2OO8X

Synthesis, structural analysis, and sar studies of triazine derivatives as potent, selective tie-2 inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
259
Chain Sequence
GQVLKARIRMDAAIKRMKEKDDHRDFAGELEVLCKLGHHPNIINLLGACEHYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Angiopoietin-1 receptor
publication title Synthesis, structural analysis, and SAR studies of triazine derivatives as potent, selective Tie-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 259
sequence length 282
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oo8X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oo8X01
4A9RA 3V5WA 3Q60A 3A62A 4EH2A 3JY0A 3O0GA 4DFYA 4WUNA 1QCFA 3VS7A 2Z02A 4LI5A 3V04A 3C1XA 2R4BA 4BRXA 4UXQA 2HZ4A 1LR4A 1NA7A 2JBPA 3KVWA 4AZTA 2F7EE 3GEQA 1APME 4IAIA 4AZEA 4OAVB 4J95A 1UKHA 3D5UA 2VU3A 3PJ3A 3BE9A 1ZOGA 5J9ZA 4C34A 3ZEPA 2BAKA 3D7TB 4E6DA 3OF0A 3V5JA 2VTNA 1R0EA 2FA2A 4I0TA 2J90A 3I5ZA 5GJDA 3NUAA 4S31A 4QP7A 5HQ0A 4BDHA 5HHWA 2XRWA 2WMRA 4IW0A 4AWIA 2VZ6A 5LVNA 2PMOX 3RZBA 4WG4A 3MVLA 4KIOA 2VTMA 4LL0A 2I0YA 5L3AA 4TTHB 2IO6A 3HKOA 3F61A 3IECA 4LYNA 4DTAA 2XIXA 1VEBA 4YGAA 2XK6A 3H9OA 4BTFA 3LCSA 3QD2B 4D9UA 2W1IA 3KXMA 3FYKX 1UNHA 3F88A 4MBLA 5LVLA 4NW5A 4BCJA 5CEKA 3HP2A 4XG2A 5CI6A 3F6XA 4O0SA 3ULZA 3VN9A 1E1XA 4M69B 4ASZA 4CFWA 2CKOA 2UZBA 3ZU7A 4EH9A 1R0PA 2BZIB 1UWHA 2GNHA 2PSQA 1R78A 2OSCA 2C1BA 3NUSA 3SD0A 1OI9A 2Z60A 3FJQE 3CSVA 4QRCA 2WFYA 3B8QA 2PVMA 3HUBA 2IW8A 2PPQA 5FG8A 4EOMA 2OI4X 3D4QA 2WZJA 3R1SA 3IOPA 1PF8A 1L3RE 4JG6A 4F9WA 4UMQA 4M68A 5LWNA 3A8WA 3FC2A 2XIYA 3NAYA 5HESA 4NWMA 4UB7A 2G1TA 3PVGA 3BHYA 2V7AA 1YHSA 3OY1A 5IKWA 3ZLSA 1Q8YA 2PZYA 4QMPA 1B38A 2XIRA 3AC8A 1U4DA 2WTKC 2PMLX 3MI9A 3W18A 5AV4A 4KKHA 4O7ZA 3DDPA 4X0MA 2JGZA 2X2KA 3NNUA 3HA6A 5M44A 2AC5A 4XG9A 2ZM4A 2WTWA 3NIZA 4OTGA 1XH4A 4QMZA 5DLSA 4EYMA 2RFNA 3EIDA 4RQKA 3NW5A 5ACKA 2XK4A 3C4XA 5JGBA 2B9FA 3ZSIA 4MCVA 4FTIA 5E8VA 3T9TA 3GT8A 5A14A 2VO6A 3E88A 2HYYA 4NM5A 5E91A 4AOTA 2PUPA 2ZB1A 3KXHA 2HW7A 3R00A 2C0OA 3D7TA 5E8UA 5FUTA 4U40A 4L52A 1M2PA 4YURA 3A7FA 4FOBA 1W83A 2IZTA 4ZSAA 4QMQA 2QOIA 3DBQA 1VYZA 5LCKA 3Q9ZA 3RALA 4BWPA 2W4OA 4CMUA 3A4OX 3TV7A 4GCJA 1W0XC 4NCTC 3R04A 1Q97A 3GCQA 3E7OA 3I81A 4LGHA 4WRSA 3VUDA 5EHOA 2EUFB 2ETRA 5H3QA 4E20A 1H25A 4FUYA 4IH8A 3BWFA 3NYOA 2VTRA 1RQQA 4F1OA 4O91A 1PKGA 1SVEA 1XBCA 3NRMA 4GUBA 4TPTA 4F9AA 5DR9A 1LUFA 4NJDA 4JS8A 5CSPA 4M69A 4IDTA 5CF5A 3L1SA 3MY5A 3VS0A 4TYHA 5EM7A 2GS6A 4J99A 4M12A 3G33A 4I41A 4M7IA 2IJMA 4C4JA 4Z55A 1G8SA 3KN5A 4BDGA 1U54B 1F5QA 4J8MA 3FKLA 4BCMA 1M17A 4G6NA 5CANA 5EQPA 4U5JA 4GS6A 2E9OA 4KS8A 2JEDA 3T9IA 2J50A 1YW2A 3FV8A 4ERWA 3UOLA 3AMYA 3NYVA 2XKEA 3AC3A 3AC5A 2YZAA 4AZFA 5CT0A 5JRSA 4S30A 5M57A 3CE3A 4USDA 2C6MA 3MYGA 3LXLA 4KINA 2BZKB 3QC9A 4QTDA 3SKCA 3FI3A 3VS1A 3OXIA 3HYHA 4D0WA 2YLEA 4FNWA 2UZNA 5HLNA 2ZAZA 2OJJA 2VTTA 5D12A 3VBXA 4D2TA 2X6EA 4RJ8A 5HORA 4CKJA 4FEWA 5T6KA 1U5RA 3LFQA 4N0SA 3N4TA 5EQEA 2B52A 1OL7A 2CLXA 4U9AA 3MH1A 2BVAA 2OZOA 2Z7LA 4L6QA 3V3VA 3AD5A 4UWCA 3FLYA 1JSTA 3SOCA 2J0JA 5IH4A 4GKHA 4LGDA 4EHZA 5JT2A 2WEVA 1Y8YA 3RPRA 3O23A 2GQSA 4D0XA 2CGVA 1ZZ2A 1ND4A 4JI9A 2EB3A 4C35A 4FV0A 2GNIA 3EN9A 1B6CB 3D7ZA 2E9NA 3II5A 3G51A 3ORZA 3DTCA 2C5YA 2GQRA 2R7IA 4ZJJA 3QQUA 4FTUA 4QNAA 4NJ3A 3R8VA 4CFFA 5KCVA 5LCJA 1UNGA 2CMWA 4ID7A 1YQJA 4E7WA 2WNTA 3PSCA 2OXXA 2QHMA 3NZ0A 5AUVA 3V8SA 2X8EA 3OWJA 4QP9A 2YEXA 2CKPA 2NRYA 4DBXA 4GV1A 3HAMA 2BDJA 3CP9A 2XKFA 3QTWA 5EW9A 3GU4A 3ENHA 4CFXA 3SG9A 2UW4A 1U59A 3W8QA 4IMYA 4S2ZA 3HV3A 3AC4A 3ZBXA 1JVPP 2HAKA 3NNVA 3R7UA 4XLVA 5EYMA 1U54A 2VX3A 3PY1A 3FLNC 3I60A 2WXVA 5KE0A 3UODA 3BV3A 1Q3DA 4K33A 2R3FA 5EM6A 4CFUA 5ANOA 1WCCA 1R39A 2B53A 2BCJA 4G3FA 4KNBA 4YZ9A 3UMXA 4IWQA 4L45A 4BKJA 1OITA 1M2QA 2JKMA 5I9WA 4LGGA 4CD0A 2E2BA 4O0UA 1BI8A 4HVHA 4YJQA 4BICA 2ITWA 3BLRA 4OTPA 1Z57A 2WHBA 4I93A 4UYAA 4LRJA 3C5IA 3NNWA 5HTIA 5IEVA 4IAZA 1Q99A 1ZAOA 4DH3A 2CNQA 1HOWA 3QX2A 3GGFA 4IWDA 4M8TA 4NH1A 4BI0A 4EJNA 3RM7A 4D2PA 3OT8A 4RG0A 3ZRLA 4KBAA 2QU5A 4Z9LA 3PVBA 1HCLA 3PE1A 3PPKA 4G3EA 1XQZA 5M55A 2DWBA 4DG2E 3M1SA 4UEUA 2WU6A 1OM1A 5FLFA 3PXKA 2BRGA 3PJ2A 3RHXA 5CEOA 3DLZA 3U54A 5FM2A 3PLAE 3I4BA 3LCDA 2O2UA 5AR5A 2JLDA 3FZOA 3WI6A 5HNIX 1FGKA 2CKQA 2W17A 5L8JA 4HVGA 1TQMA 2WMUA 4DFXE 3I0QA 4I4FA 4MXOA 4E8AA 5HZNA 1AD5A 4IX5A 2XEZA 4AGCA 4AP7A 4FSTA 3IDBA 5BYYA 4IAYA 2BZJA 2W06A 4FG9A 3EJ1A 3EFWA 3LLTA 4L3LA 3TZMA 4OTFA 3O7LD 4AAAA 4EQMA 5CEMA 3ATSA 5IDPA 4FV6A 2V62A 3D94A 4EZ3A 1K3AA 1UU7A 4XBUA 3SA0A 2BAQA 2GSFA 3QA0A 4FL2A 1CKPA 4I20A 3LKMA 1JWHA 2YIRA 3G6HA 3LFBA 4E6CA 3PJ8A 5B7VA 3C51A 4NM3A 3RWPA 2BDFA 3ZYAA 4F1MA 3DK3A 4DH5A 3UQCA 4FTNA 3I6WA 4R77A 3ROYA 4PP9A 2R9SA 3ORIA 5DWRA 3DJ7A 3BWJA 4BKYA 3A61A 4R78A 3RBWA 4YUQA 4QYFA 5HE2A 4WHZA 2I0HA 4DAWA 4AXAA 4PNKA 4NFNA 2X2MA 5AAGA 4YJPA 1REKA 3KMWA 3QXOA 4K2RA 4O1PA 1FMKA 4FV2A 3ZLXA 3HUCA 4IVCA 4L7FA 4EH3A 5KBQA 2FO0A 3C13A 4WG3A 2QVSE 5CU4A 5CAOA 4H3PA 3CQEA 3QGYA 4JDKA 5GNKA 3K3IA 4CTBA 4UMUA 1PXPA 4X2GA 2ITXA 3SAYA 3KA0A 4BDJA 4G5PA 2CN5A 2C0TA 