXA 3MH2A 2W9FB 3SKCA 4ZTSA 3MA6A 3QQGA 5GINE 4QMLA 5H8EA 4DGGA 4HVGA 3NAYA 4ANNA 1CKIA 4RWKA 4EYMA 2XANA 3ULIA 4EK8A 5KMJA 3N4UA 5KUPA 4WSQA 2VTPA 4XRJA 5AP3A 4M12A 5E1EA 3FPQA 3GGFA 4MVFA 4V0GB 4YNOA 5CALA 4NZWB 5CAVA 2C5NA 4AX8A 5LMKC 5LMKA 4AA0A 3MFSA 3ZZEA 2I40A 4DC2A 3S1HA 2R3JA 3W0NA 1XH9A 2ETRA 3SLSA 3A8XA 5DHJA 4HVSA 4BCHA 4N4SA 5IU2A 2VTRA 4EH5A 1J7UA 4CLIA 3CPCA 4BY9E 3MPTA 3EQDA 4DH3A 3DQWA 2CMWA 3PVUA 2PUNA 1TFFA 4H3QA 3CY2A 2C6IA 2X2KA 3ZONA 2X4ZA 4HVHA 3FMDA 4NKSA 4F6SA 4RA4A 3R7GA 4LOOA 2BZHB 4ACMA 4O4EA 2GS7A 4BDIA 5HTBA 3F7ZA 3KMWA 3UPZA 5JFWA 4JMQA 5C27A 4BR3A 5JGAA 3EIDA 3TZ8A 3QTRA 4C59A 1PKGA 3L9PA 2GPHA 3W16A 3QD2B 4K33A 2Y0AA 5G1XA 4DLJA 4YLLA 3ZS5A 4R5YA 4HYSA 1YOMA 2X6DA 4OBPA 3ZYAA 3TWJA 2X9EA 4LV5A 1RE8A 4BZDA 4G3FA 5I3RA 4EH8A 2WMTA 5DNRA 2PE0A 4XP3A 3D7ZA 4AQCA 5EDQA 4V01A 1R3CA 3V3VA 2OJ9A 2Y6OA 2WHBA 3LE6A 4BKZA 1ZMVA 3ZLYA 1UNGA 3UP2A 3P7BA 3U55A 5CEPA 5B7VA 3DTCA 2OJIA 1NVRA 2VTTA 4I6BA 4LV7A 3IOPA 4FL3A 5EI8A 2QKRA 3OBJA 3L8PA 4L67A 4RC2A 2RIOA 3P9JA 1FINA 3L8SA 1H1SA 1O6YA 3FKOA 3R9NA 3H0YA 4DH7A 3NFFB 3MJ1A 5DLSA 2FUMA 5ANOA 5EK7A 3VS7A 3ZUVA 4BHZA 3DAEA 4HGSA 2YDJA 4ID7A 4Z7GA 4YJSA 4D5KA 3RZFA 3LFFA 4QMTA 4ZAUA 5DGZA 3UDZA 4RVLA 2UW3A 3O7LD 5CQWA 4EWHA 1P4FA 4D0XA 4X2KA 2HAKA 1U54B 2V62A 4JDIA 4W4YA 3UZTA 2XNNA 1PXLA 2XJ1A 4HVIA 3EQCA 3PDTA 3F3UA 2O8YA 4DDIA 2WZJA 3ERKA 4GJ2A 4I0SA 1YW2A 4F0GA 3ATSA 4QMOA 4YC8A 2DUVA 5CY3A 1ZXEA 4FT9A 4H39A 5GJDA 4H58A 2QOHA 4TY1A 3RM6A 3JS2A 4F64A 1GOLA 4ZJVA 4EOIA 2Z7RA 2PWLA 2NO3A 4AZWA 2YHVA 1VLRA 3G9NA 3LCDA 4I6LA 3O50A 4O91A 5ETAA 2O5KA 4L8MA 3IDCA 3BIZA 3NLBA 3RZBA 2OFUA 4DTBA 4QT1A 1WBVA 4RC3A 4AGWA 