3OZ6A

Crystal structure of mapk from cryptosporidium parvum, cgd2_1960
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
378
structure length
343
Chain Sequence
b'DRHVLRKYELVKKIVWKSIDRRTGEVVAVKKIFDQNSTDAQRTFREIMILTELSGHENIVNLLNVLRADNDRDVYLVFDYMETDLHAVIRANILEPVHKQYVVYQLIKVIKYLHSGGLLHRDMKPSNILLNAECHVKVADFGLSRSFVNIRRVTNNIPLSINYVATRWYRAPEILLGSTKYTKGIDMWSLGCILGEILCGKPIFPGSSTMNQLERIIGVIDFPSNEDVESIQSPFAKTMIESLKEKVEKRDIFTKWKNLLLKINPKADCNEEALDLLDKLLQFNPNKRISANDALKHPFVSIFHNPNEEPNCDHIITIPHSIDDYRNLVYSEISRRKRELISN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1, serine/threonine protein
publication title Crystal structure of MapK from Cryptosporidium Parvum, cgd2_1960
rcsb
source organism Cryptosporidium parvum iowa ii
molecule tags Transferase
total genus 116
structure length 343
sequence length 378
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oz6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oz6A01
4X0MA 3OTUA 3H4JA 2J9MA 1JLUE 1OECA 4AW1A 4BKYA 4GK2A 3DXPA 2BTRA 3BHHA 4O86A 1OKWA 3VUTA 5CI6A 5CY3A 4RWJA 3QXOA 4FVRA 3ELJA 2HY0A 4P5ZA 4L46A 3CGOA 1KOBA 4NU1A 4IAFA 3W2RA 3ID6C 2F4JA 4F63A 3F5XA 4NFMA 4O27B 2J90A 2ZMDA 2PE0A 3BQCA 3A62A 1YXUA 3BYUA 3CR0A 3E63A 3Q9ZA 4NM3A 4QP3A 3HP5A 4FZDB 3ZH8A 5GIOE 3P23A 3VRYA 3VJNA 1KWPA 4FV9A 2GFSA 1PY5A 4YLLA 4XP2A 3FSFA 2WB8A 3JVRA 2EB3A 3QL8A 4L42A 4U0IA 3KRRA 1TQMA 4LUDA 4IB5A 4QYGA 5M08A 2P2IA 4CZYB 3DB8A 3UMXA 3MVMA 4UYAA 2VTJA 2C3IB 4FKGA 1AD5A 4HYSA 3CSVA 3C51A 4DEBA 3D5UA 5IZFA 4L00A 4LFIA 1FBNA 1K9AA 4IE9A 1OITA 3D14A 2BUJA 2BZHB 2GTNA 5AP1A 5BUJA 4X2KA 3TTJA 3ALNA 4ZK5A 4WA9A 1MQBA 3R1YA 4AFJA 3HNGA 4E6DA 4A07A 3DPKA 3FSKA 4O0UA 1FMKA 1Q24A 5C8MA 4FTCA 3TI1A 4OAVB 4TRLA 4MCVA 1WBWA 4O7YA 4FTJA 1F3MC 3AC1A 2YJRA 3WILA 4FYNA 3ANQA 4FI1A 1W84A 3GFWA 4NM0A 1REKA 5TOZA 2X2MA 4DN5A 4YR8A 3QZIA 2QOFA 2Z7RA 2JFLA 4FKJA 4DH3A 4QMQA 3DOGA 2XS0A 3ORTA 3ZXZA 5HTBA 5IF1A 4AWIA 4Z7GA 5CXZA 4FZ6A 1FQ1B 1M7QA 1QMZA 4G3GA 2VGOA 4MNEB 5EOBA 5CS6A 3KN5A 4BDGA 4TXCA 1V0BA 2BRMA 5CU6A 4L6QA 2XH5A 4RIXA 3DBQA 1OKZA 3NVKI 1IR3A 2BHHA 4QRCA 5LMAA 3UP2A 4AQCA 4OT5A 4RZVA 4EH9A 3K5UA 5DT4A 1WFCA 4IX4A 5KMKA 2WPAA 5L6PA 4ZSEA 2UZDA 2ZOQA 2QOIA 3BLQA 3NS9A 3NUUA 4XG4A 5HGIA 4S31A 4DH1A 4F64A 4BHNA 4QMWA 5BMSA 3LE6A 2ZV7A 4Y8DA 4AT5A 1NW1A 5HVJA 1KV1A 4HZSA 4C4FA 3MB6A 4P2KA 3QCSA 3VUKA 4GK3A 1J7IA 1G5SA 3ALOA 1VR2A 4FZ7A 4O7NA 2C6OA 2R3JA 5L8KA 2OZOA 3BCEA 3ACJA 3RGFA 3U54A 4M14A 3DAEA 4XRJA 3ZMMA 3RNYA 5AAGA 3LOKA 4WG3A 5HI2A 2I0VA 5AA8A 5CEMA 3PIXA 5IU2A 4APCA 4G34A 3PVUA 4TPTA 4FNZA 2JKKA 3W2CA 4EYJA 5E90A 4I0SA 3JS2A 4U9AA 3EWHA 1UNHA 5JGAA 5M4CA 5ETFA 4CRSA 1NXKA 2JBPA 3QTZA 3FQSA 3NIEA 3HV7A 4IX6A 3R73A 1K3AA 2WTWA 2HYYA 2YM8A 3A8XA 3HMMA 3I7BA 3R9NA 1OIYA 3COMA 2YITA 4EHZA 4AU8A 4AX8A 2OIDA 2WOTA 3FWQA 3LFSA 4G17A 4F4PA 1ND4A 5K0XA 2JDVA 5A4CA 2CNVA 2VO6A 2B9FA 3R7GA 4LG4A 3S3IA 3DJ6A 5EM5A 4E7WA 4BCGA 4I1ZA 4I4EA 4NKSA 3MPTA 1ZARA 2Y4PA 2Q0NA 3PA3A 2X6EA 1BI8A 4GSBA 4C4EA 2W1HA 4L52A 4PRJA 5DA3A 4OAUC 2AYPA 4QT1A 5KE0A 5D9HA 2W1IA 3TNQB 3QYWA 3RKBA 4U6RA 2NO3A 5IDPA 3LXNA 2WO6A 4IWQA 1ZOHA 2P33A 4Y83A 2W9ZB 1XO2B 2JAMA 4F08A 4ANLA 5JRQA 5A14A 5FTGA 4YJOA 2XJ0A 4JL9A 3F3ZA 5BVEA 3BLRA 4YJQA 3LCTA 3V8WA 4JAJA 1OL6A 4FV4A 3F61A 1G3NA 4GKIA 3TEIA 3FL4A 2W1FA 5BVOA 3PFQA 4XUFA 4BL1A 2UW4A 1WBNA 1GNGA 5FTOA 2FSTX 3A7GA 3I79A 3R2BA 3KGAA 4IJPA 4X7QA 5BQ0A 1H08A 4FSZA 2ITUA 4ZZMA 3LCOA 4G3FA 4AZVA 1WBTA 3S0OA 2QOLA 3R63A 4X6RA 1BI7A 3LFNA 3QALE 4N6YA 3QZHA 3UVPA 3ZONA 2DQ7X 3ZRKA 4BGQA 4YSJA 4IJ9A 3E8EA 2GNJA 5E9EA 5IQBA 2QO9A 5CVHA 3VS7A 4DAWA 2QU6A 3CQUA 2PY3A 3PXKA 4NJDA 3RAWA 5JFSA 2R3RA 3P79A 2X4FA 2XF0A 3OZ6A 3PA5A 4QQCA 1QPEA 3SKCA 2CHLA 3UO6A 3LPBA 4O7SA 1YW2A 5GINE 2FGIA 3Q9WA 3UOHA 2XIRA 4I20A 4XRLA 3E87A 3D2IA 2B55A 4BTFA 4H36A 3D2KA 4DH8A 1UVRA 2WMWA 4HW7A 1LEWA 3DK6A 4EH7A 3GUBA 3DFAA 4L43A 3EFJA 4MWIA 4GG7A 4UY9A 4YGAA 5K0KA 2RKUA 3Q4TA 1JVPP 1J7UA 2X0GA 4A4XA 2J0LA 2PMNX 3DK7A 3CD3A 2VAGA 3FZRA 3GBZA 5B7VA 3T3VA 4U44A 5AMNA 2BHEA 2R3QA 4CT1A 3TDVA 1KE6A 3EQIA 4BDCA 4UMUA 5CF4A 4YP8A 1WBSA 3KRLA 4IC8A 1P4OA 3ZXTA 5TT7A 3JPVA 3DKFA 4YJUA 1UU7A 2OG8A 5AX3A 4AW0A 3TDWA 3BI6A 4RIWB 3BE9A 2WMRA 2UZWE 3G6HA 2WMSA 5J5TA 4ZTMA 1WBPA 3L8XA 4D28A 1F0QA 3CIKA 5L6WL 2YA9A 3NVMB 2F7EE 3TM0A 3RALA 2C3KA 3UBDA 4BI0A 1OUKA 4M68A 5T68A 4RVMA 3RAKA 4CFFA 4YC8A 4M67A 4DINA 4YUQA 2FSOX 4OTPA 3A8WA 4J71A 4UMPA 3U6IA 2B9HA 4D2SA 2R64A 5HESA 3VUGA 3MV5A 3O51A 1R3CA 3VUHA 5J9YA 1H1QA 4MD7E 2R2PA 3LFDA 4YZMA 1O6LA 3IW8A 2EWAA 4FEXA 2R0UA 5BYZA 1PXLA 3O7LD 2JKMA 3E5AA 3C4CA 5CAUA 3EQCA 2PVHA 3PYYA 1T46A 4E5WA 5BMMA 4FX3A 2RG5A 4A4LA 5AM7A 4LGGA 3L9PA 3OEFX 3DT1A 2B7AA 3LFEA 2XCKA 2GHMA 4NM7A 2R3GA 2WXVA 1WVWA 2XBJA 3BYVA 4R3CA 4O2ZA 2WQBA 4QP2A 3POOA 4K2RA 4UV0A 2P3GX 2G2FA 2UZEA 3CE3A 5KMIA 4IQ6A 4UWCA 4AZWA 3IW7A 3G51A 4EK3A 3BRBA 3P7BA 5CQWA 4EOLA 4L44A 3ZSHA 4IAAA 3GU8A 4RT7A 1SNXA 4NUSA 3C9WA 4R5YA 2W7XA 3R8LA 5BYYA 5BVWA 2PZ5A 4XG3A 1STCE 2JIUA 3OFMA 3QTRA 4K9YA 4X3FB 4E3CA 3LFFA 4XG6A 2JEDA 2BILB 3M42A 3FMNA 4R3PA 3VNTA 4LMUA 2G1TA 1CDKA 2CLXA 