5LXMA 4ZSEA 5M51A 2X7FA 5AA8A 3PVUA 4BDKA 1XJDA 5HBEA 4BKZA 5I9XA 5IQHA 5CSVA 3FZPA 3I1AA 3HLLA 4QMNA 3UPXA 2VN9A 4ASXA 5IQBA 5A6NA 2FSOX 2W4KA 4U6RA 2R3RA 2GTMA 2QU6A 3OT3A 3PE2A 4O38A 1IAHA 4AA5A 4FA2A 2ERZE 5ANKA 1OGUA 4AW2A 2F57A 4ZY6A 4JDIA 4RC3A 4YNOA 5DMZA 4ANLA 4I6QA 5CQUA 3TUDA 3TT0A 4D55A 1H0WA 3QF9A 4FSQA 5DT0A 3BYOA 4ZAUA 3PA5A 3C4FA 4EH6A 1FOTA 2WO6A 3CTJA 4IIRA 1F3MC 2BTRA 4I5PA 2G2FA 3L8SA 4KBKA 4FE2A 3FL4A 5E90A 2WTIA 2VTQA 3F7ZA 2A4LA 4FZAB 5M4IA 5DR2A 4JBOA 1P14A 2ZV9A 3TNHA 4RZVA 3RPOA 1FVRA 3P86A 4YJNA 3CJFA 4ZZOA 2EVAA 4ZTRA 2FSMX 3KB7A 3ZEWA 3DK7A 4FTQA 4UMTA 4EORA 2W1HA 4FSRA 4FT3A 4J98A 3T8OA 3RK7A 4YJRA 3ZS5A 2WEIA 1OZ1A 5BVEA 4PX6A 2YISA 3IO7A 5JMSA 4HYSA 3VHEA 2IZRA 1YOJA 2WQOA 2X81A 5IA4A 3ZONA 2UZTA 2W99B 3VW6A 1ZMWA 1OVEA 4RLLA 3PFQA 5AV3A 3ZOSA 2XNEA 2JDOA 1KE6A 2H8HA 1H28A 2HIWA 3OWKA 4FSYA 4JBPA 3V51A 2RFSA 3Q5IA 4W8EA 2HXQA 1ZYJA 2OBJA 3BQCA 3O96A 4M0YA 3CKXA 4KSQA 5EM8A 3VUHA 4YC3A 4U79A 4L3PA 3ORPA 5HNBA 3QRTA 2GHGA 2RL5A 4XG8A 4RRVA 4JLCA 3MB7A 4PTCA 3ZRMA 5F4NA 5CLPA 4IZYA 4DT9A 4ERKA 4NZWB 5ETAA 3LFSA 5IA2A 1T45A 2PU8A 3KFAA 1YDTE 1WVYA 4BL1A 4D2SA 2O5KA 3PXZA 4Z16A 4FYNA 5A4LA 3ZXTA 3R1NA 4AA0A 2BIYA 2WMAA 5E1EA 3KF4A 3W2RA 4QQJA 3O51A 3OC1A 4NT4A 2OJ9A 4BZDA 2BHHA 4HYHA 4V0GB 5JFVA 3BRBA 2CSNA 5F94A 1V0BA 2ZM3A 2C30A 3HMMA 1G3NA 2GS7A 4K11A 3V8WA 3BBWA 1YXUA 3LM0A 4NM0A 1RJBA 2YABA 4EBWA 1P2AA 5CXZA 5EW3A 4TW9A 4JIKA 2HWPA 1PXKA 2YHVA 5EK7A 4XP3A 1FGIA 2QR8A 4XG4A 3AG9A 3VQHA 3D14A 1YWNA 1H1SA 4OT6A 4A9YA 1CMKE 5L2SA 5DVRA 3DXPA 3ODYX 4L53A 4YBKA 3F2RA 1OMWA 3HDNA 4QMVA 1MQBA 4M67A 4CYIA 5KBRA 1K2PA 4QPAA 3DDQA 4UALA 3P23A 4FZ6A 4R6VA 2VWZA 5KMJA 4XCUA 3H0YA 2WQNA 3AT4A 3QCQA 4L8MA 3GCPA 3E63A 4BTKA 5DT4A 3P1AA 3PY0A 3Q9XA 2VTOA 4B99A 4C0TA 4MBIA 3FXZA 3TL8A 3DPKA 5DPVA 4BFMA 2B9IA 4UWYA 3NYNA 4W8DA 4IACA 4J97A 3O8PA 3DY7A 3P7AA 3OBGA 3GQLA 3V5PA 4A7CA 2YIYA 1YDSE 5CF6A 5FTGA 4FT7A 2WU7A 4FEXA 4F08A 5I9ZA 3ALOA 3WZKA 2XVDA 5FDXA 1M14A 4E73A 3QYZA 3SXSA 4O0RA 4FSUA 4JDHA 4H1JA 3WZUA 3BEGA 4TXCA 4CFNA 5LVOA 1J91A 2AUHA 4FV7A 5H9BA 2EXCX 4UV0A 3H9FA 3PIYA 4ZY5A 4XUFA 5CVFA 4WNMA 4U3YA 1H08A 4IDVA 3EN7A 3ACJA 4FK6A 4ZSJA 4DYMA 5CSWA 4HVIA 3RAKA 3T3UA 5CF4A 2BIKB 1QPJA 4R5YA 4RC4A 1YHWA 3SDJA 1FBNA 1KOAA 4DH7A 4W4WA 2JKKA 5TKDA 2W7XA 2GNJA 1CKJA 3HGKA 3IW6A 5AUWA 4FTJA 5BMMA 4AE9A 5CZIA 3VBVA 4H58A 4MH7A 4WO5A 3VUMA 4PDPA 4ANNA 4PY1A 4F0IA 2R0IA 2GDOA 3E8NA 1VYWA 4V0GA 3DKFA 4G3DA 2XB7A 4L44A 1GIJA 4Q2AA 2GNFA 3ZDUA 4FI1A 3POOA 3EQBA 1BL7A 4YJOA 1P4OA 3LQ3A 2QR7A 1AGWA 3FLSA 3BHHA 4BDIA 3ZZWA 3I5NA 3Q6UA 3QYWA 3O71A 4MNEB 4PMPA 3P79A 5E8WA 4D5HA 4ORKA 2B1PA 2E9PA 3TKHA 4PPCA 2C47A 4YC6A 3IK3A 5KMMA 5H2UA 3R71A 5HCXA 3HZTA 4AT5A 3C9WA 1KWPA 3EB0A 4MF0A 4O7WA 4TZRA 3PPJA 4GYIA 1I09A 4ZMFA 3RPYA 2FYSA 5HD4A 4RT7A 4DT8A 3K3JA 2OF2A 2J2IB 4FKTA 4FIIA 2VX0A 5AAEA 4QP2A 3D0EA 4I22A 4W4XA 2HZNA 3GVUA 3ZFYA 3QD4A 5HU3A 2WQMA 4CZTA 4PDYA 3R6XA 5IPJA 2Q83A 4RJ5A 4XNEA 5ANJA 2OIDA 5CEQA 4FYOA 4NW6A 2JDVA 2C3JA 1E1VA 5J7HA 1WBTA 2HELA 3O17A 4DLJA 5KKRC 5BYZA 1NT2A 1JKTA 2QOFA 3QTXA 5HBHA 4P5ZA 2QOKA 3RKBA 2OK1A 5KKRB 3LPBA 4M0ZA 5CAQA 2UW7A 4IM0A 4BB4A 2ITQA 1ZY5A 3UMWA 3L9LA 4MQ2A 3VUIA 1OUYA 5IQAA 4Y72A 2ZV8A 1GIIA 2PMIA 3NUNA 4U7ZA 4RX9A 3ZFXA 3HP5A 4CFMA 4EL9A 5I3RA 5J9YA 3VJNA 4C57A 1Y6AA 3TTJA 4QYHA 4B4LA 4EHVA 4JQEA 4GW8A 4I6HA 3UO4A 4DEAA 2OU7A 3OTUA 4USEA 4O84A 1JQHA 3PG3A 4R1VA 2BALA 2I0EA 1BL6A 4EZ5A 4AGDA 2PVLA 5TT7A 2C3KA 2XA4A 3KRLA 5IUIA 3N4VA 5EM5A 3PXQA 1WBNA 5E92A 3F5PA 2XNPA 3D9VA 4KWPA 4W9WA 3SHEA 3BYUA 1H0VA 3A7JA 1GIHA 5CASA 3KY2A 3LW0A 2O0UA 1PXJA 3JYAA 1Q61A 4R3PA 4R3RA 5TOZA 3S95A 4O86A 4YC8A 2YDIA 4J96A 4OGRA 3VHKA 1W7HA 4MNEA 2QLUA 1Z9XA 3QTRA 3UOJA 3QZIA 4JR7A 4AFEA 3Q5ZA 4O27B 4C58A 2AC3A 1JAMA 4YO4A 5A4TA 3BLQA 2BFYA 1ZYCA 1IA8A 4Q9SA 5HBJA 3SC1A 1MRYA 4FEQA 1KE9A 1DI8A 4L01A 4K77A 1W8CA 2OZAA 4I6BA 3PVWA 1H27A 5C1QB 4LV5A 4O7SA 5HE3A 3JY9A 2YITA 4L3JA 2J4ZA 2BZHB 4PPAA 4XJ0A 5E8YA 4X2JA 4DCEA 2ITOA 3OBJA 3PP0A 4FODA 4ACDA 1OBGA 5LOHA 4EOIA 4RPVA 3MH0A 3OUKA 5GJFA 5AX9A 2CDZA 3F66A 2AYPA 4QMSA 1Y57A 3QXPA 5EHLA 4XRJA 3R7VA 2QQ7A 4TL0A 3CBLA 5M4UA 3ZZEA 5F95A 5IA5A 4XG6A 4TYIA 3W1FA 3GBZA 5B2KA 4CCUA 5KMIA 2PWLA 4M84A 5KHXA 5HICA 5AR7A 4JT3A 4M66A 4LRMA 5EHYA 3U51A 3UDBA 5CF8A 4IBMA 4OT5A 2J7TA 2RSVA 4X2FA 2FSLX 5H8BA 3DGKA 1BYGA 2OH4A 1DI9A 3RGFA 3TZ7A 4FVPA 3FMLA 3UE4A 3UYSA 2O65A 4ZTSA 1GZNA 4R7IA 5HO8A 5AV0A 2C6KA 4O6EA 3ZM9A 4EUUA 2BROA 4UN0C 1Z5MA 1QPEA 2PVHA 1WBVA 3THBA 3MFTA 4GT5A 4A07A 4FGBA 4YZNA 4D4YA 4Y8DA 2HK5A 3GP0A 4AE6A 5B2MA 4F7LA 3MESA 4CMOA 4GRBA 4ANQA 4PUZA 3EN5A 1FINA 1X8BA 3DV3A 5JQ8A 3A4PA 3EQDA 3FDNA 3L8XA 5LQFA 1XBBA 4ZTHA 2C4GA 2UZLA 3CGOA 5HKMA 3QX4A 4DITA 3OZ6A 2QKWB 3MB6A 4TYHB 5DEWA 2HW6A 4CGAA 5E1SA 3EYGA 3FE3A 3FI4A 2WKMA 2ITPA 1ERKA 4F7NA 2OFUA 3EOCA 3V5TA 3ODZX 3KEXA 4CCBA 3QWKA 2WGJA 3AD6A 3OEFX 4FTRA 3FMNA 3WF8A 3VRYA 3QCSA 3BYMA 4F6SA 4E6AA 3LXPA 4RQVA 1H1RA 5EDPA 4FNXA 1XH7A 1J3HA 4Y5QA 4K6ZA 3DK6A 3D2IA 4LMNA 3E3BX 3QKKA 4NFMA 4D4VA 3RPVA 3ZC5A 3Q4TA 5K0KA 