2EWAA

Dual binding mode of pyridinylimidazole to map kinase p38
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNILTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGTRWYRAPEIMLNMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
pubmed doi rcsb
source organism Mus musculus
total genus 103
structure length 330
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ewaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ewaA01
3O8UA 2YN8A 1FVRA 4YR8A 4FIEA 3PJ3A 5C8KA 2OJGA 5L6PA 4DTBA 3UVRA 3RTPA 5HNIX 3ZO1A 4AZFA 4QQJA 1OKZA 4A06A 4QP2A 1REJA 1QCFA 2VTOA 4AOTA 4FTMA 5CWZA 4E8AA 4BDFA 1QPCA 4N4SA 4YO4A 3NCZA 1OI9A 5LWMA 5IEYA 4DA5A 3R9NA 3EKNA 4HNFA 2JAVA 4QP4A 4U79A 1APME 4X2NA 4FMQA 2BZHB 3UGCA 2F57A 4RJ3A 2B4SB 4MEDA 2J2IB 3S4QA 3C4ZA 3L1SA 4ZAUA 3A62A 3QCQA 2W1EA 1SYKA 4NH1A 3MTFA 3FZPA 2PUIA 4AZVA 4M68A 5JFWA 3SG8A 5CTPA 5AP4A 4F0FA 3LCDA 2VO6A 2HIWA 3SA0A 4PP9A 4II5A 4FKWA 2WEVA 4DYMA 2GS2A 2IWIA 2Z8CA 4R5SA 4A7CA 3CR0A 5D7VA 3MSSA 2OFUA 4UMPA 3IKAA 4I93A 4NCTA 4QTBA 4QPMA 4RGJA 1XH6A 4LGHA 3E3BX 4CMOA 5LMBA 1O6LA 2R64A 4YHFA 4RFZA 5JGAA 2OG8A 5M4IA 2WPAA 4U80A 4N6ZA 2OK1A 3ACJA 1BL7A 5IA4A 3PG3A 4HCTA 4NIFA 4WG3A 2YCSA 3H0ZA 5E9EA 4GT3A 3PP0A 4ONAA 2CLXA 3EQIA 5C9CA 2VX1A 3OG7A 4XOYA 1IG1A 3PVWA 4D2RA 4CV8A 2P2HA 1J1CA 3PUPA 4D0XA 4BCOA 5HCYA 4HGEA 4L7FA 3R30A 1YI4A 2IZSA 4G3CA 3CGFA 3NR9A 1A48A 1E1XA 2CHLA 4A9UA 3D4QA 3TWJA 3QF9A 4FV7A 4DTKA 1NXKA 5AJQA 1XH8A 3PXZA 5AR5A 5EM6A 4AN9A 2QHMA 3C7QA 4M3QA 4G17A 3UZPA 4XUFA 1STCE 1ZARA 3HUCA 4KSQA 4BGGA 5FTOA 5M53A 1OIYA 3PWYA 1J3HA 3R9OA 5AADA 5LJJA 5D9HA 2LGCA 4IADA 3P5KA 1PHKA 3MB6A 3IGGA 5T68A 3R8PA 4B99A 4E4NA 4OTFA 4ZLOA 4JL9A 4CFXA 2X8DA 3F66A 4XG6A 3TG1A 4B8MA 4CRLA 3L9LA 5DEWA 3TNHA 3AC5A 3Q6UA 3CGOA 2FA2A 4LFIA 2IVSA 4XEYA 3QA0A 4MQ2A 5DA3A 1H08A 3EOCA 2C6MA 3NAXA 3VRYA 3OOMA 4E93A 2OSCA 2F7EE 2XJ1A 3CLYA 3QTRA 3R1SA 5KX8A 2YCFA 3JXWA 4KBAA 3OD6X 4HW7A 1U59A 5CALA 5L2SA 1WBSA 3SD0A 4YTIA 4EYMA 3PG1A 2BTSA 3LFAA 4NUSA 4PNIA 3E93A 3SOCA 1ZYDA 4FV9A 5AP6A 4XH6A 3PSBA 2QLUA 4FV2A 4ZTQA 3BI6A 3HV6A 2PSQA 5FLFA 3UOHA 4XHKB 2GQGA 4FL2A 3CE3A 3ZXTA 4QP1A 4L53A 4TPTA 5H8GA 1LP4A 3M11A 4GUEA 4AE9A 1T45A 4FSRA 2PTKA 4GU9A 4QD6A 3D5VA 4GT5A 4O0UA 4JAJA 1J7UA 3R1QA 3BYSA 5BVNA 2GMXA 4BR3A 3FQHA 3LKMA 2R0UA 3DFCB 2G15A 1GNGA 4AGWA 4AF3A 4D4YA 2XKCA 5CAOA 4KB8A 4AA5A 5BUEA 2ZM4A 3HRBA 4G34A 2BHEA 3MESA 3I79A 3RWPA 2QHNA 3NUUA 3Q9WA 3TL8A 4FKGA 3R83A 3D14A 3LVPA 4NKAA 2ZDTA 3QLGA 1A06A 3H9RA 4TZRA 3F3VA 1LR4A 2RIOA 3RM6A 4MBLA 2A19B 3GB2A 3U54A 3T9TA 5DT3A 4B0GA 4R78A 3DBFA 3ORXA 4NM3A 5CVHA 4JBQA 3OW4A 2JKKA 2OXXA 3AT3A 4XRLA 4E73A 2GHLA 1GAGA 4LGGA 2XUUA 2OZAA 2W05A 4WO5A 4JG7A 3T3VA 3DU8A 4OBOA 3PDTA 3BQRA 5JGDA 3NUSA 5CQWA 3ACKA 4MXOA 3QQJA 5AWMA 4C0TA 2C5YA 3TKHA 3B2TA 1Y57A 2V7AA 2B52A 1RW8A 4K33A 5TO8A 3KF7A 2OJ9A 2YA9A 1H00A 2UW3A 4RJ5A 5FEQA 3G51A 5EYDA 3C4CA 3PPZA 1FVVA 4JBOA 5EOLA 5C8NA 3PYYA 4OTDA 5IPJA 2H8HA 5HO6A 2WMRA 2BDJA 4NW5A 4BTKA 4IW0A 5KHXA 5KNJA 3QQHA 5JFVA 3FPMA 3PIXA 2HZ0A 2PZYA 3F2AA 4IB0A 4FK6A 5EI6A 3WZKA 1KE6A 3C4FA 2YM7A 4FK3A 2G2HA 4GT4A 5KMLA 4O7NA 2BR1A 2QO9A 2XK4A 4O0TA 2W1HA 3DKFA 1XKKA 2XH5A 