4BRXA

Focal adhesion kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
272
structure length
259
Chain Sequence
RDYEIQRERIELGRIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYMLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Synthesis of Novel Diarylamino-1,3,5-Triazine Derivatives as Fak Inhibitors with Anti-Angiogenic Activity.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 81
structure length 259
sequence length 272
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4brxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4brxA01
3O8TA 3R7UA 3QKKA 2NPQA 5IZFA 5J5SA 2W1HA 2QG7A 3W8QA 3ZXTA 4Z55A 4D4VA 2GS2A 2HYYA 3IONA 4L43A 5EM8A 4Y83A 3C50A 4H36A 3SQQA 3PXKA 1B38A 4CSVA 5L2WA 3R83A 3ZC5A 1WFCA 1PW2A 3PA3A 3PXRA 1OL1A 4PF4A 3TZ8A 1MQBA 2YM6A 4XOZA 2XCHA 5CEIA 4BTJA 1H01A 5I9XA 3GCVA 3R7VA 4DH1A 4CFUA 4GH2A 4QMYA 5BVDA 3DNDA 3O50A 4OTDA 2P33A 4X3FC 5L2IA 4ENYA 3COHA 4N57A 2CGUA 2WMXA 3D7TB 3DFCB 5EYDA 4G34A 3DY7A 4KKGA 4I0RA 3E7OA 2C69A 5A4QA 1MQ4A 1XBAA 1ZYCA 3AT3A 4IX3A 5CVGA 4ONAA 2EUFB 5J95A 3WI6A 3O7LD 2O0UA 1WVWA 3LCDA 3D7TA 2WMAA 1M52A 2XJ2A 2ITOA 5EHLA 4FZDB 4MXCA 2R0IA 3R8UA 3C9WA 2BTSA 1K2PA 4WBOA 3AC1A 5HE1A 3S2PA 2EXEA 3GC8A 3E3BX 3D5VA 2XYUA 1GAGA 1KOAA 2J0KA 2QOHA 5BYZA 5IF1A 4QPMA 2XK9A 4BGHA 3GXLA 5LJJA 3O0GA 2I1MA 2V7OA 2VX1A 4FVPA 4H3PA 4KS8A 5HD7A 4C35A 3MDYA 4FNXA 1SM2A 2HW7A 2PPQA 3SXRA 4WBBB 4FMQA 4I6BA 4MXZA 5AR3A 5AUYA 2OJJA 3ROCA 2W5AA 3Q5ZA 3R1QA 2ESMA 3C4FA 3PJ1A 2R3RA 4EJ7A 4MD8E 3AC5A 1G8AA 4FIIA 4QYHA 3JVSA 3BI6A 4FICA 3ZCLA 4DG2E 2NNWB 3I6UA 4X2KA 3HMOA 4IE9A 4CRLA 4AWIA 1PMVA 3I0QA 3FPQA 2Z7LA 4BICA 2YAAA 4AN3A 3LMGA 2PU8A 3KCFA 3HMMA 5IUGA 2WMRA 2YJSA 3F6XA 4HPUE 5JSMA 3V6SA 3AQVA 3BV3A 3I79A 2YIYA 5EDRA 3ORLA 4LMUA 5CVHA 4JJRA 3O8PA 1OUKA 5TR6A 3LPBA 3MVMA 4FVRA 4Q9ZA 5C1QB 3KMUA 3N51A 5C4LA 2J51A 5CT0A 4PPBA 3UNZA 3DXPA 4DGLC 4O2ZA 3R7GA 2JAVA 1R3CA 2X8EA 4QOXA 4Y85A 4ZSLA 2QHNA 4KAOA 4BY9E 5IA5A 1YDRE 2BILB 2XK7A 5BMMA 4AQCA 3VUIA 3L9MA 4D0WA 2WQEA 1VEBA 4NJ3A 3QA0A 5HGIA 5I3RA 3TV6A 4TW9A 2VD5A 5HE3A 4C2WA 1A06A 4B8MA 2VWIA 3QTWA 4D58A 1ZMUA 1LR4A 4L7SA 2YIWA 2UZDA 3I4BA 3PRIA 2B9HA 4D4RA 4ALUA 4H05A 4W9XA 2A27A 5FDXA 4MF1A 5HU9A 4AG8A 1YWVA 5GZ8A 5IEVA 4EORA 5FDPA 5E90A 3KXGA 3QTSA 3BHUA 4Y73A 1BLXA 2GNHA 3LFAA 4GFOA 4IWQA 4OTFA 1XJDA 4AP7A 4RLKA 2ZB1A 2Y4IB 4FTRA 3L8PA 4CKIA 2ITXA 1FPUA 4O7TA 4NU1A 1TQPA 3UGCA 1YKRA 3VVHA 2W0JA 5FEQA 5JQ5A 3BYMA 2O65A 2H8HA 3C0GA 4JVGA 4BTFA 3ORZA 4IDTA 5FXSA 4F1OA 2BR1A 4ANOA 4CZUA 2JEDA 3QTIA 3UPXA 2XEZA 4XP3A 1Q97A 1QL6A 1QPJA 4BBMA 4QP2A 4HVIA 1CKIA 2CLQA 2UZTA 2OXYA 3VS4A 1QMZA 3K3IA 4KUJA 1I09A 3NAYA 3FL5A 3WARA 4JBOA 2UVYA 4Y95A 2YJRA 5D7AA 3F7WA 2ZM4A 4M84A 2I7QA 4JAJA 5EH0A 3F69A 4JNWA 4L3PA 4O7NA 3O23A 3QYZA 4XEYA 4LGGA 3RINA 2VO3A 2X9EA 1YW2A 4MQ2A 3MB6A 2WTIA 5AEPA 3FKOA 4Y5QA 3P86A 4O84A 4PP7A 4PTEA 3CS9A 4DFXE 2BROA 2W17A 5EHOA 3BGZA 4YC3A 3NZ0A 3P9JA 2UVXA 5AV0A 2G2HA 4ANBA 1URWA 3DK7A 2OF2A 2Y4IC 5BVEA 3ORTA 4IWOA 3UOLA 3A8XA 4KIKA 3V8SA 3ORXA 1U46A 4LOPA 2GQGA 2XA4A 5AAEA 2CGVA 5IDPA 4B0GA 4RJ7A 4CVAA 3OWLA 2QHMA 5CEMA 4FE2A 1YXVA 3HX4A 2C6TA 3KRXA 2XK3A 4BC6A 4QMXA 4EOPA 2PE2A 5M51A 4FKRA 1BI7A 5IH4A 4P2KA 3JPVA 5AIRA 4F6UA 3ITZA 1W0XC 5KMLA 4NT4A 1U5RA 1WMKA 3ZSGA 2WTWA 2XK6A 3NCGA 2BPMA 2P0CA 4U97A 2QOOA 4HZRA 3WE8A 2C1AA 4C3FA 5A46A 3P78A 1E1VA 2J50A 4YO6A 1STCE 4C37A 4UZDA 4ZSEA 3JYAA 4JIAA 4FIJA 4GT5A 3QD0A 5K3YA 3TM0A 4WNOA 3IQ7A 3ANQA 2VWVA 1OL2A 4RBLA 1OZ1A 3CJFA 1P4OA 4G3GA 5HO8A 5B2LA 3V5LA 4L42A 5AUVA 4B7TA 4U42A 5I9ZA 2O64A 5KO1A 4KIQA 5LMAA 5ANIA 4RIOA 2QNJA 3KC3A 2VWBA 4J95A 1WBPA 4L7FA 4R8QA 3DBQA 3DKOA 3EZVA 4ZY5A 4QYFA 3TUBA 3JR1A 4IAKA 2Q83A 4FZ6A 3DNEA 3OOGA 2I6LA 3QLFA 5EHYA 4BFMA 4TYHB 1UNGA 2QU5A 2ZDTA 3TNQB 1ATPE 5A4LA 2RIOA 2VX0A 3GENA 4FKPA 4FTMA 2C6MA 2JLDA 3E92A 3CEKA 4FG9A 3RP9A 5FQDC 4RX8A 4O2PA 4F70A 3EFLA 4HCTA 4CLIA 1H1RA 1FGIA 3PZEA 4IBMA 5BVWA 2P2HA 2W1ZA 3QWJA 4QP9A 3DTCA 1LPUA 2VGPA 2UW7A 4UMPA 3LLAA 3BGQA 3HRBA 3OC1A 1UU7A 3CY2A 3A60A 2R3HA 2W06A 2ZMDA 2I0YA 4JG6A 4YJQA 4BIBA 4C61A 3V01A 3GOKA 2X39A 5AJQA 1UWHA 4XCUA 2CCIA 2W9FB 3QZFA 5K9IA 2YAKA 2WELA 4LGHA 5CI7A 2PK9A 3AT4A 4R77A 4HVSA 4PTGA 4C2VA 4BDJA 1JOWB 3E8EA 4GL9A 2B9FA 3ZRKA 4CMTA 4EOQA 4WNPA 4CKJA 1JSVA 3QCSA 5I5ZA 5HZNA 3QRKA 2VV9A 4OAVB 3QTZA 2WZJA 2HXLA 3FV8A 3KXNA 3PXZA 4FTUA 4IVCA 3QUPA 3BU5A 4WG4A 3MVLA 3EZRA 2OBJA 4QMZA 5EOBA 4EKLA 4UN0C 5CT7A 3LM5A 4F9CA 3SX9A 2W7XA 4XLIA 4FZAB 1H25A 3B8RA 1GZNA 3FZTA 4FK3A 5ICPA 3P23A 1CDKA 2CSNA 5ANEA 1XH7A 3V04A 4RIWB 4FYNA 2HXQA 4BI2A 4PNKA 3BEGA 2J7TA 2W9ZB 2YIXA 1UVRA 3DB6A 3O8UA 3JY9A 4RIWA 1XH5A 4I5CA 3HAVA 3VS0A 5K0KA 3KA0A 5JH6A 4CQGA 4K6ZA 3IDPA 2ITQA 4TNBA 4PPAA 3V5JA 3VS1A 5CX9A 3A2CA 5B2MA 4XV3A 4DCAA 3OWKA 3PXQA 5CQUA 4DHFA 1YI6A 2B4SB 5JEBA 3QL8A 5CNOA 3E64A 4IFGA 4U43A 2WQOA 1UU3A 2WOUA 3NLBA 3AC8A 4M97A 4QQCA 4EOIA 3WF8A 1UA2A 4ACHA 5L8KA 4MXXA 3VBVA 1IR3A 2CHLA 4EWHA 4RJ6A 2IW8A 4D2WA 4FBXA 2VN9A 2X4FA 3ZH8A 4BCGA 2VAGA 1BX6A 3DBCA 3MB7A 1NVRA 2Y9QA 2WGJA 3AD6A 3FPMA 