4BRXA

Focal adhesion kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
259
Chain Sequence
RDYEIQRERIELGRIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYMLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Synthesis of Novel Diarylamino-1,3,5-Triazine Derivatives as Fak Inhibitors with Anti-Angiogenic Activity.
pubmed doi rcsb
source organism Gallus gallus
total genus 81
structure length 259
sequence length 272
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4brxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4brxA01
4FV2A 3UNKA 5AIRA 3AT3A 4PP7A 3C5UA 1B6CB 1YDSE 2XRUA 3CGFA 2R4BA 1SM2A 4AT5A 4BDJA 2FO0A 4WNKA 2BPMA 5JGAA 4CTBA 1TQPA 2B52A 2RKUA 4MD9E 5C8NA 2R3JA 2X8DA 2CDZA 3VAPA 5DT3A 4FKVA 5L8JA 4G3FA 2Q0NA 3NUXA 1YHWA 3W2SA 3WF9A 4BGHA 5CASA 4FTNA 4RLKA 4DH3A 4I5PA 4KIPA 2E9OA 5EDQA 3VS6A 4CFXA 5A4LA 3VS1A 4ALWA 2QKRA 4DT8A 2C68A 3PVWA 4K77A 1G5SA 3WYYA 3P0MA 3R8PA 4G6OA 3ZDUA 3CXWA 3QXOA 5CSXA 3TCPA 5KUPA 3TM0A 2R3IA 3UG2A 4ANMA 2H34A 3U4UA 2X2LA 5D9HA 5AUXA 2JKKA 5E8XA 3LJ0A 3VS0A 2F2UA 3O0GA 1TQMA 2Z7LA 3HV3A 3TZMA 4D0WA 3P7BA 3QRTA 1OKVA 2OIBA 2WIHA 3CQWA 4FEQA 5CEMA 2PE1A 3U6HA 1PXJA 4UXLA 3LE6A 2PPQA 3ZC5A 2HZIA 4M97A 3L8PA 5L2QA 3KRRA 2UZEA 3O50A 2Y4IB 4RX9A 5ANEA 5HO8A 1BLXA 3SOAA 4CV8A 4D4SA 1Y57A 3QXPA 3F3UA 3V5WA 3DB6A 2XRWA 5AR2A 4BKZA 3TN8A 3QRUA 4BWKA 4EOQA 2X7FA 4IB0A 2C4GA 5M4FA 4HOKA 2ZB0A 3I0OA 4B4LA 2ITNA 5L6OA 3DY7A 4RX5A 2B1PA 1YDTE 4JBQA 4OBQA 4DFUA 4JJRA 4ACCA 3E8DA 3BV2A 3D7ZA 4W8EA 5D12A 4O21A 4EH3A 3N4VA 4J1RA 1YXXA 3BLHA 2XCKA 5KMOA 3NMUF 4GFGA 2ZM3A 3GGFA 3UIBA 2CCHA 2BMCA 5IUGA 1LPUA 5FXQA 4EEVA 3TZ9A 1FMKA 2QVSE 2ZYBA 3K2LA 1HOWA 4J96A 4XX9A 1CTPE 4YJSA 4A9SA 5J5SA 2FSMX 3FI3A 5DYJA 4U40A 4WRSA 2EUFB 3ZRLA 4YC6A 3SAYA 4FKJA 2OGVA 3BQRA 3PXZA 4EONA 1XBAA 2QOIA 3EQRA 3PG3A 2HZ4A 4O96A 4J99A 2R3PA 3R71A 5CTPA 3UJGA 3OC1A 4ANQA 2X2KA 2ZMDA 4M69A 2YIRA 4QTCA 1Z57A 4BCMA 3VWAA 2J4ZA 1ZYSA 4WT6A 1KOAA 2BZIB 4FV4A 1UNLA 1P5EA 3DB8A 2WOUA 4ZTNA 5KZIA 3U9NA 3V5TA 4C0TA 3QF9A 5LMKC 2VRXA 3AGLA 3MWUA 4HYIA 3FI4A 2VU3A 2W1CA 1ERKA 1R78A 2XH5A 3KC3A 2YHVA 4KIKB 4NFNA 4QMOA 3SG8A 4ASXA 3R8LA 5AX9A 2WTKC 2JFMA 3BYOA 4PMMA 4QMUA 4WA9A 5AR5A 1CSNA 3K3IA 5EI2A 5D1JA 5M53A 3FZOA 3BCEA 3UC3A 3Q6UA 5AWMA 5DOSA 3UPZA 4BTKA 4Q5EA 4FIGA 3UQFA 5BYLA 4TWOA 2CN5A 3KQ7A 4Y5QA 1ZAOA 2HENA 3D15A 2R3KA 3DDQA 4GK4A 4KRDA 5LWMA 3MVMA 4ORKA 3ORKA 4UZDA 4IWQA 4BZNA 1Q61A 4AGCA 3Q2MA 4D2VA 3HV6A 4FVQA 1R0PA 4TY1A 4GL9A 4F9WA 5I9XA 4CG9A 3LFNA 2UVZA 2W1EA 2YCSA 3VIDA 2RGPA 4TKSA 5FP5A 3WYXA 2OF4A 2VTPA 3P5KA 4IC7A 3WI6A 1Z9XA 3WF7A 3FHIA 1OKWA 3POOA 5EH0A 5JMSA 4S34A 5FP6A 3NUUA 1YXTA 3EN6A 3P1AA 4I94A 2LAVA 4HVGA 3R8ZA 3QCSA 1GZ8A 3GT8A 4W8DA 1XHAA 2HAKA 5HI2A 4AS0A 4EKLA 3L9PA 3OW4A 4YJOA 4EL9A 4G3CA 3GP0A 3R04A 2X6EA 4DG2E 4MK0A 4L9IA 5IA3A 4MWHA 3TTIA 1RE8A 5CVFA 4B8MA 2BIYA 5CF8A 5E92A 1ZLTA 3ORPA 4U43A 4R1VA 2DS1A 3BEAA 3RM7A 3RCDA 3PIXA 4YGAA 4YLJA 3TNWA 3HEGA 1F3MC 2VTJA 5E90A 1P4FA 5FM2A 3H10A 3HRFA 3MFSA 2Y0AA 4N6YA 4XLIA 1I44A 3AD5A 5D7AA 3ROYA 2YEXA 4CRSA 4X6RA 3R8MA 3TNQB 4D9UA 5HVKA 1A06A 5BX0A 3EQPA 3R1NA 3F2NA 1Q3DA 3OBJA 2VNWA 4L01A 4WD5A 5AUUA 4AW0A 2E9VA 3I7BA 4FZDB 4S31A 2FYSA 4I1ZA 4PPAA 3W55A 5FTGA 2PZPA 3L9NA 4YNOA 4ZOGA 5CEKA 4DTAA 5IH6A 2H9VA 3QLGA 3LQ8A 3QTQA 2BRNA 4FV0A 4UMRA 2BDWA 3AGMA 5HBHA 4BBEA 5J7HA 2HZ0A 2ZV2A 1UU3A 4AFEA 5BVKA 4EHEA 2UW0A 3FC1X 4MCVA 5EM7A 5ICPA 2DQ7X 4ZTSA 2O64A 3IS5A 3KXMA 4ZLZA 5ITAA 2VV9A 2XKEA 3I7CA 3IW7A 4I0SA 4UWCA 5LVLA 4XYFA 1YRPA 1H27A 4O0UA 5EHOA 3I0QA 3ZONA 1V1KA 2VWWA 3WF5A 4D5KA 3ATTA 2C0IA 2C6DA 4G16A 3IDCA 5JQ5A 2GFSA 2XKFA 3GC7A 5EI6A 4WBBB 1RW8A 3D7TB 3MW1A 1O6KA 2F2CB 1V0OA 3MPTA 5IZFA 4EZ3A 5EQPA 1H00A 5IA1A 3DBFA 2VTAA 2VWUA 3MBLA 4UMQA 3ZEPA 3IQ7A 1J7UA 2C1AA 4TRLA 4USEA 1QPJA 3DLSA 2B9HA 3LXNA 5JQ8A 3NW5A 4FTLA 2ACXA 2BRGA 2G2IA 3HV4A 3KXHA 4RVTA 1WVXA 4CD0A 5M4UA 5CLPA 5CSVA 4G6NA 4AT4A 3G33A 4QMZA 2C0OA 1NVSA 2GQGA 4KIQA 4FKUA 4EKKA 1L3RE 3F3VA 1YQJA 1OKZA 5HTCA 5JN2A 5HD7A 3FQSA 3CBLA 4LM5A 4BKYA 3N51A 3WF8A 5CU3A 1P14A 3BV3A 4YZMA 3D5XA 3FXXA 4YURA 5K5XA 4XP2A 4O84A 3E5AA 4FZAB 4AX8A 4XG9A 2C5OA 2PUUA 4XS2A 4EQCA 3IONA 3ZLXA 4NZWB 3NPCA 3OEFX 5AP6A 2ZDUA 3W2QA 4WUAA 5LVOA 3O23A 4QTEA 3KKVA 5IUIA 3TKUA 3BLRA 1SZMA 5GNKA 5I5ZA 4J95A 4QP4A 3WOWA 2REIA 5K0KA 4NL0A 1YOMA 4RZVA 3D14A 4FEUA 4DFLA 4AT3A 5HE1A 4WNMA 3U4WA 3CKXA 3DCVA 4QNYA 3ZH8A 2IO6A 3H30A 3MY1A 2R3QA 5HG5A 2WQBA 4OR5A 2VWYA 3PVBA 3RPOA 3NYOA 2WQNA 2PVLA 3IK3A 2F4JA 2OBJA 4EOIA 5B7VA 2WIPA 3NCGA 1QPCA 3KCKA 4KIKA 2VX1A 3UVQA 2RFEA 4ZP5A 4QTAA 4L3LA 1YDRE 3ET7A 3UQGA 3HP2A 3VS3A 1BI7A 4EH4A 5CEQA 5IKWA 4BCIA 3E8NA 4BKJA 4EQUA 5KHXA 1Y91A 1OECA 4JDHA 4O7VA 2W1IA 4RIYB 2Q83A 3EKNA 3ZFYA 2Z8CA 2UUEA 1XH8A 2X4FA 1YXSA 3BE2A 5A3XA 3VUIA 4RFYA 5EKNA 5GHVA 4RWKA 1Q62A 3PTGA 3QQLA 5CANA 4MAOA 1OPJA 3FLZA 4R78A 1ZOEA 2QNJA 4IB3A 3PY0A 3AC8A 3MJ1A 5I0BA 2R7BA 4X6QC 3PVGA 4DEDA 4TNDA 1OIYA 4PTCA 4PPBA 5M51A 4APCA 1JKTA 3JUHA 5D41A 4DH8A 5JH6A 2ZJWA 2OIQA 3U8WA 1PJKA 2OU7A 4R3CA 2YIXA 4RG0A 