5A6OA 1OMWA 1G8AA 3F3VA 4O0WA 3NSZA 5JZNA 3LZBA 3PJ3A 1ZWSA 4BI1A 3KF4A 3LQ3A 3ITZA 4I23A 2YIXA 2B52A 3CC6A 3DLZA 5H3QA 2VWYA 3O8PA 3Q6UA 4FTLA 4BDAA 1M2RA 2C0IA 4IHPA 3VS2A 1VJYA 5DFPA 2CJMA 3DTCA 4I41A 5FP5A 5HQ0A 3ENHA 1WMKA 2OO8X 5HG5A 2J2IB 2Z7SA 3BEGA 3MH0A 3OWJA 4R3RA 2ERZE 4ALUA 4FSWA 1BX6A 5DT3A 3G90X 2PVYA 3BBTB 2XK3A 3OTVA 4UZDA 3OY3A 3WF5A 1YOJA 5FRIA 3KEXA 3MVHA 4WG4A 3AGMA 3FMEA 4FKRA 4CEGA 3A7JA 2W06A 1Y6AA 4IAIA 3FAAA 3F9NA 4ASXA 5LJJA 2JFMA 3QCQA 4YZBA 2F7ZE 3U9CA 3VO3A 3QD4A 4C57A 3EL7A 4CFVA 3FI3A 4FYOA 3SG9A 2HXQA 2ZB0A 2RL5A 1Y57A 3DCVA 4YLKA 5JGBA 2VWBA 2O0UA 4R1YA 3LLAA 4FL3A 4JDKA 4WUNA 1E1VA 2OZAA 5GZAA 4XV2A 4FKWA 3E3PA 2XKFA 2QD9A 3PJ8A 4MXAA 4OR5A 3QGWA 2GS2A 3VVHA 4QPAA 4QMLA 4G16A 3LCDA 3P7CA 4NW5A 3E64A 4EOIA 4ZOGA 2JGZA 3D0EA 3F3TA 3PXQA 4RIWA 4DITA 5AR7A 1XKKA 2QR7A 1OL2A 2WEVA 2VWZA 3COIA 2IWIA 4HGTA 4RFMA 4C58A 2OLCA 3PJ1A 3V5QA 3EQGA 1K2PA 2V7OA 4IANA 4CYIA 2HK5A 4RA5A 3Q60A 4TYEA 3U51A 5FD2A 3OG7A 4S33A 4FG9A 1NVSA 5ANKA 3GCPA 3UVRA 5KMOA 4QQTA 2YCSA 5FXSA 2BRBA 3DDPA 5M44A 4O83A 3BYOA 5A3XA 2LAVA 2GPHA 5A4TA 4DT9A 4FIIA 4I4FA 5JT2A 1BYGA 3FKNA 4L7FA 4USFA 4JR7A 4IZYA 2P2HA 2ITWA 4CG9A 4F9AA 5IISA 4JDJA 1ZLTA 2GQSA 4JQ7A 3IS5A 3V01A 3KRXA 4DH7A 4O82A 3BLHA 1MRVA 3FZPA 2VGPA 5DWRA 4O38A 3ORKA 2ETKA 3F6XA 4WNMA 3RMFA 2F57A 3CCNA 5H8GA 3IO7A 1J7LA 3NYOA 3OCGA 2WU6A 2AC5A 4V01A 2A2AA 4XV9A 3O71A 4RG0A 4I3ZA 4ANSA 3BU5A 2OICA 1GZ8A 2HZ0A 3H0YA 3E7OA 5H8BA 2C6DA 3KA0A 3K3JA 4H3PA 4WNPA 3COKA 1O6KA 3SRVB 5E7RA 3ZRLA 4L01A 4RJ5A 4Y73A 1QPCA 4UBAA 5M55A 3ROCA 4K11A 2DS1A 2YFXA 2O63A 3C7QA 3HX4A 3VUDA 3CS9A 5CVFA 4AZEA 3ZO1A 1LUFA 4HGLA 3C0IA 4OTGA 4W4WA 1URCA 4RVKA 4FKOA 3QC9A 4A9YA 3PZEA 2PYWA 3JUHA 3V5TA 3PG3A 3OP5A 1G8SA 4DGGA 5HO7A 2EU9A 3GENA 1SVEA 4FEUA 3MY0A 1YRPA 4FKIA 2PVNA 4IWPA 4O0YA 4TWOA 5IA4A 4IZAA 2OJGA 1UV5A 1ZZLA 3PXRA 5EW3A 2Y9QA 4EC9A 1PRYA 3V5PA 3WF8A 3GC7A 1IAHA 4KKEA 3MA3A 2GNGA 4RWKA 4PNKA 1LP4A 3FKOA 5J9LA 1YHWA 4XX9A 4BDEA 3EQHA 3QX4A 2X7GA 2PVFA 4AACA 5L6OA 4JBOA 4U3ZA 5LCJA 4KUJA 4G2FA 4HYIA 4PP9A 2AUHA 3MFUA 4BGGA 4EOMA 5IA1A 4I6FA 4A7CA 4O7LA 4B8MA 1B38A 3O8UA 2ZM3A 3F3WA 4MBJA 3TIZA 2QOBA 4A9SA 2BIYA 3TL8A 1R1WA 4ZTRA 3A60A 3D5XA 4QMSA 4ZLOA 3OW3A 3ZM4A 3DJ7A 3RPYA 3CTJA 2OI4X 3F2AA 3KCFA 2C0OA 2QLQA 1IAJA 3L9NA 3DK3A 4LQMA 3VS5A 4DFBA 5GHVA 5C27A 4GFGA 2HZIA 4EH8A 4AOTA 2CN8A 5CSXA 2YM4A 4IAYA 5J1WA 2CNQA 4XLIA 5CT0A 4C35A 4GKHA 3LW0A 1DAWA 3QLFA 3MH2A 4FTQA 3ORIA 4O7RA 3W18A 2ITXA 3OEZA 3C0HA 3VUMA 3ORZA 3UIUA 3W2SA 4J99A 3MJ1A 2XEYA 1JSUA 5AV1A 4QMTA 3OOGA 5E8SA 5FWKK 3KMUA 5EHLA 3G5DA 4M97A 4YPSA 3LXKA 5LVPA 1MP8A 3BYSA 1JOWB 4PUZA 2YWVA 2WMVA 1B6CB 2RIOA 3BPRA 2XJ2A 4YBKA 4BCPA 3EKKA 4WRSA 2WHBA 3ZS5A 4C34A 3POZA 3UVQA 3VS3A 4KB8A 4QMYA 3H10A 5AJQA 5TE0A 3WZKA 4F65A 5ACKA 1Q8UA 4NFNA 4HNFA 3S95A 3ROYA 3GOPA 2R7BA 3MY5A 4WOVA 2NRUA 5HG8A 3ZHPC 2XNNA 2WEIA 3CLYA 2RF9A 4WBOA 1UNLA 4GJ2A 3NYVA 2W1CA 2QC6A 1H24A 3QUDA 3E93A 3U4WA 3CJGA 5AUUA 3BU6A 3KRJA 3UZTA 4D9UA 4FE2A 2W4JA 4ZJIA 3C1XA 4FA2A 2GFCA 2YM7A 3BWFA 4QPMA 3KKVA 3W33A 2CNUA 5C01A 4O0VA 2UW3A 4AZTA 4AF3A 4W4XA 3G9NA 3HV4A 3FLSA 4C4IA 1CMKE 1M2QA 2RFDA 3P1AA 4QYEA 4YSMA 5AUXA 3VBXA 3WZEA 1YWRA 2CKOA 2FUMA 3LXLA 5CAPA 4C59A 2ZVAA 4GMYA 1U54B 4AN2A 4AG8A 1JKTA 2IVSA 2GTMA 1LPUA 1OPKA 4IFCA 3QC4A 4ZS4A 2CKEA 2XB7A 3L1SA 5KZ0A 5I9WA 2C0TA 3O17A 5L2QA 3ZSGA 4AGCA 3I6UA 5JEBA 3KQ7A 4FNXA 4M7IA 3R8VA 4BI2A 5JQ8A 4R8QA 1NVQA 2W0JA 2PMOX 5EDRA 2KULA 3DAJA 2V55A 3U9NA 2WFYA 2Q83A 2C69A 1X8BA 3R1SA 3VQHA 2HELA 3FDNA 1ZYLA 3LMHA 1VYZA 2GDOA 4B99A 4RJ7A 2Z7QA 2C5VA 4Y85A 3HUCA 4EK6A 3TNIA 2JD5A 4OTWA 3WE8A 1KE9A 2QR8A 3ULIA 4CVAA 2XVDA 5CU4A 5GZ8A 5GJFA 2BRNA 4E93A 4PMMA 3K2LA 3PA4A 2IN6A 4JXFA 3TKIA 3ZDUA 3HGKA 4PNIA 4OTHA 4RX5A 3OWPA 5B2MA 4PY1A 5LWMA 1H8FA 2W9FB 2ITPA 4W8EA 4BCHA 1HOWA 2VTOA 4ENXA 4O1PA 4HPUE 3EN4A 2X8EA 5CZHA 4MX9A 4XHKB 4OBOA 1PXJA 5J95A 4IVDA 5EI8A 3UOJA 2QKRA 3ZBFA 5CTPA 4YZCA 4F7LA 3L9LA 4APPA 5IQAA 3UYTA 4HPTE 3PRIA 5F95A 3VF8A 5DNRA 4CTCA 1L3RE 3R6XA 2A4LA 4IADA 2BFYA 5TO8A 4IBMA 4BGHA 5K5XA 2XM8A 4EONA 3QFVA 3MJ2A 4LL0A 4EHEA 2WTIA 3R02A 3MS9A 5BUEA 1DAYA 3VS0A 3P5KA 3AC4A 4FOCA 4PMPA 3F7ZA 1URWA 4IVBA 3W8QA 3OHTA 4WUAA 4Y95A 2ZYBA 4ZTSA 1H01A 3ZUVA 5CSPA 5AIRA 1W0XC 2W17A 4O6LA 5D10A 2JLDA 4CLIA 1OGUA 4NT4A 4FTAA 5ACBC 4BBFA 1R78A 3OBJA 3VS1A 3WARA 1JSTA 5K4JA 5HCXA 1UWHA 2YM3A 5BNJA 4IAZA 3EN9A 4J7BA 3IGGA 4FV0A 1XBCA 2IVTA 3CKXA 5CALA 3ZEWA 5KBQA 1OVEA 4KS8A 4BIBA 5HE2A 1QL6A 4JT3A 5G1XA 5LVMA 4Y5HA 2VZ6A 3MPAA 1P5EA 1TQPA 4FIJA 4YO6A 3RWPA 3UPXA 5I9XA 2WNTA 3HZTA 3QQKA 3R83A 3R1QA 4GW8A 5AV3A 3R8MA 4C2WA 1SM2A 3NX8A 2JBOA 3AD6A 5HO6A 4ASDA 3EKNA 4ACCA 2VX3A 2VWVA 5FUTA 1UWJA 5IPJA 3ZC5A 4ZTQA 3AT2A 3VUIA 2XIZA 3NNVA 4FNWA 3LFAA 4K0YA 3HUBA 2JIVA 3F66A 2DYLA 4LI5A 5DR9A 4I5MA 3WIGA 2CGXA 3FYKX 3OXIA 4TNBA 2VTNA 3EQRA 3O23A 1FVRA 3SLSA 2PE1A 3AC3A 3O96A 5AUTA 2CMWA 3FC1X 2IVUA 5C4KA 2XCHA 4YBJA 4KIQA 5AV4A 4J8MA 4DBXA 4F0IA 2F7XE 1IASA 4RLKA 3KVXA 4F9BA 3A7HA 2FA2A 4H1MA 2W5BA 4G6OA 3RI1A 5EK7A 3R7YA 3O2MA 4FSTA 4O91A 3DNEA 3ZZWA 2PMIA 3HRCA 