3OZ6A

Crystal structure of mapk from cryptosporidium parvum, cgd2_1960
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
378
structure length
343
Chain Sequence
DRHVLRKYELVKKIVWKSIDRRTGEVVAVKKIFDQNSTDAQRTFREIMILTELSGHENIVNLLNVLRADNDRDVYLVFDYMETDLHAVIRANILEPVHKQYVVYQLIKVIKYLHSGGLLHRDMKPSNILLNAECHVKVADFGLSRSFVNIRRVTNNIPLSINYVATRWYRAPEILLGSTKYTKGIDMWSLGCILGEILCGKPIFPGSSTMNQLERIIGVIDFPSNEDVESIQSPFAKTMIESLKEKVEKRDIFTKWKNLLLKINPKADCNEEALDLLDKLLQFNPNKRISANDALKHPFVSIFHNPNEEPNCDHIITIPHSIDDYRNLVYSEISRRKRELISN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1, serine/threonine protein
publication title Crystal structure of MapK from Cryptosporidium Parvum, cgd2_1960
rcsb
source organism Cryptosporidium parvum iowa ii
total genus 116
structure length 343
sequence length 378
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oz6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oz6A01
3E5AA 5KMIA 3MTFA 5AUVA 2GQRA 1Z57A 4F7LA 2W1ZA 5TKDA 4DBNA 4YU2A 3VBXA 4GKIA 4LOOA 4WT6A 3KU2A 4EI4A 3G9NA 4J1RA 3MI9A 3DK6A 2XK4A 1FQ1B 3DB8A 4DTKA 1XR1A 2VTOA 3FLNC 3Q2MA 3KEXA 4I23A 3QKKA 2BZKB 4O1OA 3BU6A 4FVQA 3ZLWA 3LJ1A 1WVYA 4NTTA 2P33A 5BX0A 2JIVA 5L6WL 4DE4A 3PXYA 5FTOA 4X2JA 4G3DA 5HBEA 5KCVA 4JDJA 4U7ZA 5J7BA 5AP6A 5ANOA 5AR8A 1WZYA 2R0IA 4JX3A 4DCAA 3B8QA 5CSPA 1J7LA 3P5KA 5CU2A 3RINA 4D4VA 5EW8A 3K3IA 4I5HA 3EQFA 4MXAA 5T68A 3ORNA 2OO8X 3F3VA 5BNJA 5AP5A 5IH5A 3RKBA 1AD5A 4KA3A 4EHEA 3NWWA 3RPVA 2I0VA 4FL3A 3WOWA 2HXQA 2C1AA 2OJ9A 3EFLA 3ZMMA 4YO4A 1TQIA 3E64A 4AOJA 3LFEA 2XCKA 5CYIA 3L8SA 3MA3A 3GCQA 1LP4A 4LM5A 3AT4A 4HVGA 4AOTA 2JEDA 4V0GA 4XS2A 4AW2A 1E9HA 1VZOA 2XJ2A 2QOOA 3RK7A 4QMSA 1OL1A 4G6OA 4JIKA 1NA7A 2BIKB 4CLJA 3C50A 5I4NA 3ZC6A 5J5SA 2C68A 2PVKA 2PUIA 1O6KA 4FUXA 5AA8A 3KMWA 3HGKA 4JBPA 1REJA 3H3CA 5KZIA 3NUXA 4Z9LA 3RHKA 3W18A 4JG6A 5IA3A 3DFCB 2PVJA 4RC2A 4TRLA 5CZIA 4I6BA 3Q5IA 5KNJA 4WNPA 3GVUA 3KQ7A 3ODZX 4UX9A 2CDZA 3D9VA 1PMNA 4O6EA 4CNHA 3MY1A 4QYFA 4FTRA 2XKEA 3DCVA 4BRXA 3FMKA 5I9UA 4GT4A 4TL0A 3S4QA 1Z5MA 3VS4A 1Q41A 5CWZA 3R6XA 1UU9A 3NNUA 1TKIA 2ETMA 2CCHA 2HZIA 2O65A 3CQWA 3D14A 3FQHA 5CU3A 3AT3A 5CQWA 5DE2A 3UZPA 3SRVB 3O17A 3EL7A 4IZ7A 3FHIA 4L01A 5BUEA 4CGAA 4L7FA 1ZZ2A 3FL4A 1UU7A 3SAYA 4XBRA 3MA6A 4WIHA 2Z02A 3TUCA 2P4IA 2W06A 3TZ7A 3HMPA 1Q97A 2X6DA 4YNOA 5DNRA 2QHMA 3GU4A 3SVVA 3E7VA 5CALA 2HZ0A 5M44A 3RM6A 2V62A 3I5ZA 2I6LA 2C6MA 5EW3A 2PMLX 3OVVA 4EH8A 5EOLA 2BALA 1JSVA 3P1AA 3PJ3A 3NCGA 4WRSA 4A4LA 4FKOA 3U8WA 4TNDA 5LWNA 3LIJA 4IVAA 5C27A 5CI7A 4R7IA 5HG8A 3QKMA 2JKMA 3BEGA 4TWCA 3UPXA 4IM3A 4IFGA 4MWIA 4CT2A 1OIRA 4V04A 3UMXA 2W1GA 4S32A 3OBGA 3ORKA 4J8NA 5FTQA 5GJDA 3ETAA 4RVTA 5DFPA 2VD5A 1LR4A 3LFSA 3VQUA 2H34A 5AR5A 5HTIA 5AUUA 4OAUC 4GUEA 4IAFA 3TG1A 2RF9A 2BRNA 1PXNA 4DEDA 5HVJA 2C3KA 3NVKI 4PNKA 3LXNA 2YIYA 5IUIA 5CASA 2VTRA 3C0IA 4IIRA 2HENA 4Y8DA 2CN5A 4M12A 5K0XA 2OIQA 4WUAA 3UG1A 3SHEA 1W84A 3UYSA 1FVVA 3DKGA 4FYOA 4HYUA 4C35A 4YHJA 4BHZA 4RX9A 4ALUA 4BKZA 1CKJA 2C5VA 5HGIA 3FZOA 4FL2A 1H00A 4E20A 3HA8A 3HV3A 3FL5A 4JAIA 5EI8A 1R3CA 2BILB 3OOMA 2BZIB 4FV2A 4LRKA 4Y73A 5FEEA 3PJ8A 4BDDA 4FK6A 4EOJA 5K5NA 1BLXA 2P2HA 3KA0A 1TVOA 3S00A 3R7GA 3FI2A 3OS3A 4NIFA 4IAYA 3REPA 2XUUA 3FZSA 3LVPA 4C58A 4CZYB 4FR4A 4O82A 4Y5HA 5M55A 3BYUA 2C69A 3I0QA 1QCFA 5CSWA 5IG1A 2Y4IB 3LMIA 4E6QA 5DT0A 5AV1A 3LCDA 4QYEA 5E8TA 3PXKA 3QLFA 3WYYA 1A48A 3EQIA 4GEOA 4GU6A 4PDPA 1R39A 2XEYA 5CS6A 4UXLA 2Q83A 4LGHA 3AGLA 3IK3A 3BYOA 3CD8A 4WG4A 3RCDA 3R2BA 3QZFA 4FTAA 3UIUA 4O7ZA 3HMIA 4O81A 4O0UA 4ASDA 5FUTA 2GNJA 1GNGA 2OSCA 4JBQA 3R8PA 3FI4A 3CY2A 1YI4A 4BZNA 5C4KA 4D0WA 3JPVA 5GJFA 4WKQA 2A2AA 3MWUA 2PK9A 4FZ7A 3TDWA 5JZJA 4EH4A 4BCKA 3D5VA 1JVPP 3UNJA 4CYIA 2DYLA 3W2QA 3HRBA 4USFA 2OZAA 4MXYA 3H0ZA 4WHZA 4DH8A 2GHMA 4WBBB 5CLPA 3PWYA 3R1NA 4MD9E 2YZAA 4EUUA 3BWJA 3ERKA 1CMKE 3OUKA 2W9ZB 3GI3A 4C4GA 4RJ3A 3NUUA 2X9EA 4FKSA 4BI0A 3U54A 1SM2A 2XMYA 3ZOSA 4E4NA 4IXPA 3KB7A 2B52A 5CEKA 4FE2A 4B6LA 3FJQE 4IB1A 3V51A 4OTQA 3UVRA 2ZM1A 2R3OA 3ROCA 5F9EA 1XH4A 4MBJA 2FYSA 2O5KA 1JNKA 3V5JA 3PRFA 4L3JA 4X3JA 3PY0A 4QYGA 1CM8A 1Y8YA 3QA8A 3QQUA 3S1HA 3CR0A 2W1HA 3D2IA 3R30A 4W8EA 4ZEGA 4A9SA 4AN9A 5IPJA 3QL8A 2OJGA 4NH1A 2YM7A 2VTLA 2VX0A 3LXLA 4Q5HA 4CRSA 4FSNA 4IWQA 1MRYA 5AAFA 2QOIA 3O7LD 1Y6AA 4D28A 1Y6BA 2PMIA 5HVKA 4OTRA 4A4XA 4AOIA 3POZA 3R9HA 2R3IA 1CSNA 4DA5A 3TACA 2JGZA 3W33A 2C4GA 4FZDB 4RMZA 4D4SA 4HGSA 3DBQA 3R02A 4AGDA 4YURA 4YPDA 4FZFB 4AWIA 4CXAA 3E92A 3PG3A 3RALA 4Z7HA 4YJOA 4BGHA 2ERZE 5CTPA 4IZYA 4BDGA 5HE0A 4EOIA 4FUYA 3THBA 5HORA 3GCVA 1ERKA 4FNYA 3VF8A 5A4EA 3AMBA 4DH1A 3LMHA 5BVDA 5DYJA 4WG3A 2H96A 3MIAA 5HD4A 4PTEA 4ZK5A 2XIRA 3SGCA 3FBVA 3QTWA 3ULZA 3UOHA 5JRSA 4QPSA 4EQUA 2R3JA 2Y9QA 5JN2A 5KMNA 5I9XA 3CSVA 3EN4A 5D11A 2IZSA 5CSHA 5D1JA 3VRYA 4CZUA 2B1PA 1O6LA 1J1BA 5J7HA 2WTJA 2PPQA 3VS1A 2BKZA 2J51A 2XJ0A 2B9JA 2JLDA 4YGAA 4IE9A 2WTKB 3OHTA 4IZ5A 4TY1A 2XF0A 2R9SA 3CS9A 4JXFA 3FPMA 2IVTA 3PLSA 4KBAA 3ZSHA 4BTFA 4F1TA 3HV4A 4RG0A 5JFXA 4FX3A 3NW5A 3FYKX 3FLQA 4Z55A 4OT6A 5LVMA 2PVNA 2VUWA 3QC4A 4FTCA 5IF1A 4XYFA 2ZMDA 4NTSA 3PA4A 