4WHZA 4EORA 2YWVA 5CAQA 2W17A 4D2PA 1K3AA 4IX4A 4L7FA 1PXKA 3HX4A 4WUNA 5AV2A 3DAEA 4IE9A 3VULA 4FK3A 3W33A 3GEQA 4GYIA 3BX5A 4LRJA 4YTCA 4Q5HA 4AGDA 5CSWA 3ZBXA 4QQTA 4WSYA 5AUVA 3CP9A 2O65A 4UMTA 4AW2A 2UVYA 3PSDA 2XUUA 3BBTB 3FZRA 5T68A 3MY0A 2FA2A 3MFTA 4IDTA 5HCXA 3E3BX 4EWQA 3P86A 5ACBC 3VNTA 2OW3A 4E4LA 5HVJA 4DFYA 4NK9A 3LCKA 4JG8A 3RPRA 4PL5A 4YTHA 3UZRA 1FBNA 2UW5A 3ENMA 3N9XA 5B0XA 5BNJA 4DH7A 2GQRA 2GHMA 2X9EA 2BZJA 4IVBA 5D7VA 4FYOA 3DBEA 4YJNA 5AAGA 3ZYAA 3FMLA 2JBOA 2IVSA 4FV6A 3PVUA 1J91A 5I9UA 3CSVA 4O7YA 4WRGA 3QTZA 2QONA 4WKQA 4IEBA 3HMPA 5AM6A 2E9NA 4GSBA 4TYJA 3TXOA 2RFSA 3MVLA 3WBLA 2PVRA 3QUEA 4NW5A 2GHLA 3EN4A 5J87A 5AM7A 4BIEA 4I22A 1M2QA 2YN8A 4W4VA 4QOXA 4ZZMA 4CV9A 3ALOA 5JZNA 2W05A 4I6BA 4F0GA 2XM9A 3S00A 4EH2A 5IQFA 2VX3A 3I79A 3QKKA 2BUJA 5IU2A 3KRJA 3NEWA 4FTOA 4FC0A 2W9ZB 5M09A 3NNVA 3IGOA 2C69A 4LGGA 5EM5A 3G0FA 5HE0A 3ZZEA 4AZSA 1YHVA 4BCQA 5J1VA 2IZRA 3NGAA 4FODA 4O0XA 3C5IA 2F7XE 3DNDA 5AP5A 3MESA 2JIIA 3NLBA 4IM0A 2EWAA 4ALUA 3RHKA 1UWJA 4BCHA 3FLYA 3D7TA 5HVYA 4BYJA 3R7GA 3IW4A 3VHEA 1VZOA 1OM1A 5DEYA 5CT0A 3JXWA 3ZO4A 1GAGA 2P4IA 4TPTA 3R01A 3HMNA 5BUEA 2XNEA 3R1QA 3RNIA 5EHLA 3FXWA 2YERA 5M07A 4ZAUA 5DR2A 2EXMA 4QMTA 1REJA 2QHMA 2WO6A 2XM8A 3E87A 3LHJA 5CZHA 4GV1A 2QURA 5H2UA 1CMKE 2P2HA 4KBKA 4JDJA 1F0QA 3QTWA 3ALNA 5AAFA 3F88A 2X81A 3BELA 4FKPA 1RQQA 1GZNA 3E7VA 2HXQA 4X2NA 4W4YA 2W1ZA 4IADA 4XHKB 5J1WA 4KD1A 4RX8A 3E62A 4IX3A 2VNYA 1RDQE 3Q5IA 1KV2A 5HESA 3ZUTA 4DF3A 5IQIA 3E93A 3PRFA 3GVUA 2PUIA 4FTRA 4HGLA 3BE9A 2BHHA 4U80A 3PA5A 2WU6A 3KL8A 2JGZA 4CFVA 4DINA 3WZKA 1ZRZA 1OPLA 2UW4A 3GCSA 4EWHA 3KK8A 3PZEA 2C47A 2RF9A 3G9LX 3NUAA 4IX6A 4PQNA 3R9HA 3C4XA 3QRKA 3EJ1A 2GSFA 3TDWA 4N4SA 3KY2A 3AT4A 2Q0BA 3FKNA 4ERWA 4H3QA 4JL9A 3MB7A 4BCFA 2VTRA 4RVKA 4GYGA 4E7WA 2W0JA 1ZMWA 3SKCA 3AC1A 2QU6A 2YAKA 3G90X 3RINA 3LCOA 3I60A 5HE2A 4HZSA 5ANJA 4II5A 3KN6A 4I0RA 5EYMA 2I1MA 2I0YA 3UTOA 4D4VA 5JFSA 2JDVA 1J7LA 3EQBA 2PVJA 3EYHA 5LOHA 4JX3A 2ZM1A 4ONAA 4M66A 1H01A 4RIYA 5AAEA 3QZIA 4Z7HA 4BVUA 2OWBA 2BR1A 5TF9A 3HV7A 4FI1A 2IG7A 5ETAA 4FT7A 1VR2A 1OIQA 2QG7A 5IISA 5AP2A 4AP7A 3GU7A 3NWWA 5DRBA 3SX9A 2BHEA 4FV1A 4NKSA 4A9RA 2WMTA 3UE4A 3L8VA 2HCKA 4XV1A 3ID6C 2UW7A 5ACKA 4PP9A 4DGNA 2R7IA 1G8AA 3C4EA 1MRVA 5AV4A 3R9NA 3DNEA 2GNLA 3POZA 4BCOA 3KEXA 4FV3A 2R64A 5EDRA 3EFKA 5HTBA 2RG6A 4ZLYA 1O9UA 1VYZA 2UZDA 2BFXA 3FMNA 4B99A 5J79A 3OUNB 4U79A 4EOPA 5HO7A 2OLCA 1JOWB 3C13A 3QD3A 3VS2A 5IQGA 2ZDTA 3MSSA 2J0LA 2UV2A 4D2WA 2WPAA 3UMWA 3LLAA 4OTWA 4AA4A 4YZBA 2JBPA 2AYPA 3S4QA 2GFCA 1JSVA 3VW8A 2W1HA 3GI3A 4D55A 3GU4A 1WAKA 4EH5A 4FIJA 5LCKA 3RAWA 1YI3A 2GNHA 2NRUA 3FJQE 3HDMA 3RVGA 5I9VA 4N57A 1JAMA 3QRJA 4DH5A 5G1XA 5ANIA 3FY0A 5C8MA 1R3CA 4IDVA 1M14A 3EQCA 2I0EA 1YOLA 3AMAA 4PDOA 4DHFA 5IDPA 3QCXA 4GT3A 4BR3A 3C1XA 3OFMA 5J7BA 2UW8A 5KE0A 3HMIA 4YR8A 4I5HA 2WMVA 5D11A 3GC8A 4FOBA 5C8KA 1B39A 4M84A 3NYXA 1WVYA 5BMSA 5DRDA 3ZM4A 3HNGA 4CFMA 4RFZA 4YJUA 1R0EA 5ETCA 3MTFA 4UZHA 4IH8A 3FI8A 1IR3A 4DEHA 4YC8A 4EH9A 3PXFA 1JKLA 2PVMA 3T9TA 5CF5A 1XH9A 3QX4A 5LVMA 4GW8A 3DQWA 3D5UA 3PA3A 5CXHA 4ITHA 3NW7A 5AP0A 3KVXA 4ITJA 1H1SA 5KKRB 2YJSA 1W0XC 1W83A 4FT5A 3G5DA 4I92A 4U3YA 4MXYA 2R3MA 4QP3A 4AFJA 2PVKA 2J2IB 3W2CA 4R3PA 3I4BA 3FE3A 5L6PA 2PTKA 4ZSGA 3MGYA 2CSNA 2IVTA 5FGKA 2GPHA 1M52A 4IIRA 2BRMA 5FUTA 3OTVA 3HMOA 3MN3A 2W9FB 2ZMCA 3RKBA 3WIKA 4MXZA 2PVFA 4JAJA 3R9RA 2FSTX 4HZRA 3PIZA 4XOZA 4ZY5A 4AZWA 4RMZA 2RSVA 2BVAA 1PXPA 4X2FA 2VO6A 3ZZWA 3BHVA 2XS0A 1PXIA 5E7RA 5H8BA 5TOZA 5LARA 3SOCA 5EG3A 4ZTLA 3Q04A 2GNIA 4CSVA 4ACMA 4C4EA 1R39A 2WMRA 3EB0A 4D2SA 2PZIA 1OGUA 2NRYA 1U4DA 3F2AA 3KRWA 4R8QA 4X3FB 5DPVA 4DEAA 5JGDA 5HG8A 4NM5A 2CKQA 3QQGA 5DLSA 4FIFA 4XG3A 2VTNA 4O91A 4CFFA 2XK6A 2OZOA 2ZV9A 3DK7A 4J97A 3LFQA 1H0WA 4FNYA 4KINA 5TT7A 3RWQA 4CFUA 3ZFXA 3VBYA 5DEWA 3U87A 5HHWA 1H28A 2W5HA 3GFEA 3PJ1A 2XIKA 4PMSA 2P33A 2XNMA 4FV5A 5ANGA 3U9CA 1MQ4A 1GOLA 5E8ZA 4BHZA 2J5FA 4JS8A 2J0IA 4DEBA 3WZUA 3QA0A 4QP6A 4FIIA 3MH3A 4NFMA 3A7JA 4RJ4A 3SGCA 3GBZA 1AQ1A 4HCUA 1ZYCA 3ITZA 3BGQA 4XEYA 3FQHA 5DH3A 3DLZA 1CM8A 2XA4A 2XIRA 3W18A 4A4LA 3QLFA 5AX3A 1OUKA 3FSFA 3NW6A 4QPAA 3I6UA 4BDDA 4BDHA 2CKEA 2BAJA 2ONLC 4FSNA 2XMYA 3LAUA 4O1PA 4GS6A 4H36A 5EYKA 3I6WA 4DBXA 2BTSA 4E93A 4QP9A 5HCYA 3FZSA 5F95A 3F61A 4RFMA 1PMVA 5ANDA 3UMXA 1ZOHA 1NA7A 4C61A 4LYNA 4HPTE 4JBVA 4ANNA 4TT7A 3T3VA 4CQGA 5KMMA 5I4NA 2GHGA 4QMYA 5HO6A 3H9RA 4O6LA 4TYHA 1Q3WA 2OH4A 1Y8GA 3ELJA 4XRJA 2VO0A 2XCHA 2XEZA 3EFWA 4TYIA 3Q4CA 5AMNA 3SDJA 4DEGA 2PK9A 2WXVA 4FA2A 1YVJA 2JKMA 2JKQA 3BKBA 2ITQA 2IJMA 3SVVA 3ANQA 5FWKK 3RM6A 4DCAA 2FH9A 4FUXA 3VRZA 4PMPA 4BF2A 3UZTA 3GFWA 4IAKA 3LCDA 4I20A 4S33A 4X21A 4C4HA 1QCFA 3B8RA 5HBJA 1WBWA 1KWPA 4AXAA 5HLPA 4TWNA 3OF0A 4RIWB 5FEQA 1M17A 3R00A 4DGMA 4GK2A 1OIUA 5LCJA 1GY3A 3V01A 4NEUA 4FKGA 2UVXA 3PYYA 2Z2WA 4U42A 3LVPA 5EM8A 4EHGA 2C5VA 2X4ZA 2XEYA 3O17A 4ASDA 3RMFA 2BRBA 3OY1A 4F6SA 5IEVA 3K5UA 5H8EA 4UXQA 3H0ZA 4V04A 4H39A 2YIQA 4C7TA 4DH1A 4CG8A 3UPXA 3QD4A 1JSUA 4EI4A 3QBNA 4S30A 4ZSEA 5FXRA 5I9ZA 4OTDA 