5C26A 4MVFA 2PMOX 4E73A 3L1SA 5DI1A 4L44A 4YJNA 5KBRA 5FP5A 4M0YA 4IEBA 2IZTA 3LQ8A 4MTAA 5AUXA 2GS6A 3GCPA 5ACKA 2YZAA 5CF8A 3OUNB 2G9XA 4LRMA 1PY5A 3OP5A 3NVMB 2QOFA 2OU7A 3LZBA 2WD1A 3FI4A 3H0YA 3CY3A 2BTRA 4FEQA 3CKWA 4JI9A 4V0GB 5C8MA 3PY1A 3NPCA 3VBXA 2F7ZE 3A4PA 3AGMA 3DDPA 4G1WA 4XG7A 3NUYA 2PMLX 4KBCA 4C36A 4BKYA 4XG6A 5HBJA 2IW6A 4CFVA 2VNWA 4Z16A 2ETRA 5IU2A 2WAJA 4V0GA 4R78A 5KCVA 5LQFA 1Q62A 2YCSA 3A7IA 1KE9A 3H30A 2JFMA 5CSWA 5CSVA 3VUHA 4BYJA 4TXCA 3OROA 3ZLXA 3W2CA 4I5MA 4AAAA 4JBPA 4D9TA 3BELA 3EJ1A 3DKCA 2Z7RA 1M2PA 2OXXA 4GJ2A 2QKRA 3OT3A 1K9AA 4C33A 4P5QA 2AC3A 4YC8A 5KX8A 4IZ5A 2CNUA 2X7OA 3P7CA 4EH7A 3Q2JA 5A4TA 4NL0A 2O5KA 5HI2A 3BLRA 4MX9A 3Q6WA 1VYZA 4TTHB 1U4DA 2FSTX 2XIRA 2Z2WA 4UV0A 5ANOA 4ZTQA 4D2TA 2W1IA 5BVOA 3OEZA 5C8NA 4BDFA 1JSUA 4QP8A 4BCFA 4EK3A 5IDNA 3JY0A 4YZMA 3SVVA 4EONA 4HJOA 2J0IA 1XH4A 3Q9WA 1MUOA 1XWSA 4UWBA 3VF8A 4W4XA 3R01A 3Q5IA 3IW7A 4Q9SA 4IW0A 4ZJJA 4KABA 4RX9A 2ZV8A 3DAKA 5H8GA 1PKGA 4N6ZA 4WKQA 3I5ZA 4FX3A 1WVXA 2V62A 3ZDUA 3F61A 4IC8A 3UDBA 3FMNA 3RPYA 3VBTA 5EW8A 3RK7A 1IRKA 3RPSA 4U41A 4BDGA 3K5UA 2HENA 3ZMMA 4O83A 4PY1A 3FHIA 3MN3A 2HW6A 3SLSA 4F65A 5IUHA 4LI5A 4MKCA 5HEZA 3CXWA 3R8ZA 3KKVA 4FIHA 3WBLA 2CCHA 1Q4LA 2I0EA 3R7OA 3U4UA 2X2MA 1P5EA 2J5FA 4RVLA 2QOIA 2RF9A 4HGEA 5FBOA 1FVVA 1OPKA 2DWBA 2WTCA 4RJ4A 3RCDA 5HTCA 2HZNA 3OEFX 3E7VA 1DM2A 5DGZA 3UP7A 5IA4A 3ID6C 3R00A 2JKMA 5CSXA 4DGOA 4F7JA 5FTGA 4PX6A 2OH4A 4YMJA 3ALOA 3HV7A 1Q8ZA 4PMSA 4W8EA 5KMOA 1PMEA 3PWYA 4JL9A 4EUUA 3EN6A 1RE8A 3R04A 3MPAA 5AUUA 3Q4ZA 4W4VA 4DH8A 3ORKA 4GMYA 5IUIA 3FAAA 5E8SA 2YCRA 4O7LA 1CSNA 4IHPA 4AZTA 1BL7A 2YISA 5HX6A 3FQHA 1F5QA 1JKSA 4N0SA 4ZJVA 2BCJA 4G5PA 3PRFA 5D11A 3HEGA 2B9JA 3FDNA 4U3ZA 5E8VA 3QLGA 1KV1A 3ODYX 3QGYA 3RM7A 5CALA 4CLJA 3Q04A 3DK3A 5HO7A 5CENA 3FMLA 4GT4A 3QQJA 3LFDA 3QC9A 3GQLA 2JITA 3R2YA 1YVJA 2GCDA 4FKOA 5CNNA 2GHLA 2HOGA 3D5XA 3FMDA 3NWWA 4LOOA 3ORMA 5HESA 4O22A 4XBUA 4R5YA 2XNPA 3ZFYA 4R3CA 3R9NA 1MRYA 3WF6A 3AMAA 3DQXA 5CAOA 3HRFA 2J0LA 3U9CA 4FGBA 3PYYA 3OHTA 3UOJA 4NM5A 4JT3A 4DG3E 4I20A 4RC3A 3A4OX 3L8SA 5D10A 3GUBA 4YU2A 4RVMA 5E8YA 4AGWA 5AR4A 3DU8A 4MF0A 4IAAA 4F7SA 2HWPA 2IVTA 2UZEA 3FZ1A 3V8WA 1YXTA 5HNBA 2YHVA 2QOCA 2RFDA 4X21A 2J5EA 3AXWA 3FZOA 5DH3A 3TTJA 3VJNA 4RLLA 1REJA 5HQ0A 4YZBA 4E4NA 1UKHA 3OF0A 4YSMA 5AP2A 2F57A 5IMEA 2OJ9A 1JPAA 2VTPA 3EYHA 3GB2A 3IG7A 3ENHA 3OXTA 2Z7SA 2XF0A 3DS6A 4RGJA 3EQHA 3GU8A 3BHVA 5CEQA 1G8SA 4LM5A 1U54B 3NIZA 4QO9A 1J1CA 5C01A 3W10A 1OGUA 4NJDA 4JBVA 3DAJA 3EL7A 3K3JA 4ZOGA 4EK5A 4D0XA 4F08A 1ZMVA 3SG8A 3ATSA 1Q8WA 2H34A 4FSNA 4E3CA 4RWIA 4JR7A 2YM8A 4IQ6A 4XG8A 5CU2A 1U54A 5AM7A 5DT3A 4AZEA 5AV2A 4DEEA 4FV9A 3VJOA 1FINA 3VO3A 2Y7JA 3VQUA 1M2RA 2ZV2A 2BRGA 3EIDA 3PP0A 4XYFA 5LMKA 3CTJA 3WYXA 5EDPA 2PUNA 4IM2A 1IG1A 3QHWA 5LVNA 5EQEA 3AD4A 3NUAA 3E87A 2REIA 4DGNA 1UKIA 5IQIA 2W1CA 3UOKA 2ITVA 3T8OA 4YR8A 3U54A 3LM0A 5AR5A 3LCOA 5A6NA 2C0IA 4RVKA 3OWJA 2PZRA 4FSMA 4GT3A 2ITZA 2XKDA 3LFFA 4AOJA 3TIZA 2JBPA 4H3QA 3FZRA 3A7HA 3IKAA 5DHJA 2JIUA 2ZV7A 4RPVA 4FSQA 4QMUA 5AWMA 3GC9A 3RPVA 4MH7A 4XNEA 5J8IA 4DFYA 4EOMA 2ZM3A 3HP2A 5FD2A 4QTEA 3ORIA 3PSDA 4JQEA 4RZWA 5CZHA 2BDFA 3F5XA 3QQLA 3RK5A 4XV9A 3F9NA 1NT2A 4PDOA 2VTMA 4BIEA 2WKMA 5ETFA 5LMKC 2VTNA 2VWYA 3I6WA 3D83A 5E91A 4A06A 2QOLA 2ZMCA 4Y72A 4ACMA 4BF2A 5FP6A 1UU9A 2BIYA 3HZTA 4JX7A 3TNHA 3E88A 1NXKA 3FLNC 2QONA 2YDKA 3W2SA 4RWJA 3KL8A 5AUZA 3IGOA 3JXWA 4RIYB 2FO0A 2UZVA 2XKCA 4HVHA 5ETIA 2XNMA 4F1TA 3H9OA 4BDEA 3VS2A 2VTOA 3CQEA 3IGGA 3PJ2A 3FMHA 3KXMA 2QOKA 5BNJA 1H1SA 4ALVA 4JR3A 4QMLA 3CQUA 4ZZOA 3IECA 4E1ZA 1P14A 2X0GA 3ZUVA 2YITA 3TEIA 1YI4A 4GK2A 4FTCA 5LWMA 4D2VA 2UZUE 5M4FA 3FQEA 1OL7A 2YN8A 3F2NA 3OCBA 1GZOA 4GRBA 3RZBA 3NYXA 3UQGA 2WU7A 4ZY4A 3QD2B 4ASEA 4YC6A 4UB7A 3BRBA 2YABA 4ZTSA 4UBAA 1O9UA 2LGCA 2ERKA 3BQRA 4ZTHA 4YHTA 1E9HA 1YXXA 3DZOA 4OTRA 3PSBA 2EVAA 2YCQA 1HCKA 4A4LA 4ZP5A 3VBQA 3W33A 3Q9ZA 4GIHA 3RAKA 2C3KA 4X6RA 5DE2A 5E8TA 2W05A 4C62A 4F99A 3QQGA 2E9VA 1OKYA 3Q32A 1BI8A 4A7CA 4FI1A 3FKNA 3O51A 5KMNA 2W4OA 4D2RA 4O7WA 1SNUA 5CF5A 2J9MA 4ZS0A 2A1AB 2ITTA 4L00A 3D15A 4R7BA 4HYIA 3HKOA 1VYWA 2HZ4A 4IX5A 4EHEA 4ZEGA 3UO6A 2QOBA 5ETAA 3VRZA 4AN2A 2E9OA 4ZZMA 4G6OA 4O7ZA 4E8AA 3THBA 3ULIA 3P7BA 4OTHA 4F9WA 1W84A 2HY81 1SVEA 3A7GA 4NFNA 2CGXA 3RJCA 4WO5A 2J0JA 2J4ZA 4FKWA 2I0VA 3OFMA 3IW8A 2R0UA 3L9LA 4APCA 3VBYA 3F2RA 1RJBA 3DFAA 5HICA 3GGFA 4GIIA 2F7EE 3D94A 3I7BA 3OCSA 2R5TA 5HORA 4J96A 4DEHA 2AUHA 1BL6A 4YURA 3H0ZA 4PL4A 3MIYA 4EYJA 5EM5A 5C03A 3F7ZA 2JC6A 4YTIA 5HG9A 1ZAOA 4QMOA 4CV9A 4FKIA 4OBPA 4XG4A 3LCSA 5EM6A 4D2SA 5AA8A 3PDTA 2QURA 3TT0A 3DV3A 1YHSA 2JKQA 3NR9A 5B0XA 3KREA 4FKGA 3FXZA 3D5UA 2E9NA 4DT9A 4O1PA 3WF5A 3N4VA 4BR3A 3LFBA 4EOJA 3UG1A 4GKHA 2XB7A 3UG2A 5IQFA 3CR0A 3II5A 4BCQA 4B9DA 5IMXA 1H28A 2R3PA 3K5VA 2XM8A 3VULA 3WZEA 3ZO4A 1WBSA 4KB8A 4LFIA 1H00A 5CAVA 1R0EA 1H26A 3EFWA 4G6NA 4PV0A 5LVPA 3DPKA 4A9UA 4PL5A 3VW6A 4E4XA 2C5NA 1Z9XA 2IVVA 3QCQA 2FB8A 4E6AA 3MS9A 5CSPA 1WBVA 4C3RA 4C4HA 3OMVA 4FV6A 4QNAA 5D7VA 4EEVA 2B52A 3KRJA 3P1AA 