3QAME 2XK6A 2I1MA 2ITTA 5L2IA 5HCXA 4K8AA 1JPAA 1PJKA 3GCPA 4DF3A 2PTKA 1YWVA 4YBKA 2UW3A 5DBXA 5IQBA 4OBOA 3RPRA 4QYYA 4DH7A 4X2NA 4FKLA 2WMSA 1WBNA 4MXXA 3WILA 4FSYA 3HX4A 3KN6A 3DQXA 4J96A 4RWJA 2YWPA 2XBAA 3KFAA 2WOUA 5LWMA 1BL7A 3CXWA 3R7OA 2F2CB 4A7CA 3DAKA 5KZ0A 3VQHA 4GK2A 2ONLC 2WTDA 4XOYA 4CMOA 5M51A 5AV2A 2HELA 3FUPA 4UZHA 4BDHA 2XNMA 4HW7A 3NSZA 3UO5A 3PJCA 3TUBA 2BAJA 3O7LB 4NCTA 1PXKA 4OTPA 4QMVA 3WF5A 1APME 2YM3A 4TYIA 4CFWA 4ZTMA 2JBPA 2Z60A 4M66A 2X6EA 3SXSA 4QOXA 3VN9A 4X7QA 5I5ZA 3R04A 4BY9E 4ZAUA 4PMSA 3DDPA 5FXQA 3VS3A 4FV8A 3ZH8A 5CT7A 2RG6A 2XNOA 3FLYA 3V6SA 4BWXA 5EQEA 3H0YA 3VULA 2XA4A 3VS0A 4CTCA 5K4IA 2QG5A 4GK3A 2YM4A 4FIHA 2V0DA 4MAOA 5CAPA 3MDYA 3EQPA 4JRVA 1FMOE 3IECA 4FG9A 4YJPA 4ZY6A 2E9OA 4LGGA 3W2OA 3F5XA 3MJ2A 5ANIA 3R9NA 4C4HA 4DFXE 4S33A 4D2PA 3O51A 3LQ5A 2F57A 4L46A 3QQLA 4K2RA 1FINA 4IEBA 3TZ9A 1NW1A 4USDA 2OWBA 2F9GA 5J1WA 3BLQA 3FDNA 3N51A 1XKKA 2C6EA 3TV4A 5HCYA 1OGUA 3DFAA 5LMKA 1L8TA 3LHJA 2XH5A 3HMNA 2HXLA 1B6CB 3BKBA 4XG8A 3P4KA 5FDPA 4EHZA 2UZOA 4F63A 4HVSA 5H2UA 3OF0A 1ZYCA 2OXYA 3ZLSA 4RIWB 4G6NA 4TKSA 3BHVA 4NUSA 3DJ6A 5DI1A 4M69B 3G15A 2HW7A 3QHWA 3JS2A 2VV9A 4J7BA 3MH1A 3QQHA 4HPTE 4DFNA 4RLKA 1UNLA 4YHTA 5AX9A 1UV5A 3V01A 5ANDA 1J91A 4C2WA 3QTRA 3RHXA 4WNMA 4IVDA 3KK9A 1RDQE 3TNWA 5EYCA 3NAXA 4CQGA 3U6IA 2WMTA 3E8EA 4TTHB 3WF9A 2UZUE 1F5QA 3ZM9A 2CHLA 3PDTA 2GNHA 4D2WA 3E62A 3ZDIA 4NWMA 2IVUA 2JITA 2WMVA 2UW0A 4RVKA 4BZDA 2CNUA 4JRNA 3U87A 3M11A 4M13A 5D9HA 1BUHA 3P08A 4XP2A 4C4EA 3VUDA 4HZSA 2XK9A 5LVPA 4RVMA 1FGKA 2QCSA 2G15A 4AACA 4RSSA 2IJMA 3TI1A 4MWHA 5IUGA 2VTJA 2GFCA 5ETAA 3TNIA 1U54B 3FKLA 5EHYA 3UPZA 4D2VA 4G5JA 3ZDUA 4D1XA 4O7NA 3A7IA 4XOZA 4KRCA 2W96B 4QO9A 4CMTA 5JFWA 3TZ8A 1SVHA 1OKYA 3TXOA 4C7TA 1ZZLA 3ZC5A 2PUNA 4PF4A 4JI9A 5DR9A 2GTNA 1JLUE 4EWQA 3GCUA 4G9RA 4O0RA 2PYWA 1Z9XA 2IN6A 4UYNA 4CYJA 3M1SA 3GU8A 4BCNA 5GZAA 2F4JA 1OIYA 5FP5A 3ULIA 3BELA 2OI4X 2OIBA 4RA5A 2R4BA 3MFSA 5CEPA 3L9LA 2BAQA 2BFXA 2Z7LA 3BIZA 4CZTA 4O7SA 2Y7JA 4FNXA 4WSQA 4EZ3A 1S9JA 4GK4A 5CAQA 3W16A 5HO7A 3SQQA 3NIZA 5HNIX 3IGOA 2CPKE 1HOWA 3BU3A 3PE1A 1GJOA 4PMMA 4QMUA 1JSUA 2BDFA 4TWPA 5TF9A 2AYPA 4IM0A 4LL5A 1IAJA 5M57A 1VYZA 3EWHA 2XIZA 5AP2A 1QL6A 4I0TA 3VNTA 3MY5A 2GCDA 2IVSA 2W5BA 4G17A 4GT5A 3WE4A 2R64A 3MB7A 4GFOA 4WNOA 4NM7A 2WGJA 3WE8A 4UEUA 4MXZA 4KBCA 4RIXB 4IQ6A 4AF3A 2JDRA 3PVUA 4G3GA 4MK0A 5A9UA 5CEOA 4O7VA 3WF6A 1UU3A 3KULB 2DS1A 5IA1A 2LGCA 4O0SA 1OBGA 2JKKA 1JBPE 5JGAA 2R3QA 3P86A 4O7RA 3CKWA 5BVEA 1OL6A 3DGKA 3FC1X 4NM0A 4AP7A 1Q4LA 4C4JA 5ANEA 4FTKA 2VNWA 4F6UA 2GS7A 3QCXA 4BKJA 1IRKA 4P2KA 3NUSA 5AR2A 4TNBA 2BRGA 2ZAZA 2E9PA 5LXMA 3LJ0A 3NMUF 4JJRA 2I7QA 5L2TA 3QF9A 3R0TA 4RC4A 2WXVA 4TN6A 3QGWA 3R63A 5ACKA 1DAYA 5M07A 1PXPA 4MBIA 4MNEB 3SC1A 2PVHA 4JG8A 3UZRA 1OPKA 3D5UA 5FP6A 2YIWA 4BICA 3ZRLA 3QQJA 1YXTA 2BDWA 2VWYA 4IAZA 4L42A 4LQMA 5DRBA 1ZMVA 1W7HA 3SOAA 2R5TA 3SRVA 2QG7A 3SW4A 4PV0A 1OVEA 3KGAA 4IAIA 2J4ZA 1P5EA 5FQDC 3EFKA 3DS6A 1Q3DA 4C57A 5M53A 3S3IA 1PY5A 1JKKA 3QQKA 2QO7A 4FTQA 2FB8A 4J71A 2CKEA 5EI6A 5IH4A 2B4SB 3D4QA 4GW8A 4R5YA 4MKCA 4XG9A 3DNEA 3LOKA 2NNWB 2IPXA 3MTLA 2Q0BA 2EU9A 3ZXZA 2UW6A 4PPBA 3ELJA 4ZJVA 2B0QA 3V8TA 3R8LA 2NRYA 3VO3A 1YOLA 4AUAA 4QTDA 4BCMA 4TWNA 3EJ1A 5GZ9A 2A0CX 5F95A 1O9UA 4YZMA 2G1TA 3A8XA 3KY2A 3O8UA 3VUMA 4EH9A 4F9CA 2GMXA 4BDIA 3NAYA 1FOTA 5AP7A 2G01A 1K9AA 5CSVA 5BMMA 3ALNA 3L8VA 2GHLA 4GMYA 3R01A 5EI2A 3HEGA 3L9NA 3A60A 4YJRA 5HVYA 3R1QA 4TZRA 4O22A 3S2PA 3SDJA 4RIYB 3QXPA 2F7XE 4I6HA 4CD0A 4D9UA 4FG8A 4F0GA 5CF6A 1H4LA 2AUHA 2WO6A 3MJ1A 4QP1A 5E92A 3EZVA 3Q32A 4GVAA 4OR5A 2W4KA 5L8LA 2C30A 3UNKA 3H9RA 5L6OA 3FI8A 1W98A 2BR1A 4KKHA 3QA0A 3Q4ZA 4EWHA 4YJTA 3DOGA 1ZARA 4FTNA 4OTDA 3RK9A 3WI6A 1AGWA 4GS6A 4ZJJA 3VC4A 4DEHA 5JRQA 3A8WA 5J79A 4BDAA 5J9YA 3GU7A 2OU7A 4O86A 4OTFA 3G0FA 3NYNA 3VVHA 4DYMA 3ZUVA 1UWJA 3IONA 3TKUA 3R7EA 1FPUA 2GNFA 2RG5A 5C26A 2VWIA 4ACGA 2XYUA 1Q8YA 1H1WA 4OGRA 4J8MA 4OBQA 5KKRC 2W1CA 3I81A 2JIIA 3E63A 4IX5A 3KXZA 3IW5A 4K1BA 2P3GX 4YJUA 4EH3A 4Y46A 5HNBA 4R1YA 4YO6A 1OBDA 3DZOA 3FZPA 2XBJA 1GIHA 2R3RA 5A3XA 4IZAA 4ZSJA 2YCRA 4GL9A 5HX8A 4XG6A 3HP5A 2B9HA 2UUEA 3P78A 3UP2A 2X1NA 1RJBA 2BRMA 3UODA 3GBZA 2IO6A 2KTYA 3UDBA 4AAAA 4F9BA 2QHNA 2HK5A 2XK8A 3SG9A 2JDOA 4FKIA 2X7GA 1S9IA 3RJCA 4F0IA 3BQRA 3CP9A 3QC9A 2YIQA 5H8GA 3GC0A 4FEQA 3T3VA 3LM0A 4CKJA 4KRDA 3ZCLA 5A54A 1KOBA 5DMZA 5IQGA 4YJVA 4R1VA 2W05A 2R3LA 2OKRA 3BX5A 3PTGA 3EMGA 4L53A 2YDKA 3GT8A 2XB7A 2Z7QA 1PRYA 3MYGA 3AG9A 3COHA 3QD0A 3K2LA 3IQ7A 4ZSAA 4ZY5A 2H6DA 3PYYA 4RVLA 2QC6A 3A99A 3C13A 5HESA 2VTSA 4JT3A 3VBVA 5KMLA 3ALOA 5FM3A 4RT7A 3RAIA 3G90X 4IM2A 4U3ZA 1Y57A 5EDRA 3AMYA 4HJOA 4BCGA 3R9RA 2YCFA 3UYTA 3ZONA 2WMBA 4EBWA 4EC9A 5ETFA 5ANJA 4DG0E 4J99A 5BVNA 1UNGA 2PZ5A 3OWKA 2ITZA 5BMSA 5M56A 2VO0A 3OCBA 4MD7E 3UOJA 3E7OA 4ZZMA 3P7CA 5HO6A 3E3BX 3FMLA 3A4OX 4EHGA 3HNGA 2X81A 4JX7A 4YUQA 1CKIA 5CU0A 5I9ZA 3DU8A 2XM8A 2YHVA 3DQWA 5DG5A 3EFJA 1E1VA 3QWKA 4F7JA 1ZY5A 2PVFA 4I20A 3KRLA 5A4CA 4ZMEA 4NCTC 3C4XA 3TNHA 5IQDA 2WMXA 5IMEA 5FWKK 5B0XA 1JKTA 4DTBA 4JDKA 3E8DA 3F6XA 1G8AA 2CLXA 