3QFVA 3KRJA 1UU9A 4M8TA 1UKIA 4DFYA 3EQHA 3KF7A 2P55A 4O7VA 1VEBA 4U45A 4AAYA 2XK6A 2X81A 3HUCA 3ORIA 4BCKA 1ZYCA 2OW3A 3L9LA 4EBWA 2RFSA 5LMAA 4KIQA 5IQGA 3O2MA 5FM3A 5JFXA 4X2NA 2OIQA 4E1ZA 1QL6A 5A9UA 4UYAA 3V6SA 4B0GA 4C2WA 1RJBA 4S2ZA 5A4EA 1YDSE 3RALA 5FEQA 2UVXA 3FLZA 5CENA 4RT7A 3LFEA 2QNJA 2YIWA 1Q97A 3QRUA 4AT3A 4ZOGA 4QYYA 1TVOA 3BHTA 5IA0A 5E8YA 3R9RA 4NT4A 5K3YA 1H07A 4IZ7A 4LRKA 3VULA 3WE4A 1PXKA 2YM3A 3R71A 4KSQA 3VUIA 3OCBA 3O17A 3GEQA 3QX4A 4KIKA 4BWKA 3A7HA 4QMVA 4JAIA 4AZSA 5LVOA 3AC3A 3A4OX 2XK8A 2OLCA 3RMFA 2BR1A 3OEZA 4F7JA 2YCQA 2PY3A 2BCJA 4LFIA 1MQ4A 2OGVA 4FSRA 4TWPA 2CKEA 4G9CA 2CNVA 3SHEA 3NGAA 5CU2A 5FBNC 4ANBA 4UY9A 4O21A 2F2CB 4YJUA 3UMXA 2B9JA 1HOWA 4H3PA 3VC4A 3WYXA 3QL8A 4AS0A 4BCQA 4IDVA 4CRLA 4A9UA 4TYGA 5CAQA 4N6ZA 5CAPA 2JFMA 3A7JA 3COHA 4P4CA 4PL5A 4ZZNA 3FMJA 1BMKA 2YM5A 4F1MA 5IMXA 4ALVA 4WUNA 2B55A 2XVDA 3PWYA 3LFCA 3OS3A 3OWKA 3QUEA 1KE9A 4FK3A 3VNTA 4NL0A 3JYAA 4XJ0A 3PUPA 1PMVA 3QCYA 4BN1A 4BI0A 3M11A 2R3PA 4FTUA 4RIWB 3RHKA 2YFXA 3PTGA 3PXQA 2RL5A 1FGIA 4LV8A 3VS4A 4A07A 1MQBA 3KRRA 3CJFA 4EHZA 4EOOA 3NUSA 1QPEA 5A4CA 4C4FA 3H0ZA 3Q9ZA 3BLAA 3BYMA 4ZK5A 2OJFE 4FL2A 2W1HA 4IBMA 3G5DA 4GU6A 4D2PA 5FXSA 1I44A 3DK3A 3R01A 4U97A 4ZJJA 2BAKA 4YTIA 5JKGA 3FLYA 5IQIA 3A8WA 3DGKA 3OXTA 4RVMA 4E93A 5BVEA 3Q2MA 4NK9A 2ZM1A 2GHGA 2UZDA 2ZMCA 4OTFA 4I1ZA 3NVKI 4XHKB 4KIKB 3TTJA 4LGHA 1CTPE 1UWHA 3EQPA 3Q9XA 3VAPA 5AV4A 2YWPA 5KZIA 2PZYA 3CTHA 4X3FB 3TTIA 4Z16A 2A98A 4FZAB 2PVKA 3FDNA 5CF5A 2CGVA 5DA3A 5LCKA 5AP4A 3M42A 4UB7A 4GCJA 2PVFA 4RGJA 1YWVA 3R2BA 3MH1A 4IE9A 3H9OA 2BKZA 4O38A 2C68A 4BCMA 1W82A 4J97A 4LOPA 5CZIA 4QYEA 5AP6A 2X7OA 4MD8E 4QP7A 