2OO8X

Synthesis, structural analysis, and sar studies of triazine derivatives as potent, selective tie-2 inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
259
Chain Sequence
GQVLKARIRMDAAIKRMKEKDDHRDFAGELEVLCKLGHHPNIINLLGACEHYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Synthesis, structural analysis, and SAR studies of triazine derivatives as potent, selective Tie-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 259
sequence length 282
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oo8X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oo8X01
5CSXA 2IWIA 3RHXA 4DBXA 3NRMA 3HUBA 3LFEA 2UW5A 2ITPA 4CMTA 4ZY5A 3PE2A 3CSVA 4J53A 4RX9A 2C6KA 3KXZA 4UWYA 3CLYA 3CKWA 5FRIA 4LRJA 1SNUA 4IWPA 4KINA 3TXOA 3DGKA 1URCA 4EWQA 2QVSE 3MA6A 2C6IA 3FPQA 2YACA 3LXNA 3R7GA 2J5EA 2VTIA 2YM4A 4P90A 3GEQA 4Y5QA 5EW3A 4CNHA 3SXFA 3VS7A 3DDPA 4RJ7A 2XIKA 4F6SA 4FSUA 5B2MA 3O7LB 4C02A 4QQ5A 2PMLX 4JG7A 3ALOA 3S1HA 5DE2A 4BDHA 4C2WA 4CQEA 2NNWB 2XEZA 5DFPA 4BC6A 3ALNA 5FTOA 4FV2A 4UBAA 3OCBA 5E8SA 3UC4A 4TZRA 4ZTNA 4L43A 4ANNA 5KMOA 5LQFA 2YJRA 4RIYB 4FOBA 5FTGA 4J99A 3SRVB 3DBCA 3IK3A 1ZZLA 4I94A 3WOWA 3V8TA 5IUHA 4N70A 4APCA 5F95A 5M06A 4YJRA 4IJ9A 4KUJA 4MK0A 4ANQA 1U59A 1S9JA 4WNKA 3NGAA 4Q5EA 4DEEA 4E4MA 1TKIA 3PUPA 1ZLTA 3T8OA 4NT4A 5E8ZA 5IQGA 5EQYA 3V6RA 4FSRA 4GMYA 5L2TA 5LXMA 2WIHA 1U54A 5ANJA 4GVAA 4E6AA 5KE0A 3OF0A 4LUDA 4TWPA 2C30A 2AUHA 4RA4A 1W83A 4UYNA 4G6LA 5IKWA 3F5UA 2BZHB 4JDHA 1BL7A 4V01A 4FZ7A 3ORNA 4FIGA 1Y57A 2RF9A 3PIXA 4QD6A 3RM6A 5JGAA 4I6BA 1ZOHA 2J4ZA 2B9HA 3EN4A 1YOJA 3TACA 4M15A 3PLSA 5LMKA 2WNTA 3ZUTA 1H1RA 4DFNA 3EQBA 5L3AA 3QL8A 4KBCA 4NM5A 2R2PA 1B6CB 2ZVAA 2ERKA 3VJNA 4EUUA 3SKCA 3V51A 3FZPA 4P5ZA 4ZTLA 5AUWA 3MN3A 1R3CA 3TZ8A 2G2FA 2HXLA 3P5KA 4NH1A 5A6OA 5A9UA 4C4GA 1GNGA 4YHFA 4LUEA 2YITA 5DG5A 4IQ6A 4C3PA 4CFUA 3Q5ZA 3MVMA 5HOAA 2XIRA 5TF9A 2QOOA 4AZVA 2UW9A 3NUNA 3OUKA 1Q5KA 2JKQA 4FC0A 4S2ZA 4KKHA 5E1SA 4C58A 3N4TA 1ZY5A 4E3CA 1W82A 4UMRA 2Z2WA 3RAHA 3A7IA 3EOCA 2IVUA 3M1SA 4MXXA 4F6WA 3MV5A 5JFVA 3D83A 3FUPA 4QQJA 3DBDA 5HO7A 3MIAA 4L52A 4UZHA 5D1JA 3ZXZA 3Q4UA 2R3QA 4CSVA 3B2TA 2C3JA 2BHHA 4KIPA 3RZFA 3V5PA 4CZTA 2UZTA 5K0XA 3B2WA 5FBOA 4C2VA 2VO7A 3MESA 2WXVA 5H8GA 4FSZA 4V05A 4FV1A 2BIKB 3VS6A 3UQCA 2VWBA 4C0TA 4B0GA 3LCKA 4GT3A 1V0BA 1YDRE 3KF4A 2WU6A 4U97A 5C8MA 3VUMA 1HOWA 4DA5A 5KKRB 3RWPA 4DEIA 4IX6A 4M67A 1DI9A 4HCTA 4R7BA 5BVNA 2W1DA 4KA3A 5J87A 1FBNA 2UW0A 3N4UA 5IH4A 3CGFA 3R9DA 3SC1A 3TKUA 2FA2A 4J8NA 4X6RA 2OH4A 3BE9A 2WMWA 4FT5A 1VZOA 4D2SA 1GAGA 4FKWA 5IPJA 1JLUE 4ZLZA 4RX5A 4LL0A 3VS0A 4JR3A 3LCSA 1E1VA 2Z60A 3R2YA 4O0YA 4FEXA 4MCVA 5JSMA 5FP6A 3UQGA 4E5WA 4OBQA 3UQFA 2XCHA 3FMEA 5FDXA 4O81A 1UA2A 3DTWA 4IBMA 4RA5A 5GNKA 5I3RA 1H24A 2VTSA 4FV9A 1ZY4A 2P55A 3C1XA 4JBVA 3SXSA 4ANOA 1SMHA 4FVPA 4FV8A 2J50A 4O7VA 1LP4A 3VBTA 5H2UA 3R7VA 1PF8A 2UZLA 3P86A 3Q6WA 2GS6A 5LMAA 4PP9A 2OH0E 3GU4A 4C4HA 2FO0A 2EXEA 2LGCA 4USEA 3DNEA 3ENMA 3ERKA 3TN8A 4EKLA 2IPXA 4LL5A 3KA0A 4AP7A 4XJ0A 1GIJA 3IKAA 3UZPA 3FMMA 3ZS5A 4C37A 3LZBA 3FDNA 1WBVA 2B54A 4LM5A 4DEDA 4FZ6A 5HKMA 3NMUF 2GDOA 2WHBA 2J9MA 4JDJA 4E5BA 4RZWA 4M68A 4XLIA 3R9OA 4CV8A 2ZJWA 3NAYA 3BGPA 4QP9A 4WO5A 3R1SA 4EK5A 4FKSA 1OPKA 2C47A 2H9VA 4FG9A 1ZYSA 3FBVA 4O27B 3GCUA 4IZYA 2RG6A 4FV5A 4WSQA 1PMEA 4NM0A 2RSVA 3DFCB 2XK4A 4E8AA 4YJUA 4FTIA 2WQBA 4D0XA 5C4LA 5ETCA 5HE3A 1XO2B 3OD6X 3RCJA 2R3MA 4CFWA 4YMJA 4ASZA 3QUPA 4UB7A 4LMUA 4Y46A 5IEYA 2J0JA 2PMIA 2Y4IC 2DWBA 2Y7JA 5AP7A 5AA8A 4ZEGA 4TYJA 1JKLA 3CBLA 3F7WA 5GJFA 2BFYA 3W8QA 4H1MA 5FLFA 3NX8A 1PY5A 3AMBA 2OW3A 3DK7A 5A4CA 4O7NA 1NA7A 5A3XA 4DFYA 3CJGA 2XJ2A 3A4OX 2WELA 3PZEA 4K11A 1IRKA 3P78A 4TYEA 4DG0E 2R7BA 4U6RA 4QMTA 2OJJA 3HVCA 5F94A 2QKRA 1P2AA 3HA8A 1FMKA 3FLSA 4BBEA 1GZNA 2RIOA 4MD9E 4ZZNA 3QRUA 3GVUA 4D2RA 3KEXA 3O8PA 4WT6A 4JI9A 3ZUVA 2OXYA 5EI8A 3PJ2A 3FKLA 1WBWA 2F49A 2BAKA 4DGOA 5ITAA 2B1PA 5M4CA 1DM2A 1SVGA 1H27A 4B4LA 4QMVA 4PTCA 4IANA 2YN8A 4NJ3A 5AP1A 3RK5A 1W7HA 3TJDA 4A9RA 2B55A 5EHLA 4PUZA 2YAAA 2JITA 3IW7A 4MD8E 5HX8A 4IAZA 2QU5A 4ZS0A 4AOIA 2JIVA 3G5DA 2QLQA 3I79A 4GYIA 4QNYA 4IC7A 5IEXA 3UPZA 5CSPA 5EM5A 3HECA 5CTPA 2XRUA 4BR3A 1MRUA 3M2WA 4FTMA 5AR7A 4BKJA 4PDOA 1PXNA 3LXPA 3EZRA 4CD0A 5JGBA 5CF5A 4JVGA 2GQGA 3LCTA 4G3CA 2PVNA 2XIXA 5FTQA 3VQUA 4CQGA 2HY81 4TKSA 4C3FA 3JPVA 2QOCA 4YJVA 5IU2A 2VTPA 3LMGA 4ZTHA 4H3BA 3GC9A 4HNFA 4FL2A 4EOJA 5M51A 5FGKA 5AM6A 2JDVA 4G34A 4YPSA 4BN1A 3BV2A 2R0UA 1A48A 4BVUA 2YJSA 3KCKA 3MTLA 4DLIA 4GCJA 4QMQA 1J1BA 2C6EA 1U5QA 3FKNA 4F7LA 5FWKK 2ZYBA 2PSQA 3BU6A 3E8DA 3Q9YA 2GFSA 4X2FA 4YGAA 1HCKA 2W7XA 5K3YA 3ULZA 4EH3A 1Q41A 1KE6A 3CTHA 4M69A 3ORLA 4BDDA 1IAJA 5AAEA 5J95A 1FVTA 4C59A 4O86A 2F2UA 1Q8UA 3ACKA 2WB8A 5IMEA 4NKAA 2RGPA 5DR9A 4I0TA 4QQCA 3QZGA 5KZ0A 1CTPE 4OR5A 3AXWA 3ORKA 3SW7A 2PVLA 4K18A 2OWBA 4XG3A 5FD2A 4RJ6A 5H9BA 3V5JA 4CT1A 1RQQA 4XUFA 1KOBA 3TCPA 5I0BA 1EH4A 1U4DA 4JG8A 4YZ9A 4EJ7A 4FMQA 4IVDA 5HD7A 3D5VA 2VV9A 3FI2A 4KKGA 4CRSA 4PV0A 3VUGA 2W9ZB 3ZRKA 4UMTA 4BYJA 3PVWA 4G3FA 3UGCA 3AG9A 3UYSA 1FPUA 3PG1A 