2WOTA 1W83A 3C51A 3E93A 4FKWA 1H27A 5BUJA 4Z7GA 1GAGA 2XKDA 5IU2A 2CKQA 2IW6A 3LKMA 1ZYDA 3EIDA 3SKCA 4QQJA 5M06A 4KIQA 3MBLA 4DTAA 4EH5A 1P14A 1MRUA 4W9XA 1K3AA 2ITVA 2XK7A 4BTKA 5JFSA 4K33A 4RX8A 1UNHA 5D41A 2FSTX 4FEWA 3RVGA 3OEFX 3OXZA 5CT0A 4G3FA 3Q4TA 3Q9XA 4U5JA 4DG3E 2W1EA 3VJOA 2XM9A 1JOWB 3TN8A 4DGGA 3QQFA 1NVQA 2JDSA 2F7EE 4QPAA 3R7UA 4EOQA 5DIAA 1DI8A 5C9CA 5DT4A 5AUYA 3ZBFA 3HAVA 5IQIA 2BZHB 4A06A 2YCSA 4TYJA 3OW4A 2OFVA 3PIZA 4LV8A 4LV5A 5HEZA 3ZHPC 4DT9A 5GINE 3C0HA 5CVGA 3PXQA 3C4EA 3G6HA 5LMKC 5J9LA 3HP2A 3D5WA 2R3NA 4DT8A 4JR3A 4CG8A 1XBCA 4TWOA 4QP9A 1PF8A 4FIIA 5DR6A 4D2TA 4IX6A 5H3QA 2R3MA 1GZOA 3HYHA 4XV3A 5AX3A 2JDVA 2FSOX 2QOLA 2VTAA 5A46A 4FGRA 2AC5A 2YJRA 1MUOA 3OROA 2GNLA 2WFYA 3U4UA 3PWDA 5CAVA 4FTOA 4ZLYA 4FSUA 3F61A 4JAJA 4QNYA 5TOZA 5EFQA 3UIXA 1OL5A 3BU5A 4V05A 4YP8A 3PXZA 2R3HA 4DLIA 4DFYA 2VGPA 4IH8A 1UWHA 4BF2A 3D5XA 1IEPA 3QGYA 1QMZA 2QOCA 4QP8A 3FMEA 3K5VA 3NIEA 1U46A 3OWPA 5LVOA 4C33A 2XK3A 3WIKA 3ANRA 4B7TA 3EN9A 3LCTA 4FTLA 3TTIA 4RJ7A 3VRZA 4H3BA 3VUGA 4BGQA 4E4MA 4DLJA 4WRGA 4APPA 2P55A 2C5OA 4ASEA 4E6DA 4HVHA 3QKLA 3I7BA 2R3PA 2YABA 3AT2A 3HDNA 4H36A 4X3FB 3VBQA 4B8LA 4MEDA 2KULA 3FZTA 4I0RA 5C8NA 3U4WA 3EYHA 3II5A 4P5QA 3K5UA 4I4EA 3I5NA 3IDPA 5HNGA 1DAWA 2J0MB 3BHUA 3MFTA 4HGTA 4UWCA 4XP3A 4ZTNA 1M2QA 4TPTA 5JKGA 2WQBA 1CTPE 5J5TA 2ZMCA 5K0KA 1GZKA 4QMZA 1F0QA 4XG7A 2VRXA 2XZSA 3MPAA 3QRTA 5G6VA 4FG7A 4F9WA 3UQFA 3PIXA 4TW9A 4BWPA 4FK3A 4G9CA 4FIEA 3JUHA 1VJYA 2R3FA 3LE6A 4F99A 3IW8A 4K6ZA 4OTHA 4X6QC 1A06A 4XHKB 3TIYA 2Z7RA 3NVMB 1KE7A 1OM1A 2PL0A 4LRMA 4BCHA 5LVNA 2GPHA 2VX3A 3IO7A 3TKIA 5EG3A 3F69A 4RWIA 4K9YA 4LI5A 4NU1A 4RJ4A 2VZ6A 3HKOA 3UTOA 3KRWA 4EZ5A 3OXIA 5AP4A 4EJ7A 2ZDUA 2UVZA 2SRCA 2GSFA 2A27A 4O91A 4MQ1A 2CKPA 2XCHA 3S95A 4ANMA 1Q3WA 2YERA 3BRBA 4YJQA 3Q6UA 2HCKA 3UIBA 5LCJA 3DXNA 3MB6A 4IW0A 4PP7A 1BI8A 4WUNA 1ZYLA 4DEIA 4F7SA 4NSTA 3D0EA 4ENXA 3ZYAA 4U9AA 1BYGA 2PZRA 2O64A 4GG7A 1V1KA 2WTIA 3FV8A 2YAAA 4FTIA 1OKWA 3MIYA 1OKVA 4LG4A 4QP3A 4AZSA 3R9OA 3IW7A 4ZZOA 4ZTQA 4MBLA 4RIWA 3CGFA 2XNEA 3RK5A 1NT2A 2O3PA 4M69A 3U51A 2A19B 3Q53A 2C6KA 3PXFA 3W1FA 2C5NA 3W55A 4JL9A 5JT2A 3W2CA 5LOHA 3PJ2A 4BB4A 3S0OA 4FA2A 4FSZA 1KE6A 4UY9A 2C6IA 3KRRA 4G31A 4OT5A 2HYYA 3OWLA 5AUTA 1H25A 4C61A 3ENHA 3P9JA 4BBEA 5HX6A 2GQGA 4FOCA 1OI9A 4JQ8A 4KWPA 3PP1A 4PMTA 4I92A 5CF8A 3EL8A 4IWOA 5HO8A 3F3UA 2PUPA 5IKWA 2RFEA 4FNWA 1IA9A 1FMKA 3DDQA 2X4ZA 3W2SA 4BCOA 4UN0C 3R8VA 3R22A 1T45A 4R6VA 5B2MA 4IB5A 1ATPE 3FMHA 3P0MA 3R83A 2QOKA 1XJDA 2ZM3A 2WKMA 2IVVA 4AFJA 3QHRA 2QOHA 2ITOA 4NKAA 3A2CA 3KRXA 2UZLA 4MF1A 1U54A 5ITAA 5K5XA 1ZXEA 4G3CA 3CEKA 4AZTA 1JWHA 3COKA 4D9TA 5EM8A 3ACKA 3QRUA 2E9UA 4U81A 4I6QA 4ZS0A 4FYNA 5FBNC 4FSTA 1SNXA 4FT5A 3RZFA 3V04A 2J0KA 3WF7A 2G2IA 2DWBA 3ZO3A 5HKMA 2OXXA 4PDSA 3UMWA 2R3KA 4W4YA 4ZIMA 1WVXA 1X8BA 4EONA 4FV0A 3PXRA 4W4XA 4YTHA 4MHAA 3VBYA 4ZMFA 3MW1A 1H0WA 4G34A 1ZYJA 3GNIB 4FODA 3TNQB 2YN8A 4ORKA 3AC8A 3U9NA 1YHVA 3I7CA 4C38A 5IEXA 2VTMA 3NW7A 1Q62A 3KXHA 5DVRA 2X8DA 4USEA 3KK8A 2OZOA 3FQEA 3HA6A 4HVDA 4C62A 4OAVB 3A61A 3BV3A 2YCQA 4FV1A 5H8BA 4ERWA 1RW8A 1JSTA 4MVFA 3D2KA 4BCIA 4F6SA 2CCIA 2JFMA 4CVAA 4DGOA 1OL2A 4R7HA 5CY3A 3R7VA 3WBLA 4KAOA 4FT0A 4BN1A 3ZLXA 2G2FA 4CFVA 5AUWA 3D83A 1WAKA 2QR7A 4R5SA 3SD0A 3UVPA 2OF4A 3HL7A 4DBXA 4P90A 2EUFB 4RFMA 3W8QA 4RIXA 3SW7A 4LMNA 2YACA 3UO4A 4E26A 3PIYA 4X21A 3KULA 3NNXA 3QTXA 3C0GA 3D15A 2WQOA 4JLCA 4UMUA 4YSMA 3UBDA 4GVJA 2E2BA 4D2RA 3GC9A 5BVOA 1GIJA 2I40A 3FAAA 2GQSA 2UVYA 3RZBA 4S30A 3D94A 3FMJA 4FIJA 5M4IA 2CGUA 2QLQA 3F3ZA 3Q9YA 3ZS5A 3G9LX 3I0OA 4WD5A 3RP9A 3FYJX 4QP2A 1XBAA 3NUNA 4F4PA 4IBMA 4G16A 3LCKA 5EHLA 4HCUA 1WVWA 1W82A 4I0SA 3AC5A 3DKCA 2PVLA 2HY81 3O0GA 4P5ZA 4V01A 4MNEA 4C36A 4E5AX 1YDRE 4RFYA 4EQMA 3CIKA 5EHOA 3ROYA 4DFZE 5TO8A 5JK3A 3T9IA 2EWAA 3VIDA 5F4NA 1TQMA 2C0TA 4GIHA 4PL4A 3ODYX 4FEVA 4E6AA 3I1AA 4B8MA 4JBVA 3Q6WA 3COMA 3ZTXA 4AZWA 4DHFA 5A6OA 4U8ZA 3R28A 4PTGA 2NP8A 4DFLA 4UV0A 1OECA 3EN7A 4DITA 4NZWB 4QT1A 4DG2E 1M7NA 5HD7A 4BBFA 3TDVA 4XMOA 2REIA 4AW1A 2IZTA 3B8RA 4C34A 3BE2A 3R71A 2O8YA 4U43A 1M14A 5CAUA 4TYGA 3WZEA 1YI6A 3VS6A 4BIEA 2Y6OA 4CRLA 3QX2A 4FSQA 3NR9A 3TT0A 1NVRA 5IQAA 1SMHA 4UWYA 2UW9A 4YLKA 4QMLA 1IA8A 3CPBA 3FEGA 1J1CA 4RWLA 4N6YA 5F94A 5CEQA 5CU6A 3IG7A 4EOKA 4RC3A 3GCSA 4FV9A 4B99A 4C3PA 1ZLTA 3BI6A 4D55A 4O7YA 5I9WA 3EN5A 3DT1A 4CKIA 4IAAA 3ZO1A 2QOFA 4RIYA 4RRVA 1Q8UA 2C0IA 3AC4A 4I41A 4E5WA 4I1ZA 4CFMA 3IW4A 2ITXA 4KS8A 4AZVA 3KREA 2GNGA 5L2SA 4HCTA 4AFEA 4E7WA 2QLUA 3NNVA 4XH6A 5EM7A 5H8EA 4KNBA 4N57A 3OFMA 2F7ZE 3GU6A 3FY2A 2JC6A 1YOMA 4N6ZA 4I24A 3DXQA 3LLTA 4R78A 4EOSA 5CU4A 5E8YA 4FKGA 3KN5A 4AT3A 2OGVA 3A7FA 1R78A 5DR2A 4DH5A 3LQ3A 2LAVA 3QD2B 4UMPA 3JY0A 3ZRKA 5TR6A 4L00A 1V0OA 2BDJA 1Q99A 5JMSA 2R7IA 3FLWA 2BTRA 4GFMA 4M14A 3K3JA 4IHPA 5JSMA 2ZM4A 3RWPA 3QU0A 1DI9A 3FZ1A 4KBKA 4O0YA 4M0ZA 3MH3A 3JVSA 3RM7A 3O8PA 4QYHA 4FTTA 4E6CA 4M0YA 4F9YA 2JAVA 4YZCA 2CSNA 4FI1A 4A9UA 4KIKB 4PNIA 3LPBA 3ACJA 3QYZA 2BHHA 5BYZA 5ACBC 1KSWA 3BLRA 2FA2A 3VHKA 3GC7A 3KL8A 5FXRA 5K3YA 1FBNA 2OH4A 2HW6A 3FY0A 4ANSA 