1U4DA 1BL7A 4YHTA 3IG7A 4GUBA 5CF4A 3ZRLA 4ACGA 2ZOQA 3R8VA 5AR7A 3MY5A 3MFTA 3VBVA 4IC7A 5HLWA 1P5EA 1BI7A 2W1ZA 3C7QA 2BUJA 3UDTA 5EKOA 4FKIA 3E7OA 3F6XA 3DJ7A 4O6LA 4RSSA 3KCKA 4HVDA 2WMQA 5AUTA 2G2IA 4OT5A 3NRMA 3KKVA 4JDJA 4BIEA 4FKGA 5HIEA 4TYHA 4UMQA 3VS2A 3I79A 3PWDA 4RIYB 3LW0A 2J90A 4ZTNA 4ASZA 1YI6A 3WF8A 3UC4A 4LRJA 1U5RA 4FV3A 3DKOA 3AKKA 4IEBA 3SRVA 3ZBFA 5CXZA 1OL1A 1WFCA 5AP2A 4NWMA 3BLRA 2JKKA 3E93A 1OKVA 4DTAA 3ZLXA 2AUHA 1JSTA 2J0IA 4O4BB 4BKYA 4PMPA 3ITZA 1ZMUA 4Y95A 5L2QA 3UJGA 4U41A 2FVDA 2GTNA 4D2SA 3AT4A 3FYJX 4YSJA 3BX5A 3R8LA 3CP9A 3W0PA 2LGCA 3KL8A 4OUCA 4OLIA 3BBTB 5ANDA 5IH5A 4AQKA 3W2OA 1OUKA 4YJTA 2UVZA 1YWRA 3GC8A 4K1BA 2F57A 2OF2A 4E8AA 4IH8A 4EH3A 4NH1A 3SV0A 1PRYA 4I5PA 2Z02A 2KULA 4KNBA 3DZQA 2P33A 3GI3A 3LQ8A 3LJ1A 3Q52A 4WUAA 3A2CA 3TJDA 3RWPA 4O81A 3B2TA 3EL7A 3ZC5A 5EW8A 4WIHA 1KE6A 3R00A 2JIVA 1IAHA 3DS6A 5HLPA 3QD3A 2J2IB 5CSXA 4FV8A 2J0KA 5CQUA 1WVYA 2VO7A 2WGJA 4L3PA 4AZVA 2XRWA 3THBA 4FOBA 4B7TA 3TUDA 4E26A 2RGPA 3OBGA 2JIUA 3ORKA 2OH4A 3OUKA 4AZTA 2C6KA 3MTFA 4J8NA 2W17A 4RFYA 3QZFA 1OPKA 3MTLA 3MA3A 4RFMA 4X21A 4AE9A 4IZYA 4IB1A 4KBCA 4NTTA 4DAWA 5I9YA 2BMCA 2OFVA 3SXFA 2XALA 4TN6A 3I60A 4TXCA 3MY1A 1Q4LA 3CD3A 3MVHA 3QHRA 1WAKA 4M68A 4M0ZA 2QG5A 2VX1A 4D2WA 4II5A 3PJ8A 2C5XA 3VJOA 4ZTMA 1H0WA 2IZSA 4HYIA 3OXIA 4ZP5A 3NPCA 4UEUA 3WZJA 3QQJA 1LR4A 3RWQA 4A7CA 3K3IA 3NCGA 4FKSA 2H9VA 3UYTA 4NYEA 2XCHA 3GCQA 1O9UA 2CDZA 4BTFA 3FQHA 3D15A 4K9YA 4YZ9A 4CFNA 2Y8OA 5HHWA 2PUUA 4N6YA 2XNBA 2UVYA 4EKKA 5CAUA 3U54A 1YHSA 3BBWA 2BRHA 3Q3BA 4RC4A 3LIJA 4R8QA 3K3JA 4YBJA 2BHHA 1OBDA 3PJ1A 3RVGA 5AUUA 4QPSA 3DDPA 4GIIA 2PVNA 3DV3A 4B8MA 2ETMA 