4I22A 3SQQA 4OLIA 3W55A 3A60A 2V0DA 3FWQA 2WMRA 3PY0A 4BFMA 4CFFA 2VGPA 5DOSA 4CMUA 2VX1A 5DR6A 1SZMA 4DH8A 1UVRA 2ITNA 3LIJA 4UMPA 2J5FA 4AAAA 3GOKA 4MXZA 3SOAA 4Y95A 3GOPA 1U5RA 4BZNA 4M0YA 2J2IB 4C33A 2R3NA 3UNKA 2XNGA 2ZAZA 3BLRA 4FZFB 4FTUA 3FXZA 3ZZWA 3U9NA 5J8IA 4D58A 4DGMA 3QTQA 3W2PA 4EH7A 5L4QA 3TNQB 2GNJA 4IVBA 1XBAA 5EDRA 4PDSA 2CPKE 3PA5A 1NW1A 3OT3A 3AC3A 5C01A 4PDPA 2GU8A 5KKRC 3LQ3A 4PL5A 2Y0AA 2OJGA 3K3JA 4G17A 4KNBA 2JAMA 1ZRZA 2ITZA 3KRLA 5BVEA 4KAOA 2QURA 3SRVA 3F3UA 5KMIA 4ERWA 3COHA 3D94A 4K2RA 4MKCA 3RK9A 3KF7A 3ZEPA 5AUVA 2VWWA 3CEKA 3E63A 4MWHA 4QMWA 5BYZA 2VWZA 1H07A 2BROA 1TQMA 2VO3A 2BZIB 3ZH8A 3R83A 1YOLA 2YIXA 3GT8A 5T68A 4I23A 3CGOA 3SV0A 2YISA 4FTAA 4NZWB 4DFBA 3QF9A 5AR4A 4DE4A 3A99A 1PXLA 4PL4A 3HP5A 4YP8A 4J52A 3QLFA 4V0GB 4BCGA 3MY1A 4MVFA 3O17A 3WE8A 2PULA 3F2RA 3SAYA 3EQIA 4B8MA 3FI4A 3NNVA 2VGOA 4M14A 3ZEWA 2OO8X 3OWKA 2EB2A 3OMVA 5CU3A 5M57A 3DOGA 2XKDA 5D11A 4ACGA 4TYHB 3ENHA 4CYJA 3LFAA 2IJMA 2YCFA 4UMQA 1FINA 2F7XE 1L8TA 1YHSA 3LAUA 4OBPA 3W18A 3R22A 3WIKA 1YDSE 2CNUA 2NRYA 3BWFA 2JFLA 2OXDA 3FMDA 4RPVA 4MNEA 4BIBA 4D4RA 4GT4A 4F99A 3FZTA 3R6XA 3MH3A 2XRWA 2QU6A 4O7ZA 3OEFX 4LV5A 3FAAA 5CVFA 4JAIA 4O0RA 2JGZA 2ITUA 1VYWA 2W96B 4WKQA 3ANRA 3FXXA 4A9TA 5AMNA 3A4PA 4BI1A 4O0TA 4BCKA 4HGEA 1YQJA 3Q4CA 2I0HA 4DHFA 3OG7A 4FIHA 4CRLA 5AP2A 5M08A 3D7TB 5AAGA 1WBTA 4WHZA 1Z57A 2WQNA 3EQCA 3Q6UA 5LWNA 1ND4A 4ZXTA 2ZV8A 3I0QA 3H3CA 3IW6A 1J7IA 4X6QC 5BYYA 5AIKA 5EYKA 4C38A 5AFVA 5IQBA 3ZYAA 2NPQA 3VIDA 1M52A 2XK9A 4KIKB 2QLUA 4DTBA 3HL7A 4FGRA 3F3TA 4YJSA 4FSWA 5JH6A 3JVSA 2YIRA 2Y4PA 3TJCA 2YM8A 1Z9XA 4KSQA 4QP7A 3RCDA 2UVXA 4FEVA 3FSFA 5CLPA 2I6LA 4QQTA 2BTSA 2BHEA 4U41A 3M11A 2WOTA 5CI6A 3NAXA 4FEQA 4AN3A 2PE2A 4YLKA 1OKZA 3IPHA 4QNAA 2FUMA 5J9LA 3QQGA 4IH8A 3IS5A 5E8WA 3OUNB 2HYYA 3HMPA 3PVUA 4C4JA 3P79A 1I44A 2QO7A 5HVKA 3IO7A 5I3OA 4JL9A 5CI7A 1GOLA 2X9EA 2J0MB 5FG8A 5LVLA 3TDVA 2H34A 3I6UA 2Z02A 2A0CX 4FSNA 4FX3A 2VTRA 3HEGA 4WUNA 5A14A 4BB4A 3UE4A 1UNHA 3GNIB 3LFSA 1YWRA 5FEDA 3AQVA 3T9TA 5JQ8A 5AUYA 2OF4A 2C3KA 2VTLA 3VBVA 3D0EA 2XNMA 3QZHA 5AM7A 4UMUA 1FVVA 3CS9A 5CXHA 3BHYA 5T6KA 4BYIA 3R63A 3NW7A 2GNLA 3C9WA 3E7OA 2QOHA 3OWPA 1IASA 4LOQA 4O91A 3EN6A 3AD6A 4HYUA 4J95A 4BCNA 3VBQA 3ZO3A 1XQZA 3T3UA 4BCHA 3C0GA 2PVYA 3E88A 4NFNA 2R3FA 4I0RA 1FMOE 3UZTA 3SW4A 4IZAA 4IM2A 4RGJA 3L1SA 4XHKB 3QFVA 4ALVA 2X7GA 4WSYA 3RPRA 3W2RA 4D2WA 4TNBA 4YR8A 4D55A 4ZTQA 4N57A 1O6YA 2FVDA 4FT0A 2C5NA 2W1EA 3OOGA 4I24A 4GK2A 2IVVA 4YTHA 1R1WA 4FR4A 2O5KA 5B0XA 1P4FA 2QHMA 4CZUA 2P4IA 3DS6A 4YUQA 3EYHA 4P5QA 4YJTA 4XG7A 2W1IA 4I4EA 3TZ9A 2BKZA 1ZMVA 4G6OA 4HPUE 3KL8A 1OECA 4S32A 3F5PA 4ZOGA 2J0IA 4ENXA 4FYOA 3EQPA 2P2HA 5CEMA 4LGDA 3EKKA 2OZAB 4YZDA 5CAVA 3QQFA 4CLJA 2QOBA 1J7LA 1YWVA 4PX6A 3S00A 3KFAA 1XH4A 2PVRA 2R3OA 1PRYA 3OTVA 4FGBA 4BDIA 4F0IA 5GHVA 3VW8A 4IADA 4LG4A 2YDIA 3BZ3A 3QZFA 4EZ3A 4O1PA 1F0QA 3VUDA 1PXIA 3Q4ZA 4F1TA 2FSLX 2C5YA 2RFNA 4AT3A 1AGWA 4HVGA 1KWPA 3SX9A 3Q32A 2XK3A 2Q0NA 3R73A 3Q3BA 3DLSA 4K9YA 3TM0A 3BCEA 4RFZA 4IM0A 4ZP5A 2JIUA 5BPYA 3KK9A 2PL0A 2PPQA 2QG7A 1JVPP 2XB7A 3EQHA 3QU0A 4X7QA 4DC2A 1WBPA 3THBA 2PWLA 4D9TA 3BYVA 1JKTA 5JFXA 3H9FA 3PSBA 4H3PA 3FC2A 3PWDA 4BI0A 4HGLA 5DWRA 3Q52A 5AX9A 2ZV7A 4IDTA 5TT7A 2PMOX 2ITXA 3VUIA 2PTKA 3MA3A 3VS1A 4AOJA 3FHRA 3PPJA 4L44A 4BKYA 2ZB0A 1CDKA 5ACKA 3U55A 3EJ1A 4AT4A 4AZTA 2O65A 5A4TA 2X6DA 3MYGA 1F5QA 1PYXA 2UZEA 3CXWA 4MWIA 4TY1A 3S4QA 2EB3A 3U51A 4E6DA 5IA4A 3ZSIA 5AV0A 5IZFA 5L8KA 2F2CB 3NZ0A 1L3RE 2F7EE 4Z7HA 5J9ZA 5D12A 2IZRA 2A1AB 4I5MA 2ZOQA 4J8MA 3OW3A 4QMOA 4A9SA 1H1SA 4NIFB 3HA6A 3LFFA 2IZUA 3R8LA 4YZMA 3UNJA 4BGGA 3NCZA 5BUJA 3HLLA 3CE3A 3QTZA 3LW0A 4ALUA 1PW2A 4AOTA 5IA1A 5J9YA 2PUIA 1APME 1H08A 2HENA 2XA4A 3UG2A 4C36A 2CN8A 4DBNA 3HAVA 1LUFA 5I9UA 4EH2A 3R2BA 3E93A 1T45A 2WZJA 2C6OA 2YCRA 3RM7A 2OIQA 4RQKA 4XV9A 5CASA 3REPA 5E91A 3R7EA 3ODZX 3PTGA 1OB3A 4BDAA 2QI8A 4AF3A 1J7UA 4BCMA 4BTKA 3I7BA 3TZMA 4AU8A 1VEBA 4Q2AA 3QXPA 4CEGA 3Q04A 4MXAA 4FI1A 3COIA 3E5AA 3ORTA 3HV5A 2ZMCA 3BHHA 4FKQA 4AGWA 2JDTA 3POOA 2GS7A 2G15A 2XYUA 3NIZA 4EWHA 3T3VA 4PMMA 3DCVA 4Q5HA 3DBFA 3K5UA 4U79A 1MRVA 4G3GA 1Q4LA 3RPYA 4NTTA 2X1NA 3WZDA 4CTCA 3LMHA 1WCCA 4BBFA 4PMPA 3S95A 4QYEA 2W4OA 4FNXA 2I0VA 1RJBA 3EFKA 3QLGA 2VWXA 3Q60A 4GEOA 5A4EA 5KMJA 3D7ZA 4YHTA 5HLPA 4E4LA 5HORA 4MTAA 3R9RA 4MX9A 2WTWA 4RZVA 5EYMA 5FEQA 5IQEA 4DEHA 1V0PA 5CAQA 2Z7QA 3GC0A 5EOLA 2HCKA 4ERKA 4LOPA 3NEWA 4ITIA 5J5TA 5JFWA 2PZRA 3V5WA 1R78A 3FC1X 4JDKA 4APPA 5A46A 1G8AA 1OZ1A 3M42A 4I20A 4AZWA 1KSWA 5DR2A 2JD5A 4EH6A 3RHKA 4FTQA 3F5GA 2C6LA 3ZO4A 5ICPA 1OL1A 3UO6A 1BYGA 2XM9A 2EVAA 3Q53A 4NUSA 4FV7A 4PF4A 4S34A 4EH9A 1JSTA 4ITJA 1Z5MA 5I9YA 3F5XA 2ZDTA 5CEPA 2R3LA 3KULA 3UP7A 2HZ0A 4Z7GA 2Q0BA 5GINE 1RDQE 3E8EA 2A27A 1J1CA 3ZSGA 3E64A 5C8KA 3QRKA 1PMNA 5E92A 5HCXA 3ZXTA 2OIBA 3QD0A 4QMZA 3BBWA 2JC6A 4U3YA 4FTTA 4E7WA 3RAKA 4EOPA 2GTMA 3ROYA 4X0MA 2PY3A 1Q24A 1YVJA 2J51A 2WFYA 4PTEA 4OBOA 2YIQA 2GS2A 4GH2A 3IW5A 4IFCA 5DVRA 4ZJJA 1W0XC 2IW9A 3KQ7A 4EH8A 3ATTA 4OTGA 2W1CA 4X3FA 4FKRA 