4E1ZA 5J9ZA 3WZDA 4LUDA 5TE0A 1JSVA 2BILB 3WYXA 2Y7JA 4MXZA 4XLVA 3QKKA 4DEDA 1OL6A 1RDQE 2XKEA 4XV9A 4EH3A 5L2TA 3NW7A 3OT3A 2RFSA 3SG9A 3HDMA 1GJOA 4ENXA 4EOOA 2CN5A 5HESA 4OTHA 2NRUA 2DQ7X 4O7WA 4FSMA 4AW5A 3QYZA 5EH0A 4YNOA 4J53A 2C30A 4QMOA 3CQWA 4IVBA 4XNEA 3VS5A 4RZWA 4TXCA 1PYEA 3BEAA 3G6GA 3TZ8A 3R7EA 2OJFE 2VGOA 3FKOA 1Q3DA 4KRDA 5J9LA 3AC4A 3DNEA 3KRWA 4J1RA 1KV2A 1KUTA 4LV5A 3QKMA 3AD4A 4YC3A 4AT4A 4QQTA 3F3ZA 3FZRA 2CN8A 5I4NA 3FL5A 4TNDA 4K77A 4OR5A 3OY1A 4JDKA 3THBA 4DH8A 4NCTC 1XQZA 5CI6A 2XNPA 4EOPA 4M84A 4BBFA 3LFCA 2QR8A 3NVKI 3TNIA 3R01A 4L3LA 1JWHA 2VNYA 3BWJA 3MY1A 4B9DA 3BKBA 4EEVA 2WQOA 3K5VA 4EKKA 4BWXA 3EQBA 1NW1A 1MRYA 3I60A 3FC1X 3CXWA 3DKGA 5IUHA 1W8CA 2W5BA 3K3JA 3NS9A 3RNIA 3GCQA 1PMEA 4GH2A 3MJ2A 2GFSA 5KMKA 3FWQA 5KCVA 4JVGA 3C0GA 3R9DA 3UIUA 4EQCA 5J7BA 3CTHA 5HHWA 4IM2A 3LXPA 2BALA 2SRCA 4AGUA 5B0XA 2XK6A 4I0SA 4TYIA 5KO1A 1FQ1B 3V3VA 2GNLA 4FKSA 4E20A 4IJ9A 1GZOA 3RAKA 4DN5A 1TQPA 2JDTA 5DFPA 4QPSA 5A54A 2R3PA 3I4BA 2W1CA 3FMNA 4AW2A 3QCYA 4F9CA 4G16A 4KKHA 4C36A 4CFMA 4A9RA 2BAKA 2OXYA 3R8MA 3WF5A 3VBWA 5AFVA 4JT3A 4QYEA 4F1TA 4FNZA 3R8ZA 4HVGA 4PY1A 4L6QA 3SGCA 1LUFA 4JRVA 4KWPA 5CEQA 1Q8UA 5EYCA 2XNGA 2WQBA 4YJTA 3ODZX 2FSMX 5E4HA 4BDIA 4J71A 2BDFA 4YZBA 3H9OA 3P7CA 5M09A 5LVLA 1H28A 3DAKA 4HZSA 3EQHA 3KMUA 4S31A 5CASA 3OCSA 3VUIA 3ZSGA 4AW1A 4BGHA 3HA8A 3UG2A 4XV2A 4B6LA 1DS5A 4H58A 3C1XA 2JC6A 4GV1A 4MVFA 1JOWB 3E64A 3U6IA 2X39A 3UE4A 4FSZA 2X7FA 1MQ4A 5A3XA 3QC4A 4OTPA 2EXEA 3ZOSA 3DJ5A 2X9FA 1WVWA 4E5WA 3E5AA 3PXRA 2B9HA 1OBGA 3KB7A 2UW8A 4B8LA 2VWBA 4RVTA 3NSZA 3RPSA 1G8SA 3IQ7A 5FGKA 5IQDA 5DH3A 3ALNA 3BE9A 4WBBB 4QMUA 5H2UA 5HG5A 3EKKA 4AZEA 3N4VA 3DT1A 2P2IA 4FYOA 4IJPA 4JQEA 2BMCA 4J97A 4QQ5A 3PXFA 3TTIA 3F2RA 3QZIA 3VRZA 3AXWA 4ITJA 5ETCA 3ALOA 4DF3A 5FBNC 4GFMA 3UMXA 3AQVA 3QBNA 2J0IA 4FGBA 3D2KA 5CT7A 5HLNA 3VF8A 3W2CA 3DJ6A 4LRJA 4YBKA 3R7IA 4ZEGA 4EHEA 2X2KA 4OTWA 4PTEA 5DOSA 4KIOA 4NWMA 3MI9A 5CF5A 3MB7A 4MQ1A 2I0HA 2REIA 2WMQA 5B2MA 2WTKB 4F7NA 2F2UA 5JZJA 3FYJX 2PVLA 4GRBA 1OITA 5KMNA 3RAWA 4Y83A 1KE7A 2CSNA 2A27A 4QQCA 3DBEA 3NRMA 4O0XA 4ZS0A 2PE0A 3EH9A 3MA6A 1ZXEA 2NO3A 4R7IA 4Y73A 3GOPA 4C3PA 3P79A 5FUTA 4W4XA 3NW6A 4BTFA 3MTLA 2XK8A 1P4FA 1YXXA 4LMUA 4UMUA 5AA8A 5I9YA 1BI8A 2KTYA 3C4XA 3LIJA 4K1BA 5CF8A 5DHJA 3BHTA 3EFLA 2EVAA 4MNFA 2VWWA 5FG8A 4S34A 2F7XE 4H1MA 4RFMA 3ZMMA 3OBGA 5CNOA 3N4UA 2LAVA 4HCUA 4BDJA 3LM0A 4H3QA 5C26A 1YDSE 2W1FA 5AMNA 2WD1A 1FBNA 3W18A 3DK6A 1UVRA 3R9RA 1W83A 3ZYAA 5AV3A 2ACXA 3F5XA 2JDOA 3IOPA 3R2YA 3EN5A 5CVFA 2OJJA 4ZTHA 3RKBA 4PDYA 3EZRA 5AR4A 3MS9A 4I5HA 3HL7A 5AAFA 4BYIA 1TQIA 3D2IA 3ZLXA 4DCAA 5I9UA 2PPQA 5CSWA 3AD6A 3SXFA 2W1GA 4DLIA 2W4JA 2WFYA 3EN9A 1PYXA 1KOBA 3KK9A 5AP3A 4X6RA 4O82A 3IW5A 4L45A 1CTPE 2XIYA 3HV5A 5CZHA 4G31A 4FSQA 4UBAA 4F0GA 2XP2A 2BZIB 3NEWA 2BTRA 3VUHA 2X7OA 3E8EA 4UWBA 4ZSLA 3EFKA 5GZ9A 2HZ4A 1O9UA 4GJ3A 4C2WA 4ZLZA 3PZEA 3DCVA 3GGFA 3P7AA 4KIKB 1ZOGA 2J5EA 5HVJA 4ZTMA 1U5QA 5AIRA 5E7RA 3ROYA 1H0VA 4IFCA 2X4ZA 4G3EA 5ANEA 4TL0A 5IQAA 1YOJA 5K0XA 3GT8A 5GJGA 2Y6OA 4J96A 2F49A 2KULA 2V55A 4YTCA 2CMWA 4M15A 2YCRA 2WQNA 4IC8A 4P5ZA 4BICA 4CV9A 1H1SA 3A4OX 3OWLA 3OCBA 