2X9FA 2OK1A 3JYAA 3BLHA 5FTGA 3N4VA 4OTIA 4FEXA 4XV2A 5LARA 4XLVA 3F3WA 5JEBA 3PFQA 4IC7A 2I0YA 4FZAB 4AU8A 5J9ZA 4FIFA 2YLFA 3RPSA 4YR8A 4QTEA 5EYKA 3MS9A 2ZV7A 3ZFMA 2YM5A 3VS5A 5HTCA 2C6OA 3UG2A 4DCEA 1IAHA 3LW0A 4KUJA 2WHBA 3AOXA 2ZYBA 3OXTA 5EK7A 3I60A 3R00A 4K77A 2J5FA 3DV3A 4ZXTA 4CFUA 1XH8A 2WTKC 4GCJA 3POOA 4EH6A 4O0XA 5IA5A 4P4CA 4O7TA 2WMQA 2FUMA 3F2AA 3IDCA 5E8XA 4F64A 3EKNA 2QU5A 4QTAA 3BE9A 3AMAA 1SZMA 2NRUA 5B2LA 4OBPA 1OZ1A 3MVHA 1BX6A 4PY1A 3T9TA 4ZTSA 1MQBA 4BI1A 4BDFA 4K11A 5AUZA 3G5DA 4EK8A 3TL8A 4B9DA 5HQ0A 2YM8A 4CG9A 5CAOA 4FKTA 3WF8A 2XNNA 3GU5A 5I3RA 4K18A 5DT3A 3DTWA 3EQHA 4NW6A 3R7YA 4ANQA 4O6LA 1G5SA 4YJNA 3ORIA 4YZ9A 4YZNA 4F1OA 3KXNA 3PP0A 2X2LA 5HCZA 4H05A 3U55A 3RNYA 3D7TB 4LUDA 5L6PA 2WU7A 3EB0A 4AGCA 2W5HA 5KE0A 5IZFA 2FVDA 2Y8OA 4OLIA 5JFVA 1UU8A 3PSCA 3U6HA 4RA4A 2EXCX 3TZMA 5HLWA 5JQ8A 4FMQA 3EKKA 2YDIA 4IB3A 4CLIA 3EQBA 4XG3A 3OG7A 5HIBA 3EZRA 3MH0A 5CEIA 2BUJA 3F9NA 3DNDA 4Y72A 3ZU7A 1H0VA 1TQPA 4JDHA 4O21A 3V3VA 4ONAA 3FKOA 4CCUA 4E93A 2J5EA 2HIWA 3RWQA 1PKDA 4QP6A 3HRCA 5JH6A 3LFQA 3BHTA 2QKRA 3KF4A 5AAEA 4MCVA 4YTFA 2B9IA 1PYEA 3LFBA 2YIXA 4ZOGA 3DY7A 1M17A 5AP1A 1W8CA 1T46A 1QPDA 3CJFA 2GHGA 3HV6A 5AM7A 5HLNA 4NW5A 4PMPA 5BVFA 4Y85A 1UKIA 1M52A 4J52A 4EC8A 3ID6C 4D1ZA 3NYOA 2C3JA 5KMJA 5TT7A 5E4HA 3Q9ZA 4I5MA 2PMOX 3ORXA 5TE0A 2G2HA 1J3HA 3VF9A 4DFBA 3O2MA 1PW2A 1XWSA 4HOKA 4BVUA 5LMBA 5I3OA 2QOQA 4TYHB 3VUIA 4C3FA 3C4ZA 3VS2A 4U40A 4J98A 4D5HA 4ZSEA 2HY0A 5CENA 3MFRA 2IW9A 4N4SA 1Q24A 2VTQA 5AV0A 1P4OA 5FD2A 2QQ7A 4FKPA 3SLSA 5KBQA 4BDBA 3NYXA 3NUPA 1ZRZA 2VTHA 4YZBA 4EOOA 4FSWA 4MH7A 2RGPA 5KHWA 4ZTLA 4BCJA 3HMOA 2BIYA 4FTMA 4U42A 1STCE 3U6JA 2UW4A 4FOBA 4NT4A 2YEXA 4FV6A 4RZWA 2VO7A 3O50A 2QU6A 3ZZEA 4FIGA 3E88A 4RWKA 3ATSA 4GKHA 4HGLA 5J8IA 1WBVA 5EQPA 4U80A 2C3LA 1H08A 2O2UA 3G51A 3ZM4A 4YMJA 2OLCA 4C3RA 3BV2A 4XX9A 3PZHA 3LXKA 4DEGA 2B53A 1J7IA 4OW8A 2R7BA 3KXXA 4U3YA 4X3FA 2BRHA 5EDQA 4QQ5A 4XRLA 5IQHA 2V7OA 4QNAA 4BCQA 4DEBA 3PA3A 1WCCA 5M4FA 1OIQA 2PZYA 4YLLA 1KE8A 2J9MA 5AIKA 3SV0A 1PKGA 3OD6X 2NPQA 5CX9A 3RMFA 4DH3A 4EH7A 3KC3A 3P7AA 3OTVA 3P7BA 3MVJA 2C5YA 3O71A 2UZBA 2JD5A 4NKSA 4OTGA 4XG2A 4IX3A 5BUIA 3WARA 5JGDA 3QALE 4U97A 1NXKA 4A9TA 4BI2A 5HHWA 3ORZA 4DFUA 4EORA 4QRCA 5LCKA 2XIKA 4D4YA 2W5AA 3DPKA 2XNPA 3OC1A 3OOGA 5EKNA 2VTPA 4IVCA 4U44A 3GB2A 4YNEA 1R0PA 3B2TA 2QODA 4YTCA 5C8MA 3F7WA 3PJ1A 5DA3A 4EL9A 2CNQA 3ORMA 1H1RA 4S31A 4CFNA 1HCKA 4ALWA 4EEVA 3U9CA 4EK3A 4HNIA 4D5KA 4JNWA 1FVTA 4X2GA 5G1XA 5GJGA 2A4LA 2BFYA 5FG8A 4ASXA 4FBXA 2WIPA 4GIIA 3C5UA 3F7ZA 1H1SA 3KVWA 2PE0A 3Q52A 1ZMUA 3PG1A 1ZOGA 3CC6A 3PRIA 1CKPA 2CGWA 4A9RA 3UNZA 2CJMA 4X0MA 2ZDTA 1Q8WA 4I21A 4Q2AA 5I9YA 1PYXA 1Y91A 4W4VA 1QPJA 2WEIA 3TV6A 4B4LA 4JG7A 4D1SA 2RFSA 3TCPA 1PMEA 4HNFA 5A6NA 1XHAA 1JKSA 3OZ6A 3R8ZA 3VWAA 4CTBA 3FXXA 4BGGA 2CN8A 4ITIA 1ZYSA 4F08A 2A1AB 3MSSA 4C37A 1JAMA 4IWPA 2W0JA 4PDYA 4M97A 3GP0A 2UW5A 4R3PA 4BDJA 5IQCA 4CEGA 2YDJA 5CQUA 1LEWA 4R3CA 2IWIA 4QMNA 3TEIA 2QD9A 3F5PA 5HIDA 4QMYA 5M09A 1SVGA 4NFMA 3V6RA 4IACA 4N0SA 2QI8A 4CFXA 2UZEA 4I3ZA 3A4PA 4XJ0A 2XS0A 5EYMA 3RAKA 3V8WA 1WBOA 4LRJA 5HE2A 5L3AA 4YZDA 4NM3A 3VUTA 3ORTA 5GIPE 3FXZA 3G6GA 4C2VA 3G33A 3BCEA 4IDTA 4AN3A 4U6RA 2YJSA 4MTAA 1H07A 3OY1A 3ORPA 3IOKA 3OEZA 5DHJA 5GIOE 3PSDA 3WIGA 4BFMA 5HI2A 5HBJA 1YHWA 4TYEA 5BVWA 4F6WA 4Y83A 4CSVA 2J50A 3WZKA 3ZUTA 4E8AA 5HG5A 5E8VA 5IISA 5A14A 1Q8TA 3RCJA 2OICA 5I9VA 5KMOA 2FH9A 4PL3A 5IMXA 2X2MA 5A4LA 2HOGA 3I4BA 4LOQA 4U41A 4E5BA 4BIDA 5E91A 3EN6A 3UC3A 4BWKA 1JKLA 4BTJA 4EUTA 3RGFA 4L7SA 4ZSLA 3ZO2A 5CVHA 5BVKA 3ZZWA 5BYLA 3TIZA 4UZDA 2H9VA 1U4DA 4KKGA 2J0JA 2RKUA 2O63A 4AE6A 4AE9A 4E3CA 4IVBA 2BAKA 2E9VA 2GS6A 2ZJWA 3FHRA 2VTTA 3FC2A 4DAWA 5IDNA 4YC8A 2OH0E 3C7QA 2PUUA 3KMMA 4ZS4A 4BYIA 3BYVA 2EB2A 4RZVA 4E1ZA 1OUKA 2GNIA 4IAKA 4ACCA 4CQEA 3ANQA 3W8LA 4IWDA 2PHKA 3N4TA 4H39A 1CDKA 4PTCA 2FO0A 5HBHA 1XQZA 4H3PA 3P23A 4IANA 4QMMA 3KVXA 4EOMA 1NVSA 4ID7A 3TM0A 4W8DA 5A4QA 2F2UA 5H9BA 3CTHA 1SYKA 2CMWA 4UMRA 4AN2A 2JFLA 5CNOA 3PY1A 2BZJA 3MPTA 4FTJA 5HICA 5LMAA 3V5PA 2OG8A 3GC8A 2PULA 2GU8A 3QTIA 3QXOA 3QUDA 5AUXA 5ICPA 3VBTA 2IZUA 4L8MA 5AP3A 3GGFA 4JBOA 2IZRA 1Q61A 3C5IA 5CVFA 3H10A 5JGBA 1OPJA 3JVRA 3N4UA 4IC8A 4BIBA 2C1BA 4RJ8A 4GRBA 2O0UA 3QTUA 4GJ3A 1K2PA 2X8IA 4WOVA 1U5RA 3QTSA 4JQEA 3RPYA 3BGQA 3FKNA 2RL5A 4TT7A 1WMKA 4BKYA 1QPEA 4J95A 2YM6A 2VX1A 1GIIA 1IASA 4LYNA 2OIDA 5IEYA 2W1IA 1AQ1A 4GFGA 5GNKA 3RNIA 2WMAA 5C4LA 4QQTA 2ITYA 3Q2JA 1IG1A 4C4IA 2JKOA 3AGMA 3O23A 4UMTA 4ARKA 2Z2WA 4L3PA 4B0GA 4KSPA 3HDMA 3QX4A 4GYGA 2WELA 4PPAA 2ZB0A 3BGZA 1XH6A 2FSMX 2PSQA 2R3GA 2RSVA 3BGPA 3E87A 3OCGA 1YXUA 2JAMA 4RLLA 3W10A 3TJCA 4CMUA 2Y6MA 4AGUA 3E8NA 1YXSA 4O0TA 5GHVA 1ZWSA 4O7LA 3ATTA 2BCJA 5DN3A 4XP0A 3NNWA 3EYGA 3UP7A 4KKEA 4WBOA 2C6LA 4E4LA 3IS5A 4AW0A 4ANOA 2EXEA 2VWZA 2J6MA 2JIUA 4ZSGA 5CEMA 3AC2A 1WBPA 2XKCA 3PLAE 3Q4UA 3CKXA 3OBJA 5C03A 5T3QA 3QZIA 4S34A 5BYYA 5C01A 3QUEA 4Q9ZA 2X4FA 2XRWA 2ZB1A 4BDEA 5L8JA 4FSRA 4Z16A 3IW6A 5AM6A 4FEUA 2J2IB 4O96A 5KMMA 4APCA 4JOAA 3C4FA 3O96A 3F3TA 2VTIA 4IB0A 5AR4A 2ITUA 3ZUUA 