4U42A 4N0SA 3PXFA 5HZNA 3I4BA 2WO6A 5AV3A 4AG8A 3UOKA 4ZSLA 2XKFA 4EH4A 4RWJA 4IJPA 5JFSA 4RSSA 1GZOA 3QC4A 4UXQA 4Y73A 1OVEA 3R7UA 1G8SA 3NUYA 2P3GX 3H0ZA 3H10A 3TT0A 4MXOA 4P2KA 4HZRA 3DK6A 4L3JA 4V0GA 3KRRA 4A9UA 2OBJA 3LMIA 4BCIA 3DAKA 2WEVA 3I60A 4FG8A 4FUYA 5KCVA 1IG1A 4JS8A 4RIOA 3ZDIA 5E8VA 4NL0A 4TYHA 4USDA 4ANBA 3VHKA 3KRJA 4DN5A 2NP8A 3TZ7A 2B9FA 5CEIA 4WG3A 2CGUA 4Y8DA 4F9WA 3FXWA 3G0FA 4QOXA 5CT0A 2BZJA 5EI6A 2P0CA 3NNUA 4R5YA 3QWKA 5JGDA 3PVBA 5KNJA 3R28A 3VRZA 2WQMA 4C3RA 4IAYA 2WMVA 3ZSHA 2QC6A 4O6EA 5EG3A 2QOKA 3RJCA 4X2KA 3TKHA 4D4YA 1OBDA 3MPMA 3FE3A 4I5CA 5J1WA 2PYWA 3GBZA 4Y5HA 3N4VA 3AC1A 5L2QA 5ANIA 3MB6A 2Y6OA 3V5LA 3MFUA 4JLCA 5IQFA 3WYYA 2C5OA 4AA4A 4DTKA 3KRXA 5BVDA 3P1AA 5AUZA 3EQRA 3LXKA 2QQ7A 3MWUA 3ORPA 4JX3A 4OW8A 2WTIA 4F1MA 4JT3A 3FLNC 4RC3A 3LCDA 1M2PA 4USFA 3V5QA 2C3LA 3HMNA 4DH1A 4C57A 4IXPA 3FY0A 4UV0A 4TWCA 3TEIA 4IAFA 2IVSA 1O6KA 4LRKA 3Q2JA 2GHGA 4C4FA 5FM2A 2IZSA 3AGMA 3MPAA 1KUTA 4K33A 2W0JA 1Q99A 3ZFMA 3D5XA 4P7EA 4DG2E 3ZRMA 1BI7A 3ZUUA 1WZYA 3C4EA 3PZHA 2F4JA 4RWKA 4JDIA 4AWIA 2J90A 2VTQA 4IWQA 4PPAA 3S3IA 4DH7A 3MH2A 3LPBA 4BGHA 4E6CA 3QD3A 3TUDA 1QPCA 3WZKA 3TKIA 5HIBA 4ACMA 2JLDA 4FKVA 3BGZA 4JBOA 4RVTA 4YTCA 1NY3A 3HRBA 4Q9SA 4RVLA 4RVMA 4L53A 4TL0A 4O84A 2C0TA 4EOQA 3P7BA 2CLXA 5E7RA 3TNWA 3NVMB 3ZM4A 2QR7A 4XNEA 4TTHB 3BQCA 3TG1A 5K5NA 5I9WA 4F0FA 4MBIA 3GQLA 5AV2A 1WVWA 2OZOA 3FMKA 3GFWA 4NTSA 4AZFA 4D9UA 5C9CA 5BX0A 2PUNA 3F82A 5B7VA 5C03A 4XOZA 5C26A 3HZTA 3DKOA 4HZSA 4E4NA 3DJ6A 2JDRA 2W1FA 4D28A 4A7CA 4FODA 4XMOA 2ETRA 1ZYLA 3P23A 4JQ7A 4O7TA 2W06A 3Q5IA 4JIKA 3DXQA 4FNYA 1QMZA 1YOMA 4L68A 2HW7A 2WMUA 4HCUA 4R5SA 5BMMA 4EOLA 5C1QB 5AAFA 3SHEA 3P7AA 5CWZA 4ZSEA 3UOHA 4FF8A 4AGDA 3E92A 5HLNA 3DXPA 4I0SA 1YXVA 2VTOA 4EONA 5CVHA 3BYMA 1ZYCA 4F7JA 4OTRA 1E9HA 2QOFA 1IAHA 3EFLA 4O0WA 5HI2A 5CALA 2YZLA 2R7IA 4J1RA 5EK7A 5CEQA 2VWVA 3HAMA 1JKKA 3PYYA 4D0WA 5HE1A 3BEAA 3OEZA 3AOXA 2B9JA 5DRDA 4NK9A 3KXMA 4QP1A 5TKDA 4BDKA 2YM3A 3LOKA 3CJFA 2GQSA 5HBJA 2XF0A 5KBQA 2YA9A 3BGQA 5DNRA 4PPBA 1ZYJA 4K1BA 2W5HA 4L6QA 4XRJA 4FE2A 2EU9A 3W1FA 2ITYA 3I5ZA 3GCVA 2AC5A 3HV3A 3DT1A 3ZO1A 1OKVA 3WI6A 3L9NA 4I93A 2V22A 4D2PA 2XVDA 3EWHA 3LM0A 4YZNA 1NVSA 4EL9A 4ENYA 2VRXA 4L8MA 4Q9ZA 4YO4A 4DT8A 4BKZA 2XK6A 3P9JA 5JRSA 5CF6A 4IB5A 4U43A 2W05A 5CF8A 3C5IA 4YC3A 4R3RA 5CSVA 2C5XA 3MGYA 2R3KA 4EQMA 5LMBA 2XUUA 4QYFA 1JKSA 3PDTA 1OITA 3OXZA 1DAWA 3I0OA 5ANKA 5KX8A 3LVPA 3G0EA 4AZEA 1ZARA 2QO2A 4Y83A 4ASDA 2I0EA 2PZIA 1UWJA 2O3PA 4QTCA 3B8RA 4BRXA 3PRIA 4IIRA 3NW6A 2IZTA 3DQXA 3MH0A 2JBOA 2YCSA 3ATSA 3GCPA 4O6LA 3UMWA 4NWMA 3HRCA 5DA3A 3LFDA 5M4UA 1UNGA 3Q2MA 1IR3A 4D2TA 2WMAA 3FMJA 4JBQA 4ALWA 4B6LA 5L6OA 4IWOA 1V1KA 1Q8TA 1YI3A 4UX9A 5K5XA 5ETAA 3GFEA 3TTIA 4BDGA 3VS3A 2ONLC 2X0GA 3FMLA 4UALA 3O8UA 1ZYDA 1JQHA 2WQEA 5HHWA 3QUDA 1G5SA 2WTJA 4C61A 3PVGA 2VAGA 4K6ZA 3SD0A 3SG9A 2OJ9A 3GU5A 1I09A 2XJ1A 4BIEA 4PRJA 3OROA 3VUKA 4WRGA 2UVZA 2X4ZA 5J1VA 1XBBA 3DFAA 3D9VA 4L7FA 5D10A 3Q4TA 4JAJA 4JR7A 4QO9A 4QP8A 2PVKA 2XNEA 4IB3A 4M84A 1JBPE 4PTGA 5CQUA 5DT3A 4EC8A 5H8EA 5TE0A 2UVYA 2JFMA 4RFYA 1OL5A 3ZBFA 5I9VA 4I1ZA 3ZRLA 1ZXEA 1UWHA 2XP2A 1WAKA 5DT0A 3QTSA 2WTVA 5ETIA 3NLBA 1OPJA 1GZ8A 3CPBA 4BICA 3MY5A 3D4QA 3CTQA 4YSJA 4CCBA 4GYGA 3NUAA 3FJQE 3OZ6A 3QAME 5BVKA 3TNPC 3ZLXA 2JDSA 3OY1A 1CMKE 5EM7A 4AS0A 1M2QA 2X4FA 4TYIA 4EK8A 3ANQA 4O2ZA 4OT5A 3G90X 4F9AA 3KN5A 3R8ZA 2OIDA 2BR1A 3FYKX 5CANA 3KU2A 2GTNA 2JBPA 2Q83A 3TUCA 5EHYA 5AEPA 4FKIA 1YXXA 1Q62A 5L8JA 3QCSA 4FICA 2C5VA 3SXRA 3F2AA 4EHVA 4AXAA 1XH5A 1Q61A 3RPVA 4AW0A 3KVWA 3CY2A 3TL8A 4NKSA 1G3NA 4OTWA 5KZIA 1T46A 1XR1A 3FI3A 4IAIA 1M2RA 2E2BA 3F3WA 1LR4A 4PMTA 4QMUA 2CKQA 2XM8A 4ID7A 3R7OA 4IM3A 3BLHA 3WF6A 3NW5A 4RMZA 4F64A 1FOTA 3O50A 1JPAA 3PJ8A 3DZQA 4FKTA 4TT7A 4YZBA 5DGZA 2QONA 1YHVA 1XWSA 3VJOA 4XBRA 2X2LA 4U5JA 3DJ7A 5EYCA 3R8UA 4YNOA 4BCJA 5BVOA 3GUBA 4G5JA 2RFSA 4RIYA 3GENA 4W4XA 4O7RA 2OGVA 3C5UA 4FTKA 3R00A 5L2IA 3QX4A 4O22A 4RWLA 3TV6A 3UP2A 5EKOA 4ANMA 5HTBA 3O0GA 2UZNA 3DDQA 1H8FA 5K4JA 2C0IA 5KMMA 3BYSA 5D7VA 2CKOA 2OJIA 3E8NA 2IVTA 3F66A 3L8PA 5DBXA 2C6DA 4ZSAA 3RKBA 4O7YA 1MQ4A 3BHVA 1OUYA 1PHKA 2X81A 4FSTA 5DI1A 2UW7A 2R3PA 3QCXA 4FZAB 5LOHA 4WG4A 5E8UA 5JZNA 3UO5A 2BRMA 2W17A 4JJRA 3NPCA 4A4XA 4ZMEA 5IUIA 2NO3A 3JXWA 2YCQA 2YIWA 3QTUA 3VBWA 4AA0A 3MJ2A 3R8PA 1U54B 2R3IA 4DFUA 2WKMA 4PQNA 1JNKA 3N51A 3RBWA 3WZUA 4H3QA 4FA2A 4O0XA 4L01A 2QNJA 2ZDUA 2HK5A 1REJA 2YZAA 1P14A 2BRNA 3UG1A 2E9VA 5CAPA 2R4BA 4KRCA 4GU9A 4L45A 3ID6C 4L9IA 1B38A 5EYDA 3KREA 5HCYA 3SOCA 3LLAA 4AE6A 4RC4A 1MRYA 3QQUA 5ETFA 3VS4A 5CENA 4XP3A 4WD5A 3BHTA 4UWBA 1YXSA 1QPEA 3CR0A 2B53A 3UMXA 5BUIA 1PYEA 4XG4A 4DEGA 3C4WA 2FYSA 4G5PA 3QQLA 4J7BA 4N4SA 3UC3A 3MS9A 3ZC6A 5L8LA 3U6HA 1J91A 4KWPA 4F9CA 3C0HA 4MNFA 4FT3A 4L7SA 4EUTA 4YSMA 4QP4A 1STCE 3EQFA 3VUTA 1OPLA 1Q8WA 1DAYA 2R3JA 4AGUA 3KRWA 4FYNA 1UU3A 2AYPA 1Y91A 1IEPA 2V7OA 3DBQA 2X2KA 2W1ZA 1KV2A 3BYUA 3F61A 2PUPA 3GCSA 2Z7LA 4CV9A 2F9GA 3FQSA 4EHZA 2UV2A 2X8DA 2XMYA 3OBJA 3QKKA 4NM3A 3TV4A 4QPSA 5IA0A 3O96A 4HNIA 