3G90X 3ETAA 4TT7A 4BGHA 4NTSA 3NCZA 3FHIA 4H3BA 4EH4A 1WBWA 3ANQA 3IW7A 4IX4A 3TN8A 4OUCA 3U87A 3UVRA 2XBJA 2WPAA 5HOAA 5K5NA 4G9CA 4DC2A 4LOQA 3TCPA 3D83A 2FGIA 4F0FA 2WQEA 3QFVA 3KGAA 4Q5HA 2EXMA 3AMAA 1GAGA 4GUEA 5HGIA 4IANA 5GZ9A 4E4LA 4ZJIA 5FBNC 2YJSA 4FV9A 2ESMA 5HI2A 4XP2A 2PZ5A 4HZRA 4EOKA 3LXNA 1J1BA 2RGPA 4CNHA 3H30A 3HV4A 4G1WA 2WOTA 2XYNA 4PNIA 5AEPA 4FVQA 4IWPA 3Q53A 5EI2A 4O1OA 1MUOA 4M14A 3MJ2A 3VC4A 4ZJVA 4HYIA 5HG9A 2CNVA 5IQFA 3UG1A 5ITAA 2R0UA 1A48A 4N6ZA 3WBLA 3A7HA 2CCHA 4F65A 2VWYA 3BU3A 1JKLA 3ORNA 2FSTX 4YMJA 4FEUA 4MX9A 3PYYA 4E4MA 4FG7A 4CSVA 2FUMA 2R3LA 3CQWA 2YM7A 1ZLTA 2YCQA 5KZIA 4CLJA 4GEOA 2DUVA 3NUUA 1T46A 3F3TA 3HRBA 3TKIA 3VAPA 4E5BA 2CGWA 3QQLA 4I21A 5AM6A 5JEBA 4IJPA 4MWHA 5M09A 3EMGA 2VV9A 4BCKA 3FC1X 2BRNA 1KOBA 3FI8A 4GKIA 4FV3A 4RWIA 5HLWA 3ZLYA 3QTSA 3WZEA 4AZSA 4CT2A 4YNEA 3F3ZA 2C1AA 5CYIA 4RJ4A 4AA4A 5JKGA 2ZM1A 4L46A 5IF1A 4RIXB 1MRVA 4N6YA 2RIOA 1VJYA 3IKAA 1RW8A 3ZCLA 4D4RA 3U9NA 2ZV2A 4BDCA 4BY9E 5GHVA 4CRSA 4C8BA 5I4NA 1IR3A 4YZBA 2RF9A 5A6OA 4GG7A 4IE9A 3E8CA 3H10A 2H6DA 3OOGA 2QD9A 5IG1A 5KMNA 4FTMA 4FKOA 1ZMVA 3LFEA 5HCZA 3RZFA 4AUAA 4NM7A 4BZNA 2XK7A 3GCSA 4AG8A 4DH1A 2PE2A 2ONLC 3KCKA 1LEZA 2WMQA 3UP7A 3F5UA 5CQWA 5HNGA 4G9RA 1BLXA 1FMOE 3AT2A 4WBOA 3DXQA 3IS5A 3G0FA 3DBEA 4JJRA 4IZ7A 4MD8E 2C6IA 4YZDA 4KBCA 2X2LA 3WF7A 2QOBA 3JS2A 4QTBA 3TDVA 4FTLA 3IW5A 3EQFA 2YAKA 2VTLA 4MXAA 2GCDA 3IQ7A 4L68A 1GNGA 4FZDB 3L9MA 4QP8A 4U44A 4ACGA 4BYIA 5K9IA 5CALA 5IUGA 4BDFA 3DNDA 2CCIA 2XJ1A 3HL7A 5HX8A 3DKOA 4FMQA 5KNJA 1LEWA 3BQRA 4QPMA 5FDPA 4HCTA 3JXWA 4BCFA 2CLQA 2I1MA 2V22A 3W10A 2RG6A 3SV0A 5AADA 4C4FA 2C6LA 1W98A 3AGMA 4RZWA 5GINE 3QWJA 1URCA 5C01A 3TNWA 4TNBA 4CZYB 4NTTA 2OJFE 4U80A 5D7VA 5BNJA 3FMHA 3GC0A 4KRDA 3OW3A 4PTGA 2PVNA 4QPSA 3NW6A 4Y73A 4YHJA 4IC8A 3OY3A 4Y83A 5B2LA 3MJ1A 2VWXA 4FT5A 4USFA 3ERKA 4ALVA 4D9TA 4BCIA 2OJGA 3D5XA 3R9NA 3BU5A 3C0IA 3FI2A 2ZDTA 4RIXA 3TUCA 2CNUA 4X6RA 3TV4A 5A4EA 4PMMA 4MNFA 1NY3A 5DNRA 2OFVA 3UIMA 2P55A 2WOUA 4O2PA 5J1VA 2VO0A 4XOZA 4B6LA 4FIHA 4ZLOA 4WNOA 4MVFA 3DFAA 3HEGA 4FKIA 4GFMA 2QO7A 4QMMA 3T3VA 2QNJA 4I5CA 3ZBFA 3ZSGA 4HVDA 5A54A 3MIYA 4EH8A 4F4PA 2X7OA 2C69A 2CJMA 5CVHA 2BDWA 1Q41A 2F7XE 2YM6A 2EWAA 3KK9A 3PXFA 2UZEA 4TYEA 4YLJA 3ZO3A 3N9XA 5J9LA 3AXWA 3CR0A 3PJCA 3S2PA 3TJCA 4ACHA 4EOJA 3FLQA 4ANOA 4UWBA 2C5NA 2VTHA 4EEVA 2IZSA 3UQGA 2JIUA 5BVDA 1H01A 4TY1A 4XH6A 5KHWA 2ONLA 4E5AX 3COKA 3ITZA 4G17A 4BWKA 4WNPA 4ZK5A 4C4IA 3EKNA 3QC4A 2P3GX 3I7BA 4F7JA 2I0VA 4GK4A 2VUWA 1PY5A 5HO6A 3PG1A 1K9AA 4OBOA 3WOWA 2W1EA 3UYTA 4ACMA 4RIOA 4DN5A 2WD1A 2H9VA 3C0GA 3OCSA 3MDYA 3OS3A 1F0QA 4KS7A 5GZAA 5IISA 1PRYA 2DQ7X 3OP5A 4X6QC 4IVBA 1SMHA 3GB2A 3OCTA 2XIKA 3ZH8A 4BGGA 2KTYA 3NW7A 4RA5A 5DR6A 2YM5A 3E92A 3C4EA 3ZM4A 1NVQA 1XBAA 4RIYA 2BRMA 2IVUA 2IN6A 3KQ7A 4IFCA 4AGUA 3EWHA 4NU1A 3MS9A 4OW8A 4I23A 4MK0A 4TWOA 4Z3VA 5BPYA 5HO7A 1H26A 4FKJA 3DBDA 3QKLA 4JL9A 4WRGA 3RNYA 3QLFA 4OTIA 2PVRA 4UXLA 3I6UA 4GMYA 4CFVA 1ZYDA 5LVPA 5AP2A 5BUIA 3H9RA 3S3IA 2I7QA 4FTAA 4FZFB 3TNIA 4WUAA 4PRJA 3NYXA 4L00A 4EJ7A 4XX9A 5AR8A 4ZOGA 2Y7JA 4BF2A 4HVSA 4A9TA 4OTRA 4U41A 4EOLA 1JSVA 2VGPA 2BKZA 2WMSA 2UW8A 5AJQA 5G1XA 1DM2A 3PRFA 1M52A 1Q4LA 2OIQA 1ZYSA 3F3VA 4IQ6A 4LMUA 4X3FC 3KC3A 5CT7A 4TWPA 4QYGA 5C03A 1M2RA 3RAIA 4DINA 5HVKA 5ETCA 2VNYA 5I9YA 5AA9A 1NVRA 3FXWA 5DE2A 4X3FB 3FQHA 3VBTA 1ZY4A 4M97A 5E4HA 4CG9A 4FR4A 4FV4A 4J71A 4LQMA 1S9IA 1OIQA 3LAUA 2WTCA 3UC4A 2X0GA 5BQ0A 3EQPA 3QTUA 4IB1A 5LWMA 5CEIA 2J0IA 4QMXA 3DCVA 4CKRA 2X6DA 3P78A 5CU6A 3U6JA 5CY3A 4U97A 2A1AB 4P7EA 3PDTA 2OXYA 1PW2A 1GZKA 5I9UA 1XKKA 2H34A 1TQPA 4XHKB 4AN3A 4S33A 4L43A 4EH7A 3GCVA 3F2AA 3R9DA 2PE1A 4RVMA 4BC6A 4DTKA 1H24A 4HCVA 3H4JA 3TG1A 3E7VA 4YO6A 4AFJA 4C3FA 2P2HA 2B4SB 2CGUA 4BR3A 4KB8A 2O8YA 4FL3A 3C4CA 3R73A 5I0BA 4PMSA 3NUYA 4GK2A 2GMXA 1CTPE 4KIQA 4LG4A 5EDQA 5ETFA 3MY1A 2QO2A 3PSBA 3TIYA 4BI1A 4FOCA 3DTWA 3KXGA 5DG5A 5BVWA 5L6PA 3A7IA 3NIEA 1M7NA 1SVHA 3EL8A 4DHFA 4EQUA 4O7VA 3LJ0A 4LOOA 2XS0A 5CNOA 4G6OA 3E64A 1HCKA 2QCSA 4IZAA 3VQUA 4C4GA 2OGVA 1H00A 5KZ0A 4B9DA 4O0XA 4RWKA 1G5SA 4IVAA 1U5QA 5DI1A 4CV9A 2WELA 4YU2A 5A9UA 5J7BA 3R8PA 4PWNA 4F9CA 3OOMA 5BUJA 5DHJA 3R21A 5IQGA 1S9JA 4GL9A 4FIEA 4BTJA 4AZWA 3Q9WA 2X9FA 3O8UA 4WA9A 3WZDA 3F3WA 1XR1A 5K3YA 3QKMA 1YHVA 1OIYA 5GJGA 1OKYA 2QOLA 4XV9A 4JX7A 4PMTA 4OTWA 3SX9A 3B2WA 3UC3A 4E26A 4NKAA 2P2IA 3PXYA 3DU8A 4GJ3A 4C4HA 3QA8A 5IQEA 3F9NA 4PL3A 4WNKA 1GZOA 2VRXA 3NCGA 2ETMA 1NXKA 3ZTXA 4X3FA 2GS2A 2X8DA 3EQGA 3EQHA 4UY9A 3ZMMA 1QPDA 3MPTA 3SW4A 5FQDC 3U4WA 4UMPA 1JKKA 2GQGA 4RJ6A 2UZVA 5KX8A 2Y4IB 4EH5A 3QCYA 5M4FA 4MXCA 2PUUA 3ZO2A 1JKSA 4B7TA 5FEEA 3EQCA 1BUHA 1H1QA 1Q8WA 3OEZA 1W84A 2WTJA 3TXOA 3FQSA 4QMTA 4Y95A 2XH5A 3FY2A 1H1WA 4HYUA 3VS2A 1KUTA 4FKVA 5EI6A 5JQ5A 2HY81 4RX7A 3RWQA 3P7BA 3WE8A 1PMEA 4O0WA 2BILB 4I4EA 3FPQA 4G31A 5EKNA 5LVMA 4N57A 2QC6A 2YM4A 3TUBA 4FIJA 4DG0E 3W2CA 4PDOA 2YA9A 3ORLA 3NGAA 4IB3A 3QCXA 4I3ZA 3QUEA 2C6OA 4CQGA 4C61A 3OMVA 4LRKA 1ZARA 3EHAA 4FC0A 2W5BA 5H8EA 3O50A 3PWYA 4G5JA 4DTBA 3EFKA 3QALE 2BR1A 3ULIA 