2ITWA 4EZ7A 4AS0A 2IG7A 3CQEA 5FXSA 3W32A 5IQFA 2XRUA 2CLQA 4R8QA 3Q04A 5J1VA 1OIUA 4G2FA 5IUHA 2P0CA 1KUTA 2VU3A 4DGMA 2ITNA 3HV5A 3DAJA 4FKUA 1H26A 5E8UA 1KE9A 3EQGA 2RFNA 5HG7A 2UZDA 3QD3A 2PE2A 4FZ6A 3DAEA 2YIRA 3EOCA 1F3MC 4C02A 3R21A 4BC6A 2AC3A 4HYIA 3QWJA 2YFXA 3GXLA 4FV4A 4Y5QA 3BWFA 4I5PA 4KS7A 4EKKA 3C4WA 2UV2A 2ZOQA 1V0BA 5EKOA 1UVRA 2XEZA 5CNNA 1LEZA 1G8SA 3LFCA 3QTQA 2BVAA 5EM5A 4NM5A 4EBVA 5E9EA 4WG5A 5HU9A 3CQUA 5LQFA 4D2SA 3I79A 4KIKA 3FSKA 4WO5A 4EKLA 2OJIA 2UZNA 4PPCA 4EH2A 2WIHA 3PVGA 2X0GA 2VWXA 2ZV9A 1KV2A 3NZ0A 4L44A 4ZTHA 3PE2A 1V0PA 5HU3A 2W17A 3CPCA 1ZOHA 5EOBA 5KUPA 4ASZA 4MX9A 2XKFA 5AEPA 3TUDA 2QNJA 5KHXA 3FSFA 3KXMA 4RFZA 4O27B 1YXVA 2YWVA 4JR7A 5E7RA 4YTIA 4O84A 2VWVA 4BL1A 4L45A 5FEQA 4FT9A 3ZSGA 3JY9A 3UE4A 3MGYA 3LFAA 4ZTRA 1M2PA 3LZBA 4BBMA 3DLZA 2I0HA 3AQVA 4PL5A 4YHFA 1XBBA 1YQJA 1REKA 4BHNA 4RGJA 4UB7A 3RPOA 1VEBA 2W9FB 3QRJA 3UIMA 3MV5A 3TWJA 4AG8A 4HZRA 1PMVA 3LAUA 4RX7A 3NDMA 2BHEA 3QQGA 4RJ6A 5L8KA 3GUBA 2CNVA 4NL0A 2I0EA 2OJJA 2QURA 3C4CA 3Q96A 4IDVA 4ZP5A 5IQEA 2C47A 4BCPA 4F65A 4R7BA 1OUYA 2JKQA 4H3QA 4C8BA 2WTCA 3QZGA 4IJ9A 5JQ5A 5KX8A 2ACXA 1SNUA 3M42A 4C4FA 5IDPA 5DLSA 3F82A 3AXWA 5F1ZA 4QMWA 1ND4A 1YVJA 4HPUE 5DRDA 1ZMWA 4H58A 1I44A 1H28A 2J7TA 4X2KA 3CCNA 2XNGA 2WQNA 4YC3A 4QP7A 4U45A 4YPSA 4AA4A 4LGDA 5FDXA 5EH0A 3RI1A 2BKKA 4O0WA 4K0YA 4YBJA 5E8SA 3V8SA 1G3NA 2WTWA 3D7TA 2EVAA 4M68A 4X3FC 1I09A 4XG4A 3HRFA 4MF0A 5DOSA 5IEVA 3F2NA 4PQNA 3BPRA 3SXRA 2B7AA 2OFUA 4XEYA 4V0GB 3LFNA 2V22A 4L3LA 4L52A 4UALA 4FVRA 3DXPA 3ENMA 3QTZA 3QYWA 1YOJA 3KCKA 4CT1A 2H8HA 4U79A 4HYHA 2JDTA 3P79A 4FKVA 2EB3A 1L3RE 4XUFA 5IA4A 3FMNA 4GG5A 4F0FA 4KD1A 1VYWA 4AT4A 1ZOEA 4KIPA 3OUNB 4NJDA 1LPUA 2NO3A 4DGNA 4JQ7A 4KINA 1VR2A 2YISA 4O0VA 1YW2A 4IJPA 4PDOA 4ZLZA 4FTUA 2GTMA 2QVSE 4AA5A 2WQEA 4I22A 4PUZA 1XH9A 5M08A 1XH7A 3UOKA 5KO1A 4MD8E 4LFIA 3NCZA 2W4OA 2Z7SA 5AIRA 3Q4CA 1SVEA 2X8EA 3PZEA 2C6TA 4D0XA 4MNFA 4ENYA 4X2FA 2Y4IC 3DTCA 3CTQA 3FXWA 3OTUA 2YAKA 4M67A 5HLPA 3NRMA 2PVMA 4FVPA 2V55A 3VAPA 1J7UA 3FQSA 2DUVA 4PRJA 4QPMA 4F1MA 3OY3A 4W4WA 3QRIA 1KE5A 3SOCA 4N70A 5CF5A 3BEAA 1WBWA 2GDOA 3NX8A 4BR3A 3PVWA 3TV7A 4NEUA 4TYHA 2VWWA 2P2IA 3QZHA 4BTMA 4AX8A 3F2RA 1PXIA 2WD1A 4QMPA 5IA0A 1H1PA 2RFDA 4GT3A 4XCUA 5DEWA 3MFUA 4IMYA 2IW8A 3AC3A 3OT3A 4UBAA 5I0BA 1YWNA 4II5A 3TJDA 1GZNA 4U0IA 3DKFA 5BQ0A 2XIXA 4TXCA 3CTJA 4O7WA 3V5QA 2W1DA 5FM2A 3VJNA 4A4OA 1YDSE 3K54A 4FV7A 2PY3A 3H9OA 3LCSA 3MN3A 3R1SA 4UMQA 3CD3A 4FC0A 4CCBA 3BHHA 5DPVA 3MVMA 3RTPA 2GFSA 2J90A 1KOAA 3CBLA 4FT3A 5HIEA 3L9PA 4DC2A 2OW3A 3HMMA 3SA0A 2W1FA 4UYAA 5AR3A 4MXCA 1PXLA 3FLSA 3DBCA 3CJGA 4M3QA 3NPCA 4G6LA 5T6KA 5BPYA 5M4UA 3UZTA 2C3IB 1RE8A 2HWOA 3RBWA 4FV3A 4ZLOA 2Y0AA 2W4JA 4XRJA 3Q5ZA 4Q5EA 2VGOA 3DA6A 5DEYA 5C1QB 4DN5A 3I6WA 4OTWA 4QMOA 4S2ZA 3V5TA 2X2KA 2VTNA 3M2WA 4ANLA 4ITHA 4Y95A 3FWQA 4O38A 5ETIA 3NEWA 4X6RA 3AD5A 1GY3A 3TKHA 2JBOA 3CGOA 4PP9A 3I6UA 4KSQA 4EOPA 4CV8A 4HVIA 5CXZA 4NIFB 3A7HA 3VS7A 1YRPA 3V5LA 2WTVA 4XLIA 2X39A 2XIYA 3HVCA 3W2RA 2OF2A 5AAGA 3D7ZA 4P7EA 5HTBA 2ITQA 4UXQA 1M2RA 1W0XC 2XJ1A 3PUPA 5FGKA 3KKVA 3QUPA 3GOPA 4FF8A 4JIAA 1KWPA 1U59A 3DK7A 1PXMA 1FGIA 5HE1A 2Q0NA 3OWJA 4FV5A 5EDPA 1R1WA 4RPVA 3NLBA 2WEVA 4ACHA 5B7VA 4W9WA 5HZNA 3QFVA 4C59A 4AA0A 2BRBA 3KRJA 3AC1A 3LFFA 5JZNA 4Z3VA 5AA9A 3HAMA 3H4JA 3IPHA 3DB6A 2HAKA 2QOBA 4EOLA 3L9MA 2WMUA 3PPJA 2CKOA 3Q9WA 4G3EA 4GJ2A 5M4CA 4C0TA 3L1SA 4LL0A 3UC4A 4ALVA 4AXAA 5EM6A 3ZBXA 1KV1A 2OXDA 4O2ZA 3WZJA 3ZO4A 2CGXA 4GYIA 4QMXA 5EQYA 2ETRA 3OCSA 3MESA 3W2PA 1WFCA 5D12A 4HGEA 4LUEA 5E8WA 4JDIA 5AR7A 3ZFXA 5E1EA 2OZAB 5E1SA 3NW6A 2PVRA 3ZSIA 4J97A 3ZLYA 3WZUA 4D58A 4XNEA 5AWMA 4Q9SA 2VNYA 5J87A 3QBNA 2ZV2A 2PU8A 3O8TA 1ZAOA 3VUKA 3WZDA 4FNZA 3FMDA 3SX9A 2BMCA 2WU6A 3PA5A 4RIOA 5ETCA 5J95A 4RJ5A 5CZHA 4MQ2A 2QR8A 5E90A 1BI7A 3PSBA 1MP8A 2OBJA 4OUCA 2OJFE 3H9FA 4YC6A 2B9FA 2Z8CA 1R0EA 2RIOA 1WBTA 3OP5A 3LLAA 1QPCA 2ERKA 1PMUA 2UVXA 2UZWE 3DJ5A 3E8CA 3ORLA 4CFFA 3QCYA 2FSLX 3GENA 5CI6A 3LJ2A 4YJSA 1A9UA 1XH5A 1PXJA 3BYSA 4FKJA 2V7AA 2B55A 4ITJA 3TTJA 3MY0A 2F49A 4I6FA 2ETKA 4RQKA 4NYEA 5IA2A 4IADA 5KKRB 3LM5A 4WNKA 3FI3A 4JS8A 4XV9A 4BDCA 1U5QA 4BZOA 1IR3A 5LVLA 3KXGA 4MXOA 3QCQA 4FKRA 2R2PA 1URWA 3F5UA 2BPMA 3E3PA 4MYGA 2ZVAA 3FLZA 1Q5KA 4RQVA 4GU9A 4ACDA 4F09A 3C1XA 4QQCA 3OT8A 2ITPA 2QKWB 2XVDA 3ZXTA 3R73A 1O6YA 3LFDA 2EXMA 4RX5A 2ESMA 2YLEA 2VO3A 4R3RA 1MQ4A 3KF7A 5K4JA 5HE3A 3GFEA 4L9IA 3Q60A 3ZFYA 5ANKA 4O1PA 4AZFA 5AADA 5CF4A 2VWUA 2WNTA 3LQ8A 4I5CA 3QCSA 3ZEWA 4YSJA 4NJ3A 3VW6A 5HG9A 4FGBA 1PHKA 2WZJA 3R2YA 5DWRA 4EK6A 4G1WA 1GZ8A 3JR1A 1H01A 2UW8A 1M7QA 3BZ3A 3DKOA 3HV7A 4KABA 3DLSA 3ZEPA 3IKAA 4AT5A 5F20A 3QRKA 4KB8A 1YI3A 5L2QA 3PVBA 4ZJIA 4E4XA 5C8KA 4RBLA 5B2KA 4CKRA 3GOKA 4FKQA 4A9YA 4ZY4A 4XV1A 2PWLA 3F88A 3NS9A 4FT7A 2Y4PA 4WSYA 3VHEA 5CANA 3IGGA 3IOPA 3FPQA 5KMKA 4O83A 3LMGA 5K9IA 4L43A 2VN9A 3LCOA 3UOLA 2YZLA 3A7GA 1OL7A 2QONA 4M84A 3NUAA 1WBSA 3HUBA 1YHSA 3UVQA 3EH9A 3G2FA 1ZY4A 1OPLA 3HUCA 4O2PA 5FBOA 3VBWA 2C6DA 3BBWA 3UO6A 4ACMA 4EK5A 1NY3A 4GSBA 3FE3A 4GUBA 2WMRA 3VUHA 2XYNA 4L68A 5D7VA 