1DS5A 4ZY4A 3O51A 1WBOA 1YDTE 4XG9A 4C4EA 2AC3A 4CZYB 3FLWA 3RGFA 2ZMDA 4M66A 4RC2A 4JBPA 3DK3A 5C4KA 2BPMA 3H9RA 2YM5A 3IGGA 1FGIA 1BUHA 1FQ1B 4R8QA 3NYOA 5L6PA 4BZDA 4GV1A 4U45A 2VX3A 4GUBA 4Y85A 4A4LA 2PUUA 1BX6A 3LJ0A 4NCTC 4LQMA 3OTUA 1WBNA 5ANEA 5B2LA 4II5A 4IWDA 1Q3WA 4U9AA 2WTKB 5IDPA 5DEWA 3F7ZA 4LMNA 5IISA 2ZM3A 5AUXA 4DGNA 2C68A 2DYLA 4EBWA 2OSCA 4FL1A 2BDWA 4ZMFA 2G9XA 2RG5A 4CKRA 2GHLA 2O63A 4C8BA 3NSZA 3A7JA 5EFQA 4QMMA 5E4HA 3FL4A 5BMSA 3C4XA 2V55A 2R64A 3W2QA 2CCIA 3FPMA 2WPAA 5K4IA 4PMSA 5AUTA 1WBSA 1X8BA 4IX4A 4JQ8A 3QQKA 3R7IA 4W9XA 3VS5A 4C62A 5J7HA 2R3RA 4KS8A 4BHNA 3C4ZA 5FXQA 3WZEA 5LVMA 5FP5A 3HMIA 3EL7A 3EN5A 3LLTA 4U81A 1FGKA 4R7HA 3ZO2A 3O7LD 3OWJA 3AT4A 5EW8A 4E26A 3K2LA 5DPVA 4I41A 4NYEA 5HE2A 2HZ4A 3CY3A 1A9UA 3QTIA 5KHXA 3PY1A 4M97A 2GNIA 4NU1A 2JKKA 3OFMA 3E62A 4H36A 5EDQA 3U9CA 4EHEA 1OBGA 2C6MA 3CQEA 3O71A 2ESMA 3CCNA 3D2IA 3DQWA 4MXYA 4QMLA 2E9UA 3R02A 4IDVA 4BHZA 2HZIA 4ZS4A 3LJ1A 2G01A 2G2HA 3UOLA 3W32A 3AT2A 3BU5A 4IEBA 4L67A 3MW1A 4IE9A 3PRFA 4RIWB 5ANGA 4EI4A 3F88A 3PXRA 4RIXB 4O82A 2OU7A 2I0YA 4OGRA 4BDFA 4XLVA 4XV3A 2WIPA 2P33A 4M13A 4CKIA 3H30A 4EK6A 4F65A 4KBAA 4BTMA 2NRUA 2KTYA 1OGUA 3RWQA 5IQCA 3UZRA 5JRQA 4WBOA 5IQAA 3QRTA 4X2NA 5GJDA 1VR2A 3KB7A 1Y6AA 4IVCA 5IUGA 5M53A 3JY9A 2HOGA 2ZB1A 4ZIMA 5GJGA 1ERKA 4KSPA 4LYNA 2XIYA 3RALA 2J6MA 2PE0A 5KHWA 3AMYA 3IDPA 3L9LA 3NNWA 2W1HA 2RFDA 4FKJA 4QP6A 5CZHA 2EUFB 4C7TA 5IDNA 3BX5A 3GI3A 4GK4A 2V5QA 2XNPA 3AC2A 3BPRA 1KE7A 1SNXA 3C51A 3F9NA 3HX4A 4I6HA 3TV7A 1Q8YA 2JIIA 4N6YA 3ZCLA 4OTDA 5EQEA 2VWIA 2VTMA 1P4OA 3CPCA 3DNDA 3HV4A 5AR5A 3JY0A 3G15A 2E9PA 3ZONA 2BFXA 4BIDA 2VTNA 3ETAA 4BL1A 2X8EA 4XBUA 4MAOA 1UNLA 3PP1A 4C4IA 3NWWA 4EK3A 5E9EA 4ACDA 4I5PA 2ZV2A 4HGSA 3ORIA 5HCZA 3ZHPC 2EXCX 4J96A 3JYAA 3EKNA 4EJNA 4E73A 4O38A 4EKKA 3NYXA 5ACBC 3MY0A 2YM7A 3ZTXA 2QOIA 3CTJA 4MXCA 4EEVA 4X21A 4CMOA 3F69A 1ZWSA 5I9XA 4FKLA 4YNEA 4D1SA 4U3ZA 2F7ZE 5CEKA 3EIDA 3IECA 4XX9A 4GKHA 3GC7A 2YWVA 3EQDA 1NVRA 2VU3A 4YJNA 4XYFA 5AIRA 2WEIA 5IA2A 3DKCA 3R1NA 4TN6A 5B2KA 5DH3A 1F3MC 3BBTB 5F4NA 4X2JA 4F7SA 3MB7A 4O96A 4QMPA 2CNQA 3BE2A 2UW3A 5AADA 4I5HA 1YKRA 5J5SA 5HIDA 1PMUA 2XYNA 4NW5A 2GSFA 5H3QA 3RP9A 1J3HA 3NUUA 4FKOA 3L8SA 3PA4A 4TXCA 2QODA 1VYZA 4BDBA 2OK1A 3DA6A 2X8IA 2X7OA 3JUHA 5HNBA 3CC6A 4BWPA 4FNZA 2YFXA 4FTLA 3MTFA 3HUCA 3MSSA 4JRVA 5GZ9A 3R7YA 4BDEA 2BRBA 5AV1A 3OW4A 3A2CA 2CGVA 3DTCA 4UYAA 5CF4A 5BVWA 1PJKA 3GCQA 2X9FA 5D41A 4ZSGA 1R39A 3PY3A 1XJDA 3NYVA 5LMKC 5HX6A 4YTIA 4XP2A 2IO6A 3OS3A 2WAJA 2YWPA 4R78A 5JEBA 1OIUA 2J0LA 4YTFA 3DB6A 4CFNA 3N9XA 1URWA 2BDJA 2PVMA 2X6EA 3RAWA 4FZDB 4LV8A 1BMKA 4ANLA 1CKJA 1U46A 1WVXA 4EORA 2B4SB 4DG3E 3NNXA 3IOKA 4G9RA 4M7IA 1QCFA 3EN7A 4GJ2A 4O0SA 2YIYA 2GQRA 3QKMA 3QUEA 3DB8A 4U80A 1OUKA 5AR2A 2CMWA 2Y9QA 3PJCA 4HGTA 4O7SA 3BHUA 3CD3A 2BALA 3PP0A 4XG6A 1GIHA 4FUXA 4DCAA 3OY3A 3KGAA 4E4XA 5DN3A 1OI9A 3GB2A 2WMSA 2VNYA 3U8WA 4GU6A 4RLKA 4HYSA 5IQIA 4GFGA 4AW2A 3HKOA 4H05A 4HVIA 2YEXA 5CXZA 3Q9ZA 5EI2A 2YLEA 4IAKA 4S30A 2HXQA 3K5VA 4UY9A 3I6WA 3ULIA 4FG7A 4ASEA 2BAQA 2XKCA 3ET7A 4L00A 3VC4A 1E1XA 4LFIA 1SYKA 4JXFA 3FLQA 3LJ2A 2V7AA 3FZ1A 5FBNC 3D15A 3SDJA 2C1BA 5IA5A 2X2MA 5KUPA 3TUBA 5BYLA 2CGXA 1XBCA 2BRHA 5BVFA 2VN9A 4G9CA 3ORXA 4AA5A 3U4WA 2WTKC 4JOAA 4RQVA 2R0IA 5HU3A 5KMNA 2GMXA 2R3GA 4UXLA 3ZU7A 5IEVA 4DTAA 4GIIA 2DUVA 3KCFA 1REKA 1YI6A 5I5ZA 3EH9A 4I6QA 3T9IA 4NM7A 5ANOA 2Z7SA 2OFUA 3H4JA 3NDMA 5E8YA 4G3EA 5K0KA 2XK8A 4FBXA 2BILB 3EFWA 4MHAA 5CZIA 1YXUA 2FSTX 2Y6MA 2HWPA 3MVHA 4YC6A 2GHMA 4YLJA 5AP3A 3U54A 4CG9A 5CU4A 3F3VA 1OL7A 4RVKA 1ZMUA 4TWNA 4K0YA 1LEZA 2VD5A 4JNWA 4EZ5A 5FM3A 2EXMA 1YHWA 3HP2A 4QPAA 5CU2A 5CT7A 5M55A 4RBLA 3UVQA 4EQUA 4F08A 4YU2A 4DH5A 3FLZA 3A61A 5A6NA 5IH6A 2HW6A 3QALE 2W5BA 2WTDA 5FXRA 5HTCA 5T3QA 5CY3A 3G6GA 4WA9A 4EOKA 5TR6A 3V6SA 5JKGA 3KKVA 2VTJA 3MVJA 3TDWA 3NYNA 3VVHA 3CD8A 2OF2A 3LM5A 3OP5A 4FVRA 2RKUA 4BTJA 3NVKI 5M07A 4EH5A 2PVFA 3PXKA 3EQGA 4DCEA 3HRFA 3QD4A 4XOYA 4F1OA 1LEWA 4MNEB 4HPTE 4QP3A 1TVOA 3QCQA 3EFJA 3UIBA 1H4LA 4FK3A 5M56A 2XKEA 4WIHA 3D7TA 1AQ1A 2XBJA 5HG8A 2C69A 2XIZA 1SVHA 4K77A 3Q9XA 2JDOA 5ANDA 3ZM9A 3P7CA 4HVSA 5AA9A 1PXKA 4L46A 3QCYA 5G1XA 4DYMA 2R5TA 3QWJA 3VF8A 3UYTA 4KIKA 3PSCA 2BTRA 2H6DA 2BKKA 4YJPA 3F2NA 5AX3A 5I9ZA 1PKGA 3WILA 1XKKA 3I1AA 4ITHA 5K9IA 1CKIA 2ITQA 2PE1A 5FEEA 4W9WA 2BZKB 4QTBA 3ACJA 5AP6A 4AW5A 5KO1A 3OWLA 3PJ1A 5AR8A 3U4UA 5CAOA 2ITTA 3OCGA 1P5EA 1R0EA 3R9HA 4CT2A 3D14A 3EHAA 4KBKA 3VAPA 4AX8A 3BKBA 3DKFA 2LAVA 2SRCA 3PA3A 4R7IA 4BF2A 2XS0A 3IQ7A 4AUAA 1H00A 1M14A 2V62A 4O1OA 3VW6A 3EB0A 3LE6A 3BYOA 1RW8A 5LVNA 3RNYA 4BCOA 2UW4A 4IAAA 4L42A 4AFJA 4CXAA 1ZOEA 2QKWB 4JX7A 3F3ZA 1ZMWA 4ZTSA 3P08A 3AGLA 3R04A 3PXQA 3ZBXA 3UIXA 3OCTA 4YURA 4FL3A 5CSWA 3UO4A 3ELJA 4IFGA 4W8EA 3V5TA 3VQHA 1KOAA 1YWNA 5HGIA 3NR9A 2B9IA 3PIYA 4AQCA 4E20A 4H58A 3W10A 4F63A 3GP0A 3OXTA 3ZLYA 2VWYA 4GG5A 5FDPA 5JZJA 1K2PA 4DGGA 3JS2A 3LFQA 5CYIA 1AD5A 2R3HA 4QTDA 3E87A 4O2PA 5HICA 4BI2A 1GJOA 2VWUA 4U44A 4PWNA 5CU0A 2J7TA 2YM6A 4ACCA 3FZSA 1LPUA 4GG7A 4FK6A 2WTCA 