3UZPA 3VBWA 2UUEA 3F69A 2XNNA 3W2QA 4ASEA 3VF8A 4AW0A 4JXFA 4J53A 4EBVA 5IQDA 3U6IA 3K5VA 1G8AA 3DQWA 3OROA 4E3CA 2DS1A 4FTTA 2FVDA 5IQCA 4RC2A 4QP6A 5DRBA 5EG3A 4YP8A 4IWOA 4AW5A 3VVHA 1R1WA 3BHTA 3DAEA 2B9HA 5AP0A 2VWWA 2J5EA 4DH8A 3DJ5A 4OLIA 3SLSA 1ZRZA 1QL6A 2W9ZB 4ANMA 4CG8A 2VX1A 5LMKC 2XK3A 1PMVA 3AD4A 3E93A 3PIZA 2JC6A 4EWQA 1Y6BA 3FSKA 3KRWA 4A4OA 2ZDUA 4HNFA 5AIRA 5K4IA 1RDQE 5JZNA 2UW5A 3G0EA 4B8LA 2W0JA 4F09A 3SG8A 1OPKA 2QOOA 2XJ0A 5CSHA 3UIXA 2BAJA 4EHEA 4Q9ZA 3CD8A 3DZOA 3R22A 4QMWA 4H3QA 5HLPA 4U42A 5CAVA 4IB0A 4AF3A 2XNMA 3LCTA 1ZYLA 3QQHA 4J7BA 3DNEA 2BTSA 3DQXA 2UV2A 5IZFA 5KO1A 2C3LA 4K1BA 4IAKA 3C7QA 2W4JA 4QYYA 4AN2A 4MD9E 4F9BA 1FVTA 4ZTMA 5K4JA 3RK5A 2JDRA 3NVKI 2XMYA 1PYXA 4UZHA 4F9YA 4BWXA 5AWMA 3TZ9A 3Q4ZA 3CTQA 3HV7A 4DA5A 2VO3A 3KK8A 2QKRA 4EOSA 4EOOA 4QQCA 1PXLA 3AC2A 3E3PA 1R3CA 2G01A 3R8UA 4OAUC 3HX4A 3NSZA 4PL4A 1IG1A 1XH5A 2C5VA 2J9MA 3KKVA 4GJ2A 4R5SA 2GHLA 4WKQA 1O9UA 1UA2A 4AZVA 4C37A 3SW7A 2UW3A 4EOQA 3PPZA 3IG7A 3NDMA 5DA3A 4EK5A 5IDNA 3BELA 3QRUA 4EK3A 4O7LA 3FKNA 4AOIA 3BGPA 4WD5A 5FP6A 3VS4A 4BN1A 1RE8A 3BGZA 3F7WA 5AMNA 1WZYA 1XO2B 4O0YA 4A06A 2Y9QA 3DKGA 4FIFA 2OZAB 4IAFA 2JDSA 3L8VA 4DF3A 3QLGA 3QHWA 2HCKA 5CS6A 3UTOA 3JVRA 2UVXA 3BBTB 4ZEGA 3UBDA 4D4SA 1IEPA 2PE0A 5EQYA 2WAJA 5L6OA 3DJ6A 2O3PA 5J8IA 3UIUA 2HY0A 4FSWA 1OUKA 4TNDA 1DS5A 5IU2A 1CKIA 3UNKA 3DB8A 2YFXA 3C5UA 3VJOA 3LM5A 4H1MA 5FD2A 5C8MA 2PZIA 2YDJA 3TEIA 3HNGA 3GI3A 3U9CA 5GIPE 4EHGA 3F2NA 3GU7A 4CTCA 3QRKA 2OIBA 3OVVA 3FLWA 5JRQA 5J87A 4JBQA 3GENA 5E8ZA 3ACKA 5LMKA 4WT6A 3BCEA 2O63A 4LFIA 4CQEA 4RA4A 3VBQA 4KUJA 3LCKA 3OCGA 4E1ZA 3P9JA 3PZHA 3FBVA 2UZWE 3JPVA 2RFEA 2GFCA 1Q8TA 2IW9A 3HA8A 3MVJA 4FTOA 3M42A 5GZ8A 4NUSA 1A06A 5AUZA 4KKEA 3MBLA 4FKLA 1WFCA 4JG8A 2F2CB 3LCOA 4RX8A 3ORTA 2R64A 2J6MA 3O8TA 3PTGA 4ZMEA 1KV1A 4ALUA 4X7QA 3FMKA 2V0DA 2WMTA 3R0TA 4FSZA 4UZDA 1UWJA 1YDRE 4LOPA 1Y8GA 3JVSA 4E4XA 3MPAA 3Q96A 2VGOA 2W1CA 4RFZA 3RAWA 3V6SA 4JQ7A 4BI2A 5L6WL 4IZ5A 3W33A 4YTHA 4C38A 2W1ZA 3PSDA 4EC8A 4D1SA 2J0KA 2C0IA 4TN6A 4ZXTA 2OICA 3BHVA 3KMMA 4IFGA 3VS3A 2YWVA 1O6LA 2P4IA 4DBNA 4KKGA 3EQIA 5FXSA 5CU2A 1YRPA 4ZLYA 4AQCA 3TV6A 4MHAA 4D1ZA 2V55A 3EL7A 4K8AA 4XV1A 4CT1A 1OIUA 3O7LB 4FTCA 4IC7A 2GU8A 3Q9YA 1OB3A 1ZMUA 5ICPA 1OL5A 3GFWA 1OPJA 4IHPA 1WBPA 4XG3A 4FEVA 4D2VA 4TRLA 4YLKA 2QOHA 4O83A 4DGNA 4XMOA 2CN8A 4H39A 2XK9A 5HIBA 4R7BA 2X4FA 5JK3A 4BCOA 5JN2A 4ZS4A 3S4QA 4MYGA 5EH0A 1GY3A 3QZHA 1TKIA 2VWBA 3IGOA 1PYEA 5AUTA 2QLQA 4Y5HA 3TWJA 3FMMA 3CGFA 2C5XA 3MSSA 3QRIA 1H1PA 1XH9A 2YIWA 2HWOA 2O64A 4G3GA 4P90A 2QOQA 5JZJA 3H0ZA 5TF9A 2YAAA 4E4NA 5CEPA 4DLIA 1BI7A 2PZRA 4HNIA 2WMWA 1ZOHA 2XP2A 4BDEA 4RX5A 4GVAA 3BEAA 4O6LA 3BLHA 4X2NA 1UU8A 2CHLA 2RG5A 3KMUA 4FK3A 1SNXA 3NPCA 5DH3A 4CV8A 4EC9A 4FZ7A 4LV8A 4E93A 5HX6A 2OW3A 4UYNA 2CKEA 5D10A 5HVYA 2IPXA 3K5UA 2FH9A 5J1WA 4FUXA 5IMEA 3R2BA 3LLAA 3HMOA 4OTHA 1W82A 2HENA 5LMAA 3ORKA 3W16A 5L2WA 1QMZA 4F63A 4BIDA 2Q0NA 2ZMDA 4X3JA 4C62A 2F49A 5C8KA 4V01A 2WTVA 4BDDA 2YJRA 2KULA 3UG2A 2B0QA 4RLKA 3RCJA 3RINA 3WIKA 2W05A 5IH5A 3ENMA 5M06A 5CX9A 3C4WA 1Q62A 3BZ3A 1YOMA 3VF9A 3HMNA 3MV5A 4YPDA 2ZMCA 4GVJA 5K5XA 5EOLA 3RTPA 2WMVA 3R8MA 5C26A 3CQUA 4R8QA 3UZRA 2C68A 3AGLA 3R2YA 4BHNA 4YHFA 3F3UA 3NEWA 4RVTA 4P5QA 4JAIA 3DBFA 3WYXA 4IM2A 3TI1A 3ZO4A 5H8GA 1JLUE 4XV2A 3KXXA 3TM0A 4QTCA 5IMXA 5BYLA 4QP1A 4G2FA 4CLIA 2EU9A 4DEBA 1PXMA 2F4JA 1JNKA 4WSQA 4M13A 5L4QA 4ZZNA 3FMDA 2IVTA 3BU6A 3UO6A 3FZSA 4D2RA 3PWDA 5I3OA 5GIOE 2WTDA 2J5FA 5HIEA 3UQFA 5D41A 2OJIA 3ZSHA 1Q8ZA 3IDCA 4ZSGA 3R1YA 1TQIA 1U46A 4FKRA 5M56A 3FXXA 3V5QA 1OL1A 4MD7E 3E8EA 3G15A 1KSWA 2EB2A 4RWLA 1UNLA 4WBBB 3V5LA 4EONA 1XH8A 3UVPA 3QD0A 4YBJA 2XCHA 2R3KA 4UBAA 3B2TA 3KRRA 2BPMA 3UIBA 4D28A 5C4KA 3R30A 3W32A 4F0GA 5HU9A 2W5AA 3FKOA 5BUEA 4YHTA 3R9HA 1MRUA 3MGYA 2V7OA 4L42A 3DLSA 3RHKA 1OPLA 3D5VA 4GIHA 4GK3A 2WB8A 2HOGA 5CSXA 4EZ7A 3B8RA 2BMCA 5IEYA 3VNTA 3F5GA 3QTZA 4JRNA 3EYHA 5DEYA 1WAKA 3LHJA 3LIJA 3Q2MA 5HEZA 2WTKB 1OECA 3EQRA 2ZJWA 4IX3A 1M7QA 2VNWA 4RSSA 3GC9A 4FF8A 4KD1A 3R83A 3BE2A 1KV2A 2ERKA 2XBAA 3RI1A 3I79A 1DAYA 3UO5A 3RP9A 4ENXA 4Z7HA 3LZBA 4OR5A 4OTDA 4V04A 3TTIA 1SYKA 2Z7RA 3OFMA 4C59A 4RIWB 3ELJA 1OIRA 2Y6OA 2ZYBA 4QMYA 2ITNA 1Y91A 2QHNA 3OXTA 4BHZA 4EK6A 1PHKA 3GOKA 4FBXA 4DFUA 3AC1A 3E62A 4DCAA 3PXRA 2BRHA 3OWPA 2GTNA 1GZ8A 4MQ1A 4YZMA 1H8FA 5EW8A 3KXNA 2ITZA 3DXNA 2PZPA 3COHA 5KMLA 3DB6A 2W1DA 3WIGA 4FVRA 4TYGA 3EZVA 5I9VA 2Q0BA 4KRCA 4RFMA 4QT1A 5AP5A 4HGLA 3D5WA 2YERA 2ZVAA 4TYJA 2ITYA 2YCSA 3SXRA 1FPUA 3PP1A 3RM6A 4ANBA 3UPZA 1H4LA 3IDPA 4M15A 3HAVA 5IUHA 3GU5A 4MF1A 3R7OA 4C7TA 5E8TA 3S00A 4O21A 4I0RA 3L9NA 2XNGA 3MVMA 4ALWA 4I5HA 4IX6A 4BCPA 3KF7A 4DFZE 3ANRA 2F2UA 2OH0E 2XNBA 3W55A 3LXKA 4KIPA 5FGKA 3ZUVA 3ET7A 5LMBA 3QTIA 4YPSA 4G16A 3WZJA 2BHEA 3OUNB 1ZXEA 3E87A 1KE7A 4A9UA 3UZTA 2W5HA 1Q24A 3ID6C 1JPAA 2XKCA 3FLZA 2W1FA 4MAOA 1V1KA 2YIXA 3BX5A 3CEKA 2QI8A 4U45A 4BIBA 1MP8A 3R02A 3LFNA 3R63A 4DGOA 2YIQA 3D2KA 4ZZMA 2UW9A 5IA1A 3EZRA 4G3CA 3I7CA 3F82A 3KRJA 2UVZA 4C2VA 4EK8A 3KREA 4JBVA 1ZOEA 1IRKA 2UZOA 