3SG8A 3F66A 4M8TA 1GOLA 4H1JA 3R9DA 5GZ8A 2GS2A 2QO9A 4QMTA 3C9WA 3WYXA 3NYVA 5FRIA 4I93A 3AD6A 3QLGA 2C5XA 1UKHA 4YLJA 5L4QA 1MRVA 4DEEA 4GH2A 4HYSA 1XO2B 5D10A 5AV4A 1P2AA 4I94A 5IH6A 3GQLA 5HOAA 2DQ7X 3FZRA 3MH2A 5CXHA 4L67A 3RAWA 3G0EA 3T8OA 4F70A 3RAHA 3EQRA 3EQDA 3CLYA 2YA9A 2QO2A 4ERKA 3V5WA 1DS5A 5AMNA 5ANGA 5EW9A 4BYJA 1BL6A 3PPKA 3OMVA 1BKXA 3OCTA 5FEDA 2VAGA 4PX6A 3BBTB 5D7AA 3UJGA 3B2WA 3PPZA 3PY3A 3A62A 3GFWA 3KCFA 2XNBA 2UZVA 2J0IA 3A7JA 3CE3A 2HWPA 2VWBA 4EQCA 2WQMA 4ANNA 3JXWA 4F7NA 4F9AA 2W7XA 3BHYA 5DGZA 3L8XA 4QMQA 2WMWA 1BMKA 4E73A 4IFCA 3HLLA 3UGCA 3R8UA 1URCA 2WPAA 3MPMA 5AV3A 5E8ZA 1PXOA 3LXPA 3T3UA 3Q3BA 2PVYA 5DH3A 4DGLC 2BTSA 3R8MA 4AW5A 5AP0A 3MVLA 3R1YA 3HECA 4BDKA 2X7FA 3COIA 5AFVA 3KMUA 4EYMA 2W99B 4I4FA 1Y8GA 1H1QA 1YWRA 4EK4A 4EYJA 4J53A 2FGIA 4CV9A 4PWNA 1OITA 1OMWA 2HZNA 3EQCA 2X7OA 4QTCA 3VW8A 1Q8ZA 3GQIA 4EJNA 5L2WA 3BYMA 3ZRMA 3DBDA 2HZ4A 2V5QA 5KBRA 2BROA 4IX4A 3DZQA 4D4RA 4QTBA 3FMMA 4ANBA 4UWBA 4JVGA 3CY3A 1OB3A 2CGVA 4H1MA 1LUFA 4AQCA 1B38A 3SXFA 1YXXA 1FVRA 1DM2A 5AJQA 1UA2A 4M7IA 1YDTE 3F5GA 3ITZA 4FL1A 4LMUA 1B39A 1P4FA 2C0OA 3BQCA 3ET7A 3N9XA 2PE1A 2WB8A 4R77A 4LOPA 3R7IA 3UQGA 3GEQA 1E1XA 4L6QA 2YITA 1YKRA 3EHAA 2E9NA 4FSMA 2XP2A 2VO6A 3DJ7A 1OKZA 2UZTA 2B54A 3H30A 2G9XA 4AGWA 1JQHA 2UW7A 4QD6A 2R0UA 4ZZNA 3DBFA 5LJJA 3IDBA 3DBEA 2PMNX 1H24A 3NUYA 4G5PA 4KIOA 4XBUA 2ZV8A 2WAJA 3UQCA 1RQQA 4GV1A 5CSXA 5EYDA 2J0LA 4WA9A 1HCLA 3EFWA 3NGAA 3AD4A 4BCFA 3OW3A 2PZPA 5FLFA 3TNPC 3L8PA 3HZTA 4A07A 4AZEA 3DK3A 3QD4A 4HCVA 4NFNA 4M15A 5A4TA 1EH4A 4DINA 4FICA 4QP4A 2ONLA 4DEAA 4NK9A 2PZIA 4EHVA 1H8FA
chains in the Genus database with same CATH superfamily
3E5AA 5KMIA 3MTFA 5AUVA 2GQRA 1Z57A 4F7LA 2W1ZA 5TKDA 4DBNA 4YU2A 3VBXA 4GKIA 4LOOA 4WT6A 3KU2A 4EI4A 3G9NA 4J1RA 3MI9A 3DK6A 2XK4A 1FQ1B 3DB8A 4DTKA 1XR1A 2VTOA 3FLNC 3Q2MA 3KEXA 4I23A 3QKKA 2BZKB 4O1OA 3BU6A 4FVQA 3ZLWA 3LJ1A 1WVYA 4NTTA 2P33A 5BX0A 2JIVA 5L6WL 4DE4A 3PXYA 5FTOA 4X2JA 4G3DA 5HBEA 5KCVA 4JDJA 4U7ZA 5J7BA 5AP6A 5ANOA 5AR8A 1WZYA 2R0IA 4JX3A 4DCAA 3B8QA 5CSPA 1J7LA 3AKKA 3P5KA 5CU2A 3RINA 4D4VA 5EW8A 3K3IA 4I5HA 3EQFA 4MXAA 5T68A 3ORNA 2OO8X 3F3VA 5BNJA 5AP5A 5IH5A 3RKBA 1AD5A 4KA3A 4EHEA 3NWWA 3RPVA 2I0VA 4FL3A 3WOWA 2HXQA 2C1AA 2OJ9A 3EFLA 3ZMMA 4YO4A 1TQIA 3E64A 4AOJA 3LFEA 2XCKA 5CYIA 3L8SA 3MA3A 3GCQA 1LP4A 4LM5A 3AT4A 4HVGA 4AOTA 2JEDA 4V0GA 4XS2A 4AW2A 1E9HA 1VZOA 2XJ2A 2QOOA 3RK7A 4QMSA 1OL1A 4G6OA 4JIKA 1NA7A 2BIKB 4CLJA 3C50A 5I4NA 3ZC6A 5J5SA 2C68A 2PVKA 2PUIA 1O6KA 4FUXA 5AA8A 3KMWA 3HGKA 4JBPA 1REJA 3H3CA 5KZIA 3NUXA 4Z9LA 3RHKA 3W18A 4JG6A 5IA3A 3DFCB 2PVJA 4RC2A 4TRLA 5CZIA 4I6BA 3Q5IA 5KNJA 4WNPA 3GVUA 3KQ7A 3ODZX 4UX9A 2CDZA 3D9VA 1PMNA 4O6EA 4CNHA 5BV3A 3MY1A 4QYFA 4FTRA 2XKEA 3DCVA 4BRXA 4AQKA 3FMKA 5I9UA 4GT4A 4TL0A 3S4QA 1Z5MA 3VS4A 1Q41A 5CWZA 3R6XA 1UU9A 3NNUA 1TKIA 2ETMA 2CCHA 2HZIA 2O65A 3CQWA 3D14A 3FQHA 5CU3A 3AT3A 5CQWA 5DE2A 3UZPA 3SRVB 3O17A 3EL7A 4IZ7A 3FHIA 4L01A 5BUEA 4CGAA 4L7FA 1ZZ2A 3FL4A 1UU7A 3SAYA 4XBRA 2XARA 3MA6A 4WIHA 2Z02A 3TUCA 2P4IA 2W06A 3TZ7A 3HMPA 1Q97A 2X6DA 4YNOA 5DNRA 2QHMA 3GU4A 3SVVA 3E7VA 5CALA 2HZ0A 5M44A 3RM6A 2V62A 3I5ZA 2I6LA 2C6MA 5EW3A 2PMLX 3OVVA 4EH8A 5EOLA 2BALA 1JSVA 3P1AA 3PJ3A 3NCGA 4WRSA 4A4LA 4FKOA 3U8WA 4TNDA 5LWNA 4DHZA 3LIJA 4IVAA 5C27A 5CI7A 4R7IA 5HG8A 3QKMA 2JKMA 3BEGA 4TWCA 3UPXA 4IM3A 4IFGA 4MWIA 4CT2A 1OIRA 4V04A 3UMXA 2W1GA 4S32A 3OBGA 3ORKA 4J8NA 5FTQA 5GJDA 3ETAA 4RVTA 5DFPA 2VD5A 1LR4A 3LFSA 3VQUA 2H34A 5AR5A 5HTIA 5AUUA 4OAUC 4GUEA 4IAFA 3TG1A 2RF9A 2BRNA 1PXNA 4DEDA 5HVJA 2C3KA 3NVKI 4PNKA 3LXNA 2YIYA 5IUIA 5CASA 2VTRA 3C0IA 4IIRA 2HENA 4Y8DA 2CN5A 4M12A 5K0XA 2OIQA 4WUAA 3UG1A 3SHEA 1W84A 3UYSA 1FVVA 3DKGA 4FYOA 4HYUA 4C35A 4YHJA 4BHZA 4RX9A 4ALUA 4BKZA 1CKJA 2C5VA 5HGIA 3FZOA 4FL2A 1H00A 4E20A 3HA8A 3HV3A 3FL5A 4JAIA 5EI8A 1R3CA 2BILB 3OOMA 2BZIB 4FV2A 4LRKA 4Y73A 5FEEA 3PJ8A 4BDDA 4FK6A 4EOJA 5K5NA 1BLXA 2P2HA 3KA0A 1TVOA 3S00A 3R7GA 3FI2A 3VONA 3OS3A 4NIFA 4IAYA 3REPA 2XUUA 3FZSA 3LVPA 4C58A 4CZYB 4FR4A 4O82A 4Y5HA 5M55A 3BYUA 2C69A 3I0QA 1QCFA 5CSWA 5IG1A 2Y4IB 3LMIA 4E6QA 5DT0A 5AV1A 3LCDA 4QYEA 5E8TA 3PXKA 3QLFA 3WYYA 1A48A 3EQIA 4GEOA 4GU6A 4PDPA 1R39A 2XEYA 5CS6A 4UXLA 2Q83A 4LGHA 3AGLA 3IK3A 3BYOA 3CD8A 4WG4A 3RCDA 3R2BA 3QZFA 4FTAA 3UIUA 4O7ZA 3HMIA 4O81A 4O0UA 4ASDA 5FUTA 2GNJA 1GNGA 2OSCA 4JBQA 3R8PA 3FI4A 3CY2A 1YI4A 4BZNA 5C4KA 4D0WA 3JPVA 5GJFA 4WKQA 2A2AA 3MWUA 2PK9A 4FZ7A 3TDWA 5JZJA 4EH4A 4BCKA 3D5VA 1JVPP 3UNJA 4CYIA 2DYLA 3W2QA 3HRBA 4USFA 2OZAA 4MXYA 3H0ZA 4WHZA 1G8KA 4DH8A 2GHMA 4WBBB 5CLPA 3PWYA 3R1NA 4MD9E 2YZAA 4EUUA 3BWJA 3ERKA 1CMKE 3OUKA 2W9ZB 3GI3A 4C4GA 4RJ3A 3NUUA 2X9EA 4FKSA 4O4BB 4BI0A 3U54A 1SM2A 2XMYA 3ZOSA 4E4NA 4IXPA 3KB7A 2B52A 5CEKA 4FE2A 4B6LA 3FJQE 4IB1A 3V51A 4OTQA 3UVRA 2ZM1A 2R3OA 3ROCA 5F9EA 1XH4A 4MBJA 2FYSA 2O5KA 1JNKA 3V5JA 3PRFA 4L3JA 4X3JA 3PY0A 4QYGA 1CM8A 1Y8YA 3QA8A 3QQUA 3S1HA 3CR0A 2W1HA 3D2IA 3R30A 4W8EA 4ZEGA 4A9SA 4AN9A 5IPJA 3QL8A 2OJGA 4NH1A 2YM7A 2VTLA 2VX0A 3LXLA 4Q5HA 4CRSA 4MUQA 4FSNA 4IWQA 1MRYA 5AAFA 2QOIA 3O7LD 1Y6AA 4D28A 