5AV4A 1UU7A 4QTEA 5GIPE 3OT8A 3H0YA 3Q9WA 4TWOA 3L9PA 4JG6A 4RWIA 3WYXA 5LJJA 5HG7A 1UKHA 3IW4A 4KB8A 4QMNA 3PPKA 4D1ZA 3E7VA 3UVRA 2XJ0A 2Z8CA 4TW9A 4AZSA 2YERA 1SVEA 3VS2A 4RFMA 4R1YA 4BDCA 4FEWA 2HWOA 2BVAA 2PVJA 4OTQA 2ZM1A 4QP2A 5L2SA 3FI8A 3PLAE 3QRJA 1YXTA 4CLIA 4N6ZA 4FKGA 4RJ8A 5IQDA 5HQ0A 4DEBA 5CS6A 4CGAA 5EDPA 4D1XA 4U40A 3OOMA 4U8ZA 4WNPA 4BWKA 2CNVA 3QGYA 4MF0A 4L3PA 1H25A 5A4QA 1BI8A 3LXLA 3BU3A 3ITZA 3OC1A 2VUWA 4EQCA 4ZLOA 1XH8A 3AD4A 4RIWA 4RX7A 4O0VA 3JVRA 3QRIA 4PY1A 2YABA 3DZOA 3NUXA 2OZAA 4RIXA 4D4SA 5AP4A 3IW8A 3R0TA 3FEGA 4UZDA 1ZAOA 4UN0C 3QQHA 5IA3A 4I92A 2XEYA 3DAJA 4GRBA 5A54A 3KVXA 4WUAA 5BUEA 3BRBA 3GC8A 4MYGA 4PPCA 4PP7A 4OT6A 3ZLSA 4RJ4A 4D5KA 3A8WA 3AC5A 2I40A 4BBMA 3QBNA 1MP8A 2OFVA 4W4VA 3GU7A 4Z3VA 5KBRA 2HZNA 2QD9A 4YJQA 4EC9A 3RAIA 4EOOA 3CP9A 1Y8GA 4G6NA 5BQ0A 2HAKA 4PL3A 3BWJA 2W4KA 4DFXE 2JAVA 3C4CA 2DQ7X 3BQRA 3BLQA 3NCGA 5EKNA 3V04A 3QD2B 4OTFA 4MH7A 1O9UA 3SGCA 4FIFA 3COKA 2XCKA 3F6XA 3C50A 3QQJA 3ORZA 4I3ZA 2QCSA 3C13A 4AN9A 4HVDA 3UODA 4RJ3A 3NS9A 3U87A 3KXGA 2VO0A 2IW6A 3EMGA 2QHNA 3ORMA 3W8LA 4IW0A 2ERZE 3V8SA 5AR3A 2O64A 3WF7A 3HV7A 4HYHA 4AE9A 4GW8A 4Z9LA 1XH9A 4D4VA 1XHAA 5AWMA 3G2FA 3ZZEA 5D7AA 4S33A 4DLJA 2CDZA 3W2OA 4FTCA 5EHOA 4TPTA 4XEYA 4X3JA 4FV6A 5AP5A 5JMSA 3SVVA 4FIIA 2QR8A 4GSBA 3PIZA 5DYJA 2ZM4A 3VNTA 4NIFA 4CYIA 2UZUE 3IG7A 3WZJA 4ARKA 5J7BA 3HMOA 2PVHA 4FT7A 3A62A 3UNZA 3KMUA 4ORKA 4GFMA 4C35A 3UOJA 1OIQA 1OKYA 4ZY6A 3DKGA 4GT5A 3C7QA 3GGFA 3QXOA 1B39A 2VNWA 3L8XA 4FIEA 2CKEA 4WOVA 4ZSJA 3O23A 3VBXA 3HDNA 3B8QA 3G9LX 3MBLA 2VO6A 4QT1A 4ZK5A 3TNHA 5LVOA 5HBHA 5M09A 3IONA 2FB8A 3LQ8A 4FV4A 3RPOA 4FNWA 4B99A 4ZJVA 1H1PA 2UW8A 2ACXA 1KE8A 2VTHA 3DXNA 3FQEA 2YAKA 4A9YA 2KULA 2PZPA 4RT7A 5CEOA 2GCDA 4NEUA 3AD5A 4R77A 3RPSA 3IGOA 4A06A 4XS2A 4ASXA 2H96A 4FTNA 2OKRA 4CTBA 5HO8A 4IVAA 1M17A 4WNOA 4F0GA 1PXJA 2CGWA 3KXXA 1BLXA 3VHEA 4CFXA 4J98A 4Z16A 2GNGA 5BNJA 2JKOA 4G16A 4S31A 2ITOA 3RTPA 3OCSA 4QYHA 4O0UA 3LKMA 2CSNA 4D5HA 2OICA 4ZJIA 2WMQA 1IA8A 2GPHA 4OTHA 4XP0A 2BRGA 5DIAA 4AACA 2XZSA 4QYGA 2X39A 2J0KA 3LHJA 3QA0A 3WBLA 3U6IA 2QG5A 4M8TA 3MI9A 4FTJA 5C27A 2OXXA 5CAUA 4DGLC 2QOQA 3QKLA 4G31A 4NJDA 3SLSA 3NUPA 4AT5A 4GK3A 2VZ6A 5IG1A 5DRBA 2B0QA 3WE4A 4I6FA 4F09A 4GFOA 3VN9A 3MVLA 1JSVA 3G6HA 4GS6A 1K3AA 2QO9A 4HYIA 4ACHA 4OAVB 3A7FA 4NSTA 5HD4A 4IC8A 2O2UA 1M7NA 2ETMA 2IW8A 2OI4X 3W33A 4ZZOA 3P0MA 4YLLA 1HCLA 2RFEA 2VTAA 4YZCA 3FMHA 4RLLA 4C34A 3RNIA 3LFCA 4ANSA 2E9NA 1PXOA 2RL5A 1ZZ2A 3AC4A 3QHWA 4G2FA 4GVJA 4ZTMA 4TYGA 3HMMA 2A19B 1JWHA 4CFVA 5FXSA 2O0UA 3W2SA 1PXMA 2UZWE 3KULB 3R21A 2WGJA 5HIEA 3WF9A 1OL2A 2ONLA 4W4WA 1A06A 4CFMA 3W2CA 3G9NA 2XNBA 4FVQA 3UDBA 4EOSA 4FTRA 5I4NA 4P4CA 1UU9A 3ZFXA 4CVAA 4J97A 2OLCA 1MUOA 3RI1A 5HNIX 4HVHA 1PXPA 4QYYA 4W8DA 5LVPA 3E3PA 4AGCA 5CU6A 3DBEA 4ZLYA 5D9HA 1W84A 4LGHA 5HG5A 5M4FA 4X3FB 3WF8A 5F9EA 3MFTA 3PJ3A 4XV1A 3I7CA 4D2VA 1Q97A 3QA8A 3TTJA 5KMKA 2XNNA 2Z7RA 1QPJA 3R71A 4MQ1A 4A4OA 2F57A 4NFMA 4RX8A 3QTRA 2PHKA 5TOZA 4GJ3A 5EQPA 4MBJA 4R3CA 5LARA 1CM8A 3OHTA 2EWAA 3OBGA 3TIYA 4FSQA 5IH5A 4LRMA 2GFCA 4HJOA 2C4GA 5LCJA 2CN5A 5E8TA 3MFSA 4R6VA 3A7GA 4TRLA 3RMFA 4E5AX 4IZ7A 3EZVA 4ONAA 1OM1A 3IDCA 5CVGA 4KIOA 5AUUA 3FSKA 5C8NA 1XH6A 3CIKA 4IB1A 4MF1A 4FV0A 3ZMMA 2BIYA 3TI1A 4GL9A 4IX3A 3TIZA 5DHJA 4CKJA 1PKDA 1Q8ZA 3PWYA 2C6TA 4KS7A 4F7NA 4FOCA 3DV3A 4PNIA 3KMWA 3QTXA 3HYHA 3ODYX 3FZOA 1YRPA 4EOIA 1BKXA 4KRDA 5HNGA 3FZRA 1Y6BA 2WMTA 3BEGA 3DPKA 3VUHA 3DLZA 4E1ZA 4FV3A 4YJOA 5A4LA 2O8YA 1NVQA 1OMWA 5HU9A 3ZLWA 2ZV9A 2FSOX 2B52A 5HBEA 2FH9A 2Y8OA 4I21A 3LFNA 5CSHA 5EW9A 4B9DA 3MIYA 3CQUA 2CHLA 3D2KA 2XK7A 1CSNA 2JEDA 4QMYA 3PFQA 2W4JA 3ZDUA 3PE1A 4DT9A 4M3QA 4BCPA 4EOMA 4XG2A 4PNKA 1XH7A 5DMZA 5JT2A 3AMAA 1M7QA 3KY2A 3QC9A 3IOPA 4FIJA 2WD1A 2QOLA 4OTPA 4X2GA 4F9BA 2B7AA 2W9FB 5EM8A 2W1GA 3FHIA 3PG3A 3S2PA 5JQ5A 1W8CA 2W99B 4TNDA 4YPDA 5HE0A 1H0VA 2R9SA 4DINA 4V04A 3JR1A 1MQBA 3EN9A 4QPMA 4M0ZA 3FYJX 3A7HA 3COMA 3POZA 4XG8A 4ZTRA 5CNNA 1VJYA 3W16A 3RINA 3FMNA 1TQPA 4GIHA 2WU7A 5IMXA 2CCHA 3CKXA 1S9IA 3FL5A 3HNGA 4U7ZA 2A4LA 3LCOA 3NIEA 4MEDA 4HW7A 1UU8A 4QMSA 2BAJA 4R3PA 1KE9A 3KC3A 5M44A 4UWCA 1BL6A 4MBLA 4BCQA 2WOUA 3BI6A 4YO6A 5EOBA 4IACA 5F1ZA 3RVGA 3LQ5A 2G1TA 4ZZMA 3V01A 4FSMA 4FSYA 3E8CA 3MPTA 5DLSA 1O6LA 2HELA 5GZ8A 4B7TA 3S0OA 1QL6A 3HDMA 3VRYA 3QHRA 4EYMA 3UPXA 4FKPA 3GQIA 2I1MA 1UV5A 3DJ5A 4YC8A 2BUJA 4J71A 4FEUA 1GIIA 3EYGA 4RRVA 3E3BX 1OKWA 2PK9A 2VX0A 3BV3A 3QZIA 4HOKA 5CNOA 1OL6A 5DEYA 4EHGA 3ZFYA 3FLYA 5HLWA 2GNHA 3WIGA 4QTAA 4O21A 1CKPA 4F6UA 2VTTA 4XH6A 3R01A 4UEUA 2PU8A 3ROCA 3C0IA 5KMLA 4YBJA 5CQWA 3KXHA 3VF9A 2OG8A 1NXKA 3UJGA 3C4FA 4HCVA 5AJQA 3QX2A 5LWMA 4CCUA 1R0PA 4WBBB 1PMVA 1H1WA 5J79A 3L9MA 3II5A 3BIZA 3HGKA 3U6JA 1GZKA 3KK8A 4OUCA 5CX9A 5AP0A 3VWAA 3H9OA 4A07A 1ATPE 4M12A 4FTOA 3TWJA 4AN2A 3WARA 3PPZA 4F70A 3UVPA 4G1WA 1JOWB 5LCKA 4DEAA 2XBAA 5HESA 4IHPA 2P2IA 4IZ5A 4K8AA 5M4IA 3GU6A 2WQOA 1TQIA 2E9OA 2FSMX 2CLQA 2UZDA 4JIAA 3FY2A 4DAWA 3KN6A 3IDBA 4XCUA 3UIMA 3WF5A 3G33A 2IN6A 3Q96A 3GXLA 4R1VA 2ETKA 3QYZA 1WFCA 