2DYLA 3H9RA 4FV5A 1L3RE 2PZ5A 3EN7A 1SNXA 4X7QA 1H24A 5BPYA 2Y4PA 3RNIA 1OL6A 3SRVB 3KK9A 3TKHA 5DEYA 4QRCA 4AGDA 2WQNA 4BGGA 1URCA 4U79A 2BAKA 1OMWA 3OW3A 4F1MA 2OZOA 3A61A 4DFNA 2P55A 3UNKA 4EK4A 3PPZA 5TF9A 4DFUA 2OFVA 3DBEA 1P4FA 3NNUA 3W32A 4BHZA 3MBLA 2ITWA 4WUAA 3TV7A 3UC3A 4ZLYA 3BPRA 3PG3A 4IAYA 1OBDA 3C0IA 4ZMEA 3F2AA 5L6PA 3LXNA 4AA0A 3BU3A 4R3PA 4F6SA 2X2KA 4HNFA 4OTIA 5CF4A 4OBQA 2XKFA 3CGOA 4NSTA 4J99A 4TWOA 3NYNA 2CN5A 4FTKA 5KMIA 3DXQA 2XNBA 4TYJA 4PQNA 1M7QA 3RPRA 2CNVA 2QVSE 3ZLSA 4G17A 3R9OA 4ZIMA 5CAPA 4IMYA 1HOWA 3PJ8A 2CN8A 3GCUA 4FSTA 4XLVA 3UIUA 5KZ0A 4E4LA 4J7BA 5J9YA 1Z5MA 5EG3A 4F0FA 2ITPA 2UZWE 4L45A 5HBEA 2JFLA 5T68A 1YHWA 3DJ5A 1PXLA 2BZHB 1AD5A 3FZPA 3RPOA 5A4EA 4PP9A 3DB8A 3PP1A 1A48A 5C4KA 2PE0A 5AP6A 2OO8X 4FT5A 4YJRA 1XBBA 5KNJA 3F82A 3TWJA 2JGZA 4D28A 5KHWA 4KKHA 4AE9A 3ZU7A 4R7HA 2C5XA 2GHGA 4LV8A 2EB3A 3MESA 3OW4A 3DGKA 1YWRA 3MPMA 4IB3A 1JKLA 4Z7HA 3KRWA 5JT2A 2BFYA 2ZAZA 3BIZA 3LFCA 4G16A 4KIPA 4O86A 4FKSA 3HYHA 4O0YA 5HG8A 4ZTNA 3BGPA 2IW9A 4F9YA 3D2IA 1YXSA 2XIKA 1H8FA 3HVCA 4NIFB 2VTQA 3KMMA 3U6HA 4D9UA 4TKSA 1J7LA 2WTKB 2PHKA 1FOTA 4MNFA 5HBHA 3UQFA 2XH5A 3QX2A 4NIFA 4FSYA 3VUTA 5LVMA 5ANJA 3O71A 2ETKA 2CLXA 3ETAA 5M57A 5I4NA 3R8PA 3N4UA 2F4JA 2Z7QA 5IQCA 2AC5A 3UO5A 3L8XA 4BDDA 4MHAA 2CMWA 2V0DA 4EUTA 4RG0A 3OCTA 3BHTA 4I4FA 5C27A 5LVLA 3WZKA 4I0SA 3G15A 2GFSA 5AV1A 1YOMA 4EC8A 3E8DA 4OT6A 4ASDA 3MFSA 4HNIA 4Q2AA 4O6LA 5JRSA 3RI1A 4DGMA 2GNFA 2XK4A 2G1TA 4UWCA 4R3RA 3ZONA 3FMMA 2IZUA 4IZ7A 2WMUA 3LCKA 3FI8A 4DFBA 2X2LA 2C0OA 4XP0A 3EOCA 3S00A 1WBNA 2ITYA 1WAKA 4OT5A 3G2FA 3P4KA 4AZVA 4R1YA 3PE2A 4IVBA 3LXLA 5JFXA 5T6KA 4ANMA 2YWPA 3MSSA 3VBWA 3NNXA 5EK7A 3R9RA 2CDZA 2XNNA 4N70A 4PTCA 3ERKA 3ALNA 2QO7A 4K18A 4IDVA 3SKCA 1ZYJA 5DG5A 3QWKA 5AX3A 4G6LA 3TN8A 4BWXA 3Q4CA 2OSCA 4LV5A 3M1SA 4RQKA 4DE4A 4AXAA 5BVFA 2B9IA 2WTDA 5IG1A 1JSTA 2HCKA 2VTHA 3AC3A 4OTPA 3BE9A 4FZFB 2CKOA 4I6QA 4S30A 1H0VA 3U9NA 2R64A 4NTSA 2Y8OA 2YCFA 3DKGA 3PXFA 3QTQA 4C4JA 3MI9A 4TY1A 3A7FA 3MIAA 4C57A 5JMSA 2AYPA 5BVKA 4PRJA 5F1ZA 4EC9A 3GQIA 4WT6A 4A4XA 4BBEA 3R1NA 2QO9A 1R1WA 4ZZNA 4L53A 4HYUA 3F66A 3VIDA 3U51A 1XHAA 3LQ3A 4IB0A 3HUBA 4F0GA 4GFGA 3RKBA 3C5UA 4HOKA 2C3LA 2PVRA 4D1SA 4EKKA 4USEA 1ZZLA 2IG7A 3DBDA 3CTQA 4MWIA 5A6OA 2WXVA 4TYHA 4YZDA 3ZRLA 3HP5A 3G5DA 4J71A 4KA3A 1KV2A 4FNYA 4H3BA 3OT8A 4NCTA 4ORKA 3F3ZA 4EZ7A 4MD9E 1GZKA 3AD5A 3PVWA 2GNIA 5IQEA 4OW8A 5GZAA 5G1XA 2BRNA 4GVJA 4IB5A 1Q5KA 5JGBA 3R8VA 3UC4A 3Q9YA 5L2TA 3RGFA 3B2WA 4R1VA 3RAHA 4JRVA 2EB2A 2V7AA 1OKZA 5DA3A 2PVHA 4A9SA 3D14A 3AG9A 3TZ9A 1KWPA 4C38A 2C0TA 4D2PA 2JDVA 2O63A 4Q5HA 3WIKA 4CMUA 2FSOX 4KD1A 4K1BA 5AP1A 5C9CA 4U6RA 2XJ1A 3DAEA 1ZOGA 2OJFE 3R9DA 3F3TA 3PA4A 2QC6A 4YBKA 4DLIA 5KKRB 3PLAE 3BKBA 5E7RA 4XH6A 4PDPA 4E5AX 5JGDA 4NCTC 1W82A 2BRMA 5L4QA 4L46A 5DIAA 5HKMA 2UW0A 3ORPA 2Y6MA 2B53A 5HG7A 4D4YA 3EQIA 2C5YA 1XH9A 3OTVA 3QTXA 4KRDA 1REKA 2BHHA 2VRXA 2CPKE 4HPTE 3VS7A 4MD7E 5JRQA 5DOSA 3G0EA 3R63A 2JDTA 4I4EA 1GJOA 3HV4A 4MWHA 4FA2A 2JDRA 3QU0A 1T46A 3UIMA 4IJPA 4CRSA 1R0PA 3GU4A 3PY0A 2ZVAA 4DTKA 3Q3BA 2JBOA 4B4LA 3ZM4A 1IAHA 4EOSA 4BRXA 2PZYA 1OBGA 1SZMA 4RJ5A 1BMKA 4C02A 4XV1A 2UZBA 5H9BA 4YLJA 4M12A 5CANA 3ZYAA 4LQMA 2H6DA 2QKWB 2C6LA 4ERWA 2GSFA 2R3FA 5DPVA 3CIKA 4FSWA 4ZY6A 4EJNA 1UNLA 2H96A 4AOIA 4E20A 2VWUA 3NW5A 2C5OA 3OTUA 5HNGA 2YLFA 4QMPA 4OAUC 5TO8A 1S9IA 5FWKK 4EOKA 2RFNA 4KS7A 5AP3A 5IQHA 3MY0A 4FTJA 3NYVA 4ITJA 1KE5A 1W83A 4M3QA 5DR6A 4CV8A 4EK6A 3GC7A 5J7HA 3WYYA 4GG7A 5M44A 2VNYA 2WQBA 2WU6A 2ITUA 2Q0BA 5HIEA 4WRGA 3S95A 3SD0A 4QNYA 4C3PA 4FEXA 5JFVA 4RJ8A 4AT5A 3SGCA 5AAFA 5HE2A 2XNEA 4NEUA 5JZNA 4E5BA 1W8CA 3EQGA 5HCZA 3MV5A 5CLPA 5KMJA 4BCOA 4E7WA 4L3LA 4LMNA 4E6DA 2E9PA 2WO6A 3O2MA 3EN5A 4FT3A 3I0OA 3QUEA 4XV2A 3WE4A 2PUIA 3G90X 1ZWSA 2ETMA 3QZHA 4G31A 2C3JA 2C68A 3KVXA 5AUWA 3DLSA 3I5NA 5FUTA 3OWPA 1Y6AA 5EI6A 1FMOE 1JKKA 3H10A 1PXIA 4FEUA 2V55A 1Q99A 1YI3A 2XEYA 3R02A 3GNIB 5JQ8A 3GVUA 1XO2B 4X2NA 4GKIA 1EH4A 3DT1A 4TT7A 3QUDA 4D1XA 2RG6A 2HZ0A 2ZB0A 2QCSA 4FTLA 2GNLA 5I9UA 3JS2A 4B99A 1IA9A 4BVUA 3PUPA 4JAIA 3R71A 3ULZA 3ZHPC 4BI1A 3EYGA 1PKDA 3AMYA 4IZYA 4W9WA 3IO7A 5DLSA 3TUCA 3QCYA 5DR2A 2WQMA 1XBCA 4FTIA 4RC4A 5A4CA 4XJ0A 3FJQE 2F2CB 3V3VA 1GOLA 4ACDA 2HK5A 4Z7GA 4O7SA 2PUUA 2A4LA 4IADA 3LKMA 2VU3A 3COKA 4DTAA 3TG1A 4O6EA 2BAQA 3MTFA 5CF6A 1KOBA 5AX9A 3NW6A 1MRVA 3CD8A 4HVDA 2R7IA 4Y5HA 5AMNA 2VO0A 5D12A 4JXFA 5BYYA 2I0HA 4CTBA 2R3QA 3KF7A 2YACA 1TVOA 4JG7A 1PXNA 4WSYA 4LYNA 4O0WA 5FM3A 1P2AA 2QLQA 4YJUA 4APPA 1M2QA 3HRCA 4V04A 4BCIA 3FMKA 4YJSA 5CXHA 1APME 4AFEA 5CWZA 4MXOA 4DH7A 4OTGA 2KULA 3IOKA 5DMZA 4XBRA 5DT4A 4ASXA 1ZLTA 4M67A 5TE0A 4RMZA 4CCUA 1OIQA 3CQWA 4EBWA 5AA9A 2QR8A 4MK0A 5J5TA 2PYWA 4WOVA 3F5GA 2EWAA 3WF7A 4CG8A 1VJYA 3HV6A 3NSZA 1F3MC 4S33A 3HDMA 3WZJA 3ZZWA 1V0PA 2OG8A 4CT1A 3G51A 3FE3A 5AV4A 5H8EA 1J3HA 4O91A 4CFNA 3QXPA 2Q0NA 4TYEA 3QA8A 3LOKA 4NZWB 1Q8YA 4ZSJA 3ZBXA 4PMPA 5CAQA 5EFQA 5HCXA 3LCTA 5A54A 1SVHA 3FLSA 3MY1A 4DT8A 2XNOA 4X6QC 3DCVA 2WPAA 4IZAA 4DEIA 2Y0AA 2CKEA 3V5TA 3VUGA 3ZUTA 3UODA 4PWNA 3UMWA 2VO6A 3G6GA 1R78A 1M14A 3IS5A 4N4SA 3MYGA 4EI4A 3R7EA 3HA6A 3UIBA 5E8WA 3NGAA 4X0MA 4X2GA 1IEPA 4K8AA 3W1FA 1Q61A 2X7GA 4YGAA 4FL3A 2XJ0A 3PIXA 3P7AA 4FEWA 4DF3A 2BRBA 1ZYSA 5HOAA 4W8DA 4QTCA 1XH6A 2BALA 1R39A 3A7JA 5CSHA 2O8YA 4YJVA 2QU6A 4J98A 5KE0A 4NKSA 3RWQA 4AE6A 2YIQA 3HMIA 4AU8A 4S34A 2H9VA 4LG4A 5IISA 2R9SA 4GG5A 4RQVA 1NA7A 2JDOA 4UYAA 4NTTA 4UXQA 3OZ6A 2X8DA 4BDAA 3ENMA 5FM2A 4BKJA 3MPTA 4B6LA 3C7QA 2WMSA 4I5HA 4RSSA 4IWPA 2OIQA 2R4BA 2XMYA 4NW6A 5IA2A 4EK8A 5DT0A 2WMWA 3ZOSA 3PXYA 2UV2A 3R0TA 4UYNA 4WSQA 3VN9A 5AFVA 4O27B 3GC0A 5FXQA 5AR7A 2J90A 3U87A 2VTRA 5BUJA 3LMIA 3AMBA 3CE3A 4C7TA 3BLQA 3KXZA 4QQTA 5IQGA 3QQHA 3DDQA 4O0XA 4O7RA 4FV3A 3QRJA 1YOLA 4YHJA 1ND4A 4PL3A 4AZSA 3FQSA 1OUYA 3LFQA 3IOPA 4JLCA 3W18A 4BTKA 3PVGA 1Z57A 3DTWA 5CTPA 3FMEA 5LCKA 1J7UA 2KTYA 2O2UA 3VS6A 4EOLA 2C6IA 2WMBA 4XX9A 3MFUA 1DAYA 3ZO1A 5HO6A 3F3WA 2OK1A 4E5WA 4EHGA 1JAMA 1PJKA 3TUDA 1ZARA 3BWJA 3QZGA 5M55A 4GJ3A 4ACCA 4TL0A 1NVSA 1S9JA 2SRCA 4XUFA 2C30A 3LXKA 4AS0A 2WMTA 4XG2A 4DA5A 4JBQA 4ANLA 3GFEA 5DVRA 3HL7A 4RRVA 3W2QA 4AOTA 2YFXA 3LVPA 4O7YA 4IAFA 5M4UA 3QRUA 4KKEA 5AP5A 4DH5A 2GNJA 2B54A 3IDCA 3S0OA 1U59A 2GU8A 4MBIA 3KRLA 1Y8GA 3RM6A 1GIJA 3EKKA 3S4QA 3NCZA 4LOQA 2BHEA 4NYEA 3G9LX 4DN5A 3IPHA 4JG8A 5IEXA 5IQBA 5ANDA 1OIYA 4U45A 4BKZA 5M08A 3V6RA 3KULB 3CC6A 3VUKA 3M11A 2RKUA 2XZSA 2PSQA 3PIYA 1OIUA 3K54A 1BKXA 3LE6A 4HGTA 4EL9A 2YM7A 1YWNA 4RWLA 4FEVA 3A8WA 4O0UA 1WBTA 4ACGA 3H4JA 2VUWA 3ZEPA 2OKRA 3FMJA 2XRWA 3UBDA 4IB1A 2EXMA 1M7NA 4IIRA 4GFMA 5IPJA 3FXWA 5KUPA 4AGCA 5CASA 4IX6A 3E93A 4YP8A 3GU5A 3QXOA 4QYGA 5IQAA 1PXPA 1U5QA 2X6EA 4G3CA 4S2ZA 5FEDA 1G5SA 3S3IA 1KE6A 2A0CX 2XP2A 4FV0A 3FC1X 3EFJA 5KMKA 3TKIA 3T3VA 4EH3A 3MA6A 4O0RA 3UTOA 4RIYA 4K11A 2ITNA 5H8BA 4HYSA 3HGKA 1A9UA 4AN9A 4WNMA 4ZTMA 2WOTA 3D9VA 4OR5A 3UZPA 3RNYA 3CPCA 3C4CA 2PVYA 3AC4A 3KCKA 2NRYA 3OD6X 5CYIA 2PZIA 2GFCA 4TPTA 4CD0A 5EQPA 2GQSA 2FSLX 3C51A 2QG5A 3PJ3A 3FKLA 3NUNA 1O6KA 4DEBA 4BIDA 3OCGA 3RAWA 4ZXTA 4NM3A 5HE0A 5E9EA 3FI2A 5I0BA 3R7YA 4HGSA 4EQUA 4W4YA 4U44A 4BDKA 5M07A 4QMTA 2F7XE 3O96A 4EH9A 4ZK5A 5DNRA 5J79A 4WG5A 5D1JA 2RSVA 3D0EA 4BTMA 5AADA 1K3AA 1PXOA 4WHZA 3EN4A 5E92A 3U6IA 2BZKB 3IW5A 4FC0A 4PPCA 3HMPA 2W1DA 2W5BA 1GNGA 4MQ1A 3DOGA 3TIYA 1ZXEA 3ZSHA 2WMVA 2UVZA 5TT7A 3R22A 4UMUA 2UW9A 4FOBA 1Q8UA 4QTBA 5EI8A 2PMNX 3SC1A 5AUTA 3MH1A 3Q2MA 2V5QA 4N6YA 3VHKA 2QD9A 5HLWA 3PE1A 4G9CA 2UUEA 3A99A 4USFA 3DJ6A 3GU7A 4TN6A 3RCJA 4J8MA 5JK3A 1LEZA 5BUEA 3QKMA 4WIHA 5CY3A 4GV1A 3UYSA 2FUMA 4FKJA 4IVAA 4RWKA 4BCKA 5F9EA 5HD4A 4GU9A 4FUYA 3R2BA 2WIPA 3SA0A 4F4PA 3GEQA 4IM3A 4EBVA 5A3XA 5GNKA 4KIOA 1OITA 2PVJA 4FIGA 5T3QA 4GCJA 4RA5A 3R6XA 5AP4A 3TNPC 3CLYA 4J8NA 3ZDIA 4MNEB 2C6KA 4ANQA 4K2RA 4BI0A 1PXJA 3VRYA 2O3PA 3CKXA 4KWPA 4I3ZA 3FLQA 4PMTA 4ASZA 5EI2A 4DCEA 4O96A 5A9UA 3VQHA 3BBWA 4GU6A 3FHRA 4I23A 4JDHA 2OH0E 3EQDA 2RFEA 4MNEA 4RZVA 2XVDA 4R6VA 2OXDA 2J2IB 5AIKA 5HHWA 3C0HA 4BN1A 5AAGA 3QQFA 4AT4A 4UMQA 2YDJA 3TDWA 4MXAA 3FUPA 3P08A 4YNOA 4YLKA 3O17A 3BHHA 4LL5A 4FKTA 1NVQA 2GS7A 3AGLA 4JDJA 2C5VA 4QTAA 4QMQA 1YRPA 3QX4A 4I92A 5CEKA 3OY3A 4M69B 2ZDUA 4O0TA 2VZ6A 5ANGA 3Q4TA 4QQJA 2EU9A 4TNDA 5H3QA 3B8QA 5DR9A 1XKKA 4O0SA 3I60A 3GOPA 4QMWA 3NYOA 4WD5A 3QHRA 4QYYA 1FVTA 4TWNA 4CEGA 1OPLA 4M69A 4F09A 4I1ZA 1WBWA 3QAME 5DEWA 5CU0A 3DKFA 4R5SA 2WNTA 3G9NA 1YHVA 3N9XA 4U5JA 3E8NA 3ZRMA 4KBKA 4O1OA 3ZEWA 2PVMA 4XRJA 3LJ0A 2W1EA 1CTPE 3PWDA 3ROYA 2OIBA 5K4JA 3RALA 5M53A 5CU3A 1JBPE 4XHKB 4YJOA 3R8MA 1V0BA 3C4XA 3WF9A 4FTAA 4BB4A 4CXAA 4CT2A 3NMUF 1ZRZA 5GJDA 4A9YA 5FGKA 3ZO3A 4EZ3A 5EKNA 5HTBA 3FBVA 2XIYA 2XIXA 3W2RA 4RX7A 4U3YA 2HAKA 2BKZA 2XNGA 3OOMA 3SRVA 2PVLA 3NIEA 4YJPA 3ZBFA 4FG8A 2A19B 4CFWA 2C3IB 2GTMA 4K77A 3UNJA 3LQ5A 3UOHA 4I24A 4O38A 3BQCA 4PNIA 2CJMA 3TZMA 4AUAA 5JKGA 3SW7A 3OG7A 3KRRA 3I1AA 3KB7A 3TTIA 5KZIA 5IA3A 4EH8A 1B6CB 3TKUA 3HMNA 3ATTA 2WMQA 3ZFXA 3UJGA 4EHZA 5IA0A 2B0QA 4YTCA 4MYGA 2YM4A 4QPSA 3LFEA 4C4GA 5J1VA 3DBFA 1NW1A 3LAUA 1OIRA 3TV4A 5HX8A 5M56A 2OJGA 5FTOA 3F3VA 5D9HA 5HG5A 4I5PA 3QD4A 4Q5EA 2HZIA 3ET7A 1H4LA 2P4IA 5GHVA 5GIOE 3NDMA 4ITIA 5ITAA 4FL2A 5GIPE 2PL0A 4G9RA 3PA5A 4YNEA 2IN6A 3HECA 3DK6A 2UW6A 4TYIA 4FYOA 2WEIA 1MRUA 4WA9A 3ZLWA 3OY1A 4ZLZA 4KRCA 2PWLA 4BBFA 1Q41A 4ANSA 3FLWA 1OVEA 5F4NA 3Q52A 1TKIA 2FA2A 4F9BA 4ZS4A 2LAVA 3E63A 4ZLOA 3KN6A 4R7IA 1Y91A 2I40A 4YUQA 2YLEA 4IACA 2HIWA 2JKOA 3D4QA 4DEGA 3BZ3A 4J52A 4DITA 5L8LA 5DWRA 4V01A 1BYGA 3JUHA 3V5WA 4AA4A 5L3AA 4H1JA 4F63A 3T3UA 5LOHA 3RBWA 5ETCA 1H1QA 4RFMA 5FEEA 4M66A 4QMSA 4II5A 5JFWA 3RVGA 2J6MA 3KEXA 5CZIA 2PULA 5HVYA 5E8UA 3EL8A 3QALE 4JOAA 3CSVA 4WG3A 1CM8A 4HW7A 4I93A 3N4TA 1WZYA 4DYMA 4TWCA 1OPJA 3PPJA 4Y8DA 2G2FA 3FY2A 4FL1A 4GVAA 5E8ZA 4EHVA 3TL8A 3CJGA 4ZAUA 3ELJA 3L9PA 3Q60A 3R1YA 2BUJA 2YDIA 2JAMA 4I41A 2Z60A 1Y57A 2W1GA 2HY0A 2IVSA 4YBJA 4IXPA 4K33A 2BAJA 4GSBA 4FTQA 4RFYA 4LUDA 4PDSA 4A9RA 5I9VA 1XH8A 2UZOA 3OXIA 3UVQA 5M4IA 3ZM9A 5IQDA 5IKWA 3TXOA 1Q3DA 3FYJX 4XP2A 4FF8A 1YXUA 2GHMA 3EHAA 3COMA 4H58A 1VR2A 1PRYA 1L8TA 4FV2A 4I21A 3GFWA 4A9TA 2B7AA 1ZY5A 5EYMA 4D1ZA 3LHJA 3CD3A 5CVFA 4M13A 1JKTA 3HDNA 4KIKB 4DGGA 3F88A 5CXZA 4LL0A 4CFMA 4G5JA 4TRLA 3W16A 4DH3A 2FGIA 4CGAA 4GS6A 2VO7A 4M8TA 4XS2A 2WTKC 2W96B 5DYJA 4EQCA 1Q24A 3KFAA 2DQ7X 3EQPA 4O7VA 2NRUA 4G3EA 4QD6A 1JQHA 2W1FA 3MW1A 2IO6A 2XKEA 2G2IA 1KUTA 3B2TA 3SHEA 4FG7A 3OBGA 4E4MA 1UV5A 4C8BA 5LXMA 3MVJA 2JIVA 2R2PA 3TNWA 5E1SA 4UWYA 4X3JA 1TQIA 3RTPA 2JDSA 4U40A 4BWKA 3KN5A 3R7IA 3NX8A 4QPAA 4RX5A 2PTKA 4ZMFA 5LMBA 1UNHA 2W99B 5AV3A 2R3LA 4YJTA 5JN2A 2OGVA 5CU4A 2IPXA 3QFVA 4G3FA 2PMIA 1OI9A 3PIZA 3QRTA 4UY9A 3HNGA 4I22A 2XM9A 4D4SA 5IH6A 4NH1A 4WRSA 1I44A 1SVGA 1BUHA 1J1BA 4MBJA 2C6OA 2GPHA 3D2KA 4O82A 4B8LA 5FRIA 3HA8A 1FBNA 3GU6A 2WFYA 1W7HA 2BZJA 2A2AA 2C6EA 5BVNA 4F9AA 3NS9A 1KE8A 2VTIA 4IVDA 1GY3A 2XCKA 2PVFA 5IH5A 1H08A 4ZJIA 2CKPA 3R73A 4FTTA 4FT7A 3BHYA 2BKKA 4TWPA 5EM7A 5E8XA 2UW4A 3R30A 4CFFA 4AGUA 5FG8A 3RAIA 3M2WA 2ZJWA 1RQQA 2PY3A 2R3GA 3LIJA 4XG3A 4QT1A 4IANA 1H07A 1PHKA 2Z8CA 4BL1A 4U81A 5CU6A 4EYMA 5L6OA 4GW8A 2BIKB 3DQWA 4EH2A 3EKNA 2VTJA 2GNGA 3KK8A 1XQZA 3TJCA 4FTNA 1T45A 3MGYA 3QF9A 4FTOA 3TI1A 2OIDA 4YPDA 4FSZA 1RW8A 2NP8A 3FI3A 3LFNA 3TZ7A 3EFKA 4Z9LA 3UQCA 4LGDA 3QGWA 5LWNA 2HWOA 4F64A 1HCLA 1FMKA 2YERA 2OI4X 4BDBA 2BFXA 4CZTA 3RWPA 4JRNA 1B39A 4O21A 3E8CA 5EKOA 4BCPA 4MEDA 2X81A 3W2PA 5GZ9A 3L9NA 3Q53A 4P90A 3SV0A 1JVPP 2RFSA 4LRJA 5G6VA 4D55A 5FTQA 2OF4A 2F2UA 4OTWA 3QRIA 3R1SA 2R3JA 2XYNA 2F9GA 1DS5A 3NUUA 3CTHA 2GDOA 3FLZA 2YZLA 4C4EA 3BU6A 3LFSA 4S32A 3ZC6A 5ACBC 3COIA 4S31A 5CI6A 3KXHA 3W2OA 5A14A 5KKRC 3F5UA 4QP1A 4BYIA 1QPCA 2XBAA 4L9IA 3QQUA 4D5KA 4YZ9A 4F0IA 5FBNC 4NK9A 5GJGA 4CQEA 2IJMA 4FK6A 4I6FA 3NW7A 3QYWA 4RA4A 3TJDA 2VTAA 3WOWA 4FV4A 4XRLA 4C34A 5BYLA 1UWJA 3WZUA 4C0TA 3E3PA 4BCJA 4KINA 1Q3WA 1OKWA 2CKQA 3SG9A 3FY0A 3PFQA 4DG0E 3ZZEA 3BYVA 3Q6UA 3A62A 3ZS5A 2BDJA 4HCUA 4K0YA 5L2QA 3LW0A 5L8JA 1FGKA 3LXPA 5BMSA 5JGAA 4FKQA 3SOCA 3PG1A 5JZJA 4A07A 4J97A 3BCEA 3VF9A 4L3JA 2IZSA 5K4IA 4USDA 5GINE 4RJ3A 3AOXA 3ZTXA 2WHBA 1DI9A 3TNIA 3Q9XA 4ZSGA 4YO4A 1DAWA 2UW8A 4GEOA 4CG9A 4P7EA 2GTNA 2X8IA 5EQYA 2P2IA 4L68A 1SMHA 2VGOA 3PY3A 1ZOHA 4AF3A 3WILA 1OB3A 4FGRA 3BYSA 4K9YA 2BZIB 1CKJA 1GZ8A 2DUVA 4M0ZA 4AACA 3LJ1A 1ZYDA 3MH3A 3V5PA 3WZDA 1YOJA 1ZMWA 2BRHA 3EQBA 4YHFA 4LUEA 2QI8A 2X9FA 2UW5A 3EB0A 3V51A 2G15A 5J87A 3NUXA 2YIRA 4GYIA 3NUPA 3BBTB 2PVNA 4PUZA 4DLJA 3MJ1A 1E1XA 3NRMA 5L2SA 3NAXA 5CQWA 3NNWA 3KU2A 2ZM1A 5HVKA 4ANNA 1YQJA 2ZOQA 3LJ2A 4AA5A 3FLYA 1PMNA 4E6QA 4OLIA 3IW4A 4OTQA 4U0IA 5BQ0A 4M7IA 3UVPA 4BCNA 2JKKA 3MFTA 4FNZA 4IAZA 3DJ7A 1Y6BA 4OGRA 5JFSA 5BX0A 3UIXA 3EWHA 4JQ7A 4X2JA 4BHNA 3FC2A 5HNIX 3FSKA 1XR1A 4FKLA 4QMMA 2VWZA 4C59A 1GIHA 4FV8A 2W5HA 3GT8A 4YPSA 2XRUA 3IW6A 4JIKA 5TOZA 5KBQA 3ZLYA 3CBLA 3KXXA 2QO2A 3C4EA 3KVWA 2IWIA 3VW8A 3ZSIA 1WVYA 1H0WA 3SXSA 2YM3A 1ZOEA 4MBLA 1CKPA 3R21A 3F5PA 2VX3A 1YDSE 1PYEA 4IM0A 5AM6A 4UMTA 5EOLA 3NVKI 4WUNA 2FYSA 3GI3A 4UALA 4YLLA 4QYEA 2YM5A 5J1WA 4UZHA 3QKLA 4O0VA 1F0QA 1ZZ2A 4AW2A 1IAJA 5HIBA 3UMXA 5B2KA 2PVKA 4ARKA 1JNKA 1QCFA 4XG9A 2W4JA 3OXZA 4GYGA 4U7ZA 4NWMA 3KY2A 2XS0A 3G33A 3VC4A 1OKVA 3OUKA 1AGWA 1MP8A 5DN3A 1H27A 2R3IA 5F94A 4DFZE 3FXXA 2VTLA 3VHEA 5FLFA 2YA9A 4HZSA 3ODZX 2OZAB 3VNTA 5HU3A 5M09A 2IZRA 4OBOA 4PDYA 2R3KA 4XOYA 1AQ1A 3FYKX 1X8BA 4FNWA 4FSRA 4ZTRA 2OZAA 4BDIA 4DTBA 4FIFA 1PXKA 3RHKA 2FH9A 1RDQE 3UVRA 1CMKE 3CCNA 3RHXA 2PE1A 5I9WA 5I3OA 3S1HA 2XIZA 4OUCA 3OVVA 5HCYA 3HAMA 2UZNA 3BYOA 3C13A 3C5IA 5HTIA 4IH8A 4YZCA 2X6DA 3E5AA 2BDWA 2OFUA 3C4WA 3POZA 4MAOA 4P4CA 3QCXA 3VS3A 4BWPA 5LVOA 1O6LA 2CGWA 2X1NA 5DFPA 4UX9A 4QMNA 4Y46A 4EH6A 3ZFMA 1VZOA 3MWUA 4I94A 3FEGA 2RL5A 4DFLA 1LEWA 3PSCA 4J53A 3G0FA 1IA8A 1V1KA 3EQFA 3VUMA 4GK3A 1LUFA 4ID7A 2ACXA 3H3CA 5DRBA 3T9TA 4J1RA 1FQ1B 1ZY4A 5HLNA 3NUSA 4KSPA 4D5HA 5CEOA 4FV7A 2RGPA 2C6DA 3L8VA 3SW4A 1ZYLA 2PZPA 4LRKA 1H1PA 1KE7A 5KHXA 1PF8A 2BVAA 4FOCA 3DXNA 4BZNA 1Q8TA 5AR2A 5F20A 2C4GA 4G2FA 4M14A 5KMMA 1OL5A 1Y8YA 3MA3A 4KNBA 1JLUE 4QP3A 4QP4A 5L6WL 4BDHA 3QD3A 4CYIA 3U6JA 2HELA 4BGQA 2F49A 4KSQA 4MXYA 4EH4A 2E9UA 3CPBA 3RK9A 4M68A 4CYJA 2E2BA 5GJFA 4H1MA 2G01A 3R28A 2W4KA 3FL4A 4F7NA 3CP9A 2JIIA 3HLLA 2R3OA 2R3NA 5LCJA 3LMHA 5TKDA 4QTDA 4F7LA 3IK3A 3MTLA 2OLCA 1YDTE 4RVTA 1V0OA 3CGFA 2YWVA 2P3GX 4L52A 4NW5A 1JWHA 1G3NA 1J91A 4YSJA 1GIIA 5IA1A 5BUIA 3BX5A 4E6CA 1J7IA 1IASA 4JQ8A 4DEDA 3SAYA 4NM7A 5D41A 3EH9A 4TYGA 4EH5A 1QPEA 3MFRA 4FIEA 3UZTA 3BV2A 2OJIA 3I7CA 4HCVA 4P5ZA 4M15A 5B7VA 4BCMA 4C58A 5I9YA 2UZLA 3ACJA 3C4ZA 4JDKA 3UYTA 4CTCA 5J9ZA 2PUPA 3UZRA 2C47A 5M4CA 4X2FA 3PJCA 3PLSA 4O81A 5AP0A 2WTJA 4WNKA 3BWFA 2VWXA 4L8MA 3C1XA 4C4IA 2WB8A 3POOA 3QTUA 2YEXA 3EQRA 4ENXA 3QQKA 4QP7A 4CZYB 4E93A 3EN9A 3T9IA 3FSFA 2C1BA 5M06A 4QMVA 5CEPA 2R3MA 3AT2A 3ACKA 3G6HA 3PVUA 5AP7A 3ZO2A 4DINA 4ERKA 3MH2A 4E26A 3E62A 4RIXB 4CMOA 2ERZE 3UP2A 1UU8A 2Z02A 4AZFA 2UW3A 5H2UA 4DC2A 3D5WA 4EQMA 4IFCA 3EMGA 4RIXA 1PYXA 5J7BA 2QR7A 2VWWA 3M42A 4NUSA 4IAIA 5ANKA 3BEAA 4CCBA 3D7ZA 4L01A 2Y6OA 4L6QA 3KULA 4H39A 2XK8A 5EYKA 4RC2A 3U8WA 4BCHA 4AZWA 4F6WA 5E4HA 4IC7A 2ZV9A 2IVUA 2JD5A 