2XBJA 3QKLA 3PXQA 3E87A 5IA2A 3ANQA 3FE3A 4UWCA 4GKIA 2VD5A 5KZ0A 3ENMA 3CBLA 3K5UA 3UO6A 3KXMA 4NTSA 3ZC5A 3G0EA 3MA3A 4RWJA 2BRHA 3ZZEA 5JK3A 2HXLA 3PJ2A 3QTUA 4O0VA 3BPRA 3D7TB 3RCJA 3ZCLA 4EH8A 4U7ZA 5AX9A 3TUBA 2OLCA 2UVZA 1J7LA 4OTGA 4AS0A 4APCA 5HVYA 2W9FB 3Q9YA 3MV5A 3Q4ZA 3VS3A 4QP7A 4ANMA 4OTRA 4D9TA 3TV6A 3LXNA 1SMHA 1GIHA 3LW0A 4O0YA 4JXFA 4RC2A 1KV1A 4RG0A 5E8TA 5IA3A 4JRNA 5L6OA 2X7GA 4XOZA 1T46A 1Q62A 4RIYB 3U51A 4JG8A 4M0YA 1R0EA 2GCDA 4GIHA 5HLWA 4FYNA 2XK3A 5IEVA 2XNBA 3DGKA 2WMWA 3LJ1A 2BKZA 2NNWB 1PXPA 4G6OA 4ZJIA 5EKNA 2XJ0A 2XNMA 4CG8A 1GIIA 3WIKA 3KXNA 3RMFA 4D5KA 1OUKA 4U97A 4XG4A 5EDRA 4M12A 2QI8A 3UJGA 4BCHA 4FKPA 2Q0BA 5BYYA 4KS8A 3UZTA 3ZDIA 3MFUA 1OKWA 1M2QA 4Z16A 3EIDA 1H1QA 3QA8A 4ZZMA 3WF6A 4DFUA 4TRLA 1GZKA 3W33A 4QMVA 5IA5A 2G2FA 1Q4LA 4IEBA 4CT1A 2ZV9A 3QHWA 4NSTA 2FYSA 4BZNA 4DFZE 4ALWA 3Q04A 4OAUC 3BLQA 3KMMA 3ENHA 3VVHA 3EJ1A 3F5UA 3FKNA 1OM1A 5BMMA 3ZBFA 4UYAA 1SM2A 4O7TA 3A7GA 5IMEA 1BI7A 5LMKA 4BVUA 1H24A 5B2KA 4L67A 3UDBA 4O6LA 5KMOA 4IB5A 4YJUA 4YPDA 3TDWA 2YM3A 4YLJA 4RWKA 2WNTA 4LOOA 3VS2A 4NW6A 5HNBA 2RKUA 2UW9A 4M69B 5IA0A 1CSNA 1ZY5A 2R3HA 4S2ZA 4CLJA 4X2GA 2QOLA 3KXZA 3PIZA 3W2OA 3BU6A 4WSYA 3WYYA 3FC2A 1W82A 2Y6MA 2I0EA 5M56A 2EU9A 4BDKA 4I92A 5CSPA 4I23A 3NIEA 1Q8TA 3L8SA 4FV8A 3CKXA 2CNQA 1H25A 4O22A 5E8UA 3DA6A 4ZSJA 2QD9A 1Q99A 4KSPA 3N51A 2JAMA 5ANDA 3W2QA 3G2FA 3ULZA 4FKVA 5TR6A 3NVMB 3AD5A 4JX3A 4PP7A 4YNEA 3LM5A 3T8OA 3UODA 3R1NA 2X2LA 3P86A 4AXAA 1M17A 3FLWA 4XG2A 3UOLA 3SXSA 4BYJA 4H3PA 4Y85A 4EJ7A 4Y8DA 3F3WA 2WTCA 4NK9A 4O27B 4PWNA 3HYHA 1AGWA 5HBHA 5CEOA 2YLEA 5D1JA 5HG7A 5BUIA 5IH5A 4ASXA 4O0SA 4MXAA 5CENA 1ZYCA 5LMAA 2OWBA 4JR7A 4DGGA 5HO7A 2V5QA 2W4OA 3II5A 4C02A 2RFNA 2VTJA 3KC3A 4LRKA 4PV0A 4EOLA 3HV3A 4GK4A 5DIAA 3CD3A 5AP1A 3HAMA 4DEEA 1ND4A 1HOWA 2UW7A 3CY2A 4RIXB 2OBJA 3PRIA 1JPAA 3FKLA 3H10A 1XH5A 3O7LD 4V0GB 4Z9LA 3LQ3A 3U4UA 3L8VA 5AUZA 3CQEA 3OMVA 4X7QA 4U40A 2XIZA 3IK3A 4K8AA 4ZS4A 1J91A 4EHZA 4I41A 1M14A 2YLFA 4TTHB 5EHYA 3TEIA 4U41A 2YIRA 3R21A 3R00A 1UKHA 3DQWA 2H6DA 4QTCA 3TZ9A 3A7JA 2ETKA 4EWQA 3RHKA 5L8JA 4AT3A 4ACHA 4PTCA 5GZ8A 2BRBA 3GEQA 3PY1A 5DYJA 2QKRA 4BDDA 4AQCA 4XS2A 5EG3A 4C59A 4DG3E 4OAVB 2O65A 2X81A 4MAOA 5H9BA 1BKXA 3TV7A 3PE2A 3UNJA 3W55A 3QUPA 2BIYA 2ITPA 5JZNA 5AUUA 5DPVA 5HICA 3GU7A 4I5MA 2O8YA 3IS5A 4FV3A 4FTJA 3FY2A 1URWA 4I5CA 4USEA 4IWDA 2JFLA 4FTIA 4PPCA 4U9AA 5LCJA 4R7BA 1JQHA 5CU4A 1G3NA 2BZJA 4EBWA 4O1OA 1GZNA 1VJYA 2Z7LA 3QD3A 4F65A 4UEUA 4I6BA 5DGZA 2PZPA 4X3FA 1E1VA 3QX4A 4L68A 2R7BA 5AUWA 2ERZE 2VN9A 4G6NA 3VUMA 4O7YA 5IQEA 4JBVA 3DJ7A 1P5EA 4KIPA 2F2CB 3NAYA 4FTLA 4YJOA 5CXHA 3FPQA 4PMMA 3UQGA 3N4TA 1XBAA 3SLSA 2CNUA 3VS6A 4G2FA 3OROA 3PY3A 5KKRB 2AC5A 2R9SA 4AA4A 4A9SA 4JI9A 3PPKA 2Z2WA 4FEXA 4BRXA 5I0BA 5IDNA 4FGRA 5E8XA 2VU3A 3KRRA 4HVHA 3RWQA 3TM0A 3RZFA 5A14A 3U87A 4AW0A 3ZO4A 1P14A 5GIOE 4OBQA 3D5UA 3DLZA 4EORA 2WU7A 3AC1A 4EHGA 5CANA 3WF8A 2ZVAA 3EL8A 2QOKA 4F6WA 3NNVA 1ZZLA 2JFMA 5CQUA 5KBRA 2UVXA 5KMIA 4NL0A 5JEBA 1DAWA 4ITIA 1IAJA 4BBEA 4ZZOA 3ULIA 4XG3A 2BDWA 2C3IB 4FV5A 5BYZA 1R3CA 4FTUA 1GZ8A 4PUZA 4PPAA 1JBPE 3VW8A 3ELJA 4O2ZA 5GIPE 4MD7E 1S9IA 4YSMA 5HCXA 