2VTIA 4H39A 4KD1A 4N4SA 1SMHA 4YJSA 2ITQA 4II5A 3QRJA 5E1SA 4UN0C 3ODYX 4OBPA 4NJ3A 5LCKA 4FK3A 3V5WA 4CGAA 1J3HA 4JX3A 1CKJA 3Q4CA 5KHXA 5IQHA 4GU9A 3DQXA 2X8DA 4RX9A 3RNIA 2GNFA 2W4OA 2QODA 2WZJA 3R0TA 3FMMA 3GI3A 4WNKA 4C33A 4ZIMA 2ZV9A 5LVNA 2YCRA 4DGLC 3QRIA 5M57A 2C6EA 1ZYJA 4D2WA 4AN9A 2CSNA 1GOLA 2UW0A 3AGLA 4B7TA 2QKWB 4YURA 5ANDA 3BEAA 4BYIA 2JC6A 3KXGA 2BMCA 3D7TA 4J98A 5CSVA 4YC3A 3SOAA 3VJOA 4ZY4A 5HTIA 3D7ZA 4IVAA 2IJMA 3LJ1A 4I94A 3T3UA 3L8VA 1IEPA 1S9JA 3EHAA 3WE4A 2FSLX 3OCSA 2XMYA 4CYJA 3UO5A 3IONA 2GNHA 1NVRA 4FTUA 5AV0A 4E4XA 1P14A 5HO8A 4ZZNA 3NIZA 4IB3A 4X2JA 2YAKA 4BWPA 2W1GA 3C4FA 2IO6A 2ZV2A 5J5SA 3R7IA 5HIEA 4RA4A 2EXCX 4BDHA 3PY3A 5KBRA 5M07A 3BHYA 2O65A 3HAVA 4RLLA 4CQGA 4ZS0A 3NDMA 2BPMA 2RSVA 1R0EA 3BHUA 3MVLA 4K8AA 4V0GA 3VS4A 2PZYA 4XP3A 4EEVA 5JK3A 2EB2A 4G31A 4FIHA 3UDBA 2JAVA 4MNFA 5H2UA 1W7HA 5FM3A 2J5FA 3HV5A 4ARKA 3KC3A 4LOPA 4EBWA 2A27A 5M09A 3ZC6A 4L9IA 4RWLA 2WOUA 3EQDA 4DGMA 4OBQA 4WO5A 4U41A 1JKLA 4WBBB 1KSWA 3AD5A 3L8SA 5GZ9A 4FC0A 3QXPA 3CD8A 3N4UA 1OKVA 5E8YA 3EN5A 3W55A 1OUYA 1OIUA 4RX8A 1TVOA 2XKDA 2Z8CA 2C68A 3PIZA 3MPMA 2BALA 4DCAA 3GU4A 1WBOA 3DB6A 2B0QA 4F6WA 4RIYB 2YISA 4TT7A 5EI6A 3QD2B 5E4HA 3IDPA 2I7QA 1YHSA 4BVUA 5B2LA 3CPBA 2V5QA 1ZMUA 4TZRA 4QMZA 5HNIX 3AD4A 1H26A 3ATTA 2C6LA 4BCNA 2UV2A 3V5LA 5CEIA 3E7VA 3FJQE 3HKOA 3DZOA 5KKRC 2J6MA 4E4NA 4H05A 3TT0A 3LLTA 3LJ0A 3R8UA 4C38A 3MH3A 3VW8A 3UO4A 2BAQA 5BUIA 3L8PA 3EMGA 4X2GA 1T45A 3QF9A 5CU3A 4CRLA 5IDNA 2I0EA 2HENA 4ZP5A 2PHKA 3PWYA 5A4QA 3A4PA 4CG8A 4J95A 4QTBA 4CFXA 3FPQA 3RZFA 3II5A 4MTAA 4ZTLA 2Y6MA 1M52A 3QLGA 1NA7A 3TTIA 2PVKA 3ZLSA 3PXZA 4PMTA 3OVVA 3RK5A 4PDPA 2GMXA 5HLNA 3K54A 5I3OA 4QNAA 2QO2A 4XBRA 4RC3A 3WI6A 4J8NA 1KV2A 2PMLX 5IG1A 4OTRA 5EKOA 4C2VA 5AUYA 1ERKA 4Q9SA 4IH8A 2WAJA 2OH4A 4MH7A 5EHYA 4NEUA 5CQUA 3TV6A 2IZTA 4EKKA 4J1RA 3ORLA 2B9IA 3ZU7A 3DFCB 1Q3DA 3HMNA 1E9HA 2XKEA 2IW6A 1ZYDA 3Q53A 4RFYA 5F1ZA 4UXLA 4DFLA 4YJVA 1EH4A 2UW7A 5JZJA 3Q32A 4I6BA 5I5ZA 4GIHA 4UWYA 2PULA 4MBIA 2PTKA 4Z7HA 5EFQA 2HY81 5DR2A 5BVKA 2O3PA 3QTXA 4MXOA 4YLJA 1PMNA 2O5KA 2XA4A 4FUXA 5CXHA 5HE3A 3RM6A 1CTPE 3RWQA 2E9NA 1H27A 5D7AA 4NK9A 2R3OA 5M53A 4I0TA 4EC8A 5HG7A 3WF6A 2G2HA 4QMNA 3COHA 4JIAA 4JRVA 3PG1A 4EQMA 4BFMA 3QKKA 2YJSA 3S4QA 4AA0A 2QU5A 4ITIA 3BV2A 4XV1A 3BHTA 3Q5ZA 4RC2A 2VD5A 4H3QA 1OL1A 3C50A 4RQVA 5KZIA 5T3QA 4AE6A 4Q2AA 5E8UA 2E9VA 4MNEA 1H1PA 4MBLA 2CGUA 4FKVA 1Q8YA 4Z55A 1GIJA 4M66A 2ITTA 3H3CA 3ZDIA 5IUIA 3PSBA 2VWUA 3E88A 4HJOA 3FXZA 3KXMA 2Y4IB 3S00A 2C4GA 3C4XA 2IZUA 3ETAA 3HVCA 3MWUA 3R8PA 3F2NA 4D2RA 3FMJA 4EL9A 1HCKA 3GVUA 2ZB1A 4OLIA 3U55A 2GHLA 4WT6A 3KMWA 5FBOA 4OUCA 4RZWA 2BDFA 3F5UA 4KRDA 1UU3A 3PY1A 3GC8A 5CI7A 1M7NA 3R2YA 3C4EA 1CM8A 2HIWA 4ALWA 5A6NA 3KXXA 3R9DA 4FTIA 3UG2A 3N4VA 2FH9A 2OXXA 3F7WA 3QZFA 5AR8A 3RZBA 4D55A 4YNEA 3D94A 3DY7A 4B0GA 2QVSE 1MRYA 3QTWA 1KOAA 4ALVA 4QP4A 3OT8A 3NNUA 4YPDA 3ENMA 4F6SA 4YMJA 3ZOSA 2JDTA 3EFLA 4BYJA 2UZNA 2VTLA 4HZRA 2YIRA 3DDQA 5AX9A 3AC5A 5HX8A 1GIIA 4C36A 1PXMA 3KU2A 4FEQA 3S1HA 3QQUA 5AUZA 5IKWA 4DG3E 2X1NA 5KHWA 4AOIA 4HCVA 5J7HA 4USEA 2VO3A 5HE1A 1RJBA 2CGWA 3ZBXA 4EJ7A 4JG8A 2XK8A 4R7BA 3BE2A 1SYKA 1FPUA 3ORNA 3V6RA 2VX0A 5HD4A 2GS7A 3C0GA 4F99A 3QA8A 4WHZA 3NW5A 2A1AB 4AGWA 4FV6A 4BZDA 4FV7A 4KIOA 2R3KA 3HLLA 2R3HA 4EH5A 2GSFA 4D2TA 2C6MA 1RDQE 3JXWA 4GJ3A 4E6AA 2IVVA 5L2WA 5DPVA 5M4IA 2HZ4A 3GXLA 1SVHA 1JBPE 3MDYA 4ZY6A 3QAME 3OS3A 1YXSA 4I21A 2E9UA 1YI3A 1ZMVA 2CN5A 3UIMA 1XQZA 4F70A 4PWNA 2C6IA 1PXIA 2Z2WA 4LL5A 3QA0A 2PK9A 4GT3A 5CLPA 2RFEA 3VBTA 5KMNA 3PSDA 3TZ8A 5A4LA 1FVTA 5LMKC 2H34A 3ATSA 2YWPA 3Q4UA 3W32A 5I9VA 4FSUA 1FINA 4MAOA 2VTQA 3OBGA 1YDRE 4DA5A 2WTKB 4KBKA 4DTAA 5CENA 3E92A 5DYJA 3IOKA 2P55A 3VRZA 3DS6A 4K33A 2XK6A 2X2LA 4QP7A 3GQIA 3TNPC 4IM0A 4ANMA 4QP8A 1A48A 4KIKB 4RRVA 2UVYA 3OC1A 3W2QA 4FTNA 4K6ZA 4L53A 2IZSA 3PP0A 5LARA 3Q2MA 2I0YA 4CKJA 5ANGA 5GIPE 2WKMA 4FKSA 4EKLA 4NW6A 3REPA 3NZ0A 3PRFA 1Z57A 5CAOA 2WMUA 4FSYA 4FV5A 2R3LA 4XMOA 5K9IA 1Y8YA 3CXWA 3NAXA 1UA2A 3PSCA 1TKIA 4KA3A 3T9TA 4IEBA 5HIDA 4MEDA 4NIFB 4G3CA 2XK9A 5EM6A 4ZMEA 5CF6A 3VC4A 4BKZA 4O0XA 3KXZA 3OW4A 5I3RA 1J1BA 2W05A 4GU6A 3VBVA 5I9ZA 4AA4A 4RJ6A 2SRCA 2C3LA 4FGRA 4LOOA 4F7JA 4FTTA 4TYJA 3FC2A 4M13A 4GRBA 4MWHA 3WF9A 4HVHA 4AFEA 4EOPA 3R7UA 4MYGA 5CEQA 3PPJA 2QOCA 4C61A 3VQUA 3B8RA 4FG7A 3H9FA 3I0OA 4QPSA 2VTRA 2XNEA 5DE2A 4D9TA 2HZNA 5BPYA 5IA2A 3AMYA 5LMBA 5HOAA 3QX2A 2E2BA 4PL4A 2IG7A 5IEYA 3DV3A 4JOAA 3TKUA 4QTDA 1W83A 3BHVA 4GS6A 3D9VA 1Q99A 5AAFA 3R8ZA 1MUOA 3DNDA 4ZMFA 1E1XA 3Q2JA 3PWDA 4FSNA 3LVPA 4HGSA 1Q4LA 4BCIA 4XCUA 3FLQA 5ETCA 1V0PA 5J7BA 4DLJA 1H25A 1WZYA 3GEQA 4UB7A 3OMVA 5HORA 5HD7A 3KL8A 5E8XA 1XH7A 3HRBA 5L3AA 3TN8A 2OGVA 1Q3WA 4UZHA 4R6VA 1H1RA 3D5VA 1PHKA 3NWWA 4UWBA 5LQFA 3Q9XA 4AW5A 3UIBA 1IG1A 5EM7A 4BWXA 3LQ8A 2PWLA 3AMBA 4K18A 5IMXA 3UTOA 3JYAA 4ZTHA 5IQFA 4PQNA 2C3JA 4LRMA 4BCJA 4FSQA 4JAIA 2E9PA 3BQRA 3F88A 3NUXA 5AP4A 2QQ7A 3HECA 4R7IA 3MIAA 4M69B 3EN7A 1AGWA 5DR6A 2X9FA 2W96B 3DKOA 3JVSA 4GUBA 5HX6A 4QO9A 5F20A 2GU8A 2J51A 2PL0A 2C6TA 4KNBA 4EH2A 3GFEA 4X3JA 4JIKA 2GQGA 4TKSA 3CEKA 3EH9A 2NP8A 4JRNA 2CGVA 4XNEA 5DBXA 2W1ZA 3R01A 2V0DA 3O7LB 5HICA 3IQ7A 4BTKA 5JFWA 3NRMA 4QMOA 5IH5A 3RAHA 1YDSE 2XK4A 4O6EA 3D5WA 2R4BA 3ZFXA 2LGCA 3M11A 4EUUA 4X3FA 3G0FA 4ONAA 3HAMA 3NUSA 1REJA 2W99B 2Y4IC 3DBEA 3I0QA 4C0TA 2PSQA 5DOSA 5HKMA 5DN3A 3O8TA 4EK5A 4EBVA 4FMQA 5B2KA 5HVKA 3HMIA 3KK8A 5D12A 4EZ3A 2WMQA 2J5EA 1U4DA 1Y8GA 4ITJA 4N6ZA 4V04A 4D4VA 5CASA 4DEAA 3A7IA 1YXVA 4RVLA 4KBCA 2NPQA 3H9RA 2WQNA 2VN9A 3C4WA 4NH1A 5HNGA 3ULZA 1OPLA 3WYXA 4FV1A 3BU3A 3IKAA 5DEYA 1B39A 4XG7A 3RPVA 5IH4A 4XS2A 4EH6A 3PE2A 4X2FA 3KXNA 3R04A 4TYHB 3EZVA 3LFCA 4CCBA 5FQDC 3TV4A 3F5PA 5CAQA 2ESMA 2OIQA 4S32A 2BROA 5HBJA 3OY1A 2YN8A 4FKQA 3OCBA 4O81A 3FUPA 1Z9XA 3GU6A 2YLFA 2OXDA 4I6HA 3OWKA 3QD3A 5CAVA 3G0EA 4BDFA 5JRSA 4BY9E 3IECA 2E9OA 3DBFA 4JQ8A 5LVLA 3VWAA 3VBYA 2G01A 4AAAA 3VHKA 3WIKA 4ANBA 4NIFA 1W8CA 2BCJA 2AC3A 3ZZEA 4BDJA 3Q5IA 1U59A 1XBBA 3HDMA 5HNBA 4EUTA 4E73A 4ZJVA 3FZSA 1KE5A 2G2IA 3MFTA 3W2PA 3OT3A 5AP3A 3IPHA 1JSVA 4UMRA 5KO1A 4JBPA 4DFZE 2FSMX 3OCTA 3VS6A 3CP9A 4PDYA 1PXNA 3IW4A 4NZWB 3TUCA 5C26A 5D11A 4B9DA 2UZVA 4C8BA 4EQCA 2BKZA 4RSSA 4LOQA 4DFYA 5TR6A 3UQGA 3R22A 4FEWA 3EFKA 4QP9A 2YHVA 4J53A 3Q9YA 4X3FC 1OPJA 3G33A 3NUNA 3OF0A 4FKLA 3EQBA 1I44A 2OF4A 4PTCA 4QMUA 5A9UA 1O6YA 4W4YA 1XH4A 4DHFA 2B4SB 4RIOA 4MF0A 1ZOGA 4FIGA 3GP0A 3K5VA 4QP1A 1UU9A 2XNBA 5F4NA 3MN3A 2NRYA 1RQQA 2WTKC 2UZLA 2FVDA 4DYMA 5C4LA 1WVYA 4TNDA 2PVMA 4NL0A 2BAKA 5I9YA 4F9CA 3KRWA 2YIQA 4YC6A 4FTMA 4BR3A 5DVRA 3EQPA 4C02A 4Q5HA 5EDQA 3IOPA 4DGNA 2WTVA 2KTYA 4BBEA 3FBVA 3G2FA 4BICA 2BIKB 2G15A 2XIXA 3QTUA 4I24A 4K1BA 3R9RA 2WMBA 2YDKA 4M69A 4FVPA 3K3IA 3NUPA 1UKIA 4R1VA 1U46A 2QURA 3BV3A 2R3PA 4PDOA 4PMSA 4DTBA 4YO4A 3OD6X 2C5YA 4KINA 1F5QA 4C4HA 4ZJJA 3SGCA 5L2SA 1QCFA 4XYFA 4U40A 4MQ1A 2OU7A 2X6DA 3SRVA 5EYMA 4WG5A 3TZ7A 3V8SA 1XH9A 4GH2A 3I7CA 2J0KA 4C4JA 4MXCA 3H0ZA 5FDXA 4PPBA 4GCJA 4P5QA 1OI9A 2BDWA 2C5NA 4FICA 2HAKA 1W98A 4TYGA 3O0GA 4L67A 3DKGA 4N70A 3HMOA 4CT2A 3LKMA 2JDSA 3VBQA 4LUEA 3WF7A 4QMPA 4E1ZA 3U4UA 3L9MA 4L45A 3RAIA 4ZLYA 3FQHA 4EH4A 3C5UA 5J79A 1BL6A 4CKIA 1OKYA 3I81A 4HYHA 1OIQA 3I6WA 3DU8A 5ANIA 5ANEA 3QZGA 5CANA 2QONA 3HMPA 5IQEA 2R3NA 5J8IA 2GHGA 3Q3BA 4TYHA 3QWKA 4UALA 3CTHA 4FT0A 1OM1A 4JBVA 3F69A 5LWNA 4U97A 4KKGA 3PXYA 2OJJA 4YZDA 3RHXA 2XKCA 3NAYA 2XUUA 2OW3A 5IA3A 2GNLA 5B0XA 4M8TA 4AGDA 3NCZA 3GC9A 1OIRA 2OJFE 2J7TA 3N51A 2OK1A 5GNKA 4DEHA 3ZRMA 2XK7A 2XNGA 3FXWA 4BF2A 4DFNA 3ZLYA 2QO7A 4RC4A 4O7WA 4NTSA 1IA9A 5AM6A 4HGEA 4GFMA 5K3YA 4YTIA 3PVBA 3NNWA 3QHRA 3VF9A 2YM6A 3QTSA 4ZXTA 4YJRA 4ASEA 4YHJA 4DCEA 4PX6A 5A54A 4D0WA 4G3DA 1H1WA 2HW6A 4CMUA 2RG6A 2YZAA 4TL0A 2ZJWA 4G5PA 2Z7LA 4W8DA 5CVGA 5CEKA 4WD5A 3G6GA 4ZSGA 3MYGA 1WBVA 4I93A 4IXPA 5CU0A 5HVYA 3AOXA 3MSSA 4ACMA 1VZOA 2YEXA 3IG7A 4D2VA 4LRJA 3CGFA 5AWMA 1DI9A 2F2UA 3FZ1A 1S9IA 3FMHA 3TACA 1DI8A 4S34A 4F7SA 5DMZA 4G6NA 4B6LA 5KX8A 2FO0A 2VWIA 5HZNA 3HEGA 2PZPA 3IGOA 4IFGA 4RJ3A 5C8KA 5C8NA 1YXTA 2NNWB 3AQVA 1XH8A 4GYIA 4JQEA 5AAEA 3QHWA 4F9WA 2WTJA 3PJ2A 4FTOA 4UMQA 3KXHA 4Z3VA 2J0MB 3QQLA 2ONLC 4D2PA 3Q96A 2BFXA 3FY2A 2PVRA 4H3BA 4P4CA 2VNWA 3DBCA 1RE8A 1ZOEA 3ZFMA 1YWNA 3UOLA 4BDDA 3MI9A 5HBHA 5DRDA 1I09A 3GQLA 4AS0A 2R9SA 4ZSAA 2ZMCA 2J4ZA 4M3QA 4BDKA 3HA8A 5DLSA 5BYLA 2YABA 2QOQA 4U42A 3OROA 1ZZ2A 4USDA 3ZCLA 5K5NA 1QPJA 4DEIA 1JWHA 1Q62A 1UKHA 2QG5A 4RJ8A 4XLVA 1PJKA 5AADA 5AFVA 4GG5A 4KBAA 4NCTA 3P4KA 3CY3A 2OKRA 3C13A 3G15A 3GOKA 5JFXA 4NSTA 5DGZA 2OBJA 1GAGA 1RW8A 1H07A 4IZ7A 4QP6A 3P7AA 1U54A 4JX7A 2W1DA 3UNZA 4ZAUA 5CF5A 2ERKA 3C5IA 4MKCA 2WIHA 4F0GA 4WIHA 1XWSA 1IRKA 3SXSA 1AQ1A 2YZLA 1YDTE 4QTCA 2OFUA 3ERKA 2WMTA 3I4BA 2W5HA 4C7TA 3CPCA 4O96A 2RGPA 4MXZA 4TYIA 1ZYCA 3F3UA 2Z60A 3R7VA 5C1QB 4DF3A 4X21A 4E20A 5D7VA 5E92A 4QMVA 2PU8A 4JVGA 4JDHA 3RCDA 3P78A 3LM0A 3V04A 4BCFA 1P4FA 4MVFA 5EDPA 5KCVA 3F2RA 3LFBA 3PDTA 3FYJX 4TTHB 4JJRA 4U5JA 4ZSJA 3R9HA 4BIDA 3FMDA 3FLYA 4EI4A 5EI2A 1NT2A 1GZKA 3QTQA 3ORPA 4Y46A 4FVQA 4Z9LA 2UW8A 3WOWA 2J50A 4E6QA 4ZLZA 3U6HA 2YCQA 2XIYA 3SHEA 3DLSA 2P4IA 2XJ1A 3P86A 4LYNA 3QWJA 3EOCA 3UC4A 4IWDA 4BN1A 4ORKA 3DAKA 2OH0E 4QNYA 1L8TA 3FEGA 4BDIA 4BIEA 3FZTA 4FNYA 4X2NA 4KIPA 3P0MA 1KE8A 4DLIA 4OW8A 1JKSA 3QCXA 4YU2A 3FI2A 1NY3A 4S30A 4EK4A 3GCQA 3UNJA 2ACXA 4U45A 5JH6A 2VUWA 5AR2A 4NTTA 1J1CA 2XIKA 4C3FA 2GS6A 4I5PA 4NCTC 4F9YA 1OBGA 1YOMA 2VO7A 3GU5A 3OXTA 1PXPA 2PUUA 3EZRA 3QCYA 4L3JA 4FL2A 4BZOA 2F49A 3EYGA 5EHOA 4EQUA 4QYFA 5L4QA 4I0RA 3W2OA 4D1XA 4QTEA 2HWOA 4CMOA 3QU0A 5HE0A 2Y6OA 3QRTA 4O84A 2ITOA 3HV6A 5JSMA 1H0WA 3MA6A 3NEWA 2XRUA 2RFNA 4AXAA 4O7VA 2H96A 3LMIA 2OSCA 4LV8A 5M4FA 3LXPA 2WQMA 5FXQA 2ZM1A 4PV0A 4L3PA 1A9UA 2XNOA 2WELA 3MIYA 3O50A 3ORMA 2DUVA 4L3LA 2JDRA 3MFSA 4FV2A 5EYDA 2UZUE 2VWXA 3ZO2A 1MQ4A 2QHNA 5IUHA 1BL7A 4CSVA 3AC2A 4GEOA 4EOJA 4IB0A 1JPAA 4NM5A 4AW2A 2VO0A 3R71A 4MXYA 3F5GA 4M84A 3TJDA 4FT9A 3VAPA 4AP7A 4ANNA 3GC0A 4ERKA 5HHWA 4PF4A 5CNOA 4XP0A 1ATPE 4XG9A 2OWBA 3TCPA 3BWJA 3E3BX 3QTIA 4R7HA 2C5XA 4R5SA 1FMOE 2I40A 2VTTA 2YERA 1DM2A 3EFWA 4F1TA 2RFSA 1FGIA 4C3RA 1VYWA 2B54A 2UZBA 4FKPA 4AZSA 3FMKA 4IAKA 3NCGA 4W4VA 2X2KA 2FB8A 3SW4A 2A0CX 4HVSA 4QTAA 3PTGA 4FOBA 1XR1A 4IVCA 1PKDA 3KREA 3QUPA 5IEXA 2OJIA 3PIYA 4J96A 3HV3A 4E4LA 2HXLA 4RBLA 3PLSA 3DBDA 3HL7A 4BCQA 4HVGA 1Q8TA 4YTHA 2XYNA 3NMUF 5C9CA 5IQIA 4DEEA 4KSPA 4MK0A 5K4IA 4GVAA 4FEVA 3FXXA 3KN6A 1PYXA 4CZTA 3GT8A 2J0IA 3PXFA 5HLPA 3ZYAA 1FVVA 2QNJA 2JKQA 4FKUA 3FQEA 2BDJA 3R7OA 1DS5A 2V7AA 4U80A 5J1VA 5A46A 3V3VA 1Y91A 3KFAA 3SC1A 2VTHA 3PJCA 3ZSIA 5LVOA 1YQJA 5FEEA 4BDBA 3HRFA 5GJGA 2QOHA 5KUPA 1BKXA 3V5JA 4ZTNA 3QGYA 3ODZX 3LAUA 3CKWA 5AP5A 5DRBA 4U81A 5AR3A 4C3PA 5HLWA 5KMJA 4PL3A 3A2CA 3UQFA 3LCSA 2W5AA 2Y0AA 3GNIB 3QBNA 4EOQA 2QG7A 3QKLA 4E6CA 3N9XA 3I60A 1BLXA 5EOLA 2WTDA 4G9RA 1FOTA 4PPAA 1R39A 5CX9A 2VTAA 3JY9A 3SXFA 3GCSA 4F09A 1U5RA 2XZSA 3RJCA 1OB3A 4Q9ZA 4XOZA 3CY2A 2BZIB 2Y7JA 4QQ5A 4F7NA 3LIJA 4F6UA 5LMKA 1YI6A 1ZY5A 5AP6A 2JDOA 2CLQA 1WAKA 4FIEA 4DE4A 2I0HA 5CSHA 3IDBA 5E91A 4C4GA 4DH5A 5JN2A 3KMMA 2ITYA 3PE1A 3R30A 3ZUUA 4QOXA 3R28A 2Z02A 5AP7A 2UW5A 4EWQA 3SVVA 5E8TA 2QI8A 2OZAB 3FPMA 4TW9A 4BRXA 3D15A 3KVWA 3T8OA 3V51A 2BVAA 3BZ3A 4D4SA 4PDSA 3E62A 3S2PA 3BKBA 3SD0A 5J9ZA 4UXQA 4U43A 4HNIA 4DG2E 3TNWA 4H1JA 5BVNA 5CU2A 3GGFA 2B1PA 4JR3A 5FBNC 4RIYA 4AT4A 3BYMA 4JNWA 3TZMA 4CV8A 4MF1A 4IWOA 4O21A 2BZKB 2I1MA 5AP2A 5I0BA 4E4MA 5IA0A 2R3IA 3QQHA 2OJ9A 2UW9A 4BWKA 2UW6A 3VN9A 4F1OA 3UZPA 2ZDUA 2X7OA 4GYGA 4ACHA 3OXZA 4R77A 1H28A 3V6SA 1VEBA 3UPZA 5KMMA 1LEZA 1BUHA 1YWVA 2WMAA 4IB1A 3SX9A 3VHEA 4P7EA 4PPCA 3BBWA 4FL1A 5FDPA 4KS7A 2UUEA 3DZQA 3U6JA 4XG2A 3SAYA 3UMWA 4E8AA 1ZMWA 3QD0A 4NKAA 3MTLA 3SXRA 4EHVA 1OBDA 5LXMA 4FG8A 4J52A 4C62A 2PZIA 5IA5A 4I5CA 3BGZA 5I4NA 5E8ZA 4EOSA 4KRCA 5EYKA 1SVGA 2C1BA 2GNIA 2Y8OA 3BX5A 2VV9A 4WRGA 2YDJA 2HOGA 1KUTA 2X9EA 1JKKA 3AXWA 3MFRA 4UEUA 2H6DA 3E8CA 3ZTXA 3MTFA 4HCUA 4IACA 3UIXA 4IMYA 3FHIA 5AV2A 4YTCA 4BC6A 2HWPA 2IW9A 1MRUA 4WSQA 3I5NA 2C47A 2WQOA 3MBLA 3A7FA 4YZ9A 4CFNA 4D5HA 5JGDA 3PP1A 4A4OA 2XBAA 1KE7A 3MB7A 4ID7A 5AIKA 4DFXE 1TQIA 2XYUA 3QRUA 4TN6A 3VW6A 3EIDA 4IX3A 3EJ1A 3HDNA 3E8NA 3GB2A 4JBQA 3ZO4A 4HVDA 5FXRA 5ANOA 1CSNA 5FM2A 4Y72A 3TG1A 3U87A 3N4TA 3WZUA 4ASZA 4YHFA 3ORXA 4B4LA 2R0IA 5HU3A 2PUPA 1M14A 2R7IA 5KNJA 4ZSLA 4BHZA 4PTGA 2ITZA 4GV1A 4XOYA 2QLUA 3FI4A 5ICPA 1ZRZA 3UE4A 3CJFA 3NYNA 4LGDA 4CLJA 1LR4A 4XBUA 2XEZA 4JG6A 1P2AA 4L7SA 4EJNA 2CKPA 5G6VA 1YKRA 4X6QC 5TKDA 5E8VA 2C1AA 3NW6A 4BCMA 3P9JA 5E8WA 2WMXA 3PY0A 1UNGA 1HCLA 4J97A 4A9TA 3WBLA 5M4UA 3KY2A 2PZRA 3DKCA 3WZDA 3DQWA 2XRWA 2DWBA 3TNHA 3W16A 4NYEA 4ZZOA 1YXXA 4EZ5A 3SA0A 3RVGA 2BR1A 5BX0A 3A4OX 3LFQA 4JG7A 3SW7A 4MD8E 3UYSA 4O7ZA 4WSYA 3KCKA 4BTJA 4FSMA 4E26A 5JFVA 3W1FA 2W4KA 1V0OA 4FK6A 3MGYA 3M1SA 3IW6A 2XM9A 3MY1A 1XH6A 1Z5MA 2YDIA 4DC2A 2UZTA 4W9WA 2EXEA 3EB0A 3PVGA 4B8LA 2UVXA 5DI1A 5FGKA 5L2IA 1Q8WA 3EN6A 2HW7A 3OUKA 5EW9A 4BCKA 4Y5QA 4DT8A 3ZO3A 1YI4A 4XH6A 5CZIA 3RM7A 3B2WA 2CDZA 3ZEPA 1PF8A 3FE3A 3NPCA 4OTFA 5JKGA 3U8WA 1M17A 2GCDA 3WYYA 3FLNC 3UG1A 4FODA 4IW0A 2EUFB 1H00A 3UJGA 2GQRA 1OL5A 3RTPA 5CF8A 3AG9A 2YACA 5E1EA 3TV7A 4GT4A 3PZHA 4AN3A 3NLBA 3DGKA 2OXYA 1Q8ZA 2OIBA 2QHMA 4KAOA 4ANQA 3R9OA 2QOKA 5FG8A 3AC8A 2H8HA 2PUIA 1PYEA 1YHVA 3CBLA 2PVJA 3KB7A 5HEZA 4D58A 3FHRA 3TXOA 2A19B 3DJ5A 2ZAZA 4FF8A 5EYCA 4OT6A 1H4LA 1WCCA 2B9JA 3ET7A 3GCVA 5EG3A 3T9IA 4E5AX 1GZNA 4WNOA 1GY3A 3H30A 4DG0E 3FLZA 4CD0A 5EW8A 1ZAOA 4ENYA 3BIZA 2PPQA 2CPKE 4MXXA 4D1SA 3LQ5A 4WKQA 3TUDA 3UOKA 3EL8A 5DH3A 2V22A 4O22A 3UQCA 4AE9A 4YHTA 5JMSA 1A06A 3FMLA 4HOKA 3QQJA 2ITNA 3GU7A 4Q5EA 4CKRA 4DGOA 2H9VA 3VBWA 2P0CA 4ACGA 2C5OA 4I22A 4ERWA 3NUAA 4ZY5A 3IW5A 4EH3A 3SOCA 2QCSA 4FV8A 5H8EA 2UVZA 4FV3A 4JS8A 3KULB 4BBMA 3TZ9A 3MH1A 3LM5A 3P08A 4TWPA 1JAMA 4LM5A 2VRXA 4C37A 3PPKA 4O0TA 4RFZA 1SNUA 3M2WA 3RK7A 5EH0A 2X81A 5M51A 2OFVA 3FZOA 4IZ5A 5J87A 4G6LA 4RQKA 1APME 4OTIA 4KIKA 4CCUA 2BTSA 4K77A 5CNNA 2OF2A 4NWMA 3QYZA 4BZNA 4RJ4A 4HYUA 5CSWA 4AUAA 2WD1A 5CEPA 2PUNA 3QQGA 1ZYSA 2BAJA 4IDTA 4O2PA 5H9BA 4DBNA 3HP2A 4QYYA 1U5QA 3RBWA 4CXAA 3OUNB 4FR4A 4G1WA 3KK9A 4GUEA 2JKOA 5ITAA 4GIIA 2YIWA 3ANRA 2YAAA 4DTKA 5L2TA 4ANOA 2VTSA 2ZDTA 3IK3A 4IDVA 3TWJA 3WZJA 3ZFYA 5IQDA 2CCIA 3AT3A 4D0XA 3R1NA 3SDJA 4N57A 2O64A 4UYNA 5CEOA 4TY1A 3G9LX 3UC3A 4HVIA 1PXOA 5GJDA 3RCJA 2XNMA 3DXNA 2REIA 2WU7A 2R3FA 3DA6A 4KSQA 4OGRA 4RMZA 5HCYA 3TUBA 3Q4ZA 5LOHA 4FUYA 5L8JA 3BELA 4HCTA 1W82A 4MQ2A 5CYIA 5FEDA 2ZM4A 4YZNA 3ZLXA 4A9UA 5F9EA 4FT7A 1JNKA 1ZY4A 2X8IA 3NUYA 3PPZA 5HBEA 4F0FA 4YJTA 2J0JA 5EQYA 3RK9A 3D83A 2IPXA 5DT0A 5HIBA 4LMNA 3CQEA 1Y6BA 2YCFA 4OTDA 4U7ZA 3SQQA 5EQPA 3MVJA 5ETIA 1XHAA 4DEDA 3QQFA 5IMEA 3C4ZA 2YM5A 4BCOA 4M15A 3FKLA 1Q41A 4XJ0A 3QUEA 3MESA 3W8LA 5EQEA 3Q04A 3R21A 5AUVA 4AA5A 4E5BA 3EQFA 5CT7A 4YJPA 3THBA 1H0VA 5F94A 4W9XA 4GT5A 3QRKA 4MD9E 5FLFA 3QKMA 4YTFA 4XG8A 2IZRA 3GCUA 3V8TA 4U79A 3SG8A 2O2UA 4EK8A 4U3YA 5AR5A 5AP0A 3UODA 1PKGA 4ZEGA 1R0PA 3SV0A 2BRGA 1GZOA 4LV5A 5EM8A 2Q0BA 3FV8A 1XJDA 5DIAA 4CQEA 4XEYA 2G9XA 3BGQA 4I92A 4KABA 3B2TA 2WTCA 1V1KA 3LHJA 2BKKA 1PMEA 5BVDA 3NW7A 4A9RA 5AA9A 4R78A 3NNXA 4DEGA 2X4ZA 3LMGA 2ITVA 4GVJA 4H58A 3TKHA 1JQHA 5T6KA 4G5JA 5IH6A 3FI8A 4O7TA 2VWWA 4P90A 4QMMA 2VTMA 4UMTA 3I5ZA 4YJNA 