3Q96A 3UE4A 4U80A 4U9AA 4V05A 4FV1A 4KBAA 5FXRA 4I6HA 5F95A 5DBXA 1NY3A 3TCPA 4Z3VA 4CNHA 2QODA 2NO3A 1OECA 3DZQA 5EYCA 5LARA 4DAWA 4CKRA 4FZ7A 3V8TA 2FSMX 4UXLA 4HGLA 4FKUA 3SDJA 4AT3A 5E1EA 3DA6A 3GBZA 3Q4UA 3WIGA 3W55A 4UMRA 3VUDA 3OS3A 4A4OA 2GQRA 1W98A 3VS5A 4G3DA 3PTGA 2ONLA 3V5QA 3PPKA 3RZFA 5K5NA 3FWQA 3UPZA 2B1PA 4U8ZA 3P5KA 3KGAA 5AR8A 5HIDA 4AFJA 4GUBA 3UO4A 3ZXZA 5J9LA 5K5XA 3GP0A 4IWDA 4GK4A 2WTVA 3FZSA 3ORNA 5EDQA 3DLZA 4FUXA 3BLHA 3QTRA 4BZOA 1TQMA 1M17A 3KMWA 4JX3A 4MCVA 3EQCA 4NFMA 2RG5A 3PZHA 2OWBA 3MVHA 4BZDA 3ZUUA 4CFXA 2XUUA 4GUEA 5EW3A 3MY5A 4EWQA 3F3UA 3GCSA 3BYUA 4HYHA 1PMUA 4IJ9A 4EZ5A 1H1WA 4AW1A 5C8KA 3MH0A 2EXCX 3SOAA 2CNQA 1SYKA 4TZRA 4ZTLA 3R8LA 3REPA 2VTTA 3BE2A 3NNVA 4FKVA 3VAPA 2FVDA 4JDIA 4C4FA 3KF4A 4YTHA 4RT7A 4JS8A 3TACA 2ONLC 5CAUA 4NKAA 4YZNA 3H9FA 5DRDA 3QBNA 2ZYBA 3AC2A 5CS6A 2OW3A 2QOQA 3MJ2A 3OBJA 3JVRA 4NM0A 4FSUA 4PMMA 3HUCA 4AW0A 1LP4A 4QQ5A 3K2LA 2QQ7A 4BDCA 2XBJA 3IDBA 5HLPA 3GCQA 3RMFA 3NEWA 3HV5A 3KQ7A 1FVRA 3U4WA 4FT0A 1WBOA 4IX4A 4I0TA 4AX8A 3I81A 2WEVA 4DBNA 2B55A 2OICA 3P79A 3SXFA 1KSWA 2R7BA 4FT9A 4UEUA 2J0MB 4X3FB 4EOOA 3U55A 4FVQA 4W4WA 4FODA 3ANRA 3VWAA 3W8LA 4L67A 4ZSAA 5K0XA 1WCCA 4QP6A 4FR4A 4AW5A 4DBXA 2V22A 3QC4A 1DI8A 1QPDA 3P0MA 4XMOA 2BMCA 1PXMA 2WIHA 4X3FA 4DEAA 2GMXA 5EW9A 4ITHA 3LLTA 5IEYA 1ERKA 4HVGA 2X4ZA 2VTSA 3PVBA 4RFZA 3R9HA 1O6YA 3QZIA 5HVJA 4ALWA 3TDVA 1OM1A 2QLUA 2DS1A 2X7FA 3O7LB 3HV3A 4YTFA
chains in the Genus database with same CATH superfamily
3O8TA 3R7UA 4I6LA 3QKKA 2NPQA 5IZFA 5J5SA 2W1HA 2QG7A 3W8QA 3ZXTA 4Z55A 4D4VA 2GS2A 2HYYA 3IONA 4L43A 5EM8A 4Y83A 3C50A 4H36A 3SQQA 3PXKA 1B38A 4CSVA 5L2WA 3R83A 3ZC5A 1WFCA 1PW2A 3PA3A 3PXRA 1OL1A 4PF4A 3TZ8A 1MQBA 2YM6A 4XOZA 2XCHA 5CEIA 4BTJA 2AEGA 1H01A 5I9XA 3GCVA 3R7VA 4DH1A 4CFUA 4GH2A 4QMYA 5BVDA 3DNDA 3O50A 4OTDA 2P33A 4X3FC 5L2IA 4ENYA 3COHA 4N57A 2CGUA 2WMXA 3D7TB 3DFCB 5EYDA 4G34A 3DY7A 4KKGA 4I0RA 3E7OA 2C69A 5A4QA 1MQ4A 1XBAA 1ZYCA 3AT3A 4IX3A 5CVGA 4ONAA 3UDSA 2EUFB 5J95A 3WI6A 3O7LD 2O0UA 1WVWA 3LCDA 3D7TA 2WMAA 1M52A 2XJ2A 2ITOA 5EHLA 4FZDB 4MXCA 2R0IA 3R8UA 3C9WA 2BTSA 1K2PA 4WBOA 3AC1A 5HE1A 3S2PA 2EXEA 3GC8A 3E3BX 3D5VA 2XYUA 1GAGA 1KOAA 2J0KA 2QOHA 5BYZA 5IF1A 4QPMA 2XK9A 4BGHA 3GXLA 5LJJA 3O0GA 2I1MA 2V7OA 2VX1A 4FVPA 4H3PA 4KS8A 5HD7A 4C35A 3MDYA 4FNXA 1SM2A 2HW7A 2PPQA 3SXRA 4WBBB 4FMQA 4I6BA 4MXZA 5AR3A 5AUYA 2OJJA 3ROCA 2W5AA 3Q5ZA 3R1QA 2ESMA 3C4FA 3PJ1A 2R3RA 4EJ7A 4MD8E 3AC5A 1G8AA 4FIIA 4QYHA 3JVSA 3BI6A 4FICA 3ZCLA 4DG2E 2NNWB 3I6UA 4X2KA 2ZFYA 3HMOA 4IE9A 4BJJB 4CRLA 4AWIA 1PMVA 3I0QA 3FPQA 2Z7LA 4BICA 2YAAA 4AN3A 3LMGA 2PU8A 3KCFA 3HMMA 5IUGA 2WMRA 2YJSA 3F6XA 4HPUE 5JSMA 3V6SA 3AQVA 3BV3A 3I79A 2YIYA 4LV7A 5EDRA 3ORLA 4LMUA 5CVHA 4JJRA 3O8PA 1OUKA 5TR6A 3LPBA 3MVMA 4FVRA 4Q9ZA 5C1QB 3KMUA 3N51A 5C4LA 2J51A 5CT0A 4PPBA 3UNZA 3DXPA 4DGLC 4O2ZA 3R7GA 2JAVA 1R3CA 2X8EA 4QOXA 4Y85A 4ZSLA 2QHNA 4KAOA 4BY9E 5IA5A 1YDRE 2BILB 2XK7A 5BMMA 4AQCA 3VUIA 3L9MA 4D0WA 2WQEA 1VEBA 4NJ3A 3QA0A 2XAOA 5HGIA 5I3RA 3TV6A 4TW9A 2VD5A 5HE3A 4C2WA 1A06A 4B8MA 2VWIA 3QTWA 4D58A 1ZMUA 1LR4A 4L7SA 2YIWA 2UZDA 3I4BA 3PRIA 2B9HA 4D4RA 4ALUA 4H05A 4W9XA 2A27A 5FDXA 4MF1A 5HU9A 4AG8A 1YWVA 5GZ8A 5IEVA 4EORA 5FDPA 5E90A 3KXGA 3QTSA 3BHUA 4Y73A 1BLXA 2GNHA 3LFAA 4GFOA 4IWQA 4OTFA 1XJDA 4AP7A 4RLKA 2ZB1A 2Y4IB 4FTRA 3L8PA 4CKIA 2ITXA 1FPUA 4O7TA 4NU1A 1TQPA 3UGCA 1YKRA 3VVHA 2W0JA 5FEQA 5JQ5A 3BYMA 2O65A 2H8HA 3C0GA 4JVGA 4BTFA 3ORZA 4IDTA 5FXSA 4F1OA 2BR1A 4ANOA 4CZUA 2JEDA 3QTIA 3UPXA 2XEZA 4XP3A 1Q97A 1QL6A 1QPJA 4BBMA 4QP2A 4HVIA 1CKIA 2CLQA 2UZTA 2OXYA 3VS4A 1QMZA 3K3IA 4KUJA 1I09A 3NAYA 3FL5A 3WARA 4JBOA 2UVYA 4Y95A 2YJRA 5D7AA 3F7WA 2ZM4A 4M84A 2I7QA 4JAJA 5EH0A 3F69A 4JNWA 4L3PA 4O7NA 3O23A 3QYZA 4XEYA 4LGGA 3RINA 2VO3A 2X9EA 1YW2A 4MQ2A 3MB6A 2WTIA 5AEPA 3FKOA 4FJVA 4Y5QA 3P86A 4O84A 4PP7A 4PTEA 3CS9A 4DFXE 2BROA 2W17A 5EHOA 3BGZA 4YC3A 3NZ0A 3P9JA 2UVXA 5AV0A 2G2HA 4ANBA 1URWA 3DK7A 2OF2A 2Y4IC 5BVEA 3ORTA 4IWOA 3UOLA 3A8XA 4KIKA 3V8SA 5BV3A 3ORXA 1U46A 4LOPA 2GQGA 2XA4A 5AAEA 2CGVA 5IDPA 4QDEA 4B0GA 4RJ7A 4CVAA 3OWLA 2QHMA 5CEMA 4FE2A 1YXVA 3HX4A 2C6TA 3KRXA 2XK3A 4BC6A 4QMXA 4EOPA 2PE2A 5M51A 4FKRA 1BI7A 5IH4A 4P2KA 3JPVA 5AIRA 4F6UA 3ITZA 1W0XC 5KMLA 4NT4A 1U5RA 1WMKA 3ZSGA 2WTWA 2XK6A 3NCGA 1TFFA 2BPMA 2P0CA 4U97A 2QOOA 4HZRA 3WE8A 2C1AA 4C3FA 5A46A 3P78A 1E1VA 2J50A 4YO6A 1STCE 4C37A 4UZDA 4ZSEA 3JYAA 4JIAA 4FIJA 4GT5A 3QD0A 5K3YA 3TM0A 4WNOA 3IQ7A 3ANQA 2VWVA 1OL2A 4RBLA 1OZ1A 3CJFA 1P4OA 4G3GA 5HO8A 5B2LA 3V5LA 4L42A 5AUVA 4B7TA 4U42A 5I9ZA 2O64A 5KO1A 4KIQA 5LMAA 5ANIA 4RIOA 2QNJA 3KC3A 2VWBA 4J95A 1WBPA 4L7FA 4R8QA 3DBQA 3DKOA 4AAYA 3EZVA 4ZY5A 4QYFA 3TUBA 3JR1A 4IAKA 2Q83A 4FZ6A 3DNEA 3OOGA 2I6LA 3QLFA 5EHYA 4BFMA 4TYHB 1UNGA 2QU5A 2ZDTA 3TNQB 1ATPE 5A4LA 2RIOA 2VX0A 3GENA 4FKPA 4FTMA 2C6MA 2JLDA 3E92A 3CEKA 4FG9A 3RP9A 5FQDC 4RX8A 4O2PA 4F70A 3EFLA 4HCTA 4CLIA 1H1RA 1FGIA 3PZEA 4IBMA 5BVWA 2P2HA 2W1ZA 3QWJA 4QP9A 3DTCA 1LPUA 2VGPA 2UW7A 4UMPA 3LLAA 3BGQA 3HRBA 3OC1A 1UU7A 3CY2A 3A60A 2R3HA 2W06A 2ZMDA 