1Y6BA 2PMIA 5HVKA 4OTRA 4A4XA 4AOIA 3POZA 3R9HA 2R3IA 1CSNA 4DA5A 3TACA 2JGZA 3W33A 2C4GA 4FZDB 4RMZA 4D4SA 4HGSA 3DBQA 3R02A 4AGDA 4YURA 4YPDA 4FZFB 4AWIA 4CXAA 3E92A 3PG3A 3RALA 4Z7HA 4YJOA 4BGHA 2ERZE 5CTPA 4IZYA 4BDGA 5HE0A 4EOIA 4FUYA 3THBA 5HORA 3GCVA 1ERKA 4FNYA 3VF8A 5A4EA 3AMBA 4DH1A 3LMHA 5BVDA 5DYJA 4WG3A 2H96A 3MIAA 5HD4A 4PTEA 4ZK5A 2XIRA 3SGCA 3FBVA 3QTWA 3ULZA 3UOHA 5JRSA 4QPSA 4EQUA 2R3JA 2Y9QA 5JN2A 5KMNA 5I9XA 3CSVA 3EN4A 5D11A 2IZSA 5CSHA 5D1JA 3VRYA 4CZUA 2B1PA 1O6LA 1J1BA 5J7HA 2WTJA 2PPQA 3VS1A 2BKZA 2J51A 2XJ0A 2B9JA 2JLDA 4YGAA 4IE9A 2WTKB 3OHTA 4IZ5A 4TY1A 2XF0A 2R9SA 3CS9A 4JXFA 3FPMA 2IVTA 3PLSA 4KBAA 3ZSHA 4BTFA 4F1TA 3HV4A 4RG0A 5JFXA 4FX3A 3NW5A 3FYKX 3FLQA 4Z55A 3AKLA 4OT6A 5LVMA 2PVNA 2VUWA 3QC4A 4FTCA 5IF1A 4XYFA 2ZMDA 4NTSA 3PA4A 3QAME 2XK6A 2I1MA 2ITTA 5L2IA 5HCXA 4K8AA 1JPAA 1PJKA 3GCPA 4DF3A 2PTKA 1YWVA 4YBKA 2UW3A 5DBXA 5IQBA 4OBOA 3RPRA 4QYYA 4DH7A 4X2NA 4FKLA 2WMSA 1WBNA 4MXXA 3WILA 4FSYA 3HX4A 3KN6A 3DQXA 4J96A 4RWJA 2YWPA 2XBAA 3KFAA 2WOUA 5LWMA 1BL7A 3CXWA 3R7OA 2F2CB 4A7CA 3DAKA 5KZ0A 3VQHA 4GK2A 2ONLC 2WTDA 4O4DA 4XOYA 4CMOA 5M51A 5AV2A 2HELA 3FUPA 4UZHA 4BDHA 2XNMA 4HW7A 3NSZA 3UO5A 3PJCA 3TUBA 2BAJA 3O7LB 4NCTA 1PXKA 4OTPA 4QMVA 3WF5A 1APME 3NFGB 2YM3A 4TYIA 4CFWA 4ZTMA 2JBPA 2Z60A 4M66A 2X6EA 3SXSA 4QOXA 3VN9A 4X7QA 5I5ZA 3R04A 4BY9E 4ZAUA 4PMSA 3DDPA 5FXQA 3VS3A 4FV8A 3ZH8A 5CT7A 2RG6A 2XNOA 3FLYA 3V6SA 4BWXA 5EQEA 3H0YA 3VULA 2XA4A 3VS0A 4CTCA 5K4IA 2QG5A 4GK3A 2YM4A 4FIHA 2V0DA 4MAOA 5CAPA 3MDYA 3EQPA 4JRVA 1FMOE 3IECA 4FG9A 4YJPA 4ZY6A 2E9OA 4LGGA 3W2OA 3F5XA 3MJ2A 5ANIA 3R9NA 4C4HA 4DFXE 4S33A 4D2PA 3O51A 3LQ5A 2F57A 4L46A 3QQLA 4K2RA 1FINA 4IEBA 3TZ9A 1NW1A 4USDA 2OWBA 2F9GA 5J1WA 3BLQA 3FDNA 3N51A 1XKKA 2C6EA 3TV4A 5HCYA 1OGUA 3DFAA 5LMKA 1L8TA 3LHJA 2XH5A 3HMNA 2HXLA 1B6CB 3BKBA 4XG8A 3P4KA 5FDPA 4EHZA 2UZOA 4F63A 4HVSA 5H2UA 3OF0A 2NYAA 1ZYCA 2OXYA 3ZLSA 4RIWB 4G6NA 4TKSA 3BHVA 4NUSA 3DJ6A 5DI1A 4M69B 3G15A 2HW7A 3QHWA 3JS2A 2VV9A 4J7BA 3MH1A 3QQHA 4HPTE 4DFNA 4RLKA 1UNLA 4YHTA 5AX9A 2XAMA 1UV5A 3V01A 5ANDA 1J91A 4C2WA 3QTRA 3RHXA 4WNMA 4IVDA 3KK9A 1RDQE 3TNWA 5EYCA 3NAXA 4CQGA 3U6IA 2WMTA 3E8EA 4TTHB 3WF9A 2UZUE 1F5QA 3ZM9A 2CHLA 3PDTA 2GNHA 4D2WA 3E62A 3ZDIA 4NWMA 4AXEA 2IVUA 2JITA 2WMVA 2UW0A 4RVKA 4BZDA 2CNUA 4JRNA 3U87A 3M11A 4M13A 5D9HA 1BUHA 3P08A 4XP2A 4C4EA 3VUDA 4HZSA 2XK9A 5LVPA 4RVMA 1FGKA 2QCSA 2G15A 3PUFC 4AACA 4RSSA 2IJMA 3TI1A 4MWHA 5IUGA 2VTJA 2GFCA 5ETAA 3TNIA 1U54B 3FKLA 5EHYA 3UPZA 4D2VA 4G5JA 3ZDUA 4D1XA 4O7NA 2IF8A 3A7IA 4KRCA 4XOZA 2W96B 4QO9A 4CMTA 5JFWA 3TZ8A 1SVHA 1OKYA 3TXOA 4C7TA 1ZZLA 3ZC5A 2PUNA 4PF4A 4JI9A 5DR9A 2GTNA 1JLUE 4EWQA 3GCUA 4G9RA 4O0RA 2PYWA 1Z9XA 2IN6A 4UYNA 4CYJA 3M1SA 3GU8A 4BCNA 5GZAA 2F4JA 1OIYA 5FP5A 3ULIA 3BELA 2OI4X 2OIBA 4RA5A 2R4BA 3MFSA 5CEPA 3L9LA 2BAQA 2BFXA 2Z7LA 3BIZA 4CZTA 4O7SA 2Y7JA 4FNXA 4WSQA 4EZ3A 1S9JA 4GK4A 5CAQA 3W16A 5HO7A 3SQQA 3NIZA 5HNIX 3IGOA 2CPKE 1HOWA 3BU3A 3PE1A 1GJOA 4PMMA 4QMUA 1JSUA 2BDFA 4TWPA 5TF9A 2AYPA 4IM0A 4LL5A 1IAJA 5M57A 1VYZA 3EWHA 2XIZA 5AP2A 1QL6A 4I0TA 3VNTA 3MY5A 2GCDA 2IVSA 2W5BA 4G17A 4GT5A 3WE4A 2R64A 3MB7A 4GFOA 4WNOA 4NM7A 2WGJA 3WE8A 4UEUA 4MXZA 4KBCA 4RIXB 4IQ6A 4AF3A 2JDRA 3PVUA 4G3GA 4MK0A 5A9UA 5CEOA 4O7VA 3WF6A 1UU3A 3KULB 2DS1A 5IA1A 2LGCA 4O0SA 1OBGA 2JKKA 1JBPE 5JGAA 2R3QA 3P86A 4O7RA 3CKWA 5BVEA 1OL6A 3DGKA 3FC1X 4NM0A 4AP7A 1Q4LA 4C4JA 5ANEA 4FRFA 2VNWA 4FTKA 4F6UA 2GS7A 3QCXA 4BKJA 1IRKA 4P2KA 3NUSA 5AR2A 4TNBA 2BRGA 2ZAZA 2E9PA 5LXMA 3LJ0A 3NMUF 4JJRA 2I7QA 5L2TA 3QF9A 3R0TA 4RC4A 2WXVA 4TN6A 3QGWA 3R63A 5ACKA 1DAYA 5M07A 1PXPA 4MBIA 4MNEB 3SC1A 2PVHA 4JG8A 3UZRA 1OPKA 3D5UA 5FP6A 2YIWA 4BICA 3ZRLA 3QQJA 1YXTA 2BDWA 2VWYA 4IAZA 4L42A 4LQMA 5DRBA 1ZMVA 1W7HA 3SOAA 2R5TA 3SRVA 2QG7A 3SW4A 4PV0A 1OVEA 3KGAA 4IAIA 2J4ZA 1P5EA 5FQDC 3EFKA 3DS6A 1Q3DA 4C57A 5M53A 3S3IA 1PY5A 1JKKA 3QQKA 2QO7A 4FTQA 2FB8A 4J71A 2CKEA 5EI6A 5IH4A 2B4SB 3D4QA 4GW8A 4R5YA 4MKCA 4XG9A 3DNEA 3LOKA 2NNWB 2IPXA 3MTLA 2Q0BA 2EU9A 3ZXZA 2UW6A 4PPBA 3ELJA 4ZJVA 2B0QA 1TFFA 3V8TA 3R8LA 2NRYA 3VO3A 1YOLA 4AUAA 4QTDA 4BCMA 4TWNA 3EJ1A 5GZ9A 2A0CX 5F95A 1O9UA 4YZMA 2G1TA 3A8XA 3KY2A 3O8UA 3VUMA 4EH9A 4F9CA 2GMXA 4BDIA 3NAYA 1FOTA 5AP7A 2G01A 1K9AA 5CSVA 5BMMA 3ML1A 3ALNA 3L8VA 2GHLA 4GMYA 3R01A 5EI2A 3HEGA 3L9NA 3A60A 4YJRA 5HVYA 3R1QA 4TZRA 4O22A 3S2PA 3SDJA 4RIYB 3QXPA 2F7XE 4I6HA 4CD0A 4D9UA 4FG8A 4F0GA 5CF6A 1H4LA 2AUHA 2WO6A 3MJ1A 4QP1A 5E92A 3EZVA 3Q32A 4GVAA 4OR5A 2W4KA 5L8LA 2C30A 3UNKA 3H9RA 5L6OA 3FI8A 1W98A 2BR1A 4KKHA 3QA0A 3Q4ZA 1W2CA 4EWHA 5IQEA 4YJTA 3DOGA 1ZARA 4FTNA 4OTDA 3RK9A 3WI6A 1AGWA 4GS6A 4ZJJA 3VC4A 4DEHA 5JRQA 3A8WA 5J79A 4BDAA 5J9YA 3GU7A 2OU7A 4O86A 4OTFA 3G0FA 3NYNA 3VVHA 4DYMA 3ZUVA 1UWJA 3IONA 3TKUA 3R7EA 1FPUA 2GNFA 2RG5A 5C26A 2VWIA 4ACGA 2XYUA 1Q8YA 1H1WA 4OGRA 4J8MA 4OBQA 5KKRC 2W1CA 3I81A 2JIIA 3E63A 4IX5A 3KXZA 3IW5A 4K1BA 2P3GX 4YJUA 4EH3A 4Y46A 5HNBA 4R1YA 4YO6A 1OBDA 3DZOA 3FZPA 2XBJA 1GIHA 2R3RA 5A3XA 4IZAA 4QEBA 4ZSJA 2YCRA 4GL9A 5HX8A 4XG6A 3HP5A 2B9HA 2UUEA 3P78A 3UP2A 2X1NA 1RJBA 2BRMA 3UODA 3GBZA 