2GS7A 4FL3A 4QP8A 3GQLA 3VUDA 1SVGA 4HGSA 3Q32A 5JFSA 3OWJA 3ID6C 4FICA 4W8DA 5LMKC 5G1XA 5C4LA 3DKCA 3QLFA 3I6WA 3V04A 2Y8OA 5ANIA 3HMOA 5K4JA 4FA2A 4QYYA 3UZRA 3ZBXA 1OIQA 3MH1A 2DWBA 1BLXA 3G15A 5M51A 3E63A 3MBLA 3UOKA 4CZYB 3R7GA 4TYGA 4HNIA 3UPZA 3GBZA 5E92A 3R8LA 1UU8A 2ITTA 5D41A 2QC6A 5BMSA 3KEXA 5HIBA 2ZV7A 3TNPC 2J50A 4G6LA 4FZFB 5IQBA 1XJDA 4CQGA 4C37A 4CFFA 5AR7A 4EQMA 1W84A 3LXLA 5TKDA 2GNHA 4KAOA 3MJ1A 3D5XA 3FSFA 3V6SA 1IRKA 5LVNA 2RFDA 2UZVA 3OS3A 5LARA 2UVYA 2VTNA 3RP9A 1WZYA 2GPHA 4K2RA 4ZJVA 4FTKA 2F4JA 3CY3A 2QOHA 4WT6A 2GNGA 5HBJA 4FTNA 3P08A 3ORLA 4MHAA 4IACA 1B38A 2WXVA 5M4UA 4EONA 2QO7A 3UPXA 5KBQA 4ZMFA 3WI6A 3DK3A 3DBDA 2R3IA 3FMHA 2XRUA 4B7TA 1FMOE 1W0XC 2JKOA 4BDHA 4R77A 1XH7A 4DEIA 5E90A 2I7QA 4FSUA 4IZYA 3NNXA 2W1IA 1JKTA 2VAGA 2OZOA 2XEZA 5L8LA 3PWDA 2Y0AA 4BKJA 2OXDA 5F95A 4YU2A 5FWKK 2C3JA 3LFQA 3G9LX 4EK4A 1QPJA 3AMAA 5LXMA 2GTNA 3O8TA 4ANOA 3QALE 2O0UA 3O17A 3ORIA 3FLNC 2Q0NA 3Q2MA 3RNYA 5EI8A 1U54B 2YDKA 4GEOA 1NT2A 4GVJA 1ZLTA 2UZBA 3QXOA 4MF0A 3TNWA 3LJ0A 5IISA 4M97A 2ERKA 2R5TA 4LGDA 4BIDA 3F9NA 4AFJA 5CNNA 1FMKA 2J9MA 3VIDA 1DAYA 1M2RA 1WBNA 4DEGA 4ALUA 3ITZA 4NT4A 4TKSA 5J7HA 4RVMA 2VTHA 1OUYA 2XNNA 5J95A 4FTRA 4X21A 4H1JA 2B9JA 5AM7A 5GHVA 3VNTA 3ZS5A 5IDPA 2WHBA 3NDMA 1VYZA 4KD1A 1JKKA 2PHKA 3MGYA 5EW3A 5B7VA 5IG1A 4C4FA 5JRQA 3QRJA 1G8AA 4O7SA 4EZ5A 4RX5A 1HCKA 3JUHA 2V62A 3MY5A 4BDAA 1YWVA 3A7FA 4AACA 4V04A 5LVOA 3PA5A 4PX6A 5CS6A 2XEYA 5FP5A 2QONA 2R0IA 4XJ0A 4LM5A 3MVLA 4AZTA 4LYNA 1P4OA 3LLTA 5IQFA 5HGIA 5HIDA 2QCSA 4E4LA 4I0TA 3VJNA 4EOQA 4X3FC 3EQDA 3T3UA 3HV7A 2Z02A 4FVRA 3GQIA 5JMSA 3EZVA 2WMBA 4TYJA 2UW6A 4WG5A 3RGFA 5AP7A 4D58A 3ZH8A 5HX6A 3NUXA 5EW9A 2E9NA 1GY3A 3GC9A 2VTTA 3DY7A 3LFNA 1H1WA 2C0TA 3TCPA 3ZHPC 3BLRA 2X1NA 3IPHA 2IW6A 4MNEB 4PDOA 4R1YA 5D7AA 3FMKA 4O7RA 3TUDA 3KULB 2CKQA 4BKZA 2JKQA 4JIKA 4YJVA 4RZVA 4HZRA 1CDKA 1OPLA 3SDJA 3WIGA 4D4RA 2DYLA 4HVIA 3ERKA 4BCGA 4C4IA 4FX3A 2OU7A 2ZB1A 3NYNA 4IVAA 3S00A 2R3KA 4MX9A 4AE6A 4I3ZA 3CQUA 2PMIA 1I09A 2C0IA 2E9VA 3VBQA 3P1AA 2F9GA 3C0IA 3HECA 3VULA 3HDNA 3BHHA 4EOIA 2QOIA 2W1DA 2XKDA 3GNIB 4LI5A 4TYHA 4CVAA 3QRTA 2WZJA 1Z5MA 4APPA 4QYGA 3KF4A 4I94A 3BYUA 4JS8A 4CFNA 5HG9A 1FOTA 2UZEA 4RJ7A 1VEBA 3Q4CA 1VZOA 4NTTA 1YVJA 3TACA 3BX5A 4OW8A 4EH9A 3D7TA 1CM8A 3OP5A 4IAZA 3AC8A 4GFGA 3AT2A 3OTVA 4HVDA 2XK9A 4AWIA 2XVDA 4W4WA 2CJMA 5BUJA 5L2QA 2UZUE 3FZSA 3ZRLA 4E4MA 4IZ5A 2VRXA 1RE8A 2OFVA 4WRGA 3RK7A 3R71A 4C58A 5HLPA 3QXPA 1MQBA 1SNUA 3FZTA 2R2PA 5FP6A 5J79A 4NYEA 5EQPA 2HYYA 2ITQA 5F1ZA 4QMSA 3VWAA 2YM4A 3POZA 5TF9A 2OJIA 4NFMA 3MIYA 4RIYA 3REPA 3V51A 2IPXA 4UXQA 1PW2A 4UXLA 3ZM4A 3UTOA 3ORMA 4FEVA 5EM8A 3TJDA 3HGKA 4U44A 5EHLA 3E7OA 3ORKA 4DFNA 4F7LA 3UYSA 1YW2A 2UW0A 4HYUA 3ZLYA 3FI4A 4Y72A 2B9FA 4ZP5A 2A4LA 2Z7SA 4WNMA 4PRJA 5J5SA 3U6HA 4C7TA 5HZNA 3R2BA 2IO6A 4LRMA 4AAAA 3B2WA 3FQEA 3DOGA 4EYJA 2HW7A 3V5QA 2IW9A 4MTAA 3MH0A 4DLJA 5M4CA 4I4EA 2GDOA 4UMTA 5CI7A 4FIHA 4M7IA 2WMSA 5EM7A 5CEPA 1QPEA 4OBPA 4D28A 4UZDA 5JQ8A 3DPKA 2CGVA 4BCIA 3KU2A 5EDPA 2UZTA 5I9XA 4RC3A 2Y9QA 4O21A 1KOAA 4DH7A 2IW8A 3FY0A 3FI3A 2WIPA 4LUEA 3O7LB 5J8IA 2JBPA 2O64A 2VWYA 4MYGA 3U9CA 5HD4A 3GCUA 