2I0YA 4JG6A 4O4DA 4YJQA 4BIBA 4C61A 3V01A 3GOKA 2X39A 5AJQA 1UWHA 4XCUA 2CCIA 2W9FB 3QZFA 5K9IA 2YAKA 2WELA 4LGHA 5CI7A 2PK9A 3AT4A 4R77A 4HVSA 4PTGA 4C2VA 4BDJA 1JOWB 3E8EA 4GL9A 2B9FA 3ZRKA 4CMTA 4EOQA 4WNPA 4CKJA 1JSVA 3QCSA 5I5ZA 5HZNA 3QRKA 2VV9A 4OAVB 3QTZA 2WZJA 2HXLA 3FV8A 3KXNA 3PXZA 4FTUA 4IVCA 3QUPA 3BU5A 4WG4A 3MVLA 3EZRA 2OBJA 4QMZA 5EOBA 4EKLA 4UN0C 5CT7A 3LM5A 4F9CA 3SX9A 2W7XA 4XLIA 4FZAB 1H25A 3B8RA 1GZNA 3FZTA 4FK3A 5ICPA 3P23A 1CDKA 2CSNA 5ANEA 1XH7A 3V04A 4RIWB 4FYNA 2HXQA 4BI2A 4PNKA 3BEGA 2J7TA 2W9ZB 2YIXA 1UVRA 3DB6A 3O8UA 3JY9A 4RIWA 1XH5A 4I5CA 3HAVA 3VS0A 5K0KA 3KA0A 5JH6A 4CQGA 4K6ZA 3IDPA 2ITQA 4TNBA 4PPAA 3V5JA 3VS1A 5CX9A 3A2CA 5B2MA 4XV3A 4DCAA 3OWKA 3PXQA 5CQUA 4DHFA 1YI6A 2B4SB 5JEBA 3QL8A 5CNOA 3E64A 4IFGA 4U43A 2WQOA 1UU3A 2WOUA 3NLBA 3AC8A 4M97A 4QQCA 4EOIA 3WF8A 1UA2A 4ACHA 5L8KA 4MXXA 3VBVA 1IR3A 2CHLA 4EWHA 4RJ6A 2IW8A 4D2WA 4FBXA 2VN9A 2X4FA 3ZH8A 4BCGA 2VAGA 1BX6A 3DBCA 3MB7A 3W0PA 1NVRA 2Y9QA 2WGJA 3AD6A 3FPMA 4DHZA 5C26A 4MVFA 2PMOX 4E73A 3L1SA 5DI1A 4L44A 4YJNA 5KBRA 5FP5A 4M0YA 4IEBA 2IZTA 3LQ8A 4MTAA 5AUXA 2GS6A 3GCPA 2XALA 5ACKA 2YZAA 5CF8A 3OUNB 2G9XA 4LRMA 1PY5A 3OP5A 3NVMB 2QOFA 2OU7A 3LZBA 2WD1A 3FI4A 3H0YA 3CY3A 2BTRA 4FEQA 3CKWA 4JI9A 4V0GB 5C8MA 3PY1A 3NPCA 3TMOA 3VBXA 2F7ZE 3A4PA 3AGMA 3DDPA 4G1WA 4XG7A 3NUYA 2PMLX 4KBCA 4C36A 4BKYA 4XG6A 5HBJA 2IW6A 4CFVA 2VNWA 4Z16A 1W2CA 2ETRA 5IU2A 4DDIA 2WAJA 4V0GA 4R78A 5KCVA 5LQFA 1Q62A 2YCSA 3A7IA 1KE9A 3H30A 2JFMA 5CSWA 5CSVA 3VUHA 4BYJA 4TXCA 3OROA 3ZLXA 3W2CA 4I5MA 4AAAA 4JBPA 4D9TA 3BELA 3EJ1A 3DKCA 2Z7RA 1M2PA 2OXXA 4GJ2A 2QKRA 3OT3A 1K9AA 4C33A 4P5QA 2AC3A 4YC8A 5KX8A 4IZ5A 2CNUA 2X7OA 3P7CA 4EH7A 3Q2JA 5A4TA 4NL0A 2O5KA 5HI2A 3BLRA 4MX9A 3Q6WA 1VYZA 4TTHB 1U4DA 2FSTX 2XIRA 2Z2WA 4UV0A 5ANOA 4ZTQA 4D2TA 2W1IA 5BVOA 3OEZA 5C8NA 4BDFA 1JSUA 4QP8A 4BCFA 4EK3A 5IDNA 3JY0A 4YZMA 3SVVA 4EONA 4HJOA 2J0IA 1XH4A 3Q9WA 1MUOA 1XWSA 4UWBA 3VF8A 4W4XA 3R01A 3Q5IA 3IW7A 4Q9SA 4IW0A 4ZJJA 4KABA 4RX9A 2ZV8A 3DAKA 5H8GA 1PKGA 4N6ZA 4WKQA 3I5ZA 4FX3A 1WVXA 2V62A 3ML1A 3ZDUA 3F61A 4IC8A 3UDBA 3FMNA 3RPYA 3VBTA 5EW8A 3RK7A 1IRKA 3RPSA 4U41A 4BDGA 3K5UA 2HENA 3ZMMA 4O83A 4PY1A 3FHIA 3MN3A 2HW6A 3SLSA 4F65A 5IUHA 4LI5A 4MKCA 2XAMA 5HEZA 3CXWA 3R8ZA 3KKVA 4FIHA 3WBLA 2CCHA 1Q4LA 2I0EA 3R7OA 3U4UA 2X2MA 1P5EA 2J5FA 4RVLA 2QOIA 2RF9A 4HGEA 5FBOA 1FVVA 1OPKA 2DWBA 2WTCA 4RJ4A 3RCDA 5HTCA 2HZNA 3OEFX 3E7VA 1DM2A 5DGZA 3UP7A 5IA4A 3ID6C 3R00A 2JKMA 5CSXA 4DGOA 4F7JA 5FTGA 4PX6A 2OH4A 4YMJA 3ALOA 3HV7A 1Q8ZA 4PMSA 4W8EA 5KMOA 1PMEA 3PWYA 4JL9A 4EUUA 3EN6A 1RE8A 3R04A 3MPAA 5AUUA 3Q4ZA 4W4VA 4DH8A 3ORKA 4GMYA 5IUIA 3FAAA 5E8SA 2YCRA 4O7LA 1CSNA 4IHPA 4AZTA 1BL7A 2YISA 5HX6A 3FQHA 1F5QA 1JKSA 4N0SA 3BLAA 4ZJVA 2BCJA 4G5PA 3PRFA 5D11A 3HEGA 2B9JA 3FDNA 4U3ZA 5E8VA 3QLGA 1KV1A 3ODYX 3QGYA 3RM7A 5CALA 4CLJA 3Q04A 3DK3A 5HO7A 5CENA 3FMLA 4GT4A 3QQJA 3LFDA 3QC9A 3GQLA 2JITA 3R2YA 1YVJA 2GCDA 4FKOA 5CNNA 2GHLA 2HOGA 3D5XA 3FMDA 3NWWA 4LOOA 3ORMA 5HESA 4O22A 4XBUA 4R5YA 2XNPA 3ZFYA 4R3CA 3R9NA 1MRYA 2X0QA 3AMAA 3DQXA 3WF6A 5CAOA 3HRFA 2J0LA 3U9CA 4FGBA 3PYYA 3OHTA 3UOJA 4NM5A 4JT3A 4DG3E 4I20A 4RC3A 3A4OX 3L8SA 5D10A 3GUBA 4YU2A 4RVMA 5E8YA 4AGWA 5AR4A 3DU8A 4MF0A 4IAAA 4F7SA 2HWPA 2IVTA 2UZEA 3FZ1A 3V8WA 1YXTA 5HNBA 2YHVA 2QOCA 2RFDA 4X21A 2J5EA 3AXWA 3FZOA 5DH3A 3TTJA 3VJNA 4RLLA 1REJA 5HQ0A 4YZBA 4E4NA 1UKHA 3OF0A 4YSMA 5AP2A 2F57A 5IMEA 2OJ9A 1JPAA 2VTPA 3EYHA 3GB2A 3IG7A 3ENHA 3OXTA 2Z7SA 2XF0A 3DS6A 4RGJA 3EQHA 3GU8A 3BHVA 5CEQA 1G8SA 4LM5A 1U54B 3NIZA 4QO9A 1J1CA 5C01A 3W10A 1OGUA 4NJDA 4JBVA 3DAJA 3EL7A 3K3JA 4ZOGA 4EK5A 4D0XA 4F08A 1ZMVA 3SG8A 3ATSA 1Q8WA 2H34A 4FSNA 4E3CA 4RWIA 4JR7A 2YM8A 4IQ6A 4XG8A 5CU2A 1U54A 5AM7A 5DT3A 4AZEA 5AV2A 4DEEA 4FV9A 3VJOA 1FINA 3VO3A 2Y7JA 3VQUA 1M2RA 2ZV2A 2BRGA 3EIDA 3PP0A 4XYFA 5LMKA 3CTJA 3WYXA 5EDPA 2PUNA 4IM2A 1IG1A 3QHWA 5LVNA 5EQEA 3AD4A 3NUAA 3E87A 2REIA 4DGNA 1UKIA 5IQIA 2W1CA 3UOKA 2ITVA 3T8OA 4YR8A 3U54A 3LM0A 5AR5A 3LCOA 5A6NA 2C0IA 4RVKA 3OWJA 3TYKA 2PZRA 4FSMA 4GT3A 2ITZA 2XKDA 3LFFA 4AOJA 3TIZA 2JBPA 4H3QA 3FZRA 3A7HA 3IKAA 5DHJA 2JIUA 2ZV7A 4RPVA 2XANA 4FSQA 4QMUA 5AWMA 3GC9A 3RPVA 4MH7A 4XNEA 5J8IA 4DFYA 4EOMA 2ZM3A 3HP2A 5FD2A 4QTEA 3ORIA 3PSDA 4JQEA 4RZWA 5CZHA 2BDFA 3F5XA 3QQLA 3RK5A 4XV9A 3F9NA 1NT2A 4PDOA 2VTMA 3P5JC 4BIEA 2WKMA 5ETFA 5LMKC 2VTNA 2VWYA 3I6WA 3D83A 5E91A 4A06A 2QOLA 2ZMCA 4Y72A 4ACMA 4BF2A 5FP6A 1UU9A 2BIYA 3HZTA 4JX7A 3TNHA 3E88A 1NXKA 3FLNC 2QONA 2YDKA 3W2SA 4RWJA 3KL8A 5AUZA 3IGOA 3JXWA 4RIYB 2FO0A 2UZVA 2XKCA 4HVHA 5ETIA 2XNMA 4F1TA 3H9OA 4BDEA 3VS2A 2VTOA 3CQEA 3IGGA 3PJ2A 3FMHA 3KXMA 2QOKA 5BNJA 1H1SA 4ALVA 4JR3A 4QMLA 3CQUA 4LDTA 4ZZOA 3IECA 4E1ZA 1P14A 2X0GA 3ZUVA 2YITA 3TEIA 1YI4A 4GK2A 4FTCA 5LWMA 4D2VA 2UZUE 5M4FA 3FQEA 1OL7A 2YN8A 3F2NA 3OCBA 1GZOA 4GRBA 3RZBA 3NYXA 3UQGA 2WU7A 4ZY4A 3QD2B 4ASEA 4YC6A 4UB7A 3BRBA 2YABA 4ZTSA 4UBAA 1O9UA 2LGCA 2ERKA 3BQRA 4ZTHA 4YHTA 3AKJA 1E9HA 1YXXA 3DZOA 4OTRA 3PSBA 2EVAA 2YCQA 1HCKA 4A4LA 4ZP5A 3VBQA 3W33A 3Q9ZA 4GIHA 3RAKA 2C3KA 4X6RA 5DE2A 