1GIHA 2O8YA 3VIDA 2CKQA 3UP7A 2VU3A 4M0ZA 2CCHA 4AGUA 2XP2A 3DTWA 4FZAB 4D5KA 3JY0A 4AZFA 4D4RA 4QD6A 2IW8A 4A06A 4TWCA 4JDIA 4IIRA 4EORA 2YIYA 5A4EA 1ZXEA 3PVWA 5L8LA 2ONLA 4FSRA 1O9UA 3UZRA 3EYHA 2R5TA 5IQCA 1OZ1A 4EZ7A 4G3EA 3RINA 4EYMA 5C03A 5HTCA 3KULA 5ANJA 4G9CA 4RWIA 4PTEA 1GJOA 5FTQA 1Q5KA 5DHJA 4PP7A 1H1SA 1PMUA 5TF9A 3W10A 2ZV8A 5FEQA 4AOJA 5BVFA 4CMTA 4JI9A 4O0RA 4RVTA 4BKJA 3PUPA 4FKTA 4RPVA 2VX1A 3A99A 3VULA 3ZUTA 5HCZA 4CFMA 4AT3A 2UZOA 4OTQA 3FY0A 4DFUA 4FGBA 3MW1A 3R00A 2I6LA 1Q61A 2BZJA 5IUGA 4IX5A 5KKRB 3Q6WA 2JIIA 3D7TB 5D1JA 5M56A 3NGAA 5D41A 4BB4A 4BTMA 1OL7A 1XH5A 3LCKA 3OOMA 1YOLA 2X7FA 4CTBA 5ETAA 4RX7A 3HA6A 4UX9A 4Z16A 3ACKA 4PL5A 5AUWA 4S2ZA 4CV9A 4O0SA 5EKNA 4L68A 5KMLA 4FIFA 5DG5A 4KKHA 3UGCA 4IC7A 4I6QA 2C6KA 2QOOA 4FTRA 4JLCA 1IA8A 2BRHA 4N0SA 4V05A 5FP6A 4MHAA 4XV3A 1J91A 2X39A 3RPRA 3IDCA 4D1ZA 1UU8A 2V62A 4QQJA 5M06A 3PLAE 4EOOA 2WGJA 5CWZA 3RHKA 3D4QA 4YNOA 4LRKA 4FBXA 4RIXB 3CQWA 1PXKA 3RP9A 4ITHA 4FTKA 3CTQA 3A61A 2PE2A 4V0GB 3FLWA 2EVAA 1FGKA 4LGHA 5HU9A 3NYXA 2R3MA 2XNPA 4ACDA 3H9OA 5IQGA 4M12A 3F82A 2VNYA 3ZLWA 5HG9A 1SZMA 5AEPA 5IEVA 2ETMA 1PMVA 4F1MA 1CKPA 4IM2A 2WQEA 2F9GA 4GFOA 4FZFB 5I9UA 1PW2A 4U8ZA 2EXMA 4GK4A 3R7EA 4CFWA 4M0YA 2B53A 4CNHA 4D4YA 3B8QA 2ETRA 4IM3A 4EHGA 4GL9A 3NR9A 4KWPA 3ZM9A 3LJ2A 1YVJA 2JITA 4TWNA 3JR1A 3UNKA 2WIPA 3I1AA 2YLEA 4CFUA 2HCKA 4EOKA 3OWLA 4QYHA 3RPSA 1Q97A 2VTPA 4L8MA 1XBAA 2W1EA 5AR4A 1QPDA 5DEWA 4FT3A 3TIYA 2PVLA 3Q52A 4I5HA 1CKIA 1BMKA 2C30A 4O1OA 3KF7A 4FT5A 4QMXA 2F2CB 4EWHA 1M2PA 2FYSA 3DXQA 3E8DA 3BGPA 3TJCA 5JQ5A 3RPOA 3AT4A 4CZUA 1WVXA 4RGJA 3AMAA 3HYHA 3FL5A
chains in the Genus database with same CATH superfamily
4X0MA 3OTUA 3H4JA 2J9MA 1JLUE 1OECA 4AW1A 4BKYA 4GK2A 3DXPA 2BTRA 3BHHA 4O86A 1OKWA 3VUTA 5CI6A 5CY3A 4RWJA 3QXOA 4FVRA 3ELJA 2HY0A 4P5ZA 4L46A 3CGOA 1KOBA 4NU1A 4IAFA 3W2RA 3ID6C 4QDEA 2F4JA 4F63A 3F5XA 4NFMA 4O27B 2J90A 2ZMDA 3W0RA 2PE0A 3BQCA 3A62A 1YXUA 3BYUA 3CR0A 3E63A 3Q9ZA 4NM3A 4QP3A 3HP5A 4FZDB 3ZH8A 5GIOE 3P23A 3VRYA 3VJNA 1KWPA 4FV9A 2GFSA 1PY5A 4YLLA 4XP2A 3FSFA 2WB8A 3JVRA 2EB3A 3QL8A 4L42A 4U0IA 3KRRA 1TQMA 4LUDA 4IB5A 4QYGA 5M08A 2P2IA 4CZYB 3DB8A 3UMXA 3MVMA 4UYAA 2VTJA 2C3IB 4FKGA 1AD5A 4HYSA 3CSVA 3C51A 4DEBA 3D5UA 5IZFA 4L00A 4LFIA 1FBNA 1K9AA 4IE9A 1OITA 3D14A 2BUJA 2BZHB 2GTNA 5AP1A 5BUJA 4X2KA 3TTJA 3ALNA 4ZK5A 4WA9A 1MQBA 3R1YA 4AFJA 3HNGA 4E6DA 4A07A 3DPKA 3FSKA 4O0UA 1FMKA 1Q24A 5C8MA 4FTCA 3TI1A 4OAVB 4TRLA 4MCVA 1WBWA 4O7YA 4FTJA 1F3MC 3AC1A 2YJRA 3WILA 4FYNA 3ANQA 4FI1A 1W84A 3GFWA 4NM0A 1REKA 5TOZA 2X2MA 4DN5A 4YR8A 3QZIA 2QOFA 2Z7RA 2JFLA 4FKJA 4DH3A 4QMQA 3DOGA 2XS0A 3ORTA 3ZXZA 5HTBA 5IF1A 4AWIA 4Z7GA 5CXZA 4FZ6A 1FQ1B 1M7QA 1QMZA 4G3GA 2VGOA 4MNEB 5EOBA 5CS6A 3KN5A 4BDGA 4TXCA 1V0BA 2BRMA 5CU6A 4L6QA 2XH5A 4RIXA 3DBQA 1OKZA 3NVKI 1IR3A 2BHHA 4QRCA 5LMAA 3UP2A 4AQCA 4OT5A 4RZVA 4EH9A 3K5UA 5DT4A 1WFCA 4IX4A 5KMKA 2WPAA 5L6PA 4ZSEA 2ZFYA 2UZDA 2ZOQA 2QOIA 3BLQA 3NS9A 3NUUA 4XG4A 5HGIA 4S31A 4DH1A 4F64A 4BHNA 4QMWA 5BMSA 3LE6A 2ZV7A 4Y8DA 4AT5A 1NW1A 5HVJA 1KV1A 4HZSA 4C4FA 3MB6A 4P2KA 3QCSA 3VUKA 4GK3A 1J7IA 1G5SA 3ALOA 1VR2A 4FZ7A 4O7NA 2C6OA 2R3JA 5L8KA 2OZOA 3BCEA 3ACJA 3RGFA 3U54A 4M14A 3DAEA 4XRJA 3ZMMA 3RNYA 5AAGA 3LOKA 4WG3A 5HI2A 2I0VA 5AA8A 5CEMA 3PIXA 5IU2A 4APCA 4AAYA 4G34A 3PVUA 4TPTA 4FNZA 2JKKA 3W2CA 4EYJA 5E90A 4I0SA 3JS2A 4U9AA 3EWHA 1UNHA 5JGAA 5M4CA 5ETFA 4CRSA 1NXKA 2JBPA 3QTZA 3FQSA 3NIEA 3HV7A 4IX6A 3R73A 1K3AA 2WTWA 2HYYA 2YM8A 3A8XA 3HMMA 3I7BA 3R9NA 1OIYA 3COMA 2YITA 4EHZA 5LJJA 4AU8A 4AX8A 4DDGA 2OIDA 2WOTA 3FWQA 3LFSA 4G17A 4F4PA 1ND4A 5K0XA 2JDVA 5A4CA 2CNVA 2VO6A 2B9FA 3R7GA 4LG4A 3S3IA 3DJ6A 5EM5A 4E7WA 4BCGA 4I1ZA 4I4EA 4NKSA 3MPTA 1ZARA 2Y4PA 2Q0NA 3PA3A 2X6EA 1BI8A 4GSBA 4C4EA 2W1HA 4L52A 4PRJA 5DA3A 4OAUC 2AYPA 4QT1A 5KE0A 5D9HA 2W1IA 3TNQB 3QYWA 3RKBA 4U6RA 2NO3A 5IDPA 3LXNA 2WO6A 4IWQA 1ZOHA 2P33A 4Y83A 2W9ZB 1XO2B 2JAMA 4F08A 4ANLA 5JRQA 5A14A 5FTGA 4YJOA 2XJ0A 4JL9A 3F3ZA 5BVEA 3BLRA 3ML1A 4YJQA 3LCTA 3V8WA 4JAJA 1OL6A 4FV4A 3F61A 1G3NA 4GKIA 3TEIA 3FL4A 2W1FA 5BVOA 3PFQA 4XUFA 4BL1A 2UW4A 1WBNA 1GNGA 5FTOA 2FSTX 3A7GA 3I79A 3R2BA 3KGAA 4IJPA 4X7QA 5BQ0A 1H08A 4FSZA 2ITUA 4ZZMA 3LCOA 4G3FA 4AZVA 1WBTA 3S0OA 2QOLA 3R63A 4X6RA 1BI7A 3LFNA 3QALE 4N6YA 3QZHA 3UVPA 3ZONA 2DQ7X 3ZRKA 4BGQA 4YSJA 4IJ9A 3E8EA 2GNJA 5E9EA 5IQBA 1W2DA 2QO9A 5CVHA 3VS7A 4DAWA 2QU6A 3CQUA 2PY3A 3PXKA 4NJDA 3RAWA 5JFSA 2R3RA 3P79A 2X4FA 2XF0A 3OZ6A 3PA5A 4QQCA 1QPEA 3SKCA 2CHLA 3UO6A 3LPBA 4O7SA 1YW2A 5GINE 2FGIA 3Q9WA 3UOHA 2XIRA 4I20A 4XRLA 3E87A 3D2IA 2B55A 4BTFA 4H36A 3D2KA 4DH8A 1UVRA 2WMWA 4HW7A 1LEWA 3DK6A 4EH7A 3GUBA 3DFAA 4L43A 3EFJA 4MWIA 4GG7A 4UY9A 4YGAA 5K0KA 2RKUA 3Q4TA 1JVPP 1J7UA 2X0GA 4A4XA 2J0LA 2PMNX 3DK7A 3CD3A 2VAGA 3FZRA 3GBZA 5B7VA 3T3VA 4U44A 5AMNA 2BHEA 2R3QA 4CT1A 3TDVA 1KE6A 3EQIA 4BDCA 4UMUA 5CF4A 4YP8A 1WBSA 3KRLA 4IC8A 1P4OA 3ZXTA 5TT7A 3JPVA 3DKFA 4YJUA 1UU7A 2OG8A 5AX3A 4AW0A 3TDWA 3BI6A 4JMQA 4RIWB 3BE9A 2WMRA 2UZWE 3G6HA 2WMSA 5J5TA 4ZTMA 1WBPA 3L8XA 4D28A 1F0QA 3CIKA 5L6WL 2YA9A 3NVMB 2F7EE 3TM0A 3RALA 