3BHHA 3CR0A 3O8UA 5GZAA 3R2YA 2VTNA 3KMMA 4O2PA 3K2LA 1H1QA 5K0KA 4USFA 3HA6A 2UZBA 3HECA 3RK5A 3UVRA 3V01A 4AN9A 5BYYA 3I5NA 4YO6A 4BC6A 4AA4A 3R22A 1Y91A 3QBNA 3U4WA 1OM1A 2YLFA 3G6HA 3OWPA 1Y6BA 4WHZA 5FWKK 3PPZA 4AF3A 5BVFA 4Q5HA 5JGDA 4RFZA 1MRYA 4YC6A 5A46A 2ITTA 1H24A 3RPRA 3LHJA 2HCKA 1DAYA 2WFYA 4FVPA 5DG5A 4ENXA 3SD0A 5HX8A 4X7QA 2PULA 1Q8WA 3LFSA 4AU8A 3NUUA 4ANMA 4U3ZA 4RVKA 2R3OA 4FTMA 4AXAA 4NCTC 3H9FA 3C4CA 3ODYX 4UWCA 1FBNA 4RIXB 4UYNA 4HGTA 4YZNA 3VQUA 3OUNB 2B9FA 3CTQA 4S34A 5GIOE 2R9SA 3IS5A 4ZSLA 4L9IA 4FSTA 4O0UA 2REIA 4PMTA 4TWNA 4MF0A 3DXQA 3DT1A 3C0HA 3HKOA 3OVVA 4I22A 3OOMA 2BILB 4B8LA 4NFNA 3CKWA 2E9OA 3VW8A 2GQSA 3GU4A 3AGMA 3KREA 2C6MA 2XBJA 5HIBA 4ACCA 4FZFB 3W32A 3ZSHA 5EQYA 1AD5A 1HCLA 3GENA 3LQ3A 2V22A 4U44A 5DRDA 2XIYA 3PA3A 4P7EA 4QNAA 4YJRA 3C13A 5IDNA 4PDOA 2X2LA 2G1TA 4Z55A 2R4BA 2FYSA 3F2NA 4O0XA 1H0VA 5F9EA 4YBKA 4J98A 4G2FA 4DCEA 5LVNA 2JBPA 4BB4A 3RAHA 3NW6A 3REPA 2IZUA 3DKCA 3SW4A 4FL1A 3UIBA 2WQNA 2ZDUA 3KA0A 5AM7A 4BRXA 4CZUA 4FTLA 4H36A 3GFEA 5HD4A 3H9RA 3OOGA 2OG8A 3LVPA 3ROCA 4GUEA 4DBNA 3P7AA 3H30A 4V0GA 2WAJA 3ZXZA 2R0UA 2QOBA 3EZRA 2W1EA 4X3JA 4JX3A 5HESA 4OT6A 4AOJA 5F4NA 2A4LA 3D83A 2F4JA 3DY7A 3HDNA 1OIQA 4RJ5A 3RJCA 3D14A 2VTLA 3NNXA 2XM9A 4YJVA 3MB6A 5AFVA 3PSBA 4U6RA 5L2IA 2PTKA 2WTIA 3PA5A 4MF1A 4CFXA 2V5QA 4E7WA 4N0SA 4GVAA 1UNLA 5IEYA 4CT2A 4O7YA 2JC6A 2B4SB 4JG6A 3L1SA 5HNGA 3ZDUA 1REJA 3U9NA 2CGUA 3VUGA 3TT0A 2B53A 2R3RA 3FL4A 3GNIB 4ZLZA 4DFXE 4IADA 4W8DA 2RF9A 1G8SA 2JDRA 3QD0A 4F4PA 1IR3A 4IWPA 1OIYA 4YJPA 1PF8A 4PF4A 3T8OA 2YACA 1YI4A 2J7TA 3P08A 4F70A 4EUUA 4ORKA 1GIJA 3A61A 1WMKA 3GU8A 2A1AB 5E8TA 5HCXA 3VHEA 5KMNA 