2C1BA 3QZHA 3Q5IA 4QMYA 3C51A 2WIHA 3C5UA 3A8WA 4EH5A 2XIXA 3Q5ZA 2YM5A 1F3MC 4FBXA 4P7EA 2OIQA 4WNKA 4YJSA 3QD4A 4BI2A 4O86A 4NEUA 1LPUA 3N9XA 4RJ6A 3OVVA 3RHXA 1PF8A 3V5JA 4NKSA 4P5QA 3KRLA 3HA6A 4F64A 4IIRA 3A61A 3O50A 4IX3A 4F1OA 5HE1A 5DI1A 3LCKA 3WE8A 2RF9A 3LJ2A 3ZUTA 3ZDUA 3DBQA 4OTQA 5DWRA 4L3PA 4MBIA 4FUXA 4D5HA 4R3CA 4ZZNA 2Q83A 5E8SA 4FEWA 3FBVA 4O7LA 1PMUA 2DS1A 4TW9A 3MFSA 3ZSIA 3R7YA 1ZOEA 1XO2B 2QG5A 5K0KA 3NUYA 1FPUA 3IW7A 1B6CB 1OVEA 5EDQA 5K9IA 3WZJA 2WEIA 4CYIA 5A4TA 5L2WA 2XJ2A 4YLLA 3K3IA 2JIUA 5KMMA 4BDCA 2WMAA 4BCNA 4EH2A 4BL1A 2WMXA 4ACGA 4NIFB 4PQNA 4LL5A 3EFJA 1I44A 3VHKA 2JBOA 2P55A 3LE6A 2YABA 3HLLA 3OBJA 5CVGA 3R73A 2XF0A 3QC9A 1CKIA 3R7OA 2ZV2A 3UOJA 4NJ3A 4QMZA 2W9ZB 3QGWA 5HG8A 4C4JA 1WBVA 4DGOA 2FB8A 4JOAA 2J6MA 4M8TA 4TT7A 4ENYA 3ET7A 3SXRA 1L8TA 3HMNA 5DVRA 5DRBA 4I21A 5ETFA 4YJRA 3SQQA 3WF9A 1CKPA 3G9NA 5HX8A 2CNVA 3JS2A 3MYGA 4UMRA 2R3NA 4IXPA 5HE2A 4FTCA 3UIMA 1FINA 1AD5A 2YIQA 5D11A 5IH6A 4XBUA 3LMGA 2PVRA 4XCUA 3W10A 4G3FA 4FKRA 5I3RA 4BN1A 4R6VA 1B39A 1OL7A 1Y6AA 4YP8A 2GU8A 4D2TA 2BZKB 1OL2A 3HAVA 4IM3A 5KZIA 5AM6A 3FUPA 4ZSAA 4O84A 3BIZA 2PVJA 4DEAA 4J52A 1SVEA 1A9UA 4S32A 5M44A 3HKOA 1Z9XA 2OF4A 3P78A 2C6TA 4JQ8A 4L7SA 5DR2A 5A46A 3LQ8A 4DFXE 4AUAA 2V22A 2E2BA 2W4KA 2XA4A 3HX4A 3GFEA 2VTAA 4XV3A 3E7VA 3SC1A 4F9WA 4X2JA 2YACA 3WBLA 4ZSGA 4BWKA 1UWJA 5AIKA 2QURA 5JQ5A 1OMWA 3HRFA 3QRUA 4R7HA 3MFRA 3OUKA 3ANRA 1F0QA 3A7HA 3COIA 2JEDA 3GC8A 3ATTA 3OTUA 3PVGA 3QTZA 1BX6A 1UU3A 3R8VA 2PMLX 4DBNA 3TUCA 2OGVA 5DEYA 4CG9A 1MRUA 3LCTA 2PVMA 5FQDC 1PY5A 1ZYJA 3I1AA 5JH6A 3UP2A 5BVDA 5C03A 4E7WA 5K5NA 5A6NA 1OB3A 5M07A 2R4BA 2CCIA 3F61A 1WBOA 3O71A 4JLCA 4CKJA 4GK3A 3PVBA 2YZAA 3MVHA 2FGIA 1QMZA 5EHOA 3HMMA 3R63A 2J5FA 2XM8A 3UNZA 3EFWA 1JSUA 3FMJA 4E5AX 5LVPA 4IZ7A 4LG4A 2WU6A 2HXQA 4FSNA 1BL6A 3PJ1A 4DH3A 2QNJA 5KMJA 2CKPA 1PXNA 4FL1A 1Y8YA 3OCTA 4S33A 4C61A 5J1VA 4G5JA 1H0WA 3H4JA 4EWHA 4YTFA 3BHYA 4M66A 4WKQA 4U8ZA 4YZNA 3RZBA 4JR3A 5HU9A 3FXXA 1Q97A 2ZJWA 4I6HA 4L3JA 1KSWA 3K54A 3MW1A 5BX0A 3G6HA 3NYVA 4L43A 3E62A 3FZ1A 4QP9A 3F5PA 2W0JA 3KKVA 4IM0A 1H07A 2X2MA 1IA9A 2YIWA 1YXTA 2UZOA 3I5ZA 3GP0A 2X9EA 2XRWA 3GOKA 3MPTA 4GS6A 2R3FA 4CYJA 2Y4PA 4C3RA 3FHRA 2Z60A 1URCA 3BYMA 3NLBA 3KA0A 2QOQA 5H8EA 5C1QB 3ZM9A 4O91A 2HAKA 3AC2A 3UIBA 1Q41A 3NPCA 4GCJA 1YDRE 3DB8A 4FNXA 4YJNA 5HVKA 5IMXA 1YXVA 1IEPA 4FOCA 3PA3A 3SAYA 4C34A 2C6DA 4XBRA 4ZLYA 2CGUA 2VWXA 3A60A 3UBDA 4QMTA 4JAIA 5L6WL 4FNYA 4RQVA 3ZO3A 2OF2A 3VC4A 4WIHA 2YISA 4GG7A 3S1HA 1WBPA 3HP5A 3I5NA 3EQCA 3IDPA 3V6RA 4IVCA 3FMLA 4C4GA 3OWPA 4QP3A 4RA5A 3C9WA 4CEGA 4ZY5A 4D1XA 3G90X 1H27A 5AUXA 2PVNA 2YM8A 3FJQE 3Q52A 4GK2A 3Q96A 2G2IA 4IH8A 4R3RA 3F7ZA 3HZTA 2BRMA 3UO4A 1V0PA 5HIEA 1OKYA 4E6DA 5FM3A 3TJCA 4ITHA 4BIEA 5CSHA 5CU3A 3R7UA 4USFA 4FV1A 1YKRA 4HPTE 4D1ZA 4ACCA 3H30A 3CC6A 4EK8A 3QTWA 3BE2A 4FG9A 5ITAA 3COMA 5J1WA 5E91A 5EQYA 4G5PA 5L4QA 3UNKA 3FDNA 1YI6A 3C50A 4BF2A 5A4LA 3QYWA 5F20A 5GNKA 1WCCA 3IG7A 2C5XA 4XG7A 4DEHA 2HW6A 2P3GX 5DR9A 4RVKA 3V5LA 5EK7A 1Q8YA 4E4XA 1XWSA 3NW5A 3EQPA 5IKWA 4FKQA 4TWOA 2PUPA 3OWKA 1IASA 1R0PA 1R1WA 3MVJA 4PF4A 3UVPA 4O7VA 2J0KA 3F5GA 3VBTA 4YMJA 5LCKA 1PXLA 