2C3KA 3UBDA 4BI0A 1OUKA 4M68A 5T68A 4RVMA 4QEBA 3RAKA 4CFFA 4YC8A 4M67A 4DINA 4YUQA 2FSOX 4OTPA 3A8WA 4J71A 4UMPA 3U6IA 2B9HA 4D2SA 2R64A 5HESA 3VUGA 3MV5A 3O51A 1R3CA 3VUHA 5J9YA 1H1QA 4MD7E 2R2PA 3LFDA 4YZMA 1O6LA 3IW8A 2EWAA 4FEXA 2R0UA 5BYZA 1PXLA 3O7LD 2JKMA 3E5AA 3C4CA 5CAUA 3EQCA 2PVHA 3PYYA 1T46A 4E5WA 5BMMA 4FX3A 2RG5A 4A4LA 5AM7A 4LGGA 3L9PA 3OEFX 3DT1A 2B7AA 3LFEA 2XCKA 2GHMA 4NM7A 2R3GA 2WXVA 1WVWA 2XBJA 3BYVA 4R3CA 4O2ZA 2WQBA 4QP2A 3POOA 4K2RA 4UV0A 2P3GX 2G2FA 2UZEA 3CE3A 5KMIA 4IQ6A 4UWCA 4AZWA 3IW7A 3G51A 4EK3A 3BRBA 3P7BA 5CQWA 4EOLA 4L44A 3ZSHA 4IAAA 3GU8A 4RT7A 1SNXA 4NUSA 3C9WA 4R5YA 2W7XA 3R8LA 5BYYA 5BVWA 2PZ5A 4XG3A 1STCE 2JIUA 3OFMA 3QTRA 4K9YA 4X3FB 4E3CA 3LFFA 4XG6A 2JEDA 2BILB 3M42A 3FMNA 4R3PA 3VNTA 4LMUA 2G1TA 1CDKA 2CLXA 5A6OA 1OMWA 1G8AA 3F3VA 4O0WA 3NSZA 5JZNA 3LZBA 3PJ3A 1ZWSA 4BI1A 3KF4A 3LQ3A 3ITZA 4I23A 2YIXA 2B52A 3CC6A 3DLZA 5H3QA 2VWYA 3O8PA 3Q6UA 4FTLA 4BDAA 1M2RA 2C0IA 4IHPA 3VS2A 1VJYA 5DFPA 2CJMA 3DTCA 4I41A 5FP5A 5HQ0A 3ENHA 1WMKA 2OO8X 5HG5A 2J2IB 2Z7SA 3BEGA 3MH0A 3OWJA 4R3RA 2ERZE 4ALUA 4FSWA 1BX6A 5DT3A 3G90X 2PVYA 3BBTB 2XK3A 3OTVA 2AEGA 4AXDA 4UZDA 3OY3A 4O4FA 3WF5A 1YOJA 5FRIA 3KEXA 3MVHA 4WG4A 3AGMA 3FMEA 4FKRA 4CEGA 3A7JA 2W06A 1Y6AA 4IAIA 3FAAA 3F9NA 4O4EA 4ASXA 2JFMA 3QCQA 4YZBA 2F7ZE 3U9CA 3VO3A 3QD4A 4C57A 3EL7A 4CFVA 3FI3A 4FYOA 3SG9A 2HXQA 2ZB0A 2RL5A 1Y57A 3DCVA 4YLKA 5JGBA 2VWBA 2O0UA 4R1YA 3LLAA 4FL3A 4JDKA 4WUNA 1E1VA 2OZAA 5GZAA 4XV2A 4FKWA 3E3PA 2XKFA 2QD9A 3PJ8A 4MXAA 4OR5A 2AQXA 3QGWA 2GS2A 3VVHA 4QPAA 4QMLA 4G16A 3LCDA 3P7CA 4NW5A 3E64A 4EOIA 4O4DA 4ZOGA 2JGZA 3D0EA 3F3TA 3PXQA 4RIWA 4DITA 5AR7A 1XKKA 2QR7A 1OL2A 2WEVA 2VWZA 3COIA 2IWIA 4HGTA 4RFMA 4C58A 2OLCA 1W2FA 3PJ1A 3EQGA 1K2PA 2V7OA 3V5QA 4IANA 4CYIA 2HK5A 4RA5A 3Q60A 4TYEA 3U51A 5FD2A 3OG7A 4S33A 4FG9A 1NVSA 5ANKA 3GCPA 3UVRA 5KMOA 4QQTA 2YCSA 5FXSA 2BRBA 3DDPA 5M44A 4O83A 3BYOA 5A3XA 2LAVA 2GPHA 5A4TA 4DT9A 4FIIA 4I4FA 1OGYA 5JT2A 1BYGA 3FKNA 4L7FA 4USFA 4JR7A 4IZYA 2P2HA 2ITWA 4CG9A 4F9AA 5IISA 4JDJA 1ZLTA 2GQSA 4JQ7A 3IS5A 3V01A 3KRXA 4DH7A 4O82A 3BLHA 1MRVA 3FZPA 2VGPA 5DWRA 4O38A 3ORKA 2ETKA 3F6XA 4WNMA 3RMFA 2F57A 3CCNA 5H8GA 3IO7A 1J7LA 3NYOA 3OCGA 2WU6A 2AC5A 4V01A 2A2AA 4XV9A 3O71A 4RG0A 4I3ZA 4ANSA 3BU5A 2OICA 1GZ8A 2HZ0A 3H0YA 3E7OA 5H8BA 2C6DA 3KA0A 3K3JA 4H3PA 4WNPA 3COKA 1O6KA 3SRVB 5E7RA 3ZRLA 3RWQA 4L01A 4RJ5A 4Y73A 1QPCA 4UBAA 5M55A 3ROCA 2XARA 4K11A 2DS1A 2YFXA 2O63A 3C7QA 3HX4A 3VUDA 3CS9A 5CVFA 4AZEA 3ZO1A 1LUFA 4HGLA 3C0IA 4OTGA 4W4WA 1URCA 4RVKA 4FKOA 3QC9A 4A9YA 3PZEA 2PYWA 3JUHA 3V5TA 3PG3A 3OP5A 1G8SA 4DGGA 5HO7A 2EU9A 3GENA 1SVEA 4FEUA 3MY0A 1YRPA 4FKIA 2PVNA 4IWPA 4O0YA 4TWOA 5IA4A 4IZAA 2OJGA 1UV5A 1ZZLA 3PXRA 5EW3A 2Y9QA 4EC9A 1PRYA 3V5PA 3WF8A 3GC7A 1IAHA 4KKEA 3MA3A 2GNGA 4RWKA 4PNKA 1LP4A 3FKOA 5J9LA 1YHWA 4XX9A 4BDEA 3EQHA 3QX4A 2X7GA 2PVFA 4AACA 5L6OA 4JBOA 4U3ZA 4MUQA 5LCJA 4KUJA 4G2FA 4HYIA 4PP9A 2AUHA 3MFUA 4BGGA 4EOMA 5IA1A 4I6FA 4A7CA 1TFFA 4O7LA 4B8MA 1B38A 3O8UA 2ZM3A 3F3WA 4MBJA 3TIZA 2QOBA 4A9SA 2BIYA 3TL8A 1R1WA 4ZTRA 3A60A 3D5XA 4QMSA 4ZLOA 3OW3A 3ZM4A 3DJ7A 3RPYA 3CTJA 2OI4X 3F2AA 3KCFA 2C0OA 2QLQA 1IAJA 3L9NA 3DK3A 4LQMA 3VS5A 4DFBA 5GHVA 5C27A 4GFGA 2HZIA 4EH8A 4AOTA 2CN8A 5CSXA 2YM4A 4IAYA 5J1WA 2CNQA 4XLIA 5CT0A 4C35A 4GKHA 3LW0A 1DAWA 3QLFA 3MH2A 4FTQA 3ORIA 4O7RA 3W18A 2ITXA 3OEZA 3C0HA 3VUMA 3ORZA 3UIUA 3W2SA 4J99A 3MJ1A 2XEYA 1JSUA 5AV1A 4QMTA 3OOGA 5E8SA 5FWKK 3KMUA 5EHLA 3G5DA 4M97A 4YPSA 3LXKA 5LVPA 1MP8A 3BYSA 1JOWB 4PUZA 2YWVA 2WMVA 1B6CB 2RIOA 3BPRA 2XJ2A 4YBKA 4BCPA 3EKKA 4WRSA 2WHBA 3ZS5A 4C34A 3POZA 3UVQA 3VS3A 4KB8A 4QMYA 3H10A 5AJQA 5TE0A 3WZKA 4F65A 5ACKA 1Q8UA 4NFNA 4HNFA 3S95A 3ROYA 3GOPA 2R7BA 3MY5A 4WOVA 2NRUA 5HG8A 3ZHPC 2XNNA 2WEIA 3CLYA 2RF9A 4WBOA 4LV7A 1UNLA 4GJ2A 3NYVA 2W1CA 2QC6A 1H24A 3QUDA 3E93A 3U4WA 3CJGA 5AUUA 3BU6A 3KRJA 3UZTA 4D9UA 4FE2A 2W4JA 4ZJIA 3C1XA 4FA2A 2GFCA 2YM7A 3BWFA 4QPMA 3KKVA 3W33A 2CNUA 5C01A 4O0VA 2UW3A 4AZTA 4AF3A 4W4XA 3G9NA 3HV4A 3FLSA 4C4IA 1CMKE 1M2QA 2RFDA 1G8JA 3P1AA 4QYEA 4YSMA 5AUXA 3VBXA 3WZEA 1YWRA 2CKOA 2FUMA 3LXLA 5CAPA 4C59A 2ZVAA 4GMYA 1U54B 4AN2A 4AG8A 1JKTA 2IVSA 2GTMA 1LPUA 1OPKA 4IFCA 3QC4A 4ZS4A 2CKEA 2XB7A 3L1SA 5KZ0A 5I9WA 2C0TA 3O17A 5L2QA 3ZSGA 4AGCA 3I6UA 5JEBA 3KQ7A 4FNXA 4M7IA 3R8VA 4BI2A 5JQ8A 4R8QA 1NVQA 2W0JA 2PMOX 5EDRA 2KULA 3DAJA 2V55A 3U9NA 2WFYA 2Q83A 2C69A 1X8BA 3R1SA 3VQHA 2HELA 3FDNA 1ZYLA 3LMHA 1VYZA 2GDOA 4B99A 4RJ7A 2Z7QA 2C5VA 4Y85A 3HUCA 4EK6A 3TNIA 2JD5A 4OTWA 3WE8A 1KE9A 2QR8A 3ULIA 4CVAA 2XVDA 5CU4A 5GZ8A 5GJFA 2BRNA 4E93A 4PMMA 3K2LA 3PA4A 2IN6A 4JXFA 3TKIA 3ZDUA 3HGKA 3BLAA 4PNIA 4OTHA 4RX5A 3OWPA 5B2MA 4PY1A 5LWMA 1H8FA 4BJJB 2W9FB 2ITPA 4W8EA 2A98A 4BCHA 1HOWA 2VTOA 4ENXA 4O1PA 4HPUE 3EN4A 2X8EA 5CZHA 4MX9A 4XHKB 4OBOA 1PXJA 5J95A 4IVDA 5EI8A 3UOJA 2QKRA 3ZBFA 5CTPA 4YZCA 4F7LA 3L9LA 4APPA 5IQAA 3UYTA 4HPTE 3PRIA 5F95A 3VF8A 5DNRA 4CTCA 1L3RE 3R6XA 2A4LA 4IADA 2BFYA 5TO8A 4IBMA 4BGHA 5K5XA 2XM8A 4EONA 3QFVA 3MJ2A 4LL0A 4EHEA 2WTIA 3R02A 3MS9A 5BUEA 1DAYA 3VS0A 3P5KA 3AC4A 4FOCA 4PMPA 3F7ZA 1URWA 4IVBA 