4K11A 4IWPA 4EJ7A 2YZLA 2G2HA 2UW3A 3DBCA 1QPEA 2OG8A 3GB2A 4TYGA 2VTIA 2WTVA 4R5YA 3AG9A 3DT1A 3M2WA 4KS7A 4ZSLA 5EOBA 4BGGA 4DTBA 2VN9A 4TXCA 1H24A 3LFFA 4ANLA 4YSJA 2BDJA 4AW1A 4FSQA 4I0TA 2R3GA 4M12A 3PLAE 3VVHA 3AC5A 1DI9A 3DZQA 4I6QA 4ZTRA 3R8VA 4FIHA 1G3NA 2YDKA 4NIFB 3QQKA 2HYYA 3TNIA 4FUYA 4FTQA 4ARKA 1NVQA 4AN9A 4NKAA 4GT4A 2BZKB 3K5VA 1YXVA 4EBWA 2W96B 4FKLA 3SW4A 4F6UA 5J9ZA 1BMKA 3L8SA 2WNTA 4NU1A 2JKOA 4RIXA 2ZOQA 4O7RA 3EN9A 4I41A 4OTGA 1PRYA 4OTHA 3MTLA 4RJ3A 2BAKA 4XV2A 2A19B 3RP9A 2OXXA 3V8TA 1JBPE 2XVDA 2PZYA 3WILA 4C2WA 5IG1A 1BL7A 2Y4IC 1Q5KA 2G01A 2XNGA 2YABA 4AOIA 2B54A 2C6EA 2CNQA 4R3RA 4O27B 3R30A 2IZUA 3MA6A 2CLQA 3HKOA 3JS2A 4JBOA 4YBJA 4BGQA 1FGKA 2WTDA 3TV7A 3F3WA 3E92A 3PG1A 4JT3A 2GCDA 3DFAA 4HYSA 4A4OA 4EUUA 3R9OA 4ZSAA 4FSTA 4IXPA 4UALA 5AR7A 4FYNA 5E8UA 3JVRA 1DS5A 2JDRA 4AG8A 1X8BA 4AWIA 4BDKA 2BZHB 3LFDA 5M4IA 3EQHA 3NUSA 4NM0A 4C35A 3EN7A 4RWJA 3MPAA 2HWPA 3O71A 4IM2A 4U3ZA 2WQOA 2J51A 4KSPA 3LXKA 4C4GA 1TKIA 3MFRA 4DBNA 4EH7A 4KKGA 4I5MA 3TWJA 1P2AA 1XR1A 3ZSHA 3R2BA 5HNBA 1IEPA 1PHKA 5IA4A 2WELA 2B9JA 3Q6WA 4GU6A 5LMBA 4EJNA 3ZO3A 2YDIA 2GS7A 3PRIA 4FKIA 4PY1A 3ZO1A 4R77A 4X3FA 2ONLA 3KA0A 4E4MA 3F5UA 1IAJA 3PLSA 1MUOA 3G6HA 4BWPA 3F2RA 4IM3A 4YHJA 2WQEA 1V0PA 4UMUA 4FKSA 3MH1A 4FVPA 5JRQA 1APME 3LOKA 3LFAA 2C3JA 5HNGA 1MRYA 4FTMA 5LMAA 3HUCA 1HCLA 3P23A 4O86A 3ROCA 2WU7A 2PL0A 2YM4A 3OROA 2W1GA 3OW3A 4MXOA 3RTPA 5HNIX 3FMDA 5IMEA 1IAHA 3COIA 1WBNA 2C6MA 3EL8A 3TIYA 3RPVA 1SVEA 2YM8A 4FT9A 3PJ8A 2J7TA 4C33A 4F7SA 4QP7A 4C58A 3SA0A 3CLYA 5GZ8A 5ETIA 5ANKA 5AV1A 2BKZA 4X2GA 3DKFA 3CJFA 4R1YA 3TI1A 3PA4A 4WG5A 3SXRA 4TW9A 3M1SA 4O0VA 1UWHA 2OXDA 3Q9WA 4BDGA 5FXSA 5M06A 2ITPA 5FDXA 4YTFA 3OZ6A 3QKLA 3C0IA 4E6QA 2BAQA 4YLKA 4S32A 1H1QA 2PY3A 2ITZA 1GZKA 3W1FA 3A61A 4GMYA 3SQQA 3HL7A 3TJDA 4ITIA 1M7QA 4E4NA 3QYZA 3OP5A 1Q8ZA 2XNNA 4JQ8A 2Y6MA 4D1XA 4A4XA 3UO5A 1BI8A 4XG4A 4D0XA 4KUJA 4PUZA 4ZZNA 4J8MA 4L45A 4KBAA 4F7JA 2YAAA 3PXQA 4MBIA 4Y83A 3F6XA 3TNHA 3PP1A 4XBRA 3IW5A 2JITA 4KA3A 5AUWA 1ZARA 5A4TA 3CR0A 5A46A 2HXLA 1BUHA 4GCJA 1UV5A 2UZVA 3PXKA 4C3RA 4QP1A 2XP2A 4HW7A 3CTHA 1Q8WA 3BYSA 4H3PA 4GUBA 2YM7A 2B0QA 4P90A 4Y73A 4E20A 2WMQA 3DFCB 5HG9A 4E6AA 1CDKA 2CKPA 2YISA 2JEDA 3E8EA 3HV5A 4RIWA 5EK7A 4Z9LA 5HE3A 5CENA 3SXSA 3F7ZA 3V5QA 4EHZA 1YI4A 2IW6A 1LEWA 3A62A 3NUPA 4Y8DA 2OXYA 3S2PA 5KMNA 4QNAA 4H3BA 4O7ZA 4XLVA 3NNWA 4C38A 3ACKA 2VTMA 2VWZA 4KB8A 2V62A 3G0EA 3OCGA 3R63A 5HLNA 2YM6A 3E3PA 2FSOX 3UGCA 2PMOX 3DGKA 4E6CA 3ODYX 3KULB 5A14A 5GJDA 2OJGA 4DA5A 2G2FA 3VS7A 3NNUA 5DG5A 4H1MA 5HIEA 3EQGA 4I24A 4TWCA 3CPBA 3CTJA 4EC8A 4BCGA 3FBVA 2C30A 3KFAA 3GCPA 4NCTA 3Q53A 4MQ1A 3RGFA 2XK7A 3EL7A 3CQUA 2GQSA 4Y46A 1PMNA 2BRHA 4ZS4A 3BU6A 4ACGA 4FSMA 4NIFA 4W4XA 4IJPA 2QC6A 4QMXA 5EW8A 3T3UA 2I40A 3KU2A 3QZHA 5IQEA 1YKRA 5HX8A 3QKMA 2QLUA 3DPKA 4QMPA 4YP8A 5JGBA 1E9HA 4HGEA 1YW2A 4NYEA 2C5XA 4LG4A 4UN0C 1TQIA 2XKCA 4AACA 3VHKA 4PTGA 3VUTA 4S2ZA 3HA6A 3GQLA 1GIIA 4DN5A 1SVHA 3ORXA 4UYAA 3KCFA 1REKA 3BI6A 4PX6A 5DWRA 4MF1A 4QMMA 4TL0A 5F9EA 4FKQA 1E1VA 4XG8A 1JQHA 4GJ2A 1OL1A 3IW6A 3UOLA 3A4PA 1MQBA 1S9JA 5AIKA 1PKGA 4FSYA 2XNPA 2RFDA 2O3PA 4MBJA 4YJTA 5IQBA 4K9YA 4I3ZA 3BWFA 4GKIA 2W1FA 3LLTA 3W16A 4ZK5A 2Y8OA 2PHKA 3ORZA 1PXMA 4CZTA 5BVOA 2EXEA 3HUBA 4DITA 2F9GA 3VBXA 4LOQA 1FPUA 4BCJA 4UYNA 2IW9A 3RNYA 1OL6A 3LCSA 3LZBA 5BVFA 3H3CA 3ACJA 4YLLA 5DR9A 5HIBA 4C3PA 2Y7JA 4YZDA 1WBSA 2IW8A 4C2VA 4L67A 5KNJA 4G3GA 2CMWA 4G1WA 3CY2A 5BYZA 4KRCA 4BZOA 3QTSA 2OICA 2QHNA 3VUKA 4RQVA 4CCBA 3RZFA 4P2KA 1U5QA 2ITOA 2OFUA 3KRXA 1KV1A 4FF8A 3COHA 5CU4A 4A9YA 1LEZA 4FSUA 1SNXA 2W4OA 5ANOA 1ZYLA 3FL5A 3RZBA 2CHLA 4UV0A 4BDCA 4D4YA 2BDFA 3W8LA 5FTOA 1YWVA 5E1SA 3IDPA 3NIEA 5KMJA 3LFSA 1JSTA 2JC6A 2BCJA 4N0SA 2Z02A 4O7TA 3NNXA 4UEUA 4AZFA 3K54A 1WBOA 2WEVA 4ID7A 4V0GB 3NZ0A 4FG8A 4YJVA 2XF0A 4RGJA 5AP1A 4EYJA 3GOKA 1K9AA 1OKYA 2YDJA 4P5ZA 5J8IA 4OTPA 2WMBA 2Y9QA 4FG7A 4FT0A 2C1BA 3KRLA 2XJ0A 3R1SA 4CMUA 4BICA 3SV0A 4HYHA 4GEOA 2G9XA 2F7EE 2R3LA 4TNBA 4QMLA 4BBFA 1R1WA 2GNFA 2OSCA 3G6GA 3OD6X 4GH2A 4FG9A 5G6VA 4BFMA 4L68A 4LMUA 5KX8A 3DKOA 3EN5A 4GVJA 4MWIA 2YCFA 3Q2JA 3PFQA 2PZRA 2X0GA 5L2SA 3OWJA 4CTCA 5CQWA 2F7ZE 3I81A 2XBAA 1FQ1B 2QR8A 3AT2A 3HVCA 4UWBA 4MNEB 4E5BA 4KKEA 4QPMA 2VWVA 4FV9A 4Y72A 1XH4A 5B2KA 2NNWB 4FICA 1A48A 1Q8UA 3C4ZA 3NAXA 4FX3A 4GT5A 2I0VA 2QOBA 4NM7A 3FLQA 4B8LA 4RLLA 2ITTA 5AADA 1XH7A 1ZMVA 2PU8A 4X3JA 2J5EA 4MBLA 4CKIA 4HJOA 5CF4A 5EM6A 3RALA 4CRLA 4MVFA 2W5BA 2B7AA 3RPYA 5LVPA 4B6LA 4F1MA 3OVVA 5M57A 2G15A 1Q97A 4LI5A 1YI6A 4YU2A 4JNWA 2ZM4A 5HBEA 2ERKA 4FNXA 5CU0A 5FQDC 3GU6A 1T46A 5DHJA 4O0RA 2QR7A 5JFXA 2C0TA 2VO3A 3DTCA 4FGBA 1FVRA 3PZHA 4JRNA 3QQJA 4QT1A 4U8ZA 3UODA 4EK3A 3VBTA 4B7TA 2UZOA 3QRIA 1W98A 3CPCA 3KF4A 3UIMA 4F6WA 3KXXA 2PWLA 2VZ6A 4I6FA 4NW6A 5DI1A 2YZAA 4C37A 2VD5A 3FKLA 3LFCA 4QP8A 5KMKA 5A4EA 1IRKA 4O1OA 3O96A 3EQDA 4XJ0A 4AGUA 3Q32A 3QALE 5IA2A 3F7WA 3IOPA 1GIHA 2WMWA 3KULA 4QQ5A 3R7IA 3C4FA 4O0WA 2C6KA 4AA5A 4A9UA 4NH1A 4CQEA 4Q9ZA 3O8PA 3NDMA 5HU3A 5FBOA 4F99A 4O7NA 4EHVA 3LJ1A 