4MKCA 5IQCA 4KIQA 3DZQA 1J7IA 3CKWA 4Z55A 3EMGA 3VJOA 3TTJA 4ASDA 5HTBA 1U54A 4XX9A 2BFYA 2GNJA 3S3IA 4KNBA 2X6DA 2R3MA 4NJDA 4BFMA 4QMQA 3KVWA 3V5TA 4F9YA 4EH6A 3EL7A 2UZWE 4O96A 4C57A 5L8KA 3LMIA 4ERKA 4ZMEA 3GU5A 5HNGA 1DI9A 2ESMA 1HCLA 2VTPA 2W7XA 3NNWA 3QTIA 3LQ5A 4ID7A 4OT6A 4E6QA 2FSTX 3VQHA 3LLAA 3DAJA 2R3RA 4RPVA 4YO6A 4RX7A 2PY3A 1X8BA 4F09A 4U3YA 5AEPA 2E9OA 4YLKA 5EI2A 3H3CA 3EN4A 4FODA 4RT7A 5H3QA 3VUKA 4RFYA 4I5PA 5LWNA 3V5PA 2EB3A 2VTQA 5B2LA 1Q5KA 4LQMA 4QNYA 5AR8A 4AX8A 3BBTB 5FXRA 3QTXA 3SOAA 5K4IA 4M13A 4CD0A 5ACKA 5HE0A 3TIYA 2UV2A 3O8PA 2C5OA 4DITA 4EL9A 2VX0A 4N6YA 4QMLA 4I20A 2P4IA 1PMVA 1ZZ2A 1LEZA 1RJBA 4OGRA 4HJOA 4ZY6A 4F9AA 4EOMA 1XBBA 3JYAA 1YHSA 4ZSEA 5I9WA 3E8NA 3CPBA 1J1BA 4YZCA 1W98A 1VR2A 4F7JA 2J0MB 1OIRA 3ZLWA 4EC8A 2WGJA 2OIBA 3QWJA 4FIIA 5E1EA 3LMHA 4JDJA 5M06A 3CTJA 3OXIA 4W9WA 4BIBA 4R5YA 2C6EA 2JDRA 3UIXA 5CF6A 4KA3A 4K0YA 4DHFA 5T6KA 2WMVA 3BWFA 5BNJA 5A6OA 5FM2A 2Y4IC 2VX3A 3M1SA 3AOXA 3AGMA 4IX4A 2PMOX 2W99B 3GVUA 4FKJA 3ZO2A 3GCVA 4F6UA 4YGAA 2EXCX 3C5IA 2IZRA 4EC9A 3BGPA 1OL1A 2WKMA 4NM0A 2V0DA 3QCXA 4TYEA 2ITYA 3ZSHA 3KRXA 4GIIA 5ICPA 4UX9A 3NIZA 4BCQA 5BPYA 4ANLA 5KHWA 2YDJA 5EQEA 3D5WA 3MIAA 5ETIA 2FO0A 3FAAA 4FEUA 1K3AA 1JSTA 1PRYA 2HK5A 3NYXA 5AUTA 2GTMA 1W7HA 3QQUA 3BYVA 4FTOA 2J0LA 3HRCA 4KABA 4YZMA 5GJDA 1SZMA 1GIJA 4FSYA 4D2PA 4BC6A 3FLQA 2C6LA 4I0RA 5AV1A 3I7CA 5L3AA 3TDVA 4CSVA 3JY9A 5HD7A 4C35A 4MH7A 1JVPP 2X8IA 4O2PA 2BFXA 5CYIA 2YERA 4IC7A 3ZONA 2YFXA 5HE3A 3HMIA 4PPBA 4YBJA 2I0VA 4QT1A 4U0IA 5AP5A 4DG2E 3PXKA 4O83A 2C6KA 4IHPA 1PKGA 4BCKA 1R78A 2QOOA 4F9BA 4FSTA 4Q2AA 2QKWB 5ANKA 3DBCA 3QTSA 1OIUA 4J7BA 2ZMCA 4RIWB 3MWUA 4PL3A 3Q4UA 2WAJA 4D4VA 3DDQA 2XB7A 4IWOA 5CXZA 3A7IA 3R22A 3W32A 4WSQA 4AN2A 4ANBA 2NRYA 4EZ3A 4F0IA 2VWIA 2ZV8A 4FOBA 4JDHA 4IDTA 4USDA 4PL4A 3ZUUA 4IX6A 3SV0A 4CRSA 4U5JA 4AT5A 2JITA 2UZLA 3VQUA 5I5ZA 3Q9ZA 5JKGA 5ANJA 3HNGA 4EJNA 2I0YA 5CT0A 2ITNA 4U42A 4FIFA 2BROA 4AA0A 1V1KA 2AYPA 2Z7QA 3UC3A 3DLSA 3OCGA 1YOLA 5IUIA 4BCMA 1H01A 4G9RA 3QWKA 4EI4A 5CAPA 1UWHA 5HTCA 4A4XA 3KCFA 1OECA 2CKOA 3KK8A 3FV8A 2WTJA 3W2RA 3FI8A 4RLKA 2C1AA 3PJCA 4EK5A 2FVDA 4F08A 3LPBA 2FSOX 3BU5A 4GKHA 3KY2A 3DNDA 3G5DA 4BZDA 1ERKA 1V0BA 2BUJA 1UV5A 1Y6BA 2CDZA 5EYMA 2E9PA 3OY3A 4F70A 1IAHA 4H05A 3KXHA 2OW3A 3JVSA 5LOHA 1KE5A 3IW8A 3LAUA 4E3CA 4RX9A 2YHVA 3NWWA 3UP7A 4C3FA 3KCKA 4BDGA 4DCEA 5J9YA 4A4LA 1F5QA 3F88A 5JRSA 3QUEA 4FT7A 3SKCA 2ITWA 4PMTA 2XK7A 2XBAA 5E1SA 1UA2A 3UC4A 1PXIA 3QUDA 4Z3VA 3KVXA 5HTIA 3P9JA 4EUTA 3QFVA 4U43A 4WBOA 3A4PA 2VV9A 4KBCA 4XG9A 3ZFMA 4IAFA 2IG7A 2UUEA 5HBEA 5DG5A 3DTCA 4ALVA 3SVVA 3I7BA 4W4YA 2G01A 5EW8A 5I9VA 4ASEA 1ZMWA 4A07A 4FR4A 3VO3A 3OEFX 4EUUA 2W1ZA 3G33A 5BVKA 4AG8A 2JLDA 4RJ4A 5GINE 4BTMA 1XR1A 2XIRA 2B0QA 1M52A 3KFAA 3GCPA 3I81A 3A2CA 1NVQA 2GFCA 3NZ0A 1ZRZA 2XM9A 3DFAA 2ITOA 2QU6A 4FZ7A 4CKRA 1Q3WA 5DT4A 4LL0A 3NNUA 3MPAA 4XP0A 3MH3A 4J98A 3W2SA 5FDXA 3HV4A 1OL5A 4H39A 4MXXA 5I3OA 4AZWA 3I0OA 3KN6A 4IAKA 5EFQA 3JPVA 3RJCA 5HU3A 5K5XA 2C68A 3RPVA 2PUNA 2B53A 1BUHA 3JY0A 4ORKA 1UNHA 2B7AA 1FVTA 4QMWA 3L9MA 3VHEA 2HOGA 3BV3A 4O81A 5I9ZA 3UG1A 2ZMDA 3Q60A 4ZTNA 3FXWA 3QZGA 1JLUE 4YC8A 