3FZRA 4ENYA 4ZTQA 1EH4A 4YZCA 1P4FA 4ZTNA 4IJ9A 5EDRA 3W2SA 4BZOA 4DGMA 3GU6A 2VO7A 4CRLA 2UZDA 3K2LA 3QAME 3MFRA 5BVFA 2PK9A 3ZLWA 3WF5A 3VUKA 2J0MB 1YOLA 4XOYA 2R3PA 2YDKA 2LAVA 5HE1A 4ITHA 1Q3WA 4X21A 3R7EA 4I24A 5KMOA 3K54A 4RIWA 4XBRA 2B9JA 3QBNA 3QQGA 3AQVA 2CPKE 4RIYB 4DEHA 5EOBA 3TNQB 4EQCA 2OLCA 2G9XA 3QZFA 3KN6A 5L2IA 2WQBA 1SM2A 3PLSA 5CAPA 1URWA 1KE5A 4Q5EA 4EKKA 5JH6A 4JQ8A 4XYFA 2ETKA 4JVGA 4NIFB 4RVKA 5FP5A 3NNXA 3QQKA 2ZB0A 4AN9A 4BCNA 4EYJA 4F6UA 2C6EA 3TACA 3FY0A 3NS9A 4QYEA 4ITJA 4WOVA 4HPTE 2PYWA 2Y6MA 4K18A 5AP4A 5FXQA 2E9UA 2R3QA 4JAJA 5HD7A 2RKUA 5AR3A 4EWHA 5BVNA 3GUBA 1GOLA 4CZUA 2A2AA 2QURA 2XK8A 2Y8OA 3R28A 3NLBA 2ZOQA 4PL5A 3HRCA 1XHAA 4NCTA 3CY3A 4QO9A 2C6TA 4U43A 5AP1A 2P33A 1P5EA 4HZSA 1J7LA 3KVXA 5DN3A 2GNGA 3RMFA 3CTHA 4IEBA 3DZQA 4QTAA 3H3CA 3GU8A 5FXRA 4C3RA 3SXFA 4DG3E 3GNIB 2YACA 2BFXA 3R7GA 5M4CA 1YI6A 4OBPA 4BBMA 4O82A 3LQ8A 2VD5A 4PTEA 3IOKA 2C3IB 3Q32A 1E9HA 1GJOA 3MN3A 4MEDA 3QD3A 4D58A 3LFAA 4G6LA 3MA3A 3M11A 3FL5A 4JDJA 4FT0A 3ZDIA 4U3ZA 3S1HA 2YCRA 3NR9A 4PF4A 1OL6A 3TJDA 2QG7A 5EKOA 3MVHA 4D5KA 3VO3A 5FEDA 5HG8A 3QGWA 4C02A 3PY3A 2YN8A 2YLFA 2HZIA 4J52A 2YZLA 1JSUA 1YXXA 3VS6A 2B7AA 2NRUA 4FICA 4II5A 4C36A 1NVSA 2R3JA 2XNOA 3GCUA 4ZTLA 4D1XA 4W4VA 4F7SA 3C50A 3SGCA 1PXNA 3N51A 1OKVA 3FPMA 5C8NA 2XM9A 2R3OA 5A4QA 3VW8A 3BI6A 4O7YA 2R7BA 2JDTA 4XP0A 4GYGA 4TWCA 3FAAA 3MW1A 4MXXA 3ZUTA 5I5ZA 2WMBA 5KUPA 4R1YA 2YM3A 3RPSA 2Y4PA 3G9LX 3MH3A 4JG7A 4LM5A 5ANGA 5JSMA 2PMNX 3GOPA 3KRXA 5E7RA 4C3PA 1J7UA 3VUTA 3S0OA 2UZUE 4FTKA 1PXOA 3NUPA 5DBXA 3UNZA 4NIFA 4O96A 5TE0A 3W2PA 3TKUA 4ANSA 4XEYA 1UKIA 2XUUA 3SOAA 3MWUA 2I40A 2X9EA 3C0HA 2JAMA 4FV5A 3AOXA 2XJ2A 4FKWA 2G2IA 4IAAA 4O2ZA 3COIA 3MTLA 3JR1A 3QU0A 3WE4A 1V0OA 2W9FB 4GH2A 4V05A 3DAKA 1REJA 3UP2A 5IA0A 4KSPA 2XF0A 3PJ1A 5EYKA 4BDBA 4UMRA 2BUJA 4JX3A 5F1ZA 3GFEA 3BPRA 4QD6A 4E6QA 5C27A 3P4KA 3GQIA 1I44A 4HOKA 2PVJA 3SVVA 3GXLA 3CLYA 4J8NA 2JKOA 4QMLA 2IW6A 3LJ1A 4GIIA 4U8ZA 3ZHPC 5A4CA 2GFSA 5JGAA 1OKWA 2XM8A 3PIXA 5AX3A 1STCE 1SZMA 2YM8A 2ZV7A 3A60A 3VWAA 1A9UA 4JNWA 4S34A 2ACXA 4C2WA 5JFSA 4QTEA 3BV2A 4HGEA 4X2KA 2NNWB 5CENA 4I0SA 3KULB 5DRDA 1Q5KA 5HTCA 2R3IA 3IW8A 4FKPA 4EOPA 3CPBA 2CGXA 4HGTA 3KL8A 4RJ3A 4S32A 4L67A 2QODA 5HE0A 5M08A 5L8LA 5L2QA 5ACBC 5BVOA 4GFOA 3FSFA 4NSTA 4R3CA 3QHRA 3ZRKA 3DKCA 3VS5A 4QP3A 4WIHA 5FWKK 5A46A 2VTSA 4N4SA 4TWNA 3NMUF 2NO3A 3ZXZA 3NWWA 5AUUA 5ANIA 4DFBA 4G34A 3Q52A 4F6WA 3RAHA 5L2TA 2VTIA 2DYLA 2F7ZE 4OTQA 5J5TA 4FKQA 1XWSA 3EFJA 2I6LA 3M2WA 2X1NA 4O0TA 1PMUA 3MY0A 4YTCA 1YI3A 4UX9A 4GSBA 4O7RA 3TNPC 3V6RA 4FNYA 4NL0A 3O2MA 4DEGA 5AUXA 3MFUA 1WVXA 4JIAA 4DGGA 5J5SA 5M53A 2PUNA 5F9EA 5BVKA 3UJGA 4QNYA 4AT3A 4FV1A 3W8LA 2H96A 5AP7A 3FMEA 4FKUA 4FGRA 4N70A 4KAOA 3Q6WA 3UOKA 3R9RA 1SVGA 4A9SA 2PY3A 3VBYA 5CTPA 3R7IA 5JGDA 2F9GA 3Q4CA 2JIIA 5IEXA 4JR3A 1BX6A 4ITIA 5FRIA 1YWVA 2XRUA 4TKSA 2VTPA 2A0CX 3UGCA 3DT1A 5HTBA 4P2KA 4XG7A 2PVKA 4YJSA 2GNLA 3HMPA 3Q4UA 4CVAA 3FMJA 4AX8A 2JBOA 4YSMA 4IM3A 3ZC6A 2VTAA 3G2FA 4AACA 4BTMA 5AAFA 2FB8A 3EN6A 4O22A 4F64A 3P08A 4CKIA 3LFCA 3FZTA 4FIGA 2Z7SA 3IPHA 3RNIA 3CC6A 3BYSA 3G5DA 2IVSA 1L8TA 5FTOA 1OBDA 3QL8A 2Y4IC 2A27A 2R3NA 3CD3A 5E8XA 3EFLA 5DYJA 4PQNA 5DIAA 5CAUA 2OF4A 4DE4A 3E5AA 1OL2A 3OHTA 4Z7GA 2UW6A 1H07A 1TVOA 1DAWA 3C4ZA 3HMIA 2JAVA 1WMKA 4QP4A 4PV0A 3UNJA 4EI4A 3U6HA 3W2OA 4PPBA 2ITTA 3CS9A 3R7YA 3A7GA 3LQ5A 3HRFA 3MTFA 4BBEA 3FZ1A 3KULA 4F70A 3U55A 5AV2A 4ZLZA 4CMTA 4GG5A 2R3MA 2X4ZA 5F20A 4F1TA 3DFCB 3FEGA 1IASA 4U81A 2OO8X 4W4YA 5CU3A 4WSYA 1ZWSA 3OW4A 4HW7A 4ZY4A 5E9EA 4QOXA 3IW4A 4AT4A 5IH6A 2EXEA 2PL0A 3ZO1A 3RK9A 4RGJA 1NW1A 2PULA 4YSJA 1FQ1B 2VWVA 3OD6X 2XEYA 4B0GA 3DS6A 4GT4A 1OKZA 4IVDA 1FVVA 3COMA 3PUPA 3CIKA 3HDMA 4I6FA 4OBQA 3FYJX 3HECA 5T3QA 5CU0A 1WVWA 2WMXA 2X8IA 3MPMA 3NAXA 4K0YA 4K9YA 4FG8A 4KABA 4MBJA 3UVQA 4BDAA 3OCBA 4RJ7A 4FT9A 3ZUUA 3QTQA 1PMNA 2HXLA 3VRZA 4EK4A 4IXPA 4KIKB 3KXZA 4CXAA 2QO9A 2J0LA 2QG5A 2Z8CA 3BKBA 2R3HA 3HVCA 4XRLA 5B0XA 3LMHA 5CZHA 3CCNA 2X7GA 1ZZLA 5KMKA 3NVMB 1O6KA 3LOKA 4LUDA 1WBSA 3R01A 2VTJA 2IZUA 5AP6A 5IQIA 4RFYA 1YI4A 4Y85A 2JD5A 3AMBA 1SNUA 3POZA 4W9XA 5DGZA 1MQ4A 1J7IA 1PJKA 3JUHA 3R8ZA 3WF9A 3A8XA 3CKWA 2WIHA 3VUGA 4MKCA 5EFQA 2OKRA 4FKSA 5JFXA 5AP3A 3EKKA 1JBPE 3KCFA 1V0PA 4FNZA 4IADA 4F99A 3RJCA 1VZOA 3WARA 2BRBA 3U8WA 2ITVA 4KA3A 5D1JA 5TR6A 3ROCA 4FX3A 3ALNA 3E8DA 3GC7A 2OG8A 5AUYA 2XYUA 3VIDA 3CPCA 5AR4A 2OXDA 3NX8A 4L7SA 3MA6A 4YR8A 1ATPE 5D7AA 5DOSA 5ETIA 3SRVB 5T68A 4YTFA 4JRVA 4CYJA 4Y46A 2JFLA 3BGQA 2IWIA 2R3GA 3UOHA 1CM8A 3SQQA 1YVJA 4EUTA 3R9OA 2PVFA 3LFFA 1UU3A 3P0MA 2XKDA 3LVPA 2PHKA 2Z7QA 5BMSA 5C4LA 5DFPA 3DOGA 4C33A 2VWIA 5G6VA 2G2HA 5TO8A 4BCGA 1UV5A 2YCFA 2ITUA 3ORMA 2C5OA 2IVVA 4NEUA 3A2CA 2B55A 3I0OA 2REIA 3P5KA 3G6GA 4B8MA 3FUPA 5D11A 2IG7A 3R1QA 4L9IA 3Q04A 1UU9A 3DAJA 2P0CA 4APCA 1B39A 4GFGA 4I94A 4YLLA 5HVJA 4AGWA 4PP7A 2J51A 3RCDA 2PUIA 1J1CA 3L9PA 4RWJA 1LPUA 3VULA 5AFVA 4YJVA 3IGGA 4YJTA 4KIKA 4J1RA 4RBLA 4C4EA 4WG5A 1CDKA 2PTKA 3KU2A 4CEGA 2QOCA 4BYJA 5JFWA 5L8KA 2WIPA 3EN4A 3OG7A 3OWLA 4FL1A 