2UZOA 3R1YA 2HIWA 5L6WL 4E6QA 1DI8A 1H26A 2IG7A 5GIOE 4DITA 4GUEA 2XH5A 4DFZE 2CJMA 3DU8A 3DY7A 2XNOA 5HVYA 2REIA 3EL8A 4KIQA 4NCTA 3NUSA 2YHVA 1OIYA 3AT3A 3LFBA 3PXZA 4W4YA 4DH3A 2CKPA 3MJ1A 3MFRA 1WVYA 4EYJA 2YLFA 4WNMA 4O83A 3PSDA 3ZC5A 4KABA 3R8VA 3UBDA 2FGIA 2PMNX 2WMXA 3SA0A 1NT2A 4PDYA 1Q3DA 5GZAA 3KXNA 1KV1A 3MDYA 4JQEA 4QRCA 3I5NA 5HG9A 3P4KA 4EK4A 4DF3A 3DAEA 1K9AA 1Y8YA 5IF1A 3R8MA 5E8XA 3VO3A 1H0WA 4KKEA 4EZ7A 4FKUA 2YDJA 3D5UA 5DT4A 4FT9A 5EH0A 1YI4A 2G2IA 4AW1A 2C3IB 2W5AA 4O7WA 3I81A 4G3DA 4RJ5A 3FKOA 5HO6A 2YDKA 4QMXA 2UZBA 4F4PA 2BMCA 1JSUA 2DS1A 2GNFA 4BTFA 3GU8A 5H8BA 5IQHA 1H28A 4YBKA 4O7LA 3OXIA 5TO8A 4ZAUA 3O2MA 4BGQA 4OTIA 4WG5A 3SG8A 4X3FC 3QGWA 1H1QA 2UZVA 3FV8A 5G6VA 3UIUA 3R30A 2ITVA 3G51A 3TNIA 3VULA 4NW6A 4EBVA 3AC8A 4XRLA 1H01A 4LI5A 4LOOA 5JN2A 3L8VA 1KE5A 3MH1A 4Y72A 4BZOA 4I4FA 2UW6A 2BDFA 2ITWA 3HV6A 1UKIA 3V3VA 3V8WA 4H39A 2PZYA 3QTWA 5L2WA 1JAMA 4U0IA 4MQ2A 4AFEA 3QYWA 3BELA 2BCJA 4XV2A 1QPDA 2UUEA 5HTIA 1FVRA 3O8TA 4KD1A 5EM6A 4M69B 2A2AA 3RZBA 4E93A 4GKIA 1YW2A 3D5WA 4BCFA 1GY3A 2OJFE 3PXYA 3R1QA 2HY0A 5FQDC 3OVVA 4WRSA 4L3LA 5HVJA 1OIRA 1V0OA 3CQWA 4B8LA 4H1JA 1IA9A 3RK7A 5FUTA 1ZOGA 3UTOA 2I7QA 5E90A 1SM2A 4JRNA 5F20A 3A8XA 4BY9E 2WMBA 4BWXA 4DFLA 4OAUC 3FQHA 3ZOSA 3K54A 2C0OA 3KMMA 4IMYA 4IX5A 1W98A 4LGGA 1WMKA 5JK3A 2JKMA 2H8HA 4YHJA 5E1EA 4RG0A 3R9NA 1RE8A 3K3IA 4MD7E 5HEZA 3VBYA 4F9YA 2Y4IB 4BDJA 2X7FA 2PZ5A 2C1AA 4IB0A 4Z55A 4CG8A
chains in the Genus database with same CATH superfamily
5CSXA 2IWIA 3RHXA 4DBXA 3NRMA 3HUBA 3LFEA 2UW5A 2ITPA 4CMTA 4ZY5A 3PE2A 3CSVA 4J53A 4RX9A 2C6KA 3KXZA 4UWYA 3CLYA 3CKWA 5FRIA 4LRJA 1SNUA 4IWPA 4KINA 3TXOA 3DGKA 1URCA 4EWQA 2QVSE 3MA6A 2C6IA 3FPQA 2YACA 3LXNA 3R7GA 2J5EA 2VTIA 2YM4A 4P90A 3GEQA 4Y5QA 5EW3A 4CNHA 3SXFA 3VS7A 3DDPA 4RJ7A 2XIKA 4F6SA 4FSUA 5B2MA 3O7LB 4C02A 4QQ5A 2PMLX 4JG7A 3ALOA 3S1HA 5DE2A 4BDHA 4C2WA 4CQEA 2NNWB 2XEZA 5DFPA 4BC6A 3ALNA 5FTOA 4FV2A 4UBAA 3OCBA 5E8SA 3UC4A 4TZRA 4ZTNA 4L43A 4ANNA 5KMOA 5LQFA 2YJRA 4RIYB 4JMQA 4FOBA 5FTGA 4J99A 3SRVB 3DBCA 3IK3A 1ZZLA 4I94A 3WOWA 3V8TA 5IUHA 4N70A 4APCA 5F95A 5M06A 4YJRA 4IJ9A 4KUJA 4MK0A 4ANQA 1U59A 1S9JA 4WNKA 3NGAA 4Q5EA 4DEEA 4E4MA 1TKIA 3PUPA 1ZLTA 3T8OA 4NT4A 5E8ZA 5IQGA 3PFYA 5EQYA 3V6RA 4FSRA 4GMYA 5L2TA 5LXMA 2WIHA 1U54A 5ANJA 4GVAA 4E6AA 5KE0A 4AXEA 3OF0A 4LUDA 4TWPA 2C30A 2AUHA 4RA4A 1W83A 4UYNA 4G6LA 5IKWA 3F5UA 2BZHB 4JDHA 1BL7A 4V01A 4FZ7A 3ORNA 4FIGA 1Y57A 2RF9A 3PIXA 4QD6A 3RM6A 5JGAA 4I6BA 1ZOHA 2J4ZA 2B9HA 3EN4A 1YOJA 3TACA 4M15A 3PLSA 5LMKA 2WNTA 3ZUTA 1H1RA 4DFNA 3EQBA 5L3AA 3QL8A 4KBCA 4NM5A 2R2PA 1B6CB 3BL7A 2ZVAA 2ERKA 3VJNA 4EUUA 3SKCA 3V51A 3FZPA 4P5ZA 4ZTLA 5AUWA 3MN3A 4LDTA 1R3CA 3TZ8A 4F78A 2G2FA 2HXLA 3P5KA 4NH1A 5A6OA 5A9UA 4C4GA 1GNGA 4YHFA 4LUEA 2YITA 5DG5A 4IQ6A 4C3PA 4CFUA 3Q5ZA 3MVMA 5HOAA 2XIRA 5TF9A 2QOOA 4AZVA 2UW9A 3NUNA 3OUKA 1Q5KA 2JKQA 4FC0A 4S2ZA 4KKHA 5E1SA 4C58A 3N4TA 1ZY5A 4E3CA 1W82A 4UMRA 2Z2WA 3RAHA 3A7IA 3EOCA 2IVUA 3M1SA 4MXXA 4F6WA 3MV5A 5JFVA 3D83A 3FUPA 4QQJA 3DBDA 5HO7A 3MIAA 4L52A 4UZHA 5D1JA 3ZXZA 3Q4UA 2R3QA 4CSVA 3B2TA 2C3JA 2BHHA 4KIPA 3RZFA 3V5PA 4CZTA 2UZTA 5K0XA 3B2WA 5FBOA 4C2VA 2VO7A 3MESA 2WXVA 5H8GA 4FSZA 4V05A 4FV1A 2BIKB 3VS6A 3UQCA 2VWBA 4C0TA 4B0GA 3LCKA 4GT3A 1V0BA 1YDRE 3KF4A 2WU6A 4U97A 5C8MA 3VUMA 1HOWA 4DA5A 5KKRB 3RWPA 4DEIA 4IX6A 4M67A 3PUFC 1DI9A 4HCTA 4R7BA 5BVNA 2W1DA 4KA3A 5J87A 1FBNA 2UW0A 3N4UA 5IH4A 3CGFA 3R9DA 3SC1A 3TKUA 2FA2A 4J8NA 4X6RA 2OH4A 3BE9A 2WMWA 4FT5A 1VZOA 4D2SA 1GAGA 4FKWA 5IPJA 1JLUE 4ZLZA 4RX5A 4LL0A 3VS0A 4JR3A 3LCSA 1E1VA 2Z60A 3R2YA 4O0YA 4FEXA 4MCVA 5JSMA 5FP6A 3UQGA 4E5WA 4OBQA 3UQFA 2XCHA 3FMEA 5FDXA 4O81A 1UA2A 3DTWA 4IBMA 4RA5A 5GNKA 5I3RA 1H24A 2VTSA 4FV9A 1ZY4A 2P55A 3C1XA 4JBVA 3SXSA 4ANOA 1SMHA 4FVPA 4FV8A 2J50A 4O7VA 1LP4A 3VBTA 5H2UA 3R7VA 1PF8A 2UZLA 3P86A 3Q6WA 2GS6A 5LMAA 4PP9A 4QDVA 2OH0E 3GU4A 4C4HA 2FO0A 2EXEA 2LGCA 4USEA 3DNEA 3ENMA 3ERKA 3TN8A 4EKLA 1XMMA 2IPXA 4LL5A 3KA0A 4AP7A 4XJ0A 1GIJA 3IKAA 3UZPA 3FMMA 3ZS5A 4C37A 3LZBA 3FDNA 1WBVA 2B54A 4LM5A 4DEDA 4FZ6A 5HKMA 3W0QA 3NMUF 2GDOA 2WHBA 2J9MA 4JDJA 4E5BA 4RZWA 4M68A 4XLIA 3R9OA 4CV8A 2ZJWA 3NAYA 3BGPA 4QP9A 4WO5A 3R1SA 4EK5A 4FKSA 1OPKA 2C47A 2H9VA 4FG9A 1ZYSA 3FBVA 4O27B 3GCUA 4IZYA 2RG6A 4FV5A 4WSQA 1PMEA 4NM0A 2RSVA 3DFCB 2XK4A 4E8AA 4YJUA 4FTIA 2WQBA 4D0XA 5C4LA 5ETCA 5HE3A 1XO2B 3OD6X 3RCJA 2R3MA 4CFWA 4YMJA 4ASZA 3QUPA 4UB7A 4LMUA 4Y46A 5IEYA 2J0JA 2PMIA 2Y4IC 2DWBA 2Y7JA 5AP7A 5AA8A 4ZEGA 4TYJA 1JKLA 3CBLA 3F7WA 5GJFA 2BFYA 3W8QA 4H1MA 5FLFA 3NX8A 1PY5A 3AMBA 2OW3A 3DK7A 5A4CA 4O7NA 1NA7A 5A3XA 4DFYA 3CJGA 2XJ2A 3A4OX 2WELA 3PZEA 4K11A 1IRKA 3P78A 4TYEA 4DG0E 2R7BA 4U6RA 4QMTA 2OJJA 3HVCA 5F94A 2QKRA 1P2AA 3HA8A 1FMKA 3FLSA 4BBEA 1GZNA 2RIOA 4MD9E 4ZZNA 3QRUA 3GVUA 4D2RA 3KEXA 3O8PA 4WT6A 4JI9A 3ZUVA 2OXYA 5EI8A 3PJ2A 3FKLA 1WBWA 2F49A 2BAKA 4DGOA 5ITAA 2B1PA 5M4CA 1DM2A 1SVGA 1H27A 4B4LA 4QMVA 3UDZA 4PTCA 4IANA 2YN8A 4NJ3A 5AP1A 3RK5A 1W7HA 3TJDA 4I6LA 4A9RA 2B55A 5EHLA 4PUZA 2YAAA 2JITA 3IW7A 4MD8E 5HX8A 4IAZA 4DHIB 