5AR3A 5BYZA 4G9RA 4L44A 1OL5A 2X6EA 3C51A 3QRIA 4I20A 4F65A 3CY3A 2XNEA 2R3HA 3F82A 3G90X 4NTSA 5CVGA 4L52A 3N4TA 2VTIA 4K77A 1XJDA 4FG7A 5EM6A 1PJKA 2XARA 5FXRA 1KWPA 3G33A 3QWKA 4KIOA 4FIJA 4FT3A 5DFPA 2QOOA 2BIKB 2W96B 3FY2A 1LEZA 3V8WA 3CXWA 5CSHA 5KKRB 4N70A 1S9IA 2IVTA 4HCUA 3Q5IA 4KWPA 5DVRA 4C4IA 1REKA 5LXMA 3TYKA 4B99A 4PNKA 2EWAA 5JRQA 1OGYA 2PUPA 2XJ0A 3PXZA 3UYSA 2OIBA 1R1WA 3NW7A 4O0WA 1H08A 4MXXA 4JXFA 2HY0A 4QTAA 2KTYA 5FBOA 4WOVA 1UKHA 3TN8A 4GK4A 5BVKA 4C7TA 4IAIA 3CTJA 4ANQA 2C5YA 2WTKC 4FV1A 4QMUA 5ANJA 4A4OA 4EOQA 3GCPA 3OZ6A 5IH4A 3UDSA 2EB2A 3ANRA 4PY1A 3PLSA 5DWRA 2C5OA 4TKSA 4E6DA 1CKJA 1PXNA 2A2AA 2PK9A 5FEDA 5JFSA 2VAGA 3ULZA 2NYAA 2BAJA 4FKPA 1SVGA 1VYWA 2W1GA 3ENHA 3TV7A 5JSMA 3FI3A 3FMLA 3QUDA 5E8WA 4PQNA 2OK1A 4CGAA 3D5XA 4O4CA 2XNMA 4IDTA 3HV6A 2IN6A 4IWQA 3ZEPA 4IM2A 5CU6A 4L00A 5I9UA 4DGNA 4FV7A 3R8UA 1Q41A 3OY1A 4O22A 3OWLA 4X2GA 2FSTX 4FTKA 5HG9A 3BGPA 4G31A 5T3QA 4NW6A 3LAUA 4A4XA 2AC5A 3FZSA 4TT7A 3BHYA 5BVWA 3IONA 4I3ZA 1JKKA 5HNIX 3OMVA 2EVAA 3BZ3A 2C3KA 1ZY5A 3BLHA 3QALE 4GYGA 3UZRA 5KCVA 2J0MB 1SZMA 4O4FA 5AV2A 4O7LA 4PL4A 3E8DA 3PPKA 5M44A 2I6LA 5HI2A 3F66A 3EL8A 2VRXA 4RA5A 5J5TA 1Q8UA 3F2AA 4IB3A 5ACBC 3ZFMA 3ALOA 3EFWA 3MFRA 1PXPA 4IVAA 5HD7A 4UXQA 3KN5A 1F0QA 3ZXTA 1OPLA 4QP6A 5K5XA 2ITQA 4XG6A 5CF6A 3HL7A 4ZLOA 4PDPA 3PP0A 4BZNA 3AD5A 5IUIA 2VUWA 3HVCA 4FNWA 2W0JA 4DITA 2VO0A 4RJ3A 4KSPA 3TACA 1E9HA 2IWIA 4KINA 4MXCA 4WA9A 3KB7A 3I6UA 3QQUA 4K11A 2ZV8A 3EKNA 3IW6A 4OTRA 2V0DA 4CKIA 2BDFA 4B6LA 1JWHA 3ZFXA 4AW5A 3E7VA 4BDJA 1KE8A 5JFVA 1OL6A 2XMYA 5IH6A 4D4VA 2ITXA 3O23A 1E1VA 4NCTA 2QOLA 4CD0A 3VBWA 5KBRA 2DWBA 4BCOA 2OXXA 4AACA 4CMTA 5EM8A 3TL8A 1LPUA 4RRVA 2J5EA 4Z3VA 1W83A 4M66A 4ZEGA 1T45A 4UWBA 2V55A 4Q2AA 3VF9A 4E4NA 4JL9A 2XNOA 3PFQA 5G6VA 5LARA 3TMOA 2RFNA 5AV3A 5CASA 1H1PA 4O86A 5M4FA 3E3PA 4L42A 3AC5A 3HRCA 4TNDA 3OWJA 4UV0A 3VBXA 3ZUUA 4ANOA 1BUHA 1ZZLA 4GV1A 4A9YA 5JEBA 4F9WA 3IGOA 2OKRA 5LWMA 5IQCA 2BRGA 4UWYA 4EQCA 4YC3A 1H01A 3LZBA 1ZRZA 2GQGA 2WMAA 1WBSA 4L53A 3D5WA 3KXZA 2Y4IC 4FTRA 2ZM3A 3ZC6A 1SVEA 4F63A 4J1RA 3PP1A 4L3LA 2JKOA 5AV0A 5C9CA 2HZ4A 3WYYA 4MX9A 2XCKA 3R30A 4D2VA 4AGDA 3Q4TA 2YCRA 3QCSA 3R8ZA 3CGOA 5J9YA 4RVTA 3FLNC 2HXLA 3C0IA 2VNWA 5IMEA 1YVJA 2HZIA 5AX9A 5BQ0A 2XK7A 3EZVA 3QLGA 3S4QA 2CHLA 2A0CX 1W2DA 3FBVA 1Z5MA 3S95A 3UOKA 4RJ8A 1YRPA 1ERKA 3QKMA 3R1QA 5J5SA 2IW9A 5DOSA 2GNIA 3HGKA 2C1BA 1W98A 3DOGA 3G2FA 2WKMA 3FEGA 2R3NA 3HUBA 1B39A 1WBWA 4QQJA 4RMZA 1OPJA 5FP6A 3PXYA 4AA5A 4CCUA 3UNKA 4MD7E 4FT5A 2Q0BA 2BHEA 4EEVA 4OTWA 2VV9A 4G3CA 4DFBA 1AQ1A 5AR5A 3WE8A 3FHRA 4L3JA 5T68A 3AMBA 3FXXA 3ZBXA 2WNTA 4IW0A 2F7XE 2PVYA 3QRKA 1TQIA 2XP2A 1W7HA 2I0EA 4DG0E 3FPMA 4KUJA 2JFLA 5ACKA 4IVDA 3K54A 4WRSA 3II5A 3OP5A 4FC0A 5E8UA 5FD2A 5GNKA 2WMUA 3BYVA 3QTZA 2C3JA 3DBCA 4JNWA 4ZTHA 2IG7A 3Q6WA 2C69A 3N4VA 1R0PA 2ZJWA 3KULB 5JZJA 4FKQA 3NYXA 4O1OA 4BI2A 4I21A 2ETKA 4EOLA 3MW1A 3PA4A 2R7BA 2OF4A 3GP0A 3E8CA 4EOKA 4C58A 5F95A 4U81A 3EN9A 4FSMA 1XMLA 3LFDA 1OKYA 2J4ZA 2PZPA 3JPVA 4ZXTA 5A4TA 4CQEA 3ORZA 4Y8DA 3RPOA 4C36A 3VJNA 1GNGA 4CLJA 4DEEA 1PYXA 2XNGA 2R7IA 5A14A 3Q4UA 3HRBA 4YZMA 5GIPE 4DHZA 4APPA 2PVMA 2YDIA 5EM5A 4D1XA 2ZM4A 3P1AA 4JLCA 4DT9A 4BGGA 2WQEA 4F9YA 2Q0NA 2HY81 5JK3A 2IZTA 5J9LA 4BBEA 4I23A 4IX3A 4BCPA 4QMXA 4GEOA 3BE2A 5ETFA 5I3OA 4I6QA 4R3PA 3BGQA 2WTKB 3QYZA 4FG9A