1LP4A 2JFMA 1YWRA 3GC8A 4DEDA 3WF6A 4O7NA 2W96B 3IONA 3F5XA 4ARKA 4E5WA 3FQEA 3LMIA 3ORXA 5CI7A 1YXTA 3MH2A 4ASDA 3CY2A 4MXYA 4MWIA 4LUEA 4GT3A 1BKXA 3HV6A 3PZEA 1IA9A 3BIZA 5CNNA 2UW0A 4DGLC 4XV3A 1YXVA 4I92A 4ONAA 4APPA 4BGQA 4D2WA 5HG5A 2RFDA 3NUXA 4FKGA 5AM7A 3WYYA 4RMZA 1IAJA 1UVRA 5HIDA 1PKDA 5EYDA 2LGCA 3TDWA 4HJOA 4QMOA 5BX0A 4H05A 3Q3BA 2G15A 3FHRA 3FWQA 1WBOA 3SRVA 4ACCA 3LMGA 4QQTA 2NP8A 3PA4A 5LARA 3TIZA 3QUDA 4DFNA 3LFDA 2YWPA 5J95A 5HG7A 2JKQA 4XLIA 2VWUA 4ZP5A 2W1GA 5CVGA 3PRIA 4NYEA 2SRCA 3QQFA 3QZGA 4HCUA 5ANEA 2PVYA 3A99A 4YJUA 3OXZA 5ANDA 5AV1A 5A3XA 4I1ZA 1KE8A 2Y0AA 5FTQA 2XZSA 3ZFMA 4ZSLA 4DEIA 3CXWA 3R8LA 3RVGA 2C6DA 3ATTA 5C9CA 2R5TA 3QRJA 4R7HA 4BBFA 2A19B 4FSMA 5LJJA 4RVLA 1AQ1A 2Z2WA 3D15A 4H36A 4FV8A 4YTIA 4AW1A 4P4CA 5CWZA 4AU8A 3EH9A 3AT3A 3MIAA 4O0VA 2BKKA 4MXZA 3QQJA 4GU9A 1O6YA 1PXIA 5DT3A 3G9NA 3LJ2A 5FBOA 4EKLA 5M07A 2JITA 4IB5A 2UVYA 3V01A 4HGSA 3QUPA 5IA3A 1YXSA 1YKRA 2JIVA 2QONA 4HPUE 4PDSA 3MFSA 4DEEA 4QQ5A 4BCHA 5D9HA 5EI8A 3LE6A 4XS2A 3U4UA 4NK9A 5AIKA 4I5MA 3L8PA 5EYCA 2X39A 2E9VA 4BVUA 3CJGA 3P7CA 4U0IA 4GU6A 2OWBA 4LL5A 1VR2A 2VAGA 1JOWB 4O81A 5FM3A 1BMKA 3N4UA 2XCKA 2GPHA 5HCYA 3V8TA 4BIEA 5FEQA 5CXHA 4MTAA 5J79A 2V5QA 1QPCA 3BHUA 4AOJA 3DBCA 2NPQA 3PA3A 3REPA 2GHMA 3Q2JA 4M3QA 3HV5A 3BYVA 5K0XA 1XH6A 4ZIMA 4A4XA 2XIZA 4BCQA 3WILA 1CSNA 2B54A 4JOAA 5AR2A 4DFLA 2R2PA 3DA6A 4A4LA 4O7TA 3TZ8A 4QMUA 5E8SA 4FSNA 4ZS0A 4NKSA 4AS0A 3OTVA 1Q8UA 2HZ0A
chains in the Genus database with same CATH superfamily
4A9RA 3V5WA 3Q60A 3A62A 4EH2A 3JY0A 3O0GA 4DFYA 4WUNA 1QCFA 3VS7A 2Z02A 4LI5A 3V04A 3C1XA 2R4BA 4BRXA 4UXQA 2HZ4A 1LR4A 1NA7A 2JBPA 3KVWA 4AZTA 2F7EE 3GEQA 1APME 4IAIA 4AZEA 4OAVB 4J95A 1UKHA 3D5UA 2VU3A 3KIOC 3PJ3A 3BE9A 1ZOGA 5J9ZA 4C34A 3ZEPA 2BAKA 3D7TB 4E6DA 3OF0A 3V5JA 2VTNA 1R0EA 2FA2A 4I0TA 2J90A 3I5ZA 5GJDA 3NUAA 4S31A 4QP7A 5HQ0A 4BDHA 5HHWA 2XRWA 2WMRA 4IW0A 4AWIA 2VZ6A 5LVNA 2PMOX 3RZBA 4WG4A 3MVLA 4KIOA 2VTMA 4LL0A 2I0YA 5L3AA 4TTHB 2IO6A 3HKOA 3F61A 3IECA 4LYNA 4DTAA 2XIXA 1VEBA 4YGAA 2XK6A 3H9OA 4BTFA 3LCSA 3QD2B 4D9UA 2W1IA 3KXMA 3FYKX 1UNHA 3F88A 4QEBA 4MBLA 5LVLA 4NW5A 4BCJA 5CEKA 3HP2A 4XG2A 5CI6A 3F6XA 4O0SA 3ULZA 3VN9A 1E1XA 4M69B 4ASZA 4CFWA 2CKOA 2UZBA 3ZU7A 4EH9A 1R0PA 2BZIB 1UWHA 2GNHA 2PSQA 1R78A 2OSCA 2C1BA 3NUSA 3SD0A 1OI9A 2Z60A 3FJQE 3CSVA 4QRCA 2WFYA 3B8QA 2PVMA 3HUBA 2IW8A 2PPQA 5FG8A 4EOMA 2OI4X 3D4QA 2WZJA 3R1SA 3IOPA 1PF8A 1L3RE 4JG6A 4F9WA 4UMQA 4M68A 5LWNA 3A8WA 3FC2A 2XIYA 3NAYA 5HESA 4NWMA 4UB7A 2G1TA 3PVGA 3BHYA 2V7AA 1YHSA 3OY1A 5IKWA 3ZLSA 1Q8YA 2PZYA 4QMPA 1B38A 2XIRA 3AC8A 1U4DA 2WTKC 2PMLX 3MI9A 3W18A 5AV4A 4KKHA 4O7ZA 3DDPA 4X0MA 2JGZA 2X2KA 3NNUA 3HA6A 5M44A 2AC5A 4XG9A 2ZM4A 2WTWA 3NIZA 4OTGA 1XH4A 4QMZA 5DLSA 4EYMA 2RFNA 3EIDA 4RQKA 3NW5A 5ACKA 2XK4A 3C4XA 5JGBA 2B9FA 3ZSIA 4MCVA 4FTIA 5E8VA 3T9TA 3GT8A 5A14A 2VO6A 3E88A 2HYYA 4NM5A 5E91A 4AOTA 2PUPA 2ZB1A 4DHIB 3KXHA 2HW7A 3BLAA 3R00A 2C0OA 3D7TA 5E8UA 5FUTA 4U40A 4L52A 1M2PA 4YURA 3A7FA 4FOBA 1W83A 2IZTA 4ZSAA 4QMQA 2QOIA 3DBQA 1VYZA 5LCKA 3Q9ZA 3RALA 4BWPA 2W4OA 1W2DA 4CMUA 3A4OX 3TV7A 4GCJA 1W0XC 4NCTC 3R04A 1Q97A 3GCQA 3E7OA 3I81A 4LGHA 4WRSA 3VUDA 5EHOA 2EUFB 2ETRA 5H3QA 4E20A 1H25A 4FUYA 4IH8A 3BWFA 3NYOA 2VTRA 1RQQA 4F1OA 4O91A 1PKGA 1SVEA 1XBCA 3NRMA 4GUBA 4TPTA 4F9AA 5DR9A 2ZFYA 1LUFA 4NJDA 4JS8A 5CSPA 4M69A 4IDTA 5CF5A 3L1SA 3MY5A 3VS0A 4TYHA 5EM7A 2GS6A 4J99A 4M12A 3G33A 4I41A 4M7IA 2IJMA 4C4JA 4Z55A 1G8SA 3KN5A 4BDGA 1U54B 1F5QA 4J8MA 3FKLA 4BCMA 1M17A 4G6NA 5CANA 5EQPA 4U5JA 4GS6A 2E9OA 4KS8A 2JEDA 3T9IA 2J50A 1YW2A 3FV8A 4ERWA 3UOLA 3AMYA 3NYVA 2XKEA 2X0OA 3AC5A 2YZAA 3AC3A 5CT0A 4AZFA 5JRSA 4S30A 3BL7A 5M57A 3CE3A 4USDA 2C6MA 3MYGA 3LXLA 4KINA 2BZKB 3QC9A 4QTDA 3SKCA 3FI3A 3VS1A 3OXIA 3HYHA 4D0WA 2YLEA 4FNWA 2UZNA 5HLNA 2ZAZA 2OJJA 2VTTA 5D12A 4EH7A 3VBXA 4D2TA 2X6EA 4RJ8A 5HORA 4CKJA 4FEWA 5T6KA 1U5RA 3LFQA 4N0SA 3N4TA 5EQEA 2B52A 1OL7A 2CLXA 4U9AA 3MH1A 2BVAA 2OZOA 2Z7LA 4L6QA 3V3VA 3AD5A 4UWCA 3FLYA 1JSTA 3SOCA 2J0JA 5IH4A 4GKHA 4LGDA 4EHZA 5JT2A 2WEVA 1Y8YA 3RPRA 3O23A 2GQSA 4D0XA 2CGVA 1ZZ2A 1ND4A 3O5AA 4JI9A 2EB3A 4C35A 4FV0A 2GNIA 3EN9A 1B6CB 3D7ZA 2E9NA 3II5A 3G51A 3ORZA 3DTCA 2C5YA 2GQRA 2R7IA 4ZJJA 3QQUA 4FTUA 4QNAA 4NJ3A 3R8VA 4CFFA 5KCVA 5LCJA 1UNGA 2CMWA 4ID7A 1YQJA 4E7WA 2WNTA 3PSCA 2OXXA 2QHMA 3NZ0A 5AUVA 3V8SA 2X8EA 3OWJA 4QP9A 2YEXA 2CKPA 2NRYA 4DBXA 4GV1A 3HAMA 2BDJA 3CP9A 2XKFA 3QTWA 5EW9A 3GU4A 3ENHA 4CFXA 3SG9A 2UW4A 1U59A 3W8QA 4IMYA 4S2ZA 3HV3A 3AC4A 3ZBXA 1JVPP 2HAKA 3NNVA 3R7UA 4XLVA 5EYMA 1U54A 2VX3A 3PY1A 3FLNC 3I60A 2WXVA 5KE0A 3UODA 3BV3A 1Q3DA 4K33A 2R3FA 5EM6A 4CFUA 5ANOA 1WCCA 1R39A 2B53A 2BCJA 4G3FA 4KNBA 4YZ9A 3UMXA 4IWQA 4L45A 4BKJA 1OITA 1M2QA 2JKMA 5I9WA 4LGGA 4CD0A 2E2BA 4O0UA 1BI8A 4HVHA 4YJQA 4BICA 2ITWA 3BLRA 4OTPA 1Z57A 2WHBA 4I93A 4UYAA 4LRJA 3C5IA 3NNWA 5HTIA 5IEVA 4IAZA 1Q99A 1ZAOA 4DH3A 2CNQA 1HOWA 3QX2A 3GGFA 4IWDA 4M8TA 4NH1A 4BI0A 4EJNA 3RM7A 4D2PA 3OT8A 4RG0A 3ZRLA 4KBAA 2QU5A 4Z9LA 3PVBA 1HCLA 3PE1A 3PPKA 4G3EA 1XQZA 5M55A 2DWBA 4DG2E 3M1SA 