5E8TA 2W05A 4C62A 4F99A 3QQGA 2E9VA 1OKYA 3Q32A 1BI8A 4A7CA 4FI1A 3FKNA 3O51A 5KMNA 2W4OA 4D2RA 4O7WA 1SNUA 5CF5A 2J9MA 4ZS0A 2A1AB 2ITTA 4L00A 3D15A 4R7BA 4HYIA 3HKOA 1VYWA 2HZ4A 4IX5A 4EHEA 4ZEGA 3UO6A 2QOBA 5ETAA 3VRZA 4AN2A 2E9OA 4ZZMA 4G6OA 4O7ZA 4E8AA 3THBA 3ULIA 3P7BA 4OTHA 4F9WA 1W84A 2HY81 1SVEA 3A7GA 4NFNA 2CGXA 3RJCA 4WO5A 2J0JA 2J4ZA 4FKWA 2I0VA 3OFMA 3IW8A 2R0UA 3L9LA 4APCA 3VBYA 3F2RA 1RJBA 3DFAA 5HICA 3GGFA 4GIIA 2F7EE 3D94A 3I7BA 3OCSA 2R5TA 5HORA 4J96A 4DEHA 2AUHA 1BL6A 4YURA 3H0ZA 4PL4A 3MIYA 4EYJA 5EM5A 5C03A 3F7ZA 2JC6A 4YTIA 5HG9A 1ZAOA 4QMOA 4CV9A 4FKIA 4OBPA 4XG4A 3LCSA 5EM6A 4D2SA 5AA8A 3PDTA 2QURA 3TT0A 3DV3A 1YHSA 2JKQA 3NR9A 5B0XA 3KREA 4FKGA 3FXZA 3D5UA 2E9NA 4DT9A 4O1PA 3WF5A 3N4VA 4BR3A 3LFBA 4EOJA 3UG1A 4GKHA 2XB7A 3UG2A 5IQFA 3CR0A 3II5A 4BCQA 4B9DA 5IMXA 1H28A 2R3PA 3K5VA 2XM8A 3VULA 3WZEA 3ZO4A 1WBSA 4KB8A 4LFIA 1H00A 5CAVA 1R0EA 1H26A 3EFWA 4G6NA 4PV0A 5LVPA 3DPKA 4A9UA 4PL5A 3VW6A 4E4XA 2C5NA 1Z9XA 2IVVA 3QCQA 2FB8A 4E6AA 3MS9A 5CSPA 1WBVA 4C3RA 4C4HA 3OMVA 4FV6A 4QNAA 5D7VA 4EEVA 2B52A 3KRJA 3P1AA 2DYLA 3H9RA 4FV5A 1L3RE 2PZ5A 3EN7A 1SNXA 4X7QA 1H24A 5BPYA 2Y4PA 3RNIA 1OL6A 3SRVB 3KK9A 3TKHA 5DEYA 4QRCA 4AGDA 2WQNA 4BGGA 1URCA 4U79A 2BAKA 1OMWA 3OW3A 4F1MA 2OZOA 3A61A 4DFNA 2P55A 3UNKA 4EK4A 3PPZA 5TF9A 4DFUA 2OFVA 3DBEA 1P4FA 3NNUA 3W32A 3KIOC 4BJJA 4BHZA 3MBLA 2ITWA 4WUAA 3TV7A 3UC3A 4ZLYA 3BPRA 3PG3A 4IAYA 1OBDA 3C0IA 4ZMEA 3F2AA 5L6PA 3LXNA 4AA0A 3BU3A 4R3PA 4F6SA 2X2KA 1ST4A 4HNFA 4OTIA 5CF4A 4OBQA 2XKFA 3CGOA 4NSTA 4J99A 4TWOA 3NYNA 2CN5A 4FTKA 5KMIA 3DXQA 2XNBA 4TYJA 4PQNA 1M7QA 3RPRA 2CNVA 2QVSE 3ZLSA 4G17A 3R9OA 4QDVA 4ZIMA 5CAPA 4IMYA 1HOWA 3PJ8A 2CN8A 3GCUA 4FSTA 4XLVA 3UIUA 5KZ0A 4E4LA 4J7BA 5J9YA 1Z5MA 5EG3A 4F0FA 2ITPA 2UZWE 4L45A 5HBEA 2JFLA 5T68A 1YHWA 3DJ5A 1PXLA 2BZHB 1AD5A 3FZPA 3RPOA 5A4EA 4PP9A 3DB8A 3PP1A 1A48A 5C4KA 2PE0A 5AP6A 2OO8X 4FT5A 4YJRA 1XBBA 5KNJA 3F82A 3TWJA 2JGZA 4D28A 5KHWA 4KKHA 4AE9A 3ZU7A 4R7HA 2C5XA 2GHGA 4LV8A 2EB3A 3MESA 3OW4A 3DGKA 1YWRA 3MPMA 4IB3A 1JKLA 4F78A 4Z7HA 3KRWA 5JT2A 2BFYA 2ZAZA 3BIZA 3LFCA 4G16A 4KIPA 4O86A 4FKSA 3HYHA 4O0YA 5HG8A 4ZTNA 3BGPA 2IW9A 4F9YA 3D2IA 1YXSA 2XIKA 1H8FA 3HVCA 4NIFB 2VTQA 3KMMA 3U6HA 4D9UA 4TKSA 1J7LA 2WTKB 2PHKA 1FOTA 4MNFA 5HBHA 3UQFA 2XH5A 1G8JA 3QX2A 4NIFA 4FSYA 3VUTA 5LVMA 5ANJA 3O71A 2ETKA 2CLXA 3ETAA 5M57A 5I4NA 3R8PA 3N4UA 2F4JA 2Z7QA 5IQCA 2AC5A 3UO5A 3L8XA 4BDDA 4MHAA 2CMWA 2V0DA 4EUTA 4RG0A 3OCTA 3BHTA 4I4FA 5C27A 5LVLA 3WZKA 4I0SA 3G15A 2GFSA 5AV1A 1YOMA 4EC8A 3E8DA 4OT6A 4ASDA 3MFSA 4HNIA 4Q2AA 4O6LA 5JRSA 3RI1A 4DGMA 2GNFA 2XK4A 2G1TA 4UWCA 4R3RA 3ZONA 3FMMA 2IZUA 4IZ7A 2WMUA 3LCKA 3FI8A 4DFBA 2X2LA 2C0OA 4XP0A 3EOCA 3S00A 1WBNA 2ITYA 1WAKA 4OT5A 3G2FA 3P4KA 4AZVA 4R1YA 3PE2A 4IVBA 3LXLA 5JFXA 5T6KA 4ANMA 2YWPA 3MSSA 3VBWA 3NNXA 5EK7A 3R9RA 2CDZA 2XNNA 4N70A 4PTCA 3ERKA 3ALNA 2QO7A 4K18A 4IDVA 3SKCA 1ZYJA 5DG5A 3QWKA 5AX3A 4G6LA 3TN8A 4BWXA 3Q4CA 2OSCA 4LV5A 3M1SA 4RQKA 4DE4A 4AXAA 5BVFA 2B9IA 2WTDA 5IG1A 1JSTA 2HCKA 2VTHA 3AC3A 4OTPA 3BE9A 4FZFB 2CKOA 4I6QA 4S30A 1H0VA 3U9NA 2R64A 4NTSA 2Y8OA 2YCFA 3DKGA 3PXFA 3QTQA 4C4JA 3MI9A 4TY1A 3A7FA 3MIAA 4C57A 5JMSA 2AYPA 5BVKA 4PRJA 5F1ZA 4EC9A 3GQIA 4WT6A 4A4XA 4BBEA 3R1NA 2QO9A 1R1WA 4ZZNA 4L53A 4HYUA 3F66A 3VIDA 3U51A 1XHAA 3LQ3A 4IB0A 3HUBA 4F0GA 4GFGA 3RKBA 3C5UA 4HOKA 2C3LA 2PVRA 4D1SA 4EKKA 4USEA 1ZZLA 2IG7A 3DBDA 3CTQA 4MWIA 5A6OA 2WXVA 4TYHA 4YZDA 3ZRLA 3HP5A 3G5DA 4J71A 4KA3A 1KV2A 4FNYA 4H3BA 3OT8A 4NCTA 4ORKA 3F3ZA 4EZ7A 4MD9E 1GZKA 3AD5A 3PVWA 2GNIA 5IQEA 3W0OA 4OW8A 4JMQA 5GZAA 5G1XA 2BRNA 4GVJA 4IB5A 1Q5KA 5JGBA 3R8VA 3UC4A 3Q9YA 5L2TA 3RGFA 3B2WA 4R1VA 3RAHA 4JRVA 2EB2A 2V7AA 1OKZA 5DA3A 2PVHA 4A9SA 3D14A 3AG9A 3TZ9A 1KWPA 4C38A 2C0TA 4D2PA 2JDVA 3W0MA 2O63A 4Q5HA 3WIKA 4CMUA 2FSOX 4KD1A 4K1BA 5AP1A 5C9CA 4U6RA 2XJ1A 3DAEA 1ZOGA 2OJFE 3R9DA 3F3TA 3PA4A 2QC6A 4YBKA 4DLIA 5KKRB 3PLAE 3BKBA 5E7RA 4XH6A 4PDPA 4E5AX 5JGDA 4NCTC 1W82A 2BRMA 5L4QA 4L46A 5DIAA 5HKMA 2UW0A 3ORPA 2Y6MA 2B53A 5HG7A 4D4YA 3EQIA 2C5YA 1XH9A 3OTVA 3QTXA 4KRDA 1REKA 2BHHA 2VRXA 2CPKE 4HPTE 3VS7A 4MD7E 5JRQA 5DOSA 1OGYA 3G0EA 3R63A 2JDTA 4I4EA 1GJOA 3HV4A 4MWHA 4FA2A 2JDRA 3QU0A 1T46A 3UIMA 4IJPA 4CRSA 1R0PA 3GU4A 3PY0A 2ZVAA 4DTKA 3Q3BA 2JBOA 4B4LA 3ZM4A 1IAHA 4EOSA 4BRXA 2PZYA 1OBGA 1SZMA 4RJ5A 1BMKA 4C02A 4XV1A 2UZBA 5H9BA 4YLJA 4M12A 5CANA 3ZYAA 4LQMA 2H6DA 2QKWB 2C6LA 4ERWA 2GSFA 2R3FA 5DPVA 3CIKA 4FSWA 4ZY6A 4EJNA 1UNLA 2H96A 4AOIA 4E20A 2VWUA 3NW5A 2C5OA 3OTUA 5HNGA 2YLFA 4QMPA 4OAUC 5TO8A 1S9IA 5FWKK 4EOKA 2RFNA 4KS7A 5AP3A 5IQHA 3MY0A 4FTJA 3NYVA 4ITJA 1KE5A 1W83A 4M3QA 5DR6A 4CV8A 4EK6A 3GC7A 5J7HA 3WYYA 4GG7A 5M44A 2VNYA 2WQBA 2WU6A 2ITUA 2Q0BA 5HIEA 4WRGA 3S95A 3SD0A 4QNYA 4C3PA 4FEXA 5JFVA 4RJ8A 4AT5A 3SGCA 5AAFA 5HE2A 2XNEA 4NEUA 5JZNA 4E5BA 1W8CA 3EQGA 5HCZA 3MV5A 5CLPA 5KMJA 4BCOA 4E7WA 4L3LA 4LMNA 4E6DA 2E9PA 2WO6A 3O2MA 3EN5A 4FT3A 3I0OA 3QUEA 4XV2A 3WE4A 2PUIA 3G90X 1ZWSA 2ETMA 3QZHA 4G31A 2C3JA 2C68A 3KVXA 5AUWA 3DLSA 3I5NA 5FUTA 3OWPA 1Y6AA 5EI6A 1FMOE 1JKKA 3H10A