2QU5A 4ZS0A 4AOIA 2JIVA 3G5DA 2QLQA 3I79A 4GYIA 4QNYA 4IC7A 5IEXA 3UPZA 5CSPA 5EM5A 3HECA 5CTPA 2XRUA 4BR3A 1MRUA 3M2WA 4FTMA 5AR7A 4BKJA 4PDOA 1PXNA 3LXPA 3EZRA 4CD0A 5JGBA 5CF5A 4JVGA 2GQGA 3LCTA 4G3CA 2PVNA 2XIXA 5FTQA 3VQUA 4CQGA 2HY81 4TKSA 4C3FA 3JPVA 2QOCA 4YJVA 5IU2A 2VTPA 3LMGA 4ZTHA 4H3BA 3GC9A 4HNFA 4FL2A 4EOJA 5M51A 5FGKA 5AM6A 2JDVA 4G34A 4YPSA 4BN1A 3BV2A 2R0UA 1A48A 4BVUA 2YJSA 3KCKA 3MTLA 4DLIA 4GCJA 4QMQA 1J1BA 2C6EA 1U5QA 3FKNA 4F7LA 5FWKK 2ZYBA 2PSQA 3BU6A 3E8DA 3Q9YA 2GFSA 4X2FA 4YGAA 1HCKA 2W7XA 5K3YA 3ULZA 4EH3A 1Q41A 1KE6A 3CTHA 4M69A 3ORLA 4BDDA 1IAJA 5AAEA 5J95A 1FVTA 4C59A 4O86A 2F2UA 1Q8UA 3ACKA 2WB8A 5IMEA 4NKAA 2RGPA 5DR9A 4I0TA 4QQCA 3QZGA 5KZ0A 1CTPE 4OR5A 3AXWA 3ORKA 3SW7A 2PVLA 4K18A 2OWBA 4XG3A 5FD2A 4RJ6A 5H9BA 3V5JA 4CT1A 1RQQA 4XUFA 1KOBA 3TCPA 5I0BA 1EH4A 1U4DA 4JG8A 4YZ9A 4EJ7A 4FMQA 4IVDA 5HD7A 3D5VA 2VV9A 3FI2A 4KKGA 4CRSA 4PV0A 3VUGA 2W9ZB 3ZRKA 4UMTA 4BYJA 3PVWA 4G3FA 3UGCA 3AG9A 3UYSA 1FPUA 3PG1A 4I22A 3SQQA 4OLIA 3W55A 3A60A 2V0DA 3FWQA 2WMRA 3PY0A 4BFMA 4CFFA 2VGPA 5DOSA 4DHZA 4CMUA 2VX1A 4QEBA 5DR6A 1SZMA 4DH8A 1UVRA 2ITNA 3LIJA 4UMPA 2J5FA 4AAAA 3GOKA 4MXZA 3SOAA 4Y95A 3GOPA 1U5RA 4BZNA 4M0YA 2J2IB 4C33A 2R3NA 3UNKA 2XNGA 2ZAZA 3BLRA 4FZFB 4FTUA 3FXZA 3ZZWA 3U9NA 5J8IA 4D58A 4DGMA 3QTQA 3W2PA 4EH7A 5L4QA 3TNQB 2GNJA 4IVBA 1XBAA 5EDRA 4PDSA 2CPKE 3PA5A 1NW1A 3OT3A 3AC3A 5C01A 4PDPA 2GU8A 5KKRC 3LQ3A 4PL5A 2Y0AA 2OJGA 3K3JA 4G17A 4KNBA 2JAMA 1ZRZA 2ITZA 3KRLA 5BVEA 4KAOA 2QURA 3SRVA 2X0QA 3F3UA 5KMIA 4ERWA 4DHJA 3COHA 3D94A 4K2RA 4MKCA 3RK9A 3KF7A 3ZEPA 5AUVA 2VWWA 3CEKA 3E63A 4MWHA 4QMWA 5BYZA 2VWZA 1H07A 2BROA 1TQMA 2VO3A 2BZIB 3ZH8A 3R83A 1YOLA 2YIXA 3GT8A 5T68A 4I23A 3CGOA 3SV0A 2YISA 4FTAA 4NZWB 4DFBA 3QF9A 5AR4A 4DE4A 3A99A 3KIOC 1PXLA 4PL4A 3HP5A 4YP8A 4J52A 3QLFA 4V0GB 4BCGA 3MY1A 4MVFA 3O17A 3WE8A 2PULA 3F2RA 3SAYA 3EQIA 4B8MA 3FI4A 3NNVA 2VGOA 4M14A 3ZEWA 2OO8X 3OWKA 2EB2A 3OMVA 5CU3A 5M57A 3DOGA 2XKDA 5D11A 4ACGA 4TYHB 3ENHA 4CYJA 3LFAA 2IJMA 2YCFA 4UMQA 1FINA 2F7XE 1L8TA 1YHSA 3LAUA 4OBPA 3W18A 3R22A 3WIKA 1YDSE 2CNUA 2NRYA 3BWFA 2JFLA 2OXDA 3FMDA 4RPVA 4MNEA 4BIBA 4D4RA 4GT4A 4F99A 3FZTA 3R6XA 3MH3A 2XRWA 2QU6A 4O7ZA 3OEFX 4LV5A 3FAAA 5CVFA 4JAIA 4O0RA 2JGZA 2ITUA 1VYWA 2W96B 4WKQA 3ANRA 3FXXA 4A9TA 5AMNA 3A4PA 4BI1A 4O0TA 4BCKA 4HGEA 1YQJA 3Q4CA 2I0HA 4DHFA 3OG7A 4FIHA 4CRLA 5AP2A 5M08A 3D7TB 5AAGA 1WBTA 4WHZA 1Z57A 2WQNA 3EQCA 3Q6UA 5LWNA 1ND4A 4ZXTA 2ZV8A 3I0QA 3H3CA 3IW6A 1J7IA 4X6QC 5BYYA 5AIKA 5EYKA 4C38A 5AFVA 5IQBA 3ZYAA 2NPQA 3VIDA 1M52A 2XK9A 4KIKB 2QLUA 4DTBA 3HL7A 4FGRA 3F3TA 4YJSA 4FSWA 5JH6A 3JVSA 2YIRA 2Y4PA 3TJCA 2YM8A 1Z9XA 4KSQA 4QP7A 3RCDA 2UVXA 2NYAA 4FEVA 3FSFA 5CLPA 2I6LA 4QQTA 2BTSA 2BHEA 4U41A 3M11A 2WOTA 5CI6A 3NAXA 4FEQA 4AN3A 2PE2A 4YLKA 1OKZA 3IPHA 4QNAA 2FUMA 5J9LA 3QQGA 4IH8A 3IS5A 5E8WA 3OUNB 2HYYA 3HMPA 3PVUA 4C4JA 3P79A 1I44A 2QO7A 5HVKA 3IO7A 5I3OA 4JL9A 5CI7A 1GOLA 2X9EA 2J0MB 5FG8A 5LVLA 3TDVA 2H34A 3I6UA 2Z02A 2A0CX 4FSNA 4FX3A 2VTRA 3HEGA 4WUNA 5A14A 4BB4A 3UE4A 1UNHA 3GNIB 3LFSA 1YWRA 5FEDA 3AQVA 3T9TA 5JQ8A 5AUYA 2OF4A 2C3KA 2VTLA 3VBVA 3D0EA 2XNMA 3QZHA 5AM7A 4UMUA 1FVVA 3CS9A 5CXHA 3BHYA 5T6KA 4BYIA 3R63A 5BV3A 3NW7A 2GNLA 3C9WA 3E7OA 2QOHA 3OWPA 1IASA 4O4EA 4LOQA 4O91A 3EN6A 3AD6A 4HYUA 4J95A 4BCNA 3VBQA 3ZO3A 1XQZA 3T3UA 4BCHA 3C0GA 2PVYA 3E88A 4NFNA 2R3FA 4I0RA 1FMOE 3UZTA 3SW4A 4IZAA 4IM2A 4RGJA 3L1SA 4XHKB 3QFVA 4ALVA 2X7GA 4WSYA 3RPRA 3W2RA 4D2WA 4TNBA 4YR8A 4D55A 4ZTQA 4N57A 1O6YA 2FVDA 4FT0A 2C5NA 2W1EA 3OOGA 4I24A 4GK2A 2IVVA 4YTHA 1R1WA 4FR4A 2O5KA 5B0XA 1P4FA 2QHMA 4CZUA 2P4IA 3DS6A 4YUQA 3EYHA 4P5QA 4YJTA 4XG7A 1TZDA 2W1IA 4I4EA 3TZ9A 2BKZA 1ZMVA 4G6OA 4HPUE 3KL8A 1OECA 4S32A 3F5PA 4ZOGA 2J0IA 4ENXA 4FYOA 3EQPA 2P2HA 5CEMA 4LGDA 3EKKA 2OZAB 4YZDA 5CAVA 3QQFA 4CLJA 2QOBA 1J7LA 1YWVA 4PX6A 3S00A 3KFAA 1XH4A 2PVRA 2R3OA 1PRYA 3OTVA 4FGBA 4BDIA 4F0IA 5GHVA 3VW8A 4IADA 4LG4A 2YDIA 3BZ3A 3QZFA 4EZ3A 4O1PA 1F0QA 3VUDA 1PXIA 3Q4ZA 4F1TA 2FSLX 2C5YA 2RFNA 4AT3A 1AGWA 4HVGA 1KWPA 3SX9A 3Q32A 2XK3A 2Q0NA 3R73A 3Q3BA 3DLSA 4K9YA 3TM0A 3BCEA 4RFZA 4IM0A 4ZP5A 2JIUA 5BPYA 3KK9A 2PL0A 2PPQA 2QG7A 1JVPP 2XB7A 3EQHA 3QU0A 4X7QA 4DC2A 1WBPA 3THBA 2PWLA 4D9TA 3BYVA 1JKTA 5JFXA 3H9FA 3PSBA 4H3PA 3FC2A 3PWDA 4BI0A 4HGLA 5DWRA 3Q52A 5AX9A 2ZV7A 4IDTA 5TT7A 2PMOX 2ITXA 3VUIA 2PTKA 3MA3A 3VS1A 4AOJA 3FHRA 3PPJA 4L44A 4BKYA 2ZB0A 1CDKA 5ACKA 3U55A 3EJ1A 4AT4A 4AZTA 2O65A 5A4TA 2X6DA 3MYGA 1F5QA 1PYXA 2UZEA 3CXWA 4MWIA 4TY1A 3S4QA 2EB3A 3U51A 4E6DA 5IA4A 3ZSIA 5AV0A 5IZFA 5L8KA 2F2CB 3NZ0A 1L3RE 2F7EE 4Z7HA 5J9ZA 5D12A 2IZRA 2A1AB 4I5MA 2ZOQA 4J8MA 3OW3A 4QMOA 4A9SA 1H1SA 4NIFB 3HA6A 3LFFA 2IZUA 3R8LA 4YZMA 3UNJA 4BGGA 3NCZA 5BUJA 3HLLA 3CE3A 3QTZA 3LW0A 4ALUA 1PW2A 4AOTA 3AKKA 5IA1A 5J9YA 2PUIA 1APME 1H08A 2HENA 2XA4A 3UG2A 4C36A 2CN8A 4DBNA 3HAVA 1LUFA 5I9UA 4EH2A 3R2BA 1G8KA 4LV7A 3E93A 1T45A 2WZJA 2C6OA 2YCRA 3RM7A 2OIQA 4RQKA 4XV9A 5CASA 3REPA 5E91A 3R7EA 3ODZX 3PTGA 1OB3A 4BDAA 2QI8A 4AF3A 1J7UA 4BCMA 4BTKA 3I7BA 3TZMA 4AU8A 1VEBA 4Q2AA 3QXPA 4CEGA 