4UEUA 2WU6A 1OM1A 5FLFA 3NFFB 3PXKA 2BRGA 3PJ2A 3RHXA 5CEOA 3DLZA 3U54A 5FM2A 3PLAE 3I4BA 3LCDA 2O2UA 5AR5A 2JLDA 3FZOA 3WI6A 5HNIX 1FGKA 2CKQA 2W17A 5L8JA 4HVGA 1TQMA 2WMUA 4DFXE 3I0QA 4I4FA 3PUFC 4MXOA 4E8AA 5HZNA 1AD5A 4IX5A 2XEZA 4AGCA 4AP7A 4FSTA 3IDBA 5BYYA 4IAYA 2BZJA 2W06A 4FG9A 3EJ1A 3EFWA 3LLTA 4L3LA 3TZMA 4OTFA 3O7LD 4AAAA 4DHJA 4EQMA 5CEMA 3ATSA 5IDPA 4FV6A 2V62A 3D94A 4EZ3A 1K3AA 1UU7A 4XBUA 3SA0A 2BAQA 2GSFA 3QA0A 4FL2A 1CKPA 4I20A 3LKMA 1JWHA 2YIRA 3G6HA 3LFBA 4E6CA 3PJ8A 5B7VA 3C51A 4NM3A 3RWPA 2BDFA 3ZYAA 4F1MA 3DK3A 4DH5A 3UQCA 4FTNA 3I6WA 4R77A 3ROYA 4PP9A 2R9SA 3ORIA 5DWRA 3DJ7A 3BWJA 4BKYA 3A61A 4R78A 3W0OA 3RBWA 4YUQA 4QYFA 5HE2A 4WHZA 2I0HA 4DAWA 4AXAA 4PNKA 4NFNA 2X2MA 5AAGA 4YJPA 1REKA 3KMWA 3QXOA 4K2RA 4O1PA 1FMKA 4FV2A 3ZLXA 3HUCA 4IVCA 4L7FA 4EH3A 5KBQA 2FO0A 3C13A 4WG3A 2QVSE 5CU4A 5CAOA 4H3PA 3CQEA 3QGYA 4JDKA 5GNKA 3K3IA 4CTBA 4UMUA 1PXPA 4X2GA 2ITXA 3SAYA 3KA0A 4BDJA 4G5PA 2CN5A 2C0TA 5LXMA 4ZSEA 5M51A 2X7FA 5AA8A 3PVUA 4BDKA 1XJDA 5HBEA 4BKZA 5I9XA 5IQHA 5CSVA 3FZPA 3I1AA 3HLLA 4QMNA 3UPXA 2VN9A 4ASXA 5IQBA 5A6NA 2FSOX 2W4KA 4U6RA 2R3RA 2GTMA 2QU6A 3OT3A 3PE2A 4O38A 1IAHA 4AA5A 4FA2A 2ERZE 5ANKA 1OGUA 4AW2A 2F57A 4ZY6A 4JDIA 4RC3A 4YNOA 5DMZA 4ANLA 4I6QA 5CQUA 3TUDA 3TT0A 4D55A 1H0WA 3QF9A 4FSQA 5DT0A 3BYOA 4ZAUA 3PA5A 3C4FA 4EH6A 1FOTA 2WO6A 3CTJA 4IIRA 1F3MC 2BTRA 4I5PA 2G2FA 3L8SA 4KBKA 4FE2A 3FL4A 5E90A 2WTIA 2VTQA 3F7ZA 2A4LA 4FZAB 5M4IA 5DR2A 4JBOA 1P14A 2ZV9A 3TNHA 4RZVA 3RPOA 1FVRA 3P86A 4YJNA 3CJFA 4ZZOA 2EVAA 4ZTRA 2FSMX 3KB7A 3ZEWA 1XMMA 3DK7A 4FTQA 4UMTA 4EORA 2W1HA 4FSRA 4FT3A 4J98A 3T8OA 3RK7A 4YJRA 3ZS5A 2WEIA 1OZ1A 5BVEA 4PX6A 2YISA 3IO7A 5JMSA 4HYSA 3VHEA 2IZRA 1YOJA 2WQOA 2X81A 5IA4A 3ZONA 2UZTA 2W99B 3VW6A 1ZMWA 1OVEA 4RLLA 3PFQA 5AV3A 3ZOSA 2XNEA 2JDOA 1KE6A 2H8HA 1H28A 2HIWA 3OWKA 4FSYA 4JBPA 3V51A 2RFSA 3Q5IA 4W8EA 2HXQA 1ZYJA 2OBJA 3BQCA 3O96A 4M0YA 3CKXA 4KSQA 5EM8A 3VUHA 4YC3A 4U79A 4L3PA 3ORPA 5HNBA 3QRTA 2GHGA 2RL5A 4XG8A 4RRVA 4JLCA 3MB7A 4PTCA 3ZRMA 5F4NA 5CLPA 4IZYA 4DT9A 4ERKA 4NZWB 5ETAA 3LFSA 5IA2A 1T45A 2PU8A 3KFAA 1YDTE 1WVYA 4BL1A 4D2SA 2O5KA 3PXZA 4Z16A 3AKJA 4FYNA 5A4LA 3ZXTA 3R1NA 4AA0A 2BIYA 2WMAA 5E1EA 3KF4A 3W2RA 4QQJA 3O51A 3OC1A 4NT4A 2OJ9A 4BZDA 2BHHA 4HYHA 4V0GB 5JFVA 3BRBA 2CSNA 5F94A 3TYKA 1V0BA 2ZM3A 2C30A 3HMMA 1G3NA 2GS7A 4K11A 3V8WA 3BBWA 1YXUA 3LM0A 4NM0A 1RJBA 2YABA 4EBWA 1P2AA 5CXZA 5EW3A 4TW9A 4JIKA 2HWPA 1PXKA 2YHVA 5EK7A 4XP3A 1FGIA 2QR8A 4XG4A 3AG9A 3VQHA 3D14A 1YWNA 1H1SA 4OT6A 4A9YA 1CMKE 5L2SA 5DVRA 3DXPA 3ODYX 4L53A 4YBKA 3F2RA 1OMWA 3HDNA 4QMVA 1MQBA 4M67A 4CYIA 5KBRA 1K2PA 4QPAA 3DDQA 4UALA 3P23A 4FZ6A 4R6VA 2VWZA 5KMJA 4XCUA 3H0YA 2WQNA 3AT4A 3QCQA 4L8MA 3GCPA 3E63A 4BTKA 5DT4A 3P1AA 3PY0A 3Q9XA 2VTOA 4B99A 4C0TA 4MBIA 3FXZA 3TL8A 3DPKA 5DPVA 4BFMA 2B9IA 4UWYA 3NYNA 4W8DA 1XMLA 4IACA 4J97A 3O8PA 3DY7A 3P7AA 3OBGA 3GQLA 3V5PA 4A7CA 2YIYA 1YDSE 5CF6A 5FTGA 4FT7A 2WU7A 4FEXA 4F08A 5I9ZA 3ALOA 3WZKA 2XVDA 5FDXA 1M14A 4E73A 3QYZA 3SXSA 4O0RA 4FSUA 4JDHA 4H1JA 2X0QA 3BEGA 4TXCA 3WZUA 4CFNA 5LVOA 1J91A 2AUHA 4FV7A 5H9BA 2EXCX 4UV0A 3H9FA 3PIYA 4ZY5A 4XUFA 5CVFA 4WNMA 4U3YA 1H08A 4IDVA 3EN7A 3ACJA 4FK6A 4ZSJA 4DYMA 5CSWA 4HVIA 3RAKA 3T3UA 5CF4A 2BIKB 1QPJA 4R5YA 4RC4A 1YHWA 3SDJA 1FBNA 1KOAA 4DH7A 4W4WA 2JKKA 5TKDA 2W7XA 2GNJA 1CKJA 3HGKA 3IW6A 5AUWA 4FTJA 5BMMA 4AE9A 5CZIA 3VBVA 4H58A 4MH7A 4WO5A 3VUMA 4PDPA 4ANNA 4PY1A 4F0IA 2R0IA 2GDOA 3E8NA 1VYWA 4V0GA 3DKFA 4G3DA 2XB7A 4L44A 1GIJA 4Q2AA 2GNFA 3ZDUA 4FI1A 3POOA 3EQBA 1BL7A 4YJOA 1P4OA 3LQ3A 2QR7A 1AGWA 3FLSA 3BHHA 4BDIA 3ZZWA 3I5NA 3Q6UA 3QYWA 3O71A 4MNEB 4PMPA 3P79A 5E8WA 4D5HA 4ORKA 2B1PA 2E9PA 3TKHA 4PPCA 2C47A 4YC6A 3IK3A 5KMMA 5H2UA 3R71A 5HCXA 3HZTA 4AT5A 3C9WA 1KWPA 3EB0A 4MF0A 4O7WA 4TZRA 3PPJA 4GYIA 1I09A 4ZMFA 3RPYA 2FYSA 5HD4A 4RT7A 4DT8A 3K3JA 2OF2A 2J2IB 4FKTA 4FIIA 2VX0A 5AAEA 4QP2A 3D0EA 4I22A 4W4XA 2HZNA 3GVUA 3ZFYA 3QD4A 5HU3A 2WQMA 4CZTA 2IPXA 4PDYA 3R6XA 5IPJA 2Q83A 4RJ5A 4XNEA 5ANJA 2OIDA 5CEQA 4FYOA 4DH8A 4NW6A 2JDVA 2C3JA 1E1VA 5J7HA 1WBTA 2HELA 3O17A 4DLJA 5KKRC 5BYZA 1NT2A 1JKTA 2QOFA 3QTXA 5HBHA 4P5ZA 2QOKA 3RKBA 2OK1A 5KKRB 3LPBA 4M0ZA 5CAQA 2UW7A 4IM0A 4BB4A 2ITQA 1ZY5A 3UMWA 3L9LA 4MQ2A 3VUIA 1OUYA 5IQAA 4Y72A 2ZV8A 1GIIA 2PMIA 3NUNA 4U7ZA 4RX9A 3ZFXA 3HP5A 4CFMA 4EL9A 5I3RA 5J9YA 3VJNA 4C57A 1Y6AA 3TTJA 4QYHA 4B4LA 4EHVA 4JQEA 4GW8A 4I6HA 3UO4A 4DEAA 2OU7A 3OTUA 4USEA 3UDZA 4O84A 1JQHA 3PG3A 4R1VA 2BALA 2I0EA 1BL6A 4EZ5A 4AGDA 2PVLA 5TT7A 2C3KA 2XA4A 3KRLA 5IUIA 3N4VA 5EM5A 3PXQA 1WBNA 5E92A 4MUQA 3F5PA 2XNPA 3D9VA 4KWPA 4W9WA 3SHEA 3BYUA 1H0VA 3A7JA 1GIHA 5CASA 3KY2A 3LW0A 2O0UA 1PXJA 3JYAA 1Q61A 4R3PA 4R3RA 5TOZA 3S95A 4O86A 4YC8A 2YDIA 4J96A 4OGRA 3VHKA 1W7HA 4MNEA 2QLUA 3UDSA 1Z9XA 3QTRA 3UOJA 3QZIA 4JR7A 4AFEA 3Q5ZA 4O27B 4C58A 2AC3A 1JAMA 4YO4A 5A4TA 3BLQA 2BFYA 1ZYCA 1IA8A 4Q9SA 5HBJA 3SC1A 1MRYA 4FEQA 1KE9A 1DI8A 4L01A 3BL9A 4K77A 1W8CA 2OZAA 4I6BA 3PVWA 1H27A 5C1QB 4LV5A 4O7SA 5HE3A 3JY9A 2YITA 4L3JA 2J4ZA 2BZHB 4PPAA 4XJ0A 5E8YA 4X2JA 4DCEA 2ITOA 3OBJA 3PP0A 4FODA 