2IO6A 2KTYA 3UDBA 4AAAA 4F9BA 2QHNA 2HK5A 2XK8A 3SG9A 2JDOA 4FKIA 2X7GA 1S9IA 3RJCA 4F0IA 3BQRA 3CP9A 3QC9A 2YIQA 5H8GA 3GC0A 4FEQA 3T3VA 3LM0A 4CKJA 4KRDA 3ZCLA 5A54A 1KOBA 5DMZA 5IQGA 4YJVA 4R1VA 2W05A 2R3LA 2OKRA 3BX5A 3PTGA 3EMGA 4L53A 2YDKA 3GT8A 2XB7A 2Z7QA 1PRYA 3MYGA 3AG9A 3COHA 3QD0A 3K2LA 3IQ7A 4QDEA 4ZSAA 4ZY5A 2H6DA 3PYYA 4RVLA 2QC6A 3A99A 3C13A 5HESA 2VTSA 4JT3A 3VBVA 5KMLA 3ALOA 5FM3A 4RT7A 3RAIA 3G90X 4IM2A 4U3ZA 1Y57A 5EDRA 3AMYA 4HJOA 4BCGA 3R9RA 2YCFA 3UYTA 3ZONA 2WMBA 4EBWA 4EC9A 5ETFA 5ANJA 4DG0E 4J99A 5BVNA 1UNGA 2PZ5A 3OWKA 2ITZA 5BMSA 5M56A 2VO0A 3OCBA 4MD7E 3UOJA 3E7OA 4ZZMA 3P7CA 5HO6A 3E3BX 3FMLA 3A4OX 4EHGA 3HNGA 2X81A 4JX7A 4YUQA 1CKIA 5CU0A 3W0RA 5I9ZA 3DU8A 2XM8A 2YHVA 3DQWA 5DG5A 3EFJA 1E1VA 3QWKA 4F7JA 1ZY5A 2PVFA 4I20A 3KRLA 5A4CA 4ZMEA 4NCTC 3C4XA 3TNHA 5IQDA 2WMXA 5IMEA 5FWKK 5B0XA 1JKTA 4DTBA 4JDKA 3E8DA 3F6XA 1G8AA 2CLXA 2WOTA 1W83A 3C51A 3E93A 4FKWA 1H27A 5BUJA 4Z7GA 1GAGA 2XKDA 5IU2A 2CKQA 2IW6A 3LKMA 1ZYDA 3EIDA 3SKCA 4QQJA 1ST0A 4KIQA 5M06A 3MBLA 4DTAA 4EH5A 1P14A 1MRUA 4W9XA 1K3AA 2ITVA 2XK7A 4BTKA 5JFSA 4K33A 4RX8A 1UNHA 5D41A 2FSTX 4FEWA 3RVGA 3OEFX 3OXZA 5CT0A 4G3FA 3Q4TA 3Q9XA 4U5JA 4DG3E 2W1EA 3VJOA 2XM9A 1JOWB 3TN8A 4DGGA 3QQFA 1NVQA 2JDSA 2F7EE 4QPAA 3R7UA 4EOQA 5DIAA 1DI8A 5C9CA 3W0NA 5DT4A 5AUYA 3ZBFA 3HAVA 5IQIA 2BZHB 4A06A 2YCSA 4TYJA 3OW4A 2OFVA 3PIZA 4LV8A 4LV5A 5HEZA 3ZHPC 4DT9A 5GINE 3C0HA 5CVGA 3PXQA 3C4EA 3G6HA 2X0QA 5LMKC 3HP2A 3D5WA 2R3NA 5J9LA 4JR3A 4JMQA 4CG8A 4DT8A 1XBCA 4TWOA 4QP9A 1PF8A 4FIIA 4O4CA 5DR6A 4D2TA 4IX6A 5H3QA 2R3MA 1GZOA 3HYHA 4XV3A 5AX3A 2JDVA 2FSOX 2QOLA 2VTAA 5A46A 4FGRA 2AC5A 2YJRA 1MUOA 3OROA 2GNLA 2WFYA 3U4UA 3PWDA 5CAVA 4FTOA 4ZLYA 4FSUA 3F61A 4JAJA 4QNYA 5TOZA 5EFQA 3UIXA 1OL5A 3BU5A 4V05A 4YP8A 3PXZA 2R3HA 4DLIA 4DFYA 2VGPA 4IH8A 1UWHA 4BF2A 3D5XA 1IEPA 3QGYA 1QMZA 2QOCA 4QP8A 3FMEA 3K5VA 3NIEA 1U46A 3OWPA 5LVOA 4C33A 2XK3A 3WIKA 3ANRA 4B7TA 3EN9A 3LCTA 4FTLA 2AQXA 4RJ7A 3TTIA 4H3BA 3VRZA 3VUGA 4BGQA 4E4MA 4DLJA 4WRGA 4APPA 2P55A 2C5OA 4ASEA 4E6DA 4HVHA 3QKLA 2AEGA 3I7BA 2R3PA 2YABA 3AT2A 3HDNA 4H36A 4X3FB 3VBQA 4B8LA 4MEDA 2KULA 3FZTA 4I0RA 5C8NA 3U4WA 3EYHA 3II5A 4P5QA 3K5UA 4I4EA 3I5NA 3IDPA 5HNGA 1DAWA 2J0MB 3BHUA 3MFTA 4HGTA 4UWCA 4XP3A 4ZTNA 1M2QA 4TPTA 5JKGA 2WQBA 1CTPE 5J5TA 2ZMCA 5K0KA 1GZKA 4QMZA 1F0QA 4XG7A 1ST4A 2VRXA 2XZSA 3MPAA 3QRTA 5G6VA 4FG7A 4F9WA 3UQFA 3PIXA 4TW9A 4BWPA 4FK3A 4G9CA 4FIEA 3JUHA 1VJYA 2R3FA 3LE6A 4F99A 3IW8A 4K6ZA 4OTHA 4X6QC 1A06A 4XHKB 3TIYA 2Z7RA 3NVMB 1KE7A 1OM1A 2PL0A 4LRMA 4BCHA 5LVNA 2GPHA 2VX3A 3IO7A 3TKIA 5EG3A 3F69A 4RWIA 4K9YA 4LI5A 4NU1A 4RJ4A 2VZ6A 3HKOA 3UTOA 3KRWA 4EZ5A 3OXIA 5AP4A 4EJ7A 2ZDUA 2UVZA 2SRCA 2GSFA 2A27A 4O91A 4MQ1A 2CKPA 2XCHA 3S95A 4ANMA 1Q3WA 2YERA 3BRBA 4YJQA 3Q6UA 2HCKA 3UIBA 5LCJA 3DXNA 3MB6A 4IW0A 4PP7A 1BI8A 4WUNA 1ZYLA 2IEWA 4DEIA 4NSTA 3D0EA 4ENXA 3ZYAA 4F7SA 4U9AA 1BYGA 2PZRA 2O64A 4GG7A 1V1KA 2WTIA 3FV8A 2YAAA 4FTIA 1OKWA 3MIYA 1OKVA 4LG4A 4QP3A 4AZSA 3R9OA 3IW7A 4ZZOA 4ZTQA 4MBLA 4RIWA 3CGFA 2XNEA 3RK5A 1NT2A 2O3PA 4M69A 3U51A 2A19B 4LV7A 2XAOA 3Q53A 2C6KA 3PXFA 3W1FA 2C5NA 3W55A 4JL9A 5JT2A 4AXFA 3W2CA 5LOHA 3PJ2A 4BB4A 3S0OA 4FA2A 4FSZA 1KE6A 4UY9A 2C6IA 3KRRA 4G31A 4OT5A 2HYYA 3OWLA 5AUTA 1H25A 4C61A 3ENHA 3P9JA 4BBEA 5HX6A 2GQGA 4FOCA 1OI9A 4JQ8A 4KWPA 3PP1A 4PMTA 4I92A 5CF8A 3EL8A 1TZDA 4IWOA 5HO8A 3F3UA 2PUPA 5IKWA 2RFEA 4FNWA 1IA9A 1FMKA 3DDQA 2X4ZA 3W2SA 4BCOA 4UN0C 3R8VA 3R22A 1T45A 4R6VA 5B2MA 4IB5A 1ATPE 3FMHA 3P0MA 3R83A 2QOKA 1XJDA 2ZM3A 2WKMA 2IVVA 4AFJA 3QHRA 2QOHA 2ITOA 4NKAA 3A2CA 3KRXA 2UZLA 4MF1A 1U54A 5ITAA 5K5XA 1ZXEA 4G3CA 3CEKA 4AZTA 1JWHA 3COKA 4D9TA 5EM8A 3ACKA 3QRUA 2E9UA 4U81A 4I6QA 4ZS0A 4FYNA 5FBNC 4FSTA 1SNXA 4FT5A 3RZFA 3V04A 2J0KA 3WF7A 2G2IA 2DWBA 3ZO3A 5HKMA 2OXXA 4PDSA 3UMWA 3W0MA 2R3KA 4W4YA 4ZIMA 1WVXA 1X8BA 4EONA 4FV0A 3PXRA 4W4XA 4YTHA 4MHAA 3VBYA 4ZMFA 3MW1A 1H0WA 4G34A 1ZYJA 3GNIB 4FODA 3TNQB 2YN8A 4ORKA 3AC8A 3U9NA 1YHVA 3I7CA 4C38A 5IEXA 2ZFYA 2VTMA 3NW7A 1Q62A 3KXHA 5DVRA 2X8DA 4USEA 3KK8A 2OZOA 3FQEA 3HA6A 4HVDA 4C62A 4OAVB 3A61A 3BV3A 2YCQA 4FV1A 5H8BA 4ERWA 1RW8A 1JSTA 4MVFA 3D2KA 1W2DA 4BCIA 2CCIA 2JFMA 4F6SA 4CVAA 4DGOA 1OL2A 4R7HA 5CY3A 3R7VA 3WBLA 4KAOA 4FT0A 4BN1A 3ZLXA 2G2FA 4CFVA 5AUWA 3D83A 1WAKA 2QR7A 4R5SA 3SD0A 3UVPA 2OF4A 3HL7A 4DBXA 4P90A 2EUFB 4RFMA 3W8QA 4RIXA 3SW7A 4LMNA 2YACA 3UO4A 4E26A 3PIYA 4X21A 3KULA 3NNXA 3QTXA 2X0PA 3C0GA 3D15A 2WQOA 4JLCA 4UMUA 4YSMA 3UBDA 4GVJA 2E2BA 4D2RA 3GC9A 5BVOA 1GIJA 2I40A 3FAAA 2GQSA 2UVYA 3RZBA 4S30A 3D94A 3FMJA 4FIJA 5M4IA 2CGUA 4QDVA 2QLQA 3F3ZA 3Q9YA 3ZS5A 3G9LX 3I0OA 4WD5A 3RP9A 3FYJX 4QP2A 1XBAA 3NUNA 4F4PA 4IBMA 4G16A 3LCKA 5EHLA 4HCUA 1WVWA 1W82A 4I0SA 3AC5A 3DKCA 2PVLA 3BL7A 2HY81 3O0GA 4P5ZA 4V01A 4MNEA 4C36A 4E5AX 4DDIA 1YDRE 4RFYA 4EQMA 3CIKA 5EHOA 3ROYA 4DFZE 5TO8A 5JK3A 3T9IA 2EWAA 3VIDA 5F4NA 1TQMA 2C0TA 4GIHA 4PL4A 3TMOA 3ODYX 4FEVA 4E6AA 3I1AA 4B8MA 4JBVA 3Q6WA 3COMA 3ZTXA 4AZWA 4DHFA 5A6OA 4U8ZA 3R28A 4PTGA 2NP8A 4DFLA 4UV0A 1OECA 3EN7A 4DITA 1W2FA 4NZWB 4QT1A 4DG2E 1M7NA 5HD7A 4BBFA 3TDVA 4XMOA