3W8QA 3OHTA 4WUAA 4Y95A 2ZYBA 4ZTSA 1H01A 3ZUVA 5CSPA 5AIRA 1W0XC 2W17A 4O6LA 5D10A 2JLDA 4CLIA 1OGUA 4NT4A 4FTAA 5ACBC 4BBFA 1R78A 3OBJA 3VS1A 3WARA 1JSTA 5K4JA 5HCXA 1UWHA 2YM3A 5BNJA 4IAZA 3EN9A 4J7BA 3IGGA 4FV0A 1XBCA 2IVTA 5BV3A 3CKXA 5CALA 3ZEWA 5KBQA 1OVEA 4KS8A 4BIBA 5HE2A 1QL6A 4JT3A 5G1XA 5LVMA 4Y5HA 2VZ6A 3MPAA 1P5EA 1TQPA 4FIJA 4YO6A 3RWPA 3UPXA 5I9XA 2WNTA 3HZTA 3QQKA 3R83A 3R1QA 4GW8A 5AV3A 3R8MA 4LDTA 4C2WA 1SM2A 3NX8A 2JBOA 3AD6A 5HO6A 4ASDA 3EKNA 4ACCA 2VX3A 2VWVA 5FUTA 1UWJA 5IPJA 3ZC5A 4ZTQA 3AT2A 3VUIA 2XIZA 3NNVA 4FNWA 3LFAA 4K0YA 3HUBA 2JIVA 3F66A 2DYLA 4LI5A 5DR9A 4I5MA 3WIGA 2IEWA 2CGXA 3FYKX 3OXIA 4TNBA 2VTNA 3EQRA 2XANA 3O23A 1FVRA 3SLSA 2PE1A 4QDVA 3AC3A 4FRFA 3O96A 5AUTA 2CMWA 3FC1X 2IVUA 5C4KA 2XCHA 4YBJA 4KIQA 5AV4A 4J8MA 4DBXA 4F0IA 2F7XE 1IASA 4RLKA 3KVXA 4F9BA 3A7HA 2FA2A 4H1MA 2W5BA 4G6OA 3RI1A 5EK7A 3R7YA 3O2MA 4FSTA 4O91A 3DNEA 3ZZWA 2PMIA 3HRCA 2VTIA 4H39A 4KD1A 4N4SA 1SMHA 4YJSA 2ITQA 4II5A 3QRJA 5E1SA 4UN0C 3ODYX 4OBPA 4NJ3A 5LCKA 4FK3A 3V5WA 4CGAA 1J3HA 4JX3A 1CKJA 3Q4CA 5KHXA 5IQHA 4GU9A 3DQXA 2X8DA 4RX9A 3RNIA 2GNFA 2W4OA 2QODA 2WZJA 3R0TA 3FMMA 3GI3A 4WNKA 4C33A 4ZIMA 2ZV9A 5LVNA 2YCRA 4DGLC 3QRIA 5M57A 2C6EA 1ZYJA 4D2WA 4AN9A 2CSNA 1GOLA 2UW0A 3AGLA 4B7TA 2QKWB 4YURA 5ANDA 3BEAA 4BYIA 2JC6A 3KXGA 2BMCA 3D7TA 4J98A 5CSVA 4YC3A 3SOAA 3VJOA 4ZY4A 5HTIA 3D7ZA 4IVAA 2IJMA 3LJ1A 4I94A 3T3UA 3L8VA 1IEPA 1S9JA 3EHAA 3WE4A 2FSLX 3OCSA 2XMYA 4CYJA 3UO5A 3IONA 2GNHA 1NVRA 4BJJA 4FTUA 5AV0A 4E4XA 1P14A 5HO8A 4ZZNA 3NIZA 4IB3A 4X2JA 2YAKA 4BWPA 2W1GA 3C4FA 2IO6A 2ZV2A 5J5SA 3R7IA 5HIEA 4RA4A 2EXCX 4BDHA 3PY3A 5KBRA 5M07A 3BHYA 2O65A 3HAVA 4RLLA 4CQGA 4ZS0A 3NDMA 2BPMA 2RSVA 1R0EA 3BHUA 3MVLA 4K8AA 4V0GA 3VS4A 2PZYA 4XP3A 4EEVA 5JK3A 2EB2A 4G31A 4FIHA 3UDBA 2JAVA 4MNFA 5H2UA 1W7HA 5FM3A 2J5FA 3HV5A 4ARKA 3KC3A 4LOPA 4EBWA 2A27A 5M09A 3ZC6A 4L9IA 4RWLA 2WOUA 3EQDA 4DGMA 4OBQA 4WO5A 4U41A 1JKLA 4WBBB 1KSWA 3AD5A 3L8SA 5GZ9A 4FC0A 3QXPA 3CD8A 3N4UA 1OKVA 5E8YA 3EN5A 3W55A 1OUYA 2XAOA 1OIUA 1VLRA 4RX8A 1TVOA 2XKDA 2Z8CA 2C68A 3PIZA 3MPMA 2BALA 4DCAA 3GU4A 1WBOA 3DB6A 2B0QA 4F6WA 4RIYB 2YISA 4TT7A 5EI6A 3QD2B 5E4HA 3IDPA 2I7QA 1YHSA 4BVUA 5B2LA 3CPBA 2V5QA 1ZMUA 4TZRA 4QMZA 5HNIX 3AD4A 1H26A 3ATTA 2C6LA 4BCNA 2UV2A 3V5LA 5CEIA 3E7VA 3FJQE 3HKOA 3DZOA 5KKRC 2J6MA 4E4NA 4H05A 3TT0A 3LLTA 3W0NA 3LJ0A 3R8UA 4C38A 3MH3A 3VW8A 4O4CA 2BAQA 3UO4A 5BUIA 3L8PA 3EMGA 4X2GA 1T45A 3QF9A 5CU3A 4CRLA 5IDNA 2I0EA 2HENA 4ZP5A 2PHKA 3PWYA 5A4QA 3A4PA 4CG8A 4J95A 4QTBA 4CFXA 3FPQA 3RZFA 3II5A 4MTAA 4ZTLA 2Y6MA 1M52A 3QLGA 1NA7A 3TTIA 2PVKA 3ZLSA 3PXZA 4PMTA 3OVVA 3RK5A 4PDPA 2GMXA 5HLNA 3K54A 5I3OA 4QNAA 2QO2A 4XBRA 4RC3A 3WI6A 4J8NA 1KV2A 2PMLX 5IG1A 4OTRA 5EKOA 4C2VA 5AUYA 1ERKA 4Q9SA 4IH8A 2WAJA 2OH4A 4MH7A 5EHYA 4NEUA 5CQUA 3TV6A 2IZTA 4EKKA 4J1RA 3ORLA 2B9IA 3ZU7A 3DFCB 1Q3DA 3HMNA 1E9HA 2XKEA 2IW6A 1ZYDA 3Q53A 4RFYA 5F1ZA 1ST0A 4UXLA 4DFLA 4YJVA 1EH4A 2UW7A 5JZJA 3Q32A 4I6BA 5I5ZA 4GIHA 4UWYA 2PULA 4MBIA 2PTKA 4Z7HA 5EFQA 2HY81 5DR2A 5BVKA 2O3PA 3QTXA 1W2CA 4MXOA 2X0QA 1PMNA 2O5KA 2XA4A 4FUXA 4YLJA 5CXHA 5HE3A 1CTPE 3RM6A 2E9NA 1H27A 5D7AA 4NK9A 2R3OA 5M53A 4I0TA 4EC8A 5HG7A 3WF6A 2G2HA 4QMNA 3COHA 4JIAA 4JRVA 3PG1A 4EQMA 4BFMA 3QKKA 2YJSA 3S4QA 4AA0A 2QU5A 4ITIA 3BV2A 4XV1A 3BHTA 3PFYA 3Q5ZA 4RC2A 2VD5A 4H3QA 1OL1A 3C50A 4RQVA 5KZIA 5T3QA 4AE6A 4Q2AA 5E8UA 2E9VA 4MNEA 1H1PA 4MBLA 2CGUA 4FKVA 1Q8YA 4Z55A 1GIJA 4M66A 2ITTA 3H3CA 3ZDIA 5IUIA 3PSBA 2VWUA 3E88A 4HJOA 3FXZA 3KXMA 2Y4IB 3S00A 2C4GA 3C4XA 2IZUA 3ETAA 3HVCA 3MWUA 3R8PA 3F2NA 4D2RA 3FMJA 4EL9A 1HCKA 3GVUA 2ZB1A 4OLIA 3U55A 2GHLA 4WT6A 3KMWA 5FBOA 4OUCA 4RZWA 2BDFA 3F5UA 4KRDA 1UU3A 3PY1A 3GC8A 5CI7A 1M7NA 3R2YA 3C4EA 1CM8A 2HIWA 4ALWA 5A6NA 3KXXA 3R9DA 4FTIA 3UG2A 3N4VA 2FH9A 2OXXA 3F7WA 3QZFA 5AR8A 3RZBA 4D55A 4YNEA 3D94A 3DY7A 4B0GA 2QVSE 1MRYA 3QTWA 1KOAA 4ALVA 4QP4A 3OT8A 3NNUA 4YPDA 3ENMA 4F6SA 4YMJA 3ZOSA 2JDTA 3EFLA 4BYJA 2UZNA 2VTLA 2NYAA 4HZRA 2YIRA 3DDQA 5AX9A 3AC5A 5HX8A 1GIIA 4C36A 1PXMA 3KU2A 4FEQA 3S1HA 3QQUA 5AUZA 5IKWA 4DG3E 2X1NA 5KHWA 4AOIA 4HCVA 5J7HA 4USEA 2VO3A 5HE1A 1RJBA 2CGWA 3ZBXA 4EJ7A 4JG8A 2XK8A 4R7BA 3BE2A 1SYKA 1FPUA 3ORNA 3V6RA 2VX0A 5HD4A 2GS7A 3C0GA 4F99A 3QA8A 4WHZA 3NW5A 2A1AB 4AGWA 4FV6A 4BZDA 4FV7A 4KIOA 2R3KA 3HLLA 2R3HA 4EH5A 2GSFA 4D2TA 2C6MA 1RDQE 2X0PA 3JXWA 4GJ3A 2IVVA 4E6AA 5L2WA 5DPVA 5M4IA 2HZ4A 3GXLA 1SVHA 1JBPE 3MDYA 4ZY6A 3QAME 3OS3A 1YXSA 3AKJA 4I21A 2E9UA 1YI3A 1ZMVA 2CN5A 3UIMA 1XQZA 4F70A 4PWNA 2C6IA 1PXIA 2Z2WA 4LL5A 3QA0A 2PK9A 4GT3A 5CLPA 2RFEA 3VBTA 5KMNA 3PSDA 3TZ8A 5A4LA 1FVTA 5LMKC 2H34A 3ATSA 2YWPA 3Q4UA 3W32A 5I9VA 4FSUA 1FINA 4MAOA 2VTQA 3OBGA 1YDRE 4DA5A 2WTKB 4KBKA 4DTAA 5CENA 3E92A 5DYJA 3IOKA 3TYKA 2P55A 3VRZA 3DS6A 4K33A 2XK6A 2X2LA 4QP7A 3GQIA 3TNPC 4IM0A 4ANMA 4QP8A 1A48A 4KIKB 4RRVA 2UVYA 3OC1A 3W2QA 4FTNA 4K6ZA 4F78A 4L53A 2IZSA 3PP0A 5LARA 3Q2MA 2I0YA 4CKJA 5ANGA 5GIPE 2WKMA 4FKSA 4EKLA 4NW6A 3REPA 3NZ0A 3PRFA 1Z57A 5CAOA 2WMUA 4FSYA 4FV5A 2R3LA 4XMOA 4I6LA 5K9IA 1Y8YA 3CXWA 3NAXA 1UA2A 3PSCA 1TKIA 4KA3A 3T9TA 4IEBA 5HIDA 4MEDA 4NIFB