4ACDA 1OBGA 5LOHA 4EOIA 4RPVA 3MH0A 3OUKA 5GJFA 5AX9A 2CDZA 3F66A 2AYPA 4QMSA 1Y57A 3QXPA 5EHLA 4XRJA 3R7VA 2QQ7A 4TL0A 3CBLA 5M4UA 3ZZEA 5F95A 5IA5A 4XG6A 4TYIA 3W1FA 3GBZA 5B2KA 4CCUA 5KMIA 2PWLA 4M84A 5KHXA 5HICA 5AR7A 4JT3A 4M66A 4LRMA 5EHYA 3U51A 3UDBA 5CF8A 4IBMA 4OT5A 2J7TA 2RSVA 4X2FA 2FSLX 5H8BA 3DGKA 1BYGA 2OH4A 1DI9A 3RGFA 3TZ7A 4FVPA 3FMLA 3UE4A 3UYSA 2O65A 4ZTSA 1GZNA 4R7IA 5HO8A 5AV0A 2C6KA 4O6EA 3ZM9A 4EUUA 2BROA 4UN0C 1Z5MA 1QPEA 2PVHA 1WBVA 3THBA 3MFTA 4GT5A 4A07A 4FGBA 4YZNA 4D4YA 4Y8DA 2HK5A 3GP0A 4AE6A 5B2MA 4F7LA 3MESA 4CMOA 3W0MA 4GRBA 4ANQA 4PUZA 3EN5A 1FINA 1X8BA 3DV3A 5JQ8A 3A4PA 3EQDA 3FDNA 3L8XA 5LQFA 1XBBA 4ZTHA 2C4GA 2UZLA 3CGOA 5HKMA 3QX4A 4DITA 3OZ6A 2QKWB 3MB6A 4TYHB 5DEWA 2HW6A 4CGAA 5E1SA 3EYGA 3FE3A 3FI4A 2WKMA 2ITPA 1ERKA 4F7NA 2OFUA 3EOCA 3V5TA 3ODZX 3KEXA 4CCBA 2IEWA 3QWKA 2WGJA 3AD6A 3OEFX 4FTRA 3FMNA 3WF8A 3W0RA 3VRYA 3QCSA 3BYMA 4F6SA 4E6AA 3LXPA 4RQVA 1H1RA 5EDPA 4FNXA 1XH7A 1J3HA 4Y5QA 4K6ZA 3DK6A 3D2IA 4LMNA 3E3BX 3QKKA 4NFMA 4D4VA 3RPVA 3ZC5A 3Q4TA 5K0KA 3G90X 3ETAA 4TT7A 4BGHA 4NTSA 3NCZA 3FHIA 4H3BA 4DDGA 4EH4A 1WBWA 3ANQA 3IW7A 4IX4A 3TN8A 4OUCA 3U87A 3UVRA 2XBJA 2WPAA 5HOAA 5K5NA 4G9CA 4DC2A 4LOQA 3TCPA 3D83A 2FGIA 4F0FA 2WQEA 3QFVA 3KGAA 4Q5HA 2EXMA 3AMAA 1GAGA 4GUEA 5HGIA 4IANA 5GZ9A 4E4LA 4ZJIA 5FBNC 2YJSA 4FV9A 2ESMA 5HI2A 4XP2A 2PZ5A 4HZRA 3W0PA 4EOKA 3LXNA 1J1BA 2RGPA 4CNHA 3H30A 3HV4A 4G1WA 2WOTA 2XYNA 4PNIA 5AEPA 4FVQA 4IWPA 3Q53A 5EI2A 4O1OA 1MUOA 4M14A 3MJ2A 3VC4A 4ZJVA 4HYIA 5HG9A 2CNVA 5IQFA 3UG1A 5ITAA 2R0UA 1A48A 4N6ZA 3WBLA 3A7HA 2CCHA 4F65A 2VWYA 3BU3A 1JKLA 3ORNA 2FSTX 4YMJA 4FEUA 4MX9A 3PYYA 4E4MA 4FG7A 4CSVA 2FUMA 2R3LA 3CQWA 2YM7A 1ZLTA 2YCQA 5KZIA 4CLJA 4GEOA 2DUVA 3NUUA 1T46A 3F3TA 3HRBA 3TKIA 3VAPA 4E5BA 2CGWA 3QQLA 4I21A 5AM6A 5JEBA 4IJPA 4MWHA 5M09A 3EMGA 2VV9A 4BCKA 3FC1X 2BRNA 1KOBA 3FI8A 4GKIA 4FV3A 4RWIA 5HLWA 3ZLYA 4AXFA 3QTSA 3WZEA 4AZSA 4CT2A 4YNEA 3F3ZA 2C1AA 5CYIA 4RJ4A 4AA4A 5JKGA 2ZM1A 4L46A 5IF1A 4RIXB 1MRVA 4N6YA 2RIOA 1VJYA 3IKAA 1RW8A 3ZCLA 4D4RA 3U9NA 2ZV2A 4BDCA 4BY9E 5GHVA 4CRSA 4C8BA 5I4NA 1IR3A 4YZBA 2RF9A 5A6OA 4GG7A 4IE9A 3E8CA 4AXEA 3H10A 2H6DA 3OOGA 2QD9A 5IG1A 5KMNA 4FTMA 4FKOA 1ZMVA 3LFEA 5HCZA 3RZFA 4AUAA 4NM7A 4BZNA 2XK7A 3GCSA 4AG8A 4DH1A 2PE2A 2ONLC 3KCKA 1LEZA 2WMQA 3UP7A 3F5UA 5CQWA 5HNGA 4G9RA 1BLXA 1FMOE 3AT2A 4WBOA 3DXQA 3IS5A 3G0FA 3DBEA 4JJRA 4IZ7A 4MD8E 2C6IA 4AQKA 3PFYA 4YZDA 4KBCA 2X2LA 3WF7A 2QOBA 3JS2A 4QTBA 3TDVA 4FTLA 3IW5A 3EQFA 2YAKA 2VTLA 4MXAA 2GCDA 3IQ7A 4L68A 1GNGA 4FZDB 3L9MA 4QP8A 4U44A 4ACGA 4BYIA 5K9IA 5CALA 5IUGA 4BDFA 3DNDA 2CCIA 2XJ1A 3HL7A 5HX8A 3DKOA 4FMQA 5KNJA 1LEWA 3BQRA 4QPMA 5FDPA 4HCTA 3JXWA 4BCFA 2CLQA 2I1MA 2V22A 3W10A 2RG6A 3SV0A 5AADA 4C4FA 2C6LA 1W98A 3AGMA 4RZWA 5GINE 3QWJA 1URCA 5C01A 3TNWA 4TNBA 4CZYB 4NTTA 2OJFE 4U80A 5D7VA 5BNJA 3FMHA 3GC0A 4KRDA 3OW3A 4PTGA 2PVNA 4QPSA 3NW6A 4Y73A 4YHJA 4IC8A 3OY3A 4Y83A 5B2LA 3MJ1A 2VWXA 4FT5A 4USFA 3ERKA 4ALVA 4D9TA 4BCIA 2OJGA 3D5XA 3R9NA 3BU5A 3C0IA 3FI2A 3NFGB 2ZDTA 4RIXA 3TUCA 2CNUA 4X6RA 3TV4A 5A4EA 4PMMA 4MNFA 1NY3A 5DNRA 2OFVA 3UIMA 2P55A 2WOUA 4O2PA 5J1VA 2VO0A 4XOZA 4B6LA 4FIHA 4ZLOA 4WNOA 4MVFA 3DFAA 3HEGA 4FKIA 4GFMA 2QO7A 4QMMA 3T3VA 2QNJA 4I5CA 3ZBFA 3ZSGA 4HVDA 5A54A 4QDVA 4F78A 3MIYA 4EH8A 4F4PA 2X7OA 2C69A 2CJMA 5CVHA 2BDWA 1Q41A 2F7XE 2YM6A 2EWAA 3KK9A 3PXFA 2UZEA 4TYEA 4YLJA 3ZO3A 3N9XA 5J9LA 3AXWA 3CR0A 3PJCA 3S2PA 3TJCA 4ACHA 4EOJA 3FLQA 4ANOA 4UWBA 2C5NA 2VTHA 4EEVA 2IZSA 3UQGA 2JIUA 5BVDA 1H01A 4TY1A 4XH6A 5KHWA 2ONLA 4E5AX 3COKA 3ITZA 4G17A 4BWKA 4WNPA 4ZK5A 4C4IA 3EKNA 3QC4A 2P3GX 3I7BA 4F7JA 2I0VA 4GK4A 2VUWA 1PY5A 5HO6A 3PG1A 4JMQA 1K9AA 4OBOA 3WOWA 2W1EA 3UYTA 4ACMA 4RIOA 4DN5A 2WD1A 2H9VA 3C0GA 3OCSA 3MDYA 3OS3A 1F0QA 4KS7A 5GZAA 5IISA 1PRYA 2DQ7X 3OP5A 4X6QC 4IVBA 1SMHA 3GB2A 3OCTA 2XIKA 3ZH8A 4BGGA 2KTYA 3NW7A 4RA5A 5DR6A 2YM5A 3E92A 3C4EA 3ZM4A 1NVQA 1XBAA 4RIYA 2BRMA 2IVUA 2IN6A 3KQ7A 4IFCA 4AGUA 3EWHA 4NU1A 3MS9A 4OW8A 1TZDA 4I23A 4MK0A 4TWOA 4Z3VA 5BPYA 5HO7A 1H26A 4FKJA 3DBDA 3QKLA 4JL9A 4WRGA 3RNYA 3QLFA 4OTIA 2PVRA 4UXLA 3I6UA 4GMYA 4CFVA 1ZYDA 5LVPA 5AP2A 5BUIA 3H9RA 3S3IA 2I7QA 4FTAA 4FZFB 3TNIA 4WUAA 4PRJA 3NYXA 4L00A 4EJ7A 4XX9A 5AR8A 4ZOGA 2Y7JA 4BF2A 4HVSA 4A9TA 4OTRA 4U41A 4EOLA 1JSVA 2VGPA 2BKZA 2WMSA 2UW8A 4LV7A 5AJQA 5G1XA 1DM2A 3PRFA 1M52A 1Q4LA 2OIQA 1ZYSA 3F3VA 4IQ6A 4LMUA 4X3FC 3KC3A 5CT7A 4TWPA 4QYGA 5C03A 1M2RA 3RAIA 4DINA 5HVKA 5ETCA 2VNYA 5I9YA 5AA9A 1NVRA 3FXWA 5DE2A 4X3FB 3FQHA 3VBTA 1ZY4A 4M97A 5E4HA 4CG9A 4FR4A 4FV4A 4J71A 4LQMA 1S9IA 1OIQA 3LAUA 2WTCA 3UC4A 2X0GA 5BQ0A 3EQPA 3QTUA 4IB1A 5LWMA 3AKLA 5CEIA 2J0IA 4QMXA 3DCVA 4CKRA 2X6DA 3P78A 5CU6A 3U6JA 5CY3A 4U97A 2A1AB 4P7EA 3PDTA 2OXYA 1PW2A 1GZKA 5I9UA 1XKKA 2H34A 1TQPA 4XHKB 4AN3A 4S33A 1W2CA 4L43A 3GCVA 3F2AA 3R9DA 2PE1A 4RVMA 4BC6A 4DTKA 1H24A 4HCVA 2A98A 3H4JA 3TG1A 3E7VA 4YO6A 4AFJA 1ST4A 4C3FA 2P2HA 2B4SB 2CGUA 4BR3A 4KB8A 2O8YA 4FL3A 3C4CA 3R73A 5I0BA 4PMSA 3NUYA 4GK2A 2GMXA 1CTPE 4KIQA 4LG4A 5EDQA 5ETFA 3MY1A 2QO2A 3PSBA 3TIYA 4BI1A 4FOCA 3DTWA