5JGBA 3OOGA 2VO3A 3B8QA 3POOA 4CQEA 1WVYA 2CGWA 2WTVA 4EH7A 2EB2A 3JVRA 1Z57A 2PZIA 5IU2A 3W8LA 3A8XA 4QMXA 4NZWB 1OBDA 1CKJA 3NGAA 3TZ7A 4JG6A 3HUBA 4ZJJA 3PA4A 5CEKA 4OLIA 3LFFA 4MWHA 5HCZA 4AN3A 1ZOHA 2ZB0A 1QPDA 3TNQB 2QG7A 3L9PA 4FKOA 1ZY4A 4ERWA 2QOBA 4HVSA 3NCGA 4RX8A 4CXAA 4KBKA 2QO2A 4U81A 4O7ZA 4PMPA 3SRVB 2ZYBA 4IAAA 3BELA 4AOIA 4MD9E 2QQ7A 3WF7A 3WARA 2WQEA 5EOBA 4E6CA 4JIAA 3GENA 2B1PA 3BHVA 4RMZA 3NMUF 3KREA 2X4FA 1NA7A 3C0HA 5CX9A 3GC7A 4N0SA 4D2WA 2EUFB 3LHJA 3KXXA 4O0RA 5BVWA 3O51A 3RVGA 4HYIA 2O2UA 5AV0A 1SNXA 2YZLA 3ORNA 4FZAB 1U46A 5AV4A 4RIOA 4C2VA 2W5HA 2XYNA 1ZMVA 3DKOA 1M7QA 3GC0A 3VF9A 2WMTA 4PDSA 4LMNA 4ACDA 4C4HA 1H4LA 4MXYA 4PL5A 2EWAA 5CEMA 3ZEWA 1TVOA 3E92A 1U4DA 2ZM1A 3O2MA 3EQFA 3DS6A 4FIGA 4Q5HA 4EBVA 3S95A 4F6SA 4XG8A 3HEGA 2J0JA 5BQ0A 3LFBA 4YPSA 4JX7A 3R28A 3GU6A 4RWIA 4ZTSA 3L8PA 3TT0A 4BY9E 3KL8A 1K9AA 1YWRA 4R8QA 3QHRA 5LQFA 4KRCA 4KIKA 4FC0A 4L01A 3WILA 3H9FA 4D2SA 1WBTA 3AG9A 3IDCA 1YXSA 1YQJA 3Q9XA 4QRCA 1V0OA 4FI1A 5CSVA 5FTQA 3RM7A 1H1RA 1JKSA 1GOLA 2JDVA 4TY1A 4XV1A 2C6IA 3FMDA 2RG5A 3PTGA 3HVCA 4CFUA 1XBCA 5ETAA 4NM7A 4OTIA 4FKLA 2C3KA 4L8MA 5HKMA 1YI3A 3PE1A 3CTQA 2PWLA 3PY0A 3DDPA 3QQKA 4W9XA 5D12A 1R39A 4DAWA 1IA8A 3FL4A 4FTQA 3COHA 4A4OA 4QP6A 5EM5A 4PTGA 2QVSE 1L3RE 2X8EA 3QQFA 5E8VA 1ZYSA 5AAGA 2OIDA 3QZFA 3TIZA 5JT2A 2VWZA 3DTWA 4W4VA 4D0WA 1EH4A 2BVAA 2HWOA 2BRNA 2J51A 2VTSA 1MUOA 2PMNX 4ZXTA 3CSVA 5FTGA 5DRDA 2J4ZA 3TKUA 1MP8A 3NUPA 3VS4A 4GUBA 3Q3BA 3IW6A 3DV3A 4I22A 2QOFA 3MFTA 5IQGA 1M2PA 4AGCA 3U6JA 3FHIA 4HYHA 1TQMA 4X3FB 3C4WA 4XMOA 3U9NA 4O0WA 3E3PA 4FZ6A 3IW4A 2VWVA 4ZY4A 4DFLA 4L52A 2C0OA 4IQ6A 4UWYA 4WG4A 4F63A 4QTAA 4S30A 2GNFA 5TOZA 4L42A 2O5KA 2JD5A 5IQHA 3DZOA 3WZUA 5A4QA 3KRJA 2C5VA 3D0EA 5M57A 4F4PA 3W8QA 5AR3A 4CTBA 4D4SA 2B9IA 2WTWA 4O6EA 4WNPA 3V8SA 5EYKA 5JSMA 1OZ1A 5AAEA 4FT9A 4K6ZA 2NPQA 4TN6A 4RLLA 5AP2A 3OT8A 3A99A 4TWNA 2ONLA 2JIIA 4IX5A 3V5WA 1E9HA 3EYGA 1BYGA 4DG0E 2JKMA 3AGLA 1Q24A 3PLAE 5AV2A 5K3YA 3VAPA 1Q61A 3BRBA 3EB0A 4LV8A 5E8WA 5IF1A 2OICA 3DQXA 4C33A 4EOJA 4UMQA 4TWCA 3CCNA 2XYUA 2YEXA 2BCJA 5FXQA 5TT7A 4I1ZA 3CJGA 3WZEA 4QO9A 4C38A 4DC2A 2I6LA 3P23A 3ZFXA 2VGPA 3EN6A 3QRIA 4M69A 3IO7A 4KUJA 2IN6A 3PZHA 3FI2A 2HY81 4QPAA 4CZTA 4IBMA 4X0MA 1ZYLA 2UW5A 4AOJA 5H8BA 3OF0A 5HORA 3ETAA 3F6XA 3ZRMA 5CU2A 2HWPA 5BYLA 4EOSA 4I24A 3I6UA 5BVEA 4HOKA 3D94A 4YC6A 4X2FA 2QR7A 2ZAZA 4FZDB 4IDVA 5FXSA 1Y8GA 3QQLA 4RA4A 2WQMA 4I4FA 3EHAA 4IB3A 1Q8WA 4UALA 4MD8E 2QODA 3P0MA 4FVQA 2A0CX 4FVPA 5F4NA 2WTKC 3LFEA 3OZ6A 3MPMA 4I6FA 3OC1A 5LVMA 1UU9A 4FKUA 4UB7A 4U3ZA 3WOWA 4Y46A 4HGLA 1WAKA 4CNHA 3UQFA 5HQ0A 3L8XA 3RI1A 2XCKA 3D83A 4N70A 4FIJA 2FSLX 2J7TA 3VBXA 2RG6A 4EK3A 4DFBA 3NUNA 2YAKA 1ZMUA 3VBVA 1UU7A 3KMWA 2YIYA 3C13A 4BKYA 1AQ1A 4KINA 4QTDA 4X6QC 1DI8A 1DM2A 3CJFA 2C5NA 4G9CA 3O23A 3GU8A 1OKVA 2UW4A 4J8NA 4O1PA 5CSXA 4DGMA 1H8FA 4JQ7A 2JDSA 1PXOA 5HI2A 2E9UA 5A4CA 5DR6A 4IWQA 3EN7A 4DT9A 1KE8A 4XP2A 4UV0A 5C4KA 5IQIA 3COKA 5ANOA 3VN9A 2R7IA 4RIXA 1M7NA 3KN5A 4UYNA 3RPYA 4GW8A 2GNIA 4TWPA 4V0GA 4XLIA 3RPOA 3OHTA 4U45A 3S2PA 4FG8A 2H34A 4GYGA 5ANGA 4GVAA 2VTLA 3PJ8A 4YURA 4FKTA 1K2PA 3BBWA 2XIKA 4H36A 5M55A 