3Q04A 4MXAA 4FI1A 3COIA 3E5AA 3ORTA 3HV5A 2ZMCA 3BHHA 4FKQA 4AGWA 2JDTA 3POOA 2GS7A 2G15A 2XYUA 3NIZA 4EWHA 3T3VA 4PMMA 3DCVA 4Q5HA 3DBFA 3K5UA 4U79A 1MRVA 4G3GA 1Q4LA 3RPYA 4NTTA 2X1NA 3WZDA 4CTCA 3LMHA 1WCCA 4BBFA 4PMPA 3S95A 4QYEA 2W4OA 4FNXA 2I0VA 1RJBA 3EFKA 3QLGA 2VWXA 3Q60A 4GEOA 5A4EA 5KMJA 3D7ZA 4YHTA 5HLPA 4O4BB 4E4LA 5HORA 4MTAA 3R9RA 4MX9A 2WTWA 4RZVA 5EYMA 5FEQA 5IQEA 4DEHA 1V0PA 5CAQA 2Z7QA 3GC0A 5EOLA 2HCKA 4ERKA 4LOPA 3NEWA 4ITIA 5J5TA 5JFWA 2PZRA 3V5WA 1R78A 3FC1X 4JDKA 4APPA 5A46A 1G8AA 1OZ1A 3M42A 4I20A 4AZWA 1KSWA 5DR2A 2JD5A 4EH6A 3RHKA 4FTQA 3F5GA 2C6LA 3ZO4A 5ICPA 1OL1A 3UO6A 1BYGA 2XM9A 2EVAA 3Q53A 4NUSA 4FV7A 4PF4A 4S34A 4EH9A 1JSTA 4ITJA 1Z5MA 5I9YA 3F5XA 2ZDTA 5CEPA 2R3LA 3KULA 3UP7A 2HZ0A 4Z7GA 2Q0BA 5GINE 1RDQE 3E8EA 1W2CA 2A27A 1J1CA 3ZSGA 3E64A 5C8KA 3QRKA 1PMNA 5E92A 5HCXA 3ZXTA 2OIBA 3QD0A 4QMZA 3BBWA 2JC6A 4U3YA 4FTTA 4E7WA 3BLAA 3RAKA 4EOPA 2GTMA 3ROYA 4X0MA 2PY3A 1Q24A 1YVJA 2J51A 2WFYA 4PTEA 4OBOA 2YIQA 2GS2A 4GH2A 3IW5A 4IFCA 5DVRA 4ZJJA 1W0XC 2IW9A 3KQ7A 4EH8A 3ATTA 4OTGA 2W1CA 4X3FA 4FKRA 4U42A 4N0SA 3PXFA 5HZNA 3I4BA 2WO6A 5AV3A 4AG8A 3UOKA 4ZSLA 2XKFA 4EH4A 4RWJA 4IJPA 5JFSA 4RSSA 1GZOA 3QC4A 4UXQA 4Y73A 1OVEA 3R7UA 1G8SA 3NUYA 2P3GX 3H0ZA 3H10A 3TT0A 4MXOA 4P2KA 4HZRA 3DK6A 4L3JA 4V0GA 3KRRA 4A9UA 2OBJA 3LMIA 4BCIA 3DAKA 2WEVA 3I60A 4FG8A 4FUYA 5KCVA 1IG1A 4JS8A 4RIOA 3ZDIA 5E8VA 4NL0A 4TYHA 4USDA 4ANBA 3W0OA 3VHKA 3KRJA 4DN5A 2NP8A 3TZ7A 2B9FA 5CEIA 4WG3A 2CGUA 4Y8DA 4F9WA 3FXWA 3G0FA 4QOXA 5CT0A 2BZJA 5EI6A 2P0CA 3NNUA 4R5YA 3QWKA 5JGDA 3PVBA 5KNJA 3R28A 3VRZA 2WQMA 4C3RA 4IAYA 2WMVA 3ZSHA 2QC6A 4O6EA 5EG3A 2QOKA 3RJCA 4X2KA 3TKHA 4D4YA 1OBDA 3MPMA 3FE3A 4I5CA 5J1WA 2PYWA 3GBZA 4Y5HA 3N4VA 3AC1A 5L2QA 5ANIA 3MB6A 2Y6OA 3V5LA 3MFUA 4JLCA 5IQFA 3WYYA 2C5OA 4AA4A 4DTKA 3KRXA 5BVDA 3P1AA 5AUZA 3EQRA 3LXKA 2QQ7A 3MWUA 3ORPA 4JX3A 4OW8A 2WTIA 4F1MA 4JT3A 3FLNC 4RC3A 3LCDA 1M2PA 4USFA 3V5QA 3O5AA 2C3LA 3HMNA 4DH1A 4C57A 4IXPA 3FY0A 4UV0A 4TWCA 3TEIA 4IAFA 2IVSA 1O6KA 4LRKA 3Q2JA 2GHGA 4C4FA 5FM2A 2IZSA 3AGMA 3MPAA 2A98A 4K33A 1KUTA 2W0JA 1Q99A 3ZFMA 3D5XA 4P7EA 4DG2E 3ZRMA 1BI7A 3ZUUA 1WZYA 3C4EA 3PZHA 2F4JA 4RWKA 4JDIA 4AWIA 2J90A 2VTQA 4IWQA 4PPAA 3S3IA 4DH7A 3MH2A 3LPBA 4BGHA 4E6CA 3QD3A 3TUDA 1QPCA 3WZKA 3TKIA 5HIBA 4ACMA 2JLDA 4FKVA 3BGZA 4JBOA 4RVTA 4YTCA 1NY3A 3HRBA 4Q9SA 4RVLA 4RVMA 4L53A 4TL0A 4O84A 2C0TA 4EOQA 3P7BA 2CLXA 5E7RA 3TNWA 3NVMB 3ZM4A 2QR7A 4XNEA 1W2DA 4TTHB 3BQCA 3TG1A 5K5NA 5I9WA 4F0FA 4MBIA 3GQLA 5AV2A 1WVWA 2OZOA 3FMKA 3GFWA 4NTSA 4AZFA 4D9UA 5C9CA 5BX0A 2PUNA 3F82A 5B7VA 5C03A 3NFFB 4XOZA 5C26A 3HZTA 3DKOA 4HZSA 4E4NA 3DJ6A 2JDRA 2W1FA 4D28A 4A7CA 4FODA 4XMOA 2ETRA 1ZYLA 3P23A 4JQ7A 4O7TA 2W06A 3Q5IA 4JIKA 3DXQA 4FNYA 1QMZA 1YOMA 4L68A 2HW7A 2WMUA 4HCUA 4R5SA 5BMMA 4EOLA 5C1QB 5AAFA 3SHEA 3P7AA 5CWZA 4ZSEA 3UOHA 4FF8A 4AGDA 3E92A 5HLNA 3DXPA 4I0SA 1YXVA 2VTOA 4EONA 2AQXA 1ST4A 5CVHA 3BYMA 1ZYCA 4F7JA 4OTRA 1E9HA 2QOFA 1IAHA 3EFLA 4O0WA 5HI2A 5CALA 2YZLA 2R7IA 4J1RA 5EK7A 5CEQA 2VWVA 3HAMA 1JKKA 3PYYA 4D0WA 5HE1A 3BEAA 3OEZA 3AOXA 2B9JA 5DRDA 4NK9A 3KXMA 4QP1A 5TKDA 4BDKA 2YM3A 3LOKA 3CJFA 2GQSA 5HBJA 2XF0A 5KBQA 2YA9A 3BGQA 5DNRA 4PPBA 1ZYJA 4K1BA 2W5HA 4L6QA 4XRJA 4FE2A 2EU9A 3W1FA 2ITYA 3I5ZA 3GCVA 2AC5A 3HV3A 3DT1A 3ZO1A 1OKVA 3WI6A 3L9NA 4I93A 2V22A 4D2PA 2XVDA 3EWHA 3LM0A 4YZNA 1NVSA 4EL9A 4ENYA 2VRXA 4L8MA 4Q9ZA 4YO4A 4DT8A 4BKZA 2XK6A 3P9JA 5JRSA 5CF6A 4IB5A 4U43A 2W05A 5CF8A 3C5IA 4YC3A 4R3RA 5CSVA 2C5XA 3MGYA 2R3KA 4EQMA 5LMBA 2XUUA 4QYFA 1JKSA 3PDTA 1OITA 3OXZA 3W0SA 1DAWA 3I0OA 5ANKA 5KX8A 3LVPA 3G0EA 4AZEA 1ZARA 2QO2A 4Y83A 4ASDA 2I0EA 2PZIA 1UWJA 2O3PA 4QTCA 3B8RA 4BRXA 3PRIA 4IIRA 3NW6A 2IZTA 3DQXA 3MH0A 2JBOA 2YCSA 3ATSA 3GCPA 4O6LA 3UMWA 4NWMA 3HRCA 5DA3A 3LFDA 5M4UA 1UNGA 3Q2MA 1IR3A 4D2TA 2WMAA 3FMJA 4JBQA 4ALWA 4B6LA 5L6OA 4IWOA 1V1KA 3BL9A 1Q8TA 1YI3A 4UX9A 5K5XA 5ETAA 3GFEA 3TTIA 4BDGA 3VS3A 2ONLC 2X0GA 3FMLA 4UALA 3O8UA 1ZYDA 3VONA 1JQHA 2WQEA 5HHWA 3QUDA 1G5SA 2WTJA 4C61A 3PVGA 2VAGA 4K6ZA 3SD0A 3SG9A 2OJ9A 3GU5A 1I09A 2XJ1A 4BIEA 4PRJA 3OROA 3VUKA 4WRGA 2UVZA 2X4ZA 5J1VA 3UDTA 1XBBA 3DFAA 3D9VA 4L7FA 5D10A 3Q4TA 4JAJA 4JR7A 4QO9A 4QP8A 2PVKA 2XNEA 4IB3A 4M84A 1JBPE 4PTGA 5CQUA 5DT3A 4EC8A 5H8EA 5TE0A 2UVYA 2JFMA 4RFYA 1OL5A 3ZBFA 5I9VA 4I1ZA 3ZRLA 1ZXEA 1UWHA 2XP2A 1WAKA 5DT0A 3QTSA 2WTVA 5ETIA 3NLBA 1OPJA 1GZ8A 3CPBA 4BICA 4O4FA 3MY5A 3D4QA 3CTQA 4YSJA 4CCBA 4GYGA 3NUAA 3FJQE 3OZ6A 3QAME 5BVKA 3TNPC 3ZLXA 2JDSA 3OY1A 1CMKE 5EM7A 4AS0A 1M2QA 2X4FA 4TYIA 4EK8A 3ANQA 4O2ZA 4OT5A 3G90X 4F9AA 3KN5A 3R8ZA 2OIDA 2BR1A 3FYKX 5CANA 3KU2A 2GTNA 2JBPA 2Q83A 3TUCA 5EHYA 5AEPA 4FKIA 1YXXA 1Q62A 5L8JA 3QCSA 4FICA 2C5VA 3SXRA 3F2AA 4EHVA 4AXAA 1XH5A 1Q61A 3RPVA 4AW0A 3KVWA 3CY2A 3TL8A 4NKSA 1G3NA 4OTWA 5KZIA 1T46A 1XR1A 3FI3A 4IAIA 1M2RA 2E2BA 3F3WA 1LR4A 4PMTA 4QMUA 2CKQA 2XM8A 4ID7A 3R7OA 4IM3A 3BLHA 3WF6A 3NW5A 4RMZA 4F64A 1FOTA 3O50A 1JPAA 3PJ8A 3DZQA 4FKTA 4TT7A 4YZBA 5DGZA 2QONA 1YHVA 1XWSA 3VJOA 4XBRA 2X2LA 4U5JA 3DJ7A 5EYCA 3R8UA 4YNOA 4BCJA 5BVOA 3GUBA 4G5JA