4PTEA 4F65A 2QCSA 4FOCA 4ENYA 4G5JA 4DFXE 3MVJA 2WZJA 2OJ9A 3ZEWA 3LM0A 3SRVB 5C01A 3NS9A 3LMIA 1H08A 5JK3A 3NVKI 4FL2A 2XZSA 4EOLA 1M7NA 2HW6A 1Y6AA 2EB2A 2R3HA 2Z60A 4FNWA 4JDKA 5CT7A 2ITYA 2V55A 3ORLA 4K6ZA 4F08A 4C3FA 4DYMA 5T3QA 2SRCA 4KS8A 4PDPA 4O7SA 3R0TA 4AAAA 4CZYB 3EFJA 5A9UA 4YO4A 3EFLA 4UB7A 3TV4A 1SVGA 4CVAA 5IH4A 3PXRA 1FVTA 3DJ5A 4FIEA 3S95A 3BYUA 2YCQA 3II5A 3MIAA 4AN2A 5LVNA 4PNIA 3RK5A 4FTCA 4P4CA 2YM3A 4EQMA 1FMOE 1Q41A 5GIOE 3C4CA 1PW2A 2UZLA 3F3TA 3OS3A 3TKIA 2J9MA 2PYWA 2V5QA 5LJJA 4FTTA 2BFYA 4IAIA 3B2WA 3HLLA 5AR4A 3C9WA 3TDVA 4LV8A 5BYYA 3QQUA 3ERKA 3JPVA 3LCTA 2XJ2A 5JFVA 4JG6A 5H9BA 3D2IA 3THBA 1OL5A 5KCVA 2R5TA 3DKCA 3IO7A 3VUGA 4DGLC 5DE2A 4FTKA 5CI7A 2UZTA 4FSWA 4M0ZA 4E1ZA 3QX2A 3NRMA 5A54A 4L53A 3BZ3A 1DAWA 4JBPA 4PWNA 4MNFA 3FXZA 3RWPA 2YLEA 3ORIA 2C3LA 3CTQA 3D4QA 1SNUA 3F82A 3FLNC 1PXNA 4I6HA 4ACHA 4BI2A 4PL3A 4U97A 4LUEA 3UG1A 5KZ0A 3OT3A 4RJ7A 4XV3A 3HMMA 3T9IA 3M42A 4BDEA 3N4TA 1NVRA 4FZ7A 4HGSA 4M7IA 4YPDA 2QQ7A 2QO7A 3A4OX 3DBQA 3GUBA 2QOOA 5HCZA 1QPDA 4Q9SA 1URWA 4XG2A 4ZTQA 2EXCX 4J53A 5CEOA 4GJ3A 2A27A 3MVHA 5E1EA 3RAHA 5CALA 2FUMA 2VX0A 4TYEA 3OCTA 4V0GA 5IPJA 5KBRA 3D0EA 3ENHA 2QODA 5AUTA 3E63A 4I93A 4BIBA 2VTLA 3TUCA 3QD2B 2JDTA 3W2OA 1NY3A 2W4JA 4MYGA 3C7QA 1U5RA 3M11A 5BQ0A 3COMA 3OXIA 4CYIA 1VJYA 4FR4A 4R7HA 5E8WA 4TN6A 4ZLOA 3ZLSA 3ULIA 4IWDA 5HD4A 2WFYA 4CT2A 2UZUE 3KK9A 3KGAA 3F5PA 3P7AA 2EU9A 4GUEA 4IAYA 3ORNA 3QQFA 3L1SA 3HRCA 4WG3A 3VBVA 3COKA 1KUTA 4BYIA 5C4KA 4FTUA 4LOPA 3BYMA 5EHYA 3IW8A 3HZTA 2ITWA 2V22A 4QYHA 3ZUVA 2W1DA 3DKGA 4JR7A 5B2LA 4IWOA 2CLXA 4BDFA 2R3NA 4HVIA 5L2TA 2C5NA 2QU5A 3GU8A 3QZFA 4XH6A 1W82A 2WD1A 3UOKA 3O7LD 4FTJA 4C36A 3V51A 1YXUA 4EK8A 1T45A 4CLJA 2ZVAA 3EH9A 3UQCA 2JDOA 3W32A 5BPYA 5FDPA 3TTJA 4CFNA 4YHFA 2YIYA 2C6IA 2ITXA 2GS6A 3REPA 4LV5A 1ZYJA 4QRCA 4USDA 5M55A 4GFOA 4PDSA 3VUDA 3KN5A 4R7BA 4EZ5A 3QC9A 4DEIA 2B53A 2UW6A 2QLQA 4M8TA 1XWSA 5IA5A 2R0IA 4A7CA 3QTIA 4HCVA 4IVAA 2GTNA 2JDSA 4XRLA 2VAGA 5L6WL 4AE9A 2LGCA 5IQDA 2VTTA 5AV0A 5HX6A 4EOKA 5AR3A 4BTMA 4FEXA 5AR8A 1H25A 4FV8A 2UZBA 3U6JA 1XO2B 3HECA 2X1NA 1H0VA 2OO8X 4EBVA 3U55A 4ZZOA 1KE9A 4U6RA 4NT4A 5FLFA 4HNIA 3R02A 3UP7A 5EOLA 1KSWA 4ZY6A 3GC0A 4HGTA 4EOOA 3QC4A 1WBVA 5CXZA 1KOBA 3QD0A 3WZEA 5CEPA 2A1AB 3Q9YA 3PE2A 4FVRA 1PXLA 4K18A 5CAPA 3LPBA 2F49A 3V8SA 4WSQA 1CKIA 4C59A 4H1JA 2Z7QA 4G9RA 2O5KA 4L6QA 3EQFA 3WIGA 5FM3A 3SRVA 4WG4A 1U54B 4JX7A 2JD5A 3MDYA 3OCBA 1NT2A 2JIVA 3TUBA 3MI9A 5CNOA 4DG0E 4OAVB 3R8UA 4EZ7A 2NO3A 3OTUA 2PZ5A 3PUPA 3FWQA 4IZAA 4E4XA 1UVRA 2WKMA 3BU5A 3UVRA 3BHUA 3CJGA 4AN3A 1YWRA 4U0IA 3SG9A 1WVWA 4ZJVA 4K1BA 4EH6A 3NYNA 3PP0A 4ANSA 4D1SA 3CCNA 3F5XA 3QTRA 3QZGA 1GIJA 2QO2A 2JAMA 3ANRA 4MXCA 2P55A 4CXAA 1L8TA 2VO7A 2C5YA 1HCKA 2BIKB 2C6TA 5KMIA 2V7OA 4Y5HA 5C26A 4GG5A 4M13A 4F4PA 3KB7A 4G5PA 2QO9A 1PF8A 4K33A 1KE7A 2WMXA 4FV7A 3QFVA 1A9UA 1UNHA 3DZOA 4C8BA 3HAVA 3Q4ZA 5DIAA 3FZ1A 4QTBA 4F9YA 4L42A 4O38A 2R3OA 4LRKA 4F0IA 2B55A 4V05A 2BTRA 4X3FC 4KIOA 3MA3A 2YACA 4XP3A 2RL5A 2Y4PA 1UU9A 1OPKA 3NVMB 1JKKA 3LQ5A 5K9IA 4IAAA 4IB1A 3F69A 4U7ZA 1VEBA 4Y95A 2R3FA 3VBWA 3HA8A 5AEPA 5J9YA 2J6MA 3TEIA 3D5WA 3FLSA 3ODZX 4PRJA 5JKGA 3VS4A 3C51A 3OWLA 5JRSA 4QQCA 4QYEA 1BYGA 3FLWA 4YPSA 4YJRA 5ETFA 3ZTXA 4B9DA 4O6EA 1OZ1A 2GMXA 2PE0A 3BQCA 4XCUA 2P0CA 4H05A 4OBOA 2P3GX 4E5WA 4OGRA 3WF6A 4J71A 5E4HA 3QWKA 3SW7A 4NTSA 4KNBA 1URCA 4O0YA 3TACA 5HOAA 4D2RA 3TZ7A 5E8SA 4Z55A 3NUYA 3EZRA 3A2CA 2GTMA 2IN6A 1XKKA 2CGXA 3R7EA 3G51A 5IH5A 1ZZ2A 3FKOA 3QA8A 5BUJA 4NJ3A 3R7UA 5L2IA 1H4LA 1OL7A 2R0UA 3PJ2A 3K3JA 3L9LA 4IJ9A 3GC9A 2YIWA 2XB7A 4AOTA 4OTIA 4D28A 3BLQA 1KE8A 2VTSA 4NTTA 3NSZA 4FBXA 3H9FA 3OG7A 1NW1A 2AUHA 4CGAA 1H8FA 3GCUA 4MTAA 2X9FA 2XK9A 4KABA 4N70A 3Q5ZA 5KMLA 1DAYA 2FGIA 1ZXEA 4DTKA 2PULA 2XNBA 4IW0A 4F9CA 4YO6A 5I3OA 4NSTA 2NPQA 3AC4A 5CS6A 4B0GA 5IEYA 2WTIA 3VBQA 4F9AA 3C4WA 3NYVA 3A60A 5EKOA 1OBDA 3RBWA 1GNGA 3F9NA 3V5LA 4A9TA 3S0OA 4ASEA 4QP2A 3R73A 2CGWA 2JIUA 1UU7A 1ZY4A 4M15A 5CI6A 4JIAA 5CF6A 3UOJA 2PVNA 2W99B 4FEWA 5AJQA 3DAKA 3DU8A 4A06A 3A7IA 2CKOA 3QGWA 3GQIA 3AMBA 3D94A 1UKHA 2AC3A 3NAYA 3D9VA 4RZWA 5BVWA 3R9DA 3PXYA 3CS9A 2XIXA 4BDIA 2WTJA 4PL4A 1Q24A 4LRMA 1WFCA 4F1OA 3AXWA 1I09A 3BBWA 4U41A 4CLIA 5K4IA 5CEIA 4BB4A 3R21A 3LQ3A 1M2PA 3OOMA 2R9SA 3I5ZA 2XIYA 3ORTA 4YC3A 4FZ6A 4IQ6A 3FI2A 4QO9A 4G3EA 2QOQA 3F66A 1ZZLA 3Q52A 4WIHA 4KKHA 1F5QA 3FSKA 3A7GA 4NCTC 5KBQA 2ZV8A 3DOGA 1XH6A 2PVYA 5DN3A 3V5PA 4F7NA 2WTKB 3OXTA 4P7EA 5CU6A 4KAOA 3MH0A 1V0BA 4BWXA 4IHPA 4O7LA 2XIZA 2IWIA 4WBOA 3O8TA 4EOSA 2WTWA 4FTIA 2WEIA 3WE4A 3KXGA 5DBXA 4ZEGA 3D5VA 4XOYA 3IG7A 3U6IA 1JLUE 2B4SB 1OIRA 4F1TA 3Q4TA 4K8AA 1DM2A 4I23A 4L8MA 3QQHA 4C62A 1U54A 3ZXTA 4G2FA 4X7QA 5EDPA 2RIOA 4GRBA 3QWJA 5K5NA 2PE2A 3QL8A 3RHXA 4GU9A 4EYMA 4BIDA 3PDTA 3R1YA 4CMTA 4YZNA 4E26A 1BKXA 3IDBA 2R2PA 5CWZA 4ZMEA 1KE6A 3GNIB 4QD6A 4DGOA 2XYUA 4BTFA 1FINA 2QOLA 2OKRA 4YHTA 2PMLX 1B38A 4ZIMA 3BGPA 2WMSA 2ETRA 4FE2A 4DLIA 1IG1A 3NUNA 3ZO2A 4F9BA 5L8KA 2HY0A 3HP5A 4XP0A 2VWBA 1ZYDA 4G31A 4RSSA 4ASZA 5CY3A 2ITVA 3HAMA 3QTUA 3TL8A 2H8HA 5IUHA 4BY9E 2OZAB 2EB3A 4X0MA 5EQYA 4FNZA 5I3RA 4O22A 3QUPA 4ZXTA 3LFEA 4JOAA 1UKIA 4HYUA 3ZOSA 5EQEA 4Q2AA 3FV8A 3C0GA 4M68A 1JPAA 4UWYA 2OJIA 4LL5A 2YJRA 3A99A 4DFZE 1U46A 4IVCA 2BALA 2XK8A 3H4JA 4L44A 4BZDA 3S1HA 1O6LA 3B8QA 4QYYA 5HTIA 4Z16A 2QOKA 5FRIA 3ZXZA 3G15A 2IPXA 3VJNA 3PPJA 3FMEA 4OW8A 4BCPA 4CNHA 4ALVA 4BDBA 4YTIA 3TT0A 1XJDA 3UOHA 4D4RA 4APPA 2C3KA 5L8LA 1OBGA 2OI4X 4IB5A 1JWHA 2JFLA 5T6KA 4XBUA 4D5HA 3EKKA 4WOVA 1YWNA 4U81A 2HY81 4DG3E 4GIIA 4MH7A 3BRBA 4XUFA 5HU9A 4L3JA 2PVHA 4FKTA 3DS6A 3ZMMA 2QI8A 2ZV7A 3AD6A 4AUAA 5IF1A 2J50A 1OUYA 5E9EA 1EH4A 1ZY5A 3BHYA 3LIJA 4IX5A 5HLWA 4DFBA 3SXFA 3LMHA 2WGJA 3VJOA 3LKMA 4O7WA 4MEDA 1YHSA 4BBMA 3DQXA 3GXLA 1H07A 4HNFA 4OTQA 5AP4A 4LMNA 4ACDA 5AV3A 3NR9A 5H8GA 3T8OA 2WB8A 3QHRA 2WMAA 4ZJIA 5LXMA 3TKHA 2XNOA 4W9WA 4G34A 3P79A 4IFCA 3NCZA 4BCKA 3LMGA 5IDNA 4QMNA 2GNJA 4RJ8A 4D58A 3JYAA 3QCQA 3ORMA 3VRYA 2OF2A 3UP2A 4F70A 5DR6A 3RCJA 3FY2A 4YNEA 2VTOA 4V01A 5CSHA 5GINE 3UYSA 3V3VA 4PNKA 4RC3A 3JR1A 4NM3A 4EC9A 4RBLA 5IMXA 2HOGA 3H9OA 5F94A 5JSMA 3O7LB 2WHBA 5J5TA 4G17A 4AE6A 4U9AA 1PYXA 3Q4UA 5AP7A 3VUHA 5L3AA 3DXQA 3L8XA 4H58A 4FL3A 2JAVA 4HCTA 3I1AA 3PSBA 4AOJA 1UU8A 4BTJA 4BRXA 2J0JA 4ZS0A 3TG1A 5LWNA 1ZWSA 1UA2A 3I5NA 2FB8A 5C9CA 5B2MA 2HWOA 3E8CA 3ZSIA 1IA8A 1WCCA 5CAUA 3P7CA 3V8WA 2J0KA 4OTRA 2OH0E 2OJJA 2IZSA 4NUSA 5A4QA 2X7GA 2H96A 1W84A 4GVAA 4MD8E 4YSMA 3KREA 3OWKA 3UIXA 1FGIA 3DJ7A 3SHEA 1QL6A 4M14A 4LOOA 4C4IA 5EW3A 5DFPA 1Q99A 5F1ZA 2OIDA 1CKPA 1PMEA 2V7AA 3AD4A 5FEEA 2X39A 5C03A 4TZRA 3E88A 4L3PA 5HKMA 5M08A 1LR4A 1OB3A 2ERZE 4E3CA 2WQMA 2Z7RA 3HYHA 3F5GA 3R7VA 4ZMFA 1Q8TA 2CCIA 3EQIA 5CZIA 5LMKA 4R6VA 3QU0A 2XKDA 1H1RA 4X2KA 4CFWA 1M2RA 4R7IA 4DAWA 5DVRA 4G6LA 1Q4LA 3MB6A 5GJGA 3FMJA 3GCQA 4EUTA 3ZLYA 3ATSA 2WMUA 3ZSGA 4JVGA 2XJ1A 3QUDA 4K2RA 3DXPA 4PF4A 5BVDA 5CVGA 1QMZA 2YA9A 4YZCA 3TUDA 3A8XA 3KVWA 4IFGA 5M56A 4I4FA 5CAVA 4Y85A 1XBBA 4MHAA 5F20A 3EIDA 2GU8A 4BI0A 1PMUA 3OT8A 5DT0A 4MD7E 3KMWA 4OBPA 4MQ2A 4RJ5A 2O0UA 4QMQA 4CT1A 4QPSA 4XV9A 4CKJA 4F0FA 5JZJA 3LXPA 3MS9A 1E1XA 3MYGA 5FBNC 1IASA 4OLIA 2HELA 3WZDA 4IAZA 4EH8A 5A6OA 4GKHA 3OXZA 4U5JA 2QD9A 3IECA 3QGYA 4FL1A 3A7HA 3BHHA 4BN1A 5JEBA 2I6LA 2X8IA 2YITA 1Z5MA 3LW0A 3VO3A 2OZAA 4JQEA 2A0CX 2W06A 3UO4A 2YCRA 5HICA 3PE1A 2YM5A 2ZAZA 3UO6A 1DI8A 4L43A 2DWBA 4HVDA 5M44A 5L2WA 3MV5A 4RC4A 4N6ZA 4IZ5A 4WNOA 5CU2A 5E91A 3AOXA 2ESMA 3DDPA 3F3ZA 5E8VA 4FGRA 4YMJA 4FKWA 4O81A 3H0YA 4G3DA 4AZVA 3RK9A 3FPMA 3OBGA 4IC8A 3PSCA 3DXNA 4W9XA 2W4KA 3Q3BA 3NIZA 2KULA 4FMQA 4TWPA 4ZSJA 4J98A 5GZAA 4F63A 2BILB 2W5AA 3OUKA 3PJ3A 1VYWA 3R22A 4XG6A 4Z7GA 5AP3A 4CEGA 3MJ2A 5TR6A 4C57A 5DMZA 1GZOA 3P4KA 4LQMA 1STCE 4M0YA 4X2JA 3JVSA 3OY3A 4DEEA 1SYKA 3BYVA 4W4WA 4ENXA 4HVHA 3UC4A 2E2BA 4BC6A 1KE5A 4IZ7A 1Q8YA 4L46A 4I5CA 2FSLX 3RJCA 1CKJA 2X2MA 5AFVA 5GZ9A 4I21A 1ZMUA 2X8EA 3TJCA 3UNZA 3WARA 4AF3A 1G8SA 3QAME 4DLJA 3WZJA 1XQZA 2PMNX 3UDBA 5D10A 3GCVA 4IAFA 4ZY4A 1LP4A 4XMOA 2Z7SA 2I0HA 4E8AA 3V5JA 4FSRA 4L00A 1J7IA 5IA0A 3ZUUA 4M3QA 5H3QA 2CNVA 3OWPA 3VF9A 3WE8A 4J7BA 3OEZA 3EHAA 2E9UA 2VTHA 1W8CA 4F09A 3KXNA 4IBMA 4C02A 4OAUC 2YFXA 4JG7A 5JFWA 3CY3A 3W2RA 4FK6A 4M67A 3VQUA 3CIKA 3PJCA 4R5SA 5CNNA 3ZDIA 5DA3A 3R7OA 1J3HA 3AC2A 3CC6A 1OITA 3IOKA 3PY3A 2UZNA 4IANA 5KHWA 4BHNA 2RG5A 4OT6A 4FEVA 2IVUA 5HQ0A 3FAAA 4QMVA 3CD3A 2WAJA 3DV3A 4AW5A 4CYJA 4DC2A 2HK5A 2UW9A 3VF8A 4QMSA 3GENA 4AA0A 3EMGA 4RT7A 5EYCA 5A6NA 3B2TA 4O83A 1WBPA 4QYFA 2FVDA 1IA9A 3Q9ZA 2Y6OA 1JKSA 3R2YA 4I4EA 4DT9A 3O51A 2ITUA 3GOPA 3W10A 1BX6A 3CE3A 2CPKE 3BWJA 3W2PA 5K3YA 4FTAA 4IZYA 5FG8A 3UIUA 2E9PA 2O2UA 2R3RA 4MX9A 4LFIA 3TNPC 3HGKA 2ETMA 2X7OA 2UZWE 4FKRA 4J52A 4D9TA 4RIOA 3ULZA 4HVSA 3N4UA 3P78A 2IZTA 4FT3A 3V04A 2F57A 3FC2A 4XG7A 2NP8A 4D2TA 1WZYA 1MRUA 3UBDA 3O2MA 1FOTA 3OCSA 4G9CA 1H26A 5J95A 3RK7A 1Y8YA 2RFNA 4GK3A 5CSPA 4EK4A 4BI1A 5IQAA 5IQCA 4YJQA 3OOGA 2CGUA 2B9FA 3A7FA 3C0HA 3DK6A 3ZRMA 3ZS5A 4L7SA 3FPQA 3O8UA 4FSZA 5CVHA 3CEKA 4PV0A 1RJBA 3CQEA 3RI1A 3PPZA 5K4JA 1Y6BA 4PDYA 3DA6A 2AC5A 4FZFB 5M4CA 5F4NA 4U44A 1OMWA 3UNJA 4OTFA 1TVOA 2YLFA 3EWHA 3MY5A 4RWIA 3JY0A 2CN8A 4IVDA 3S3IA 5K0XA 1BL6A 3ZRKA 5I9YA 3BGZA 2BKKA 1H1PA 2G1TA 3CKWA 3ZBFA 2GS2A 4L52A 3VW6A 2QOHA 5HEZA 3CD8A 4LGDA 5FTQA 3IPHA 2I7QA 3BIZA 2HIWA 2QG5A 2A2AA 1O6YA 3EYGA 1OL2A 5C1QB 3P9JA 4TYHB 2HZNA 4USFA 3EZVA 5IQHA 2O8YA 4E6DA 3E64A 2XK3A 4O0SA 2P2IA 1JNKA 4K0YA 1PXOA 3DTWA 2PUPA 3FYKX 3PY1A 4HPUE 4ZJJA 5HZNA 1XH5A 3GU5A 4ERKA 5A4CA 4RA4A 5KO1A 2VUWA 5BMMA 2ZB1A 3VUMA 3UZPA 1PYEA 3FUPA 4RX7A 3PWYA 4ANOA 5J9LA 5AUYA 1SMHA 1GJOA 2PUNA 2ETKA 3UVPA 3V6RA 3FHRA 2W7XA 3FDNA 4MNEA 3FZTA 4F64A 5TE0A 4MXAA 4Z3VA 4ANBA 4EOMA 2IVVA 3QCYA 3SD0A 3IKAA 2B9IA 2WOTA 2GDOA 2BROA 1ATPE 4RC2A 4JIKA 5EW9A 3UYTA 2A4LA 3E7OA 5HGIA 3QTXA 3FEGA 4GIHA 3IGGA 3DAJA 4O2ZA 4KBCA 1WBTA 3R83A 5DGZA 4EK5A 4P5QA 4PPCA 4RA5A 4UMPA 3Q9XA 5FEDA 4NJDA 4O0TA 3QYWA 5AA8A 5TKDA 4PMTA 5E8YA 3VQHA 3G2FA 2VWXA 3RAKA 4CKRA 3LJ2A 1S9IA 4GG7A 4RPVA 4DCEA 5E8TA 4BCNA 5DNRA 3DJ6A 4JAIA 4O2PA 2VTQA 4MF0A 4U45A 2J0MB 5BVEA 1U59A 5GIPE 2PMIA 1WMKA 2GNGA 1P4OA 4JR3A 5C27A 2OFVA 2DUVA 5DT4A 3OMVA 2XBJA 3HRBA 3C50A 4AQCA 3KXZA 5EFQA 4ZTHA 4BL1A 4LUDA 4UY9A 5BUIA 1OVEA 4OT5A 4RIXB 3VC4A 3ZLWA 4ZTMA 4O82A 3KF7A 5GJFA 1UNGA 3FZPA 3R28A 4JQ7A 3KMUA 4WNPA 5CQUA 4IACA 3NX8A 2XK4A 1PY5A 4LGHA 4WO5A 2QKWB 3BU3A 2C6LA 2CJMA 3FQEA 4KWPA 4TTHB 5HG7A 3RPSA 4BDAA 2CNUA 2J90A 2JLDA 2WTCA 3P08A 3PWDA 2O63A 3G9NA 4RVMA 5HORA 1K2PA 3Q60A 3ZHPC 4DFNA 1J1CA 3BPRA 4M69B 2XYNA 3DK3A 3AC3A 5C4LA 2H6DA 3MIYA 4JI9A 4UBAA 3TIZA 4AU8A 5CAOA 1AGWA 5KKRC 4D1ZA 4DGGA 4C34A 5TO8A 4CCUA 4YUQA 3LFBA 2X6DA 3R7YA 4C4FA 5I9WA 4JXFA 3U51A 5L4QA 4C4JA 2PSQA 1XBCA 3HDNA 3QHWA 2CGVA 4RWLA 4YJPA 1NXKA 3ZFMA 3AQVA 4RRVA 3TV6A 3V6SA 4EK6A 3BHTA 5EYDA 3PIYA 3JY9A 3MFUA 1FVVA 3R6XA 4AZEA 4F7LA 2C3IB 2VGPA 2V0DA 5FD2A 3FMKA 5IEXA 4UX9A 2VWIA 4XNEA 4RJ6A 4IMYA 4CZUA 5HIDA 4OUCA 3TZ8A 1ND4A 1YOJA 1JVPP 4NWMA 4QYGA 4AGWA 5AA9A 4QTDA 4RVLA 1OI9A 1W7HA 5BVNA 2EVAA 3D83A 5CYIA 1AD5A 3ETAA 2QOFA 2KTYA 3DBDA 1PKDA 4YZ9A 5JT2A 2QOCA 5EI8A 4E73A 5LQFA 3FMHA 1J1BA 3PPKA 4FKOA 1H1WA 3KMMA 2C6OA 2DYLA 4RQKA 5AUZA 3W8QA 3VS5A 2YWPA 2OJFE 3D2KA 3MPMA 4J8NA 4JRVA 4QMWA 5CX9A 3ZCLA 4AZTA 3U54A 3ZM9A 4LL0A 3L9MA 4MXXA 3ZU7A 4JLCA 2VGOA 4A07A 4CMOA 2OK1A 3OHTA 4E5AX 3CGOA 4GFMA 1ZOGA 3EOCA 3ZC6A 3SLSA 4YBKA 1LUFA 3RAIA 3FL4A 3LM5A 3FYJX 4DE4A 4EOJA 4JDIA 3BEGA 4MKCA 3LXLA 3A8WA 3Q96A 3AMYA 3SC1A 3FMMA 3MH2A 2HW7A 4KSQA 1MP8A 3VN9A 4QQJA
chains in the Genus database with same CATH superfamily
4FV2A 3UNKA 5AIRA 3AT3A 4PP7A 3C5UA 1B6CB 1YDSE 2XRUA 3CGFA 2R4BA 1SM2A 4AT5A 4BDJA 2FO0A 4WNKA 2BPMA 5JGAA 4CTBA 1TQPA 2B52A 2RKUA 4MD9E 5C8NA 2R3JA 2X8DA 2CDZA 3VAPA 5DT3A 4FKVA 5L8JA 4G3FA 2Q0NA 3NUXA 1YHWA 3W2SA 3WF9A 4BGHA 5CASA 4FTNA 4RLKA 4DH3A 4I5PA 4KIPA 2E9OA 5EDQA 3VS6A 4CFXA 5A4LA 3VS1A 4ALWA 2QKRA 4DT8A 2C68A 3PVWA 4K77A 1G5SA 3WYYA 3P0MA 3R8PA 4G6OA 3ZDUA 3CXWA 3QXOA 5CSXA 3TCPA 5KUPA 3TM0A 2R3IA 5BV3A 3UG2A 4ANMA 2H34A 3U4UA 2X2LA 5D9HA 5AUXA 2JKKA 5E8XA 3LJ0A 3VS0A 2F2UA 3O0GA 1TQMA 2Z7LA 3HV3A 3TZMA 4D0WA 3P7BA 3QRTA 1OKVA 2OIBA 2WIHA 3CQWA 4FEQA 5CEMA 2PE1A 3U6HA 1PXJA 4UXLA 3LE6A 2PPQA 3ZC5A 2HZIA 4M97A 3L8PA 5L2QA 3KRRA 2UZEA 3O50A 2Y4IB 4RX9A 5ANEA 5HO8A 1BLXA 3SOAA 4CV8A 4D4SA 1Y57A 3QXPA 3F3UA 3V5WA 1XMMA 3DB6A 2XRWA 5AR2A 4AQKA 4BKZA 3TN8A 3QRUA 4BWKA 4EOQA 2X7FA 4IB0A 2C4GA 5M4FA 4HOKA 2ZB0A 3I0OA 4B4LA 2ITNA 5L6OA 3DY7A 4RX5A 2B1PA 1YDTE 4JBQA 4OBQA 4DFUA 4JJRA 4ACCA 3E8DA 3BV2A 3D7ZA 4W8EA 5D12A 4O21A 2X0PA 4EH3A 3N4VA 4J1RA 1YXXA 3BLHA 2XCKA 5KMOA 3NMUF 4GFGA 2ZM3A 3GGFA 3UIBA 2CCHA 2BMCA 5IUGA 1LPUA 5FXQA 4EEVA 3TZ9A 1FMKA 4MUQA 2QVSE 2ZYBA 3K2LA 1HOWA 4J96A 4XX9A 1CTPE 4YJSA 4A9SA 5J5SA 2FSMX 3FI3A 5DYJA 4U40A 4WRSA 2EUFB 3ZRLA 3W0SA 4YC6A 3SAYA 4FKJA 2OGVA 3BQRA 3PXZA 4EONA 1XBAA 2QOIA 3EQRA 3PG3A 2HZ4A 4O96A 4J99A 2R3PA 3R71A 5CTPA 3UJGA 3OC1A 4ANQA 2X2KA 2ZMDA 4M69A 2YIRA 4QTCA 1Z57A 4BCMA 3VWAA 2J4ZA 1ZYSA 4WT6A 1KOAA 2BZIB 4FV4A 1UNLA 1P5EA 3DB8A 2WOUA 4ZTNA 5KZIA 3U9NA 3V5TA 4C0TA 3QF9A 5LMKC 2VRXA 3AGLA 3MWUA 4HYIA 3FI4A 2VU3A 2W1CA 1ERKA 1R78A 2XH5A 3KC3A 2YHVA 4KIKB 4NFNA 4QMOA 3SG8A 4ASXA 3R8LA 5AX9A 3TYKA 2WTKC 2JFMA 3BYOA 4PMMA 4QMUA 4WA9A 5AR5A 1CSNA 3K3IA 5EI2A 5D1JA 5M53A 3FZOA 3BCEA 3UC3A 3Q6UA 5AWMA 5DOSA 3UPZA 4BTKA 4Q5EA 4FIGA 3UQFA 5BYLA 4TWOA 2CN5A 3KQ7A 4Y5QA 1ZAOA 2HENA 3D15A 2R3KA 3DDQA 4GK4A 4KRDA 5LWMA 3MVMA 4ORKA 3ORKA 4UZDA 4IWQA 4BZNA 1Q61A 4AGCA 3Q2MA 4D2VA 3HV6A 4FVQA 1R0PA 4TY1A 4GL9A 4F9WA 5I9XA 4CG9A 3LFNA 2UVZA 2W1EA 2YCSA 3VIDA 2RGPA 4TKSA 5FP5A 3WYXA 2OF4A 2VTPA 3P5KA 4IC7A 3WI6A 1Z9XA 3WF7A 3FHIA 1OKWA 3POOA 5EH0A 5JMSA 4S34A 5FP6A 3NUUA 1YXTA 3EN6A 3P1AA 4I94A 2LAVA 4HVGA 4F78A 3R8ZA 3QCSA 1GZ8A 3GT8A 4W8DA 1XHAA 2HAKA 5HI2A 4AS0A 4EKLA 3L9PA 3OW4A 4YJOA 4EL9A 4G3CA 3GP0A 3R04A 2X6EA 4AAYA 4DG2E 4MK0A 4L9IA 5IA3A 4MWHA 3TTIA 1RE8A 5CVFA 4B8MA 2BIYA 5CF8A 5E92A 1ZLTA 3ORPA 4U43A 4R1VA 2DS1A 3BEAA 3RM7A 3RCDA 3PIXA 4YGAA 4YLJA 3TNWA 3HEGA 1F3MC 2VTJA 5E90A 1P4FA 5FM2A 3H10A 3HRFA 3MFSA 2Y0AA 4N6YA 4XLIA 1I44A 3AD5A 5D7AA 3ROYA 2YEXA 4CRSA 4X6RA 3R8MA 3TNQB 4D9UA 5HVKA 1A06A 5BX0A 3EQPA 3R1NA 3F2NA 1Q3DA 3OBJA 2VNWA 4L01A 4WD5A 5AUUA 4AW0A 2E9VA 3I7BA 4FZDB 4S31A 2FYSA 4I1ZA 4PPAA 3W55A 5FTGA 2PZPA 3L9NA 4YNOA 4ZOGA 5CEKA 4DTAA 5IH6A 2H9VA 3QLGA 3LQ8A 3QTQA 2BRNA 4FV0A 4UMRA 2BDWA 3AGMA 5HBHA 4BBEA 5J7HA 2HZ0A 2ZV2A 1UU3A 4AFEA 5BVKA 4EHEA 2UW0A 3FC1X 4MCVA 5EM7A 5ICPA 2DQ7X 4ZTSA 2O64A 3IS5A 4LV7A 3KXMA 4ZLZA 5ITAA 2VV9A 2XKEA 3I7CA 3IW7A 4I0SA 4UWCA 5LVLA 4XYFA 1YRPA 4O4DA 1H27A 4O0UA 5EHOA 3I0QA 3ZONA 1V1KA 2VWWA 3WF5A 4D5KA 3ATTA 2C0IA 2C6DA 4G16A 3IDCA 5JQ5A 2GFSA 2XKFA 3GC7A 5EI6A 4WBBB 1RW8A 3D7TB 3MW1A 1O6KA 3BL9A 2F2CB 1V0OA 3MPTA 5IZFA 4EZ3A 5EQPA 1H00A 5IA1A 3DBFA 2VTAA 2VWUA 3MBLA 4UMQA 3ZEPA 3IQ7A 1J7UA 2C1AA 4TRLA 4USEA 1QPJA 3DLSA 2B9HA 3LXNA 5JQ8A 3NW5A 4FTLA 2ACXA 2BRGA 2G2IA 3HV4A 3KXHA 4RVTA 1WVXA 4CD0A 5M4UA 5CLPA 5CSVA 4G6NA 4AT4A 3G33A 4QMZA 2C0OA 1NVSA 2GQGA 4KIQA 4FKUA 4EKKA 1L3RE 3F3VA 1YQJA 1OKZA 5HTCA 5JN2A 5HD7A 3FQSA 3CBLA 4LM5A 4BKYA 3N51A 3WF8A 5CU3A 1P14A 3BV3A 4YZMA 3D5XA 3FXXA 4YURA 5K5XA 4XP2A 4O84A 3E5AA 4FZAB 4AX8A 4XG9A 2C5OA 2PUUA 4XS2A 2XANA 4EQCA 3IONA 3ZLXA 4NZWB 3NPCA 3OEFX 5AP6A 2ZDUA 3W2QA 4WUAA 5LVOA 3O23A 4QTEA 3KKVA 5IUIA 3TKUA 3BLRA 1SZMA 5GNKA 5I5ZA 4J95A 4QP4A 3WOWA 2REIA 5K0KA 4NL0A 1YOMA 4RZVA 3D14A 4FEUA 4DFLA 4AT3A 5HE1A 4WNMA 3U4WA 3CKXA 3DCVA 4QNYA 3ZH8A 2IO6A 3H30A 3MY1A 2R3QA 5HG5A 2WQBA 4OR5A 2VWYA 3PVBA 3RPOA 3NYOA 2WQNA 2PVLA 3IK3A 2F4JA 2OBJA 4EOIA 5B7VA 2WIPA 3NCGA 1QPCA 3KCKA 4KIKA 2VX1A 3UVQA 2RFEA 4ZP5A 4QTAA 4L3LA 1YDRE 3ET7A 3UQGA 3HP2A 3VS3A 1BI7A 4EH4A 5CEQA 5IKWA 4BCIA 3E8NA 4BKJA 4EQUA 5KHXA 1Y91A 1OECA 4JDHA 4O7VA 2W1IA 4RIYB 2Q83A 3EKNA 3ZFYA 2Z8CA 2UUEA 1XH8A 2X4FA 1YXSA 3BE2A 5A3XA 3VUIA 4RFYA 5EKNA 5GHVA 4RWKA 1Q62A 3PTGA 3QQLA 5CANA 4MAOA 1OPJA 3FLZA 4R78A 1ZOEA 2QNJA 4IB3A 3PY0A 4AXFA 3AC8A 3MJ1A 5I0BA 2R7BA 4X6QC 3PVGA 4DEDA 2AEGA 4TNDA 1OIYA 4PTCA 4PPBA 5M51A 4APCA 1JKTA 3JUHA 5D41A 4DH8A 5JH6A 2ZJWA 2OIQA 3U8WA 1PJKA 2OU7A 4R3CA 2YIXA 4RG0A 4WHZA 4EORA 2YWVA 5CAQA 2W17A 4D2PA 1K3AA 4IX4A 4L7FA 1PXKA 3HX4A 4WUNA 5AV2A 3DAEA 4IE9A 3VULA 4FK3A 3W33A 3GEQA 4GYIA 3BX5A 4LRJA 4YTCA 4Q5HA 4AGDA 5CSWA 3ZBXA 4QQTA 4WSYA 5AUVA 3CP9A 2O65A 4UMTA 4AW2A 2UVYA 3PSDA 2XUUA 3BBTB 3FZRA 5T68A 3MY0A 2FA2A 3MFTA 4IDTA 5HCXA 3E3BX 4EWQA 3P86A 5ACBC 3VNTA 2OW3A 4E4LA 5HVJA 4DFYA 4NK9A 3LCKA 4JMQA 3O5AA 4JG8A 3RPRA 4PL5A 4YTHA 3UZRA 1FBNA 2UW5A 3ENMA 3N9XA 5B0XA 5BNJA 4DH7A 2GQRA 4DHZA 2GHMA 2X9EA 2BZJA 4IVBA 5D7VA 4FYOA 3DBEA 4YJNA 5AAGA 3ZYAA 3FMLA 2JBOA 2IVSA 4FV6A 3PVUA 1J91A 5I9UA 3CSVA 4O7YA 4WRGA 3QTZA 2QONA 4WKQA 4IEBA 3HMPA 5AM6A 2E9NA 4GSBA 4TYJA 3TXOA 2RFSA 3MVLA 3WBLA 2PVRA 3QUEA 4NW5A 2GHLA 3EN4A 5J87A 5AM7A 4BIEA 4I22A 1M2QA 2YN8A 4W4VA 4QOXA 4ZZMA 4CV9A 3ALOA 5JZNA 2W05A 4I6BA 4F0GA 2XM9A 3S00A 4EH2A 5IQFA 2VX3A 3I79A 3QKKA 2BUJA 5IU2A 3KRJA 3NEWA 4FTOA 4FC0A 2W9ZB 5M09A 3NNVA 3IGOA 2C69A 4LGGA 5EM5A 3G0FA 5HE0A 3ZZEA 4AZSA 1YHVA 4BCQA 5J1VA 2IZRA 3NGAA 4FODA 4O0XA 3C5IA 2F7XE 3DNDA 5AP5A 3MESA 2JIIA 3NLBA 4IM0A 2EWAA 4ALUA 3RHKA 1UWJA 4BCHA 3FLYA 3D7TA 5HVYA 4BYJA 3R7GA 3IW4A 3VHEA 1VZOA 1OM1A 5DEYA 5CT0A 3JXWA 3ZO4A 1VLRA 1GAGA 2P4IA 4TPTA 3R01A 3HMNA 5BUEA 2XNEA 3R1QA 3RNIA 5EHLA 3FXWA 2YERA 5M07A 4ZAUA 5DR2A 2EXMA 4QMTA 1REJA 2QHMA 2WO6A 2XM8A 3E87A 3LHJA 5CZHA 4GV1A 2QURA 5H2UA 1CMKE 2P2HA 4KBKA 4JDJA 1F0QA 3QTWA 3ALNA 5AAFA 3F88A 2X81A 3BELA 4FKPA 1RQQA 1GZNA 3E7VA 2HXQA 4X2NA 4W4YA 2W1ZA 4IADA 4XHKB 5J1WA 4KD1A 4RX8A 3E62A 4IX3A 2VNYA 1RDQE 3Q5IA 1KV2A 5HESA 3ZUTA 4DF3A 5IQIA 3E93A 3PRFA 4O4EA 3GVUA 2PUIA 4FTRA 4HGLA 3BE9A 2BHHA 4U80A 3PA5A 2WU6A 3KL8A 2JGZA 4CFVA 4DINA 3WZKA 1ZRZA 1OPLA 2UW4A 3GCSA 4EWHA 3KK8A 3PZEA 2C47A 2RF9A 3G9LX 3NUAA 4IX6A 4PQNA 3R9HA 3C4XA 3QRKA 3EJ1A 2GSFA 3TDWA 4N4SA 3KY2A 3AT4A 2Q0BA 3FKNA 4ERWA 4H3QA 4JL9A 3MB7A 4BCFA 2VTRA 4RVKA 4GYGA 4E7WA 2W0JA 1ZMWA 3SKCA 3AC1A 2QU6A 2YAKA 3G90X 3RINA 3LCOA 3I60A 5HE2A 4HZSA 5ANJA 4II5A 3KN6A 4I0RA 5EYMA 2I1MA 2I0YA 3UTOA 4D4VA 5JFSA 2JDVA 1J7LA 3EQBA 2PVJA 3EYHA 5LOHA 4JX3A 2ZM1A 4ONAA 4M66A 1H01A 4RIYA 5AAEA 3QZIA 4Z7HA 4BVUA 2OWBA 2BR1A 5TF9A 3HV7A 4FI1A 2IG7A 5ETAA 4FT7A 1VR2A 1OIQA 2QG7A 5IISA 5AP2A 4AP7A 3GU7A 3NWWA 5DRBA 3SX9A 2BHEA 4FV1A 4NKSA 4A9RA 2WMTA 3UE4A 3L8VA 2HCKA 4XV1A 3ID6C 2UW7A 5ACKA 4PP9A 4DGNA 2R7IA 1G8AA 3C4EA 1MRVA 5AV4A 3R9NA 3DNEA 2GNLA 3POZA 4BCOA 3KEXA 4FV3A 2R64A 5EDRA 3EFKA 5HTBA 2RG6A 4ZLYA 1O9UA 1VYZA 2UZDA 2BFXA 3FMNA 4B99A 5J79A 3OUNB 4U79A 4EOPA 5HO7A 2OLCA 1JOWB 3C13A 3QD3A 3VS2A 5IQGA 2ZDTA 3MSSA 2J0LA 2UV2A 4D2WA 2WPAA 3UMWA 3LLAA 4OTWA 4AA4A 4YZBA 2JBPA 2AYPA 3S4QA 2GFCA 1JSVA 3VW8A 2W1HA 3GI3A 4D55A 3GU4A 1WAKA 4EH5A 4FIJA 5LCKA 3RAWA 1YI3A 2GNHA 2NRUA 3FJQE 3HDMA 3RVGA 5I9VA 4N57A 1JAMA 3QRJA 4DH5A 5G1XA 5ANIA 4QEBA 3FY0A 5C8MA 1R3CA 4IDVA 1M14A 3EQCA 2I0EA 1YOLA 3AMAA 4PDOA 4DHFA 5IDPA 3QCXA 4GT3A 4BR3A 3C1XA 3OFMA 5J7BA 2UW8A 5KE0A 3HMIA 4YR8A 4I5HA 2WMVA 5D11A 3GC8A 4FOBA 5C8KA 1B39A 4M84A 3NYXA 1WVYA 5BMSA 5DRDA 3ZM4A 3HNGA 4CFMA 4RFZA 4YJUA 1R0EA 5ETCA 3MTFA 4UZHA 4IH8A 3FI8A 1IR3A 4DEHA 4YC8A 4EH9A 3PXFA 1JKLA 2PVMA 3T9TA 5CF5A 1XH9A 3QX4A 5LVMA 4GW8A 3DQWA 3D5UA 3PA3A 5CXHA 4ITHA 3NW7A 5AP0A 3KVXA 4ITJA 1H1SA 5KKRB 2YJSA 1W0XC 1W83A 4FT5A 3G5DA 4I92A 4U3YA 4MXYA 2R3MA 4QP3A 4AFJA 2PVKA 2J2IB 3W2CA 4R3PA 3I4BA 3FE3A 5L6PA 2PTKA 4ZSGA 3MGYA 2CSNA 2IVTA 5FGKA 2GPHA 1M52A 4IIRA 2BRMA 5FUTA 3OTVA 3HMOA 3MN3A 2W9FB 2ZMCA 3RKBA 3WIKA 4MXZA 2PVFA 4JAJA 3R9RA 2FSTX 4HZRA 3PIZA 4XOZA 4ZY5A 4AZWA 4RMZA 2RSVA 2BVAA 1PXPA 4X2FA 2VO6A 3ZZWA 3BHVA 2XS0A 1PXIA 5E7RA 5H8BA 5TOZA 5LARA 3SOCA 5EG3A 4ZTLA 3Q04A 2GNIA 4CSVA 4ACMA 4C4EA 1R39A 2WMRA 3EB0A 4D2SA 2PZIA 1OGUA 2NRYA 1U4DA 3F2AA 3KRWA 4R8QA 4X3FB 5DPVA 4DEAA 5JGDA 5HG8A 4NM5A 2CKQA 3QQGA 5DLSA 4FIFA 4XG3A 2VTNA 4O91A 4CFFA 2XK6A 2OZOA 2ZV9A 3DK7A 4J97A 3LFQA 1H0WA 4FNYA 4KINA 5TT7A 3RWQA 4CFUA 3ZFXA 3VBYA 5DEWA 3U87A 5HHWA 1H28A 2W5HA 3GFEA 3PJ1A 2XIKA 4PMSA 2P33A 2XNMA 4FV5A 5ANGA 3U9CA 1MQ4A 1GOLA 5E8ZA 4BHZA 2J5FA 4JS8A 2J0IA 4DEBA 3WZUA 3QA0A 4QP6A 4FIIA 3MH3A 4NFMA 3A7JA 4RJ4A 3SGCA 3GBZA 1AQ1A 4HCUA 1ZYCA 3ITZA 3BGQA 4XEYA 3FQHA 5DH3A 3DLZA 1CM8A 2XA4A 2XIRA 3W18A 4A4LA 3QLFA 5AX3A 1OUKA 3FSFA 3NW6A 4QPAA 3I6UA 4BDDA 4BDHA 1W2DA 2CKEA 2BAJA 2ONLC 4FSNA 2XMYA 3LAUA 4O1PA 4GS6A 4H36A 5EYKA 3I6WA 4DBXA 2BTSA 4E93A 4QP9A 5HCYA 3FZSA 5F95A 3F61A 4RFMA 1PMVA 5ANDA 3UMXA 1ZOHA 1NA7A 4C61A 4LYNA 4HPTE 4JBVA 4ANNA 4TT7A 3T3VA 4CQGA 5KMMA 5I4NA 2GHGA 4QMYA 5HO6A 4FJVA 3H9RA 4O6LA 4TYHA 1Q3WA 2OH4A 1Y8GA 3ELJA 4XRJA 2VO0A 2XCHA 2XEZA 3EFWA 4TYIA 3Q4CA 5AMNA 3SDJA 4DEGA 2PK9A 2WXVA 1TFFA 4FA2A 1YVJA 2JKMA 2JKQA 3BKBA 2ITQA 2IJMA 3SVVA 3ANQA 5FWKK 3RM6A 4DCAA 3W0QA 2FH9A 4FUXA 3VRZA 4PMPA 4BF2A 3UZTA 3GFWA 4IAKA 3LCDA 4I20A 4S33A 4X21A 4C4HA 1QCFA 3B8RA 5HBJA 1WBWA 1KWPA 4AXAA 5HLPA 4DDGA 4TWNA 3OF0A 4RIWB 5FEQA 1M17A 3R00A 4DGMA 4GK2A 1OIUA 5LCJA 1GY3A 3V01A 4NEUA 4FKGA 2UVXA 3PYYA 2Z2WA 4U42A 3LVPA 5EM8A 4EHGA 2C5VA 2X4ZA 2XEYA 3O17A 4ASDA 3RMFA 2BRBA 3OY1A 4F6SA 5IEVA 3K5UA 5H8EA 4UXQA 3H0ZA 4V04A 4H39A 2YIQA 4C7TA 4DH1A 4CG8A 3UPXA 3QD4A 1JSUA 4EI4A 3QBNA 4S30A 4ZSEA 5FXRA 5I9ZA 4OTDA 4K11A 4IWPA 4EJ7A 2YZLA 2G2HA 2UW3A 3DBCA 1QPEA 2OG8A 3GB2A 4TYGA 2VTIA 2WTVA 4R5YA 3AG9A 3DT1A 3M2WA 4KS7A 4ZSLA 5EOBA 4BGGA 4DTBA 2VN9A 4TXCA 1H24A 3LFFA 4ANLA 4YSJA 2BDJA 4AW1A 4FSQA 4I0TA 2R3GA 4M12A 4AXCA 3VVHA 3PLAE 3AC5A 1DI9A 3DZQA 4I6QA 4ZTRA 3R8VA 4FIHA 1G3NA 2YDKA 4NIFB 3QQKA 2HYYA 3TNIA 4FUYA 4FTQA 4ARKA 1NVQA 4AN9A 4NKAA 4GT4A 2BZKB 3K5VA 1YXVA 4EBWA 2W96B 4FKLA 3SW4A 4F6UA 5J9ZA 1BMKA 3L8SA 2WNTA 4NU1A 2JKOA 4RIXA 2ZOQA 4O7RA 3EN9A 4I41A 4OTGA 1PRYA 4OTHA 3MTLA 4RJ3A 2BAKA 4XV2A 2A19B 3RP9A 2OXXA 3V8TA 1JBPE 2XVDA 2PZYA 3WILA 4C2WA 5IG1A 1BL7A 2Y4IC 1Q5KA 2G01A 2XNGA 2YABA 4AOIA 2B54A 2C6EA 2CNQA 4R3RA 4O27B 3R30A 2IZUA 3MA6A 2CLQA 3HKOA 3JS2A 4JBOA 4YBJA 4BGQA 1FGKA 2WTDA 3TV7A 3F3WA 3E92A 3PG1A 4JT3A 2GCDA 3DFAA 4HYSA 4A4OA 4EUUA 3R9OA 4ZSAA 4FSTA 4IXPA 4UALA 3AKLA 5AR7A 4FYNA 5E8UA 3JVRA 1DS5A 2JDRA 4AG8A 1X8BA 4AWIA 4BDKA 2BZHB 3LFDA 5M4IA 3EQHA 3NUSA 4NM0A 4C35A 3EN7A 4RWJA 3PFYA 3MPAA 2HWPA 3O71A 4IM2A 4U3ZA 2WQOA 2J51A 4KSPA 3LXKA 4C4GA 1TKIA 3MFRA 4DBNA 4EH7A 4KKGA 4I5MA 3TWJA 1P2AA 1XR1A 3ZSHA 3R2BA 5HNBA 1IEPA 1PHKA 5IA4A 2WELA 2B9JA 3Q6WA 4GU6A 5LMBA 4EJNA 3ZO3A 2YDIA 2GS7A 3PRIA 4FKIA 4PY1A 3ZO1A 4R77A 4X3FA 2ONLA 3KA0A 4E4MA 3F5UA 1IAJA 3PLSA 1MUOA 3G6HA 4BWPA 3F2RA 4IM3A 4BJJB 4YHJA 2WQEA 1V0PA 4UMUA 4FKSA 3MH1A 4FVPA 5JRQA 1APME 3LOKA 3LFAA 2C3JA 5HNGA 1MRYA 4FTMA 5LMAA 3HUCA 1HCLA 3P23A 4O86A 3ROCA 2WU7A 2PL0A 2YM4A 3OROA 2W1GA 3OW3A 4MXOA 3RTPA 5HNIX 3FMDA 5IMEA 1IAHA 3COIA 1WBNA 2C6MA 3EL8A 3TIYA 3RPVA 1SVEA 2YM8A 4FT9A 3PJ8A 2J7TA 4C33A 4F7SA 4QP7A 4C58A 3SA0A 2XARA 3CLYA 5GZ8A 5ETIA 5ANKA 5AV1A 2BKZA 4X2GA 3DKFA 3CJFA 4R1YA 3TI1A 3PA4A 4WG5A 3SXRA 4TW9A 3M1SA 4O0VA 1UWHA 2OXDA 3Q9WA 4BDGA 5FXSA 5M06A 2ITPA 5FDXA 3W0RA 4YTFA 3OZ6A 3QKLA 3C0IA 4E6QA 2BAQA 4YLKA 4S32A 1H1QA 2PY3A 2ITZA 1GZKA 3W1FA 3A61A 4GMYA 3SQQA 3HL7A 3TJDA 4ITIA 1M7QA 4E4NA 3QYZA 3OP5A 1Q8ZA 2XNNA 4JQ8A 2Y6MA 4D1XA 4A4XA 3UO5A 1BI8A 4XG4A 4D0XA 4KUJA 4PUZA 4ZZNA 4J8MA 4L45A 4KBAA 4F7JA 2YAAA 3PXQA 4MBIA 4Y83A 3F6XA 3TNHA 3PP1A 4XBRA 3IW5A 2JITA 4KA3A 5AUWA 1ZARA 5A4TA 3CR0A 3KIOC 5A46A 2HXLA 1BUHA 4GCJA 1UV5A 2UZVA 3PXKA 4C3RA 4QP1A 2XP2A 4HW7A 3BYSA 1Q8WA 3CTHA 4H3PA 4GUBA 2YM7A 2B0QA 4P90A 4Y73A 4E20A 2WMQA 3DFCB 5HG9A 4E6AA 1CDKA 2CKPA 2YISA 2JEDA 3E8EA 3HV5A 4RIWA 5EK7A 4Z9LA 5HE3A 5CENA 3SXSA 3F7ZA 3V5QA 4EHZA 1YI4A 2IW6A 1LEWA 3A62A 3NUPA 4Y8DA 2OXYA 3S2PA 5KMNA 4QNAA 4H3BA 4O7ZA 4XLVA 3W0PA 3NNWA 4C38A 3ACKA 2VTMA 2VWZA 4KB8A 2V62A 3G0EA 3OCGA 3R63A 5HLNA 2YM6A 3E3PA 2FSOX 3UGCA 2PMOX 3DGKA 4E6CA 3ODYX 3KULB 5A14A 5GJDA 2OJGA 4DA5A 2G2FA 3VS7A 3NNUA 5DG5A 4H1MA 5HIEA 3EQGA 4I24A 4TWCA 3CPBA 3CTJA 4EC8A 4BCGA 3FBVA 2C30A 3KFAA 3GCPA 4NCTA 3Q53A 4MQ1A 3RGFA 2XK7A 3EL7A 3CQUA 2GQSA 4Y46A 1PMNA 2BRHA 3VONA 4ZS4A 3BU6A 4ACGA 4FSMA 4NIFA 4W4XA 4IJPA 2QC6A 4QMXA 5EW8A 3T3UA 2I40A 3KU2A 3QZHA 5IQEA 3W0MA 1YKRA 5HX8A 3QKMA 2QLUA 3DPKA 4QMPA 4YP8A 5JGBA 1E9HA 4HGEA 1YW2A 4NYEA 2C5XA 4LG4A 4UN0C 1TQIA 2XKCA 4AACA 3VHKA 4PTGA 3VUTA 4S2ZA 3HA6A 3GQLA 1GIIA 4DN5A 1SVHA 3ORXA 4UYAA 3KCFA 1REKA 3BI6A 4PX6A 5DWRA 4MF1A 4QMMA 4TL0A 5F9EA 4FKQA 1E1VA 4XG8A 1JQHA 4GJ2A 1OL1A 3IW6A 3UOLA 3A4PA 1MQBA 1S9JA 5AIKA 1PKGA 4FSYA 2XNPA 2RFDA 2O3PA 4MBJA 4YJTA 5IQBA 4K9YA 4I3ZA 3BWFA 4GKIA 2W1FA 3LLTA 3W16A 4ZK5A 2Y8OA 2PHKA 3ORZA 1PXMA 4CZTA 5BVOA 2EXEA 3HUBA 4DITA 2F9GA 3VBXA 4LOQA 1FPUA 4BCJA 4UYNA 2IW9A 3RNYA 1OL6A 3LCSA 3LZBA 5BVFA 3H3CA 3ACJA 4YLLA 5DR9A 5HIBA 4C3PA 2Y7JA 4YZDA 1WBSA 2IW8A 2AQXA 4C2VA 4L67A 5KNJA 4G3GA 2CMWA 4G1WA 3CY2A 5BYZA 4KRCA 4BZOA 3QTSA 2OICA 2QHNA 3VUKA 4RQVA 4CCBA 3RZFA 4P2KA 1U5QA 2ITOA 2OFUA 3KRXA 1KV1A 4FF8A 3COHA 5CU4A 4A9YA 1LEZA 4FSUA 1SNXA 2W4OA 5ANOA 1ZYLA 3FL5A 3RZBA 2CHLA 4UV0A 4BDCA 4D4YA 2BDFA 3W8LA 5FTOA 1YWVA 5E1SA 3IDPA 3NIEA 5KMJA 3LFSA 1JSTA 2JC6A 2BCJA 4N0SA 2Z02A 4O7TA 3NNXA 4UEUA 4AZFA 3K54A 1WBOA 2WEVA 4ID7A 4V0GB 3NZ0A 4FG8A 4YJVA 2XF0A 4RGJA 5AP1A 4EYJA 3GOKA 1K9AA 1OKYA 2YDJA