4AFEA 5DMZA 1O6YA 2PVHA 3RAIA 2IZUA 1JAMA 4MWIA 2VNWA 3W16A 4E6AA 5C8MA 1PKDA 3NUAA 2A1AB 1H26A 4DGLC 2XCHA 3RK5A 3PSCA 3IONA 4GJ2A 3BHUA 4L44A 3QRKA 2OO8X 4KKEA 5DBXA 2C6OA 3D9VA 2C3LA 2WOUA 2WB8A 3KXGA 4ZTRA 5KE0A 2ZOQA 4JBPA 4Y5QA 3SW4A 2PVFA 4JDIA 5DE2A 3UVQA 2UZDA 4G3DA 2ETMA 4ANQA 4FV4A 4YHJA 4FT5A 4IMYA 3D7ZA 2VZ6A 4OUCA 5AR2A 4F1MA 2YWVA 2IJMA 4FSWA 2BAQA 2R3QA 3W1FA 3VW6A 5DNRA 2EXMA 5F9EA 3GUBA 2AUHA 4W8EA 3BLHA 3QD2B 3V01A 4RWLA 2V7OA 1FGKA 4IANA 4M67A 2BPMA 4Q5EA 3Q53A 4ZOGA 3JR1A 2ZDUA 3DAEA 1RQQA 2PVKA 2X6EA 3G0FA 1KE9A 2FH9A 2PZRA 2W96B 3QQGA 5FBOA 3W2PA 2PUUA 2W06A 4Z7GA 2P33A 4C62A 3ATSA 5C27A 3DB6A 4BHNA 4WUAA 2RL5A 5GZAA 3LFDA 4MXCA 3B8RA 4EHVA 4RIWA 1TKIA 3BYOA 4IE9A 2HELA 4PMSA 5EKOA 2XNEA 4UY9A 1NVSA 3F69A 4B4LA 3P7BA 2IVVA 4IZAA 4WNOA 3L9NA 5DT0A 4A9YA 1SVHA 2UZNA 2I40A 3R8UA 5E8ZA 3NYOA 5AA9A 1VYWA 4QYFA 1YXUA 4IFGA 2OZAB 3BQCA 4WA9A 3DXPA 3QTQA 2PYWA 4GYIA 3ORTA 5DLSA 4EH4A 2VTRA 3ZLSA 4I6QA 1PMNA 2DUVA 2G1TA 3SX9A 3FMMA 2ETRA 4D9UA 3DK7A 3FXZA 4D1SA 1S9JA 4R3PA 4ASZA 4KS7A 4CGAA 4CZUA 4FF8A 5CU0A 2YM6A 3PLSA 5IA1A 5JN2A 2XS0A 3P4KA 4R1VA 1UNLA 4EOKA 3MY0A 4C4EA 4RJ8A 2ONLC 2GQRA 2WMUA 3ZRKA 1YRPA 5F94A 4HCVA 5CZIA 1JKLA 1OPJA 3GU4A 3IECA 3MN3A 3RPRA 3ZU7A 3E88A 2BAJA 3VUGA 4BZOA 4GMYA 4TYHB 3ORPA 4YJQA 5HOAA 3HMPA 3EQRA 4OT5A 4CFVA 4QTEA 4Q9SA 4AU8A 1P2AA 1QL6A 2ITXA 3GCSA 2BKKA 3BV2A 4GL9A 1REKA 2OH4A 3LXKA 2PVYA 1U5RA 4M14A 4QMPA 5CY3A 3ZZWA 1Y91A 3R7VA 2PZ5A 5IEXA 4GSBA 3BU3A 5J87A 3F3UA 2GHMA 4MCVA 2GQSA 4EQUA 5M08A 1NVRA 3QX2A 4QNAA 3PP1A 3CPCA 2WTIA 2VO7A 4P90A 4DINA 5DN3A 1G5SA 3RINA 4DT8A 4PNKA 3FLZA 4QMNA 2Z7RA 5IH4A 1WFCA 3OXTA 4YUQA 3MDYA 5HEZA 4IAIA 2PU8A 4DH5A 3R02A 2O63A 3GFWA 3LOKA 4JJRA 2H96A 2HZNA 2PK9A 3FMEA 3QD0A 4FV0A 2BIKB 1ZAOA 2X0GA 4H3BA 3ZUVA 3IOKA 3OFMA 1PJKA 1NY3A 4QOXA 4BTJA 3BZ3A 3U8WA 2GHGA 3UYTA 2CGXA 4DEBA 5JFXA 3F3TA 2G9XA 3WE4A 2ITUA 5J5TA 4X2KA 4RQKA 2QLQA 4IB1A 4CFWA 3F2NA 3PVUA 1PXMA 3E8DA 2HCKA 4MF1A 1O6KA 3O0GA 3RAHA 5CAVA 2YDIA 4HPUE 3T9IA 4BBMA 4L46A 3CD8A 4CCBA 1WBWA 2WTDA 4D55A 3ROCA 2CCHA 3R0TA 2BRGA 4DGNA 3R1YA 4WOVA 1XHAA 2OI4X 2YITA 3Q6WA 4P2KA 2IVUA 4RBLA 2P0CA 5CU6A 4F7SA 4DBXA 3OXZA 4V05A 2VUWA 4CLIA 4MK0A 4CMTA 3LCOA 4WHZA 4RSSA 5AUYA 4WRSA 4CKIA 3UO5A 4GU6A 4GG5A 4YJPA 4ACMA 1YWNA 5IZFA 5M4FA 4BI1A 2YWPA 4BHZA 4BB4A 2WO6A 3TXOA 2VWUA 5D10A 5FD2A 4KKGA 5C01A 2ITZA 3NX8A 3RALA 3TKIA 3UQCA 4Y95A 3V8TA 4EKLA 2YAAA 3FLYA 4YHTA 1OPKA 2ITVA 1Q8ZA 4Y5HA 2WELA 4DTAA 1OGUA 2VTMA 3Q2JA 4XRJA 3SRVA 3HP2A 4BCPA 1H1PA 4RRVA 4C8BA 4CT2A 3VS1A 5CLPA 2B55A 1IR3A 4WUNA 4HYSA 3FQSA 3AMYA 4JNWA 5CF4A 4J99A 2PE1A 4DH1A 3V8WA 4EK6A 4ZIMA 1UKIA 3ZFYA 4FTTA 3TV4A 1XH9A 3LFSA 3CEKA 3FEGA 2AC3A 3ZC6A 3GI3A 2FUMA 2QU5A 4FKIA 4IVDA 3H0YA 4AP7A 3GXLA 1CMKE 3PIYA 3TI1A 3AT4A 3RCDA 5CAUA 5FEDA 2C47A 2C4GA 4P4CA 2YJSA 3LCSA 3BGQA 4TNBA 5CEIA 2H9VA 2HZIA 3ORZA 3S0OA 3LZBA 4AGDA 2YJRA 3OUNB 5T3QA 3OW3A 3VS7A 3QL8A 4FTAA 2R3OA 1ZWSA 2YIXA 1PXJA 4LOQA 3FZOA 4WD5A 4EZ7A 2R3GA 1LEWA 2VO0A 1FGIA 2YCQA 1YHVA 2F7ZE 2PL0A 3D15A 3KQ7A 4QMMA 3K2LA 4LOPA 4YZDA 4D2VA 2XMYA 4L9IA 3DXQA 4QYHA 2CPKE 4FNWA 4NM5A 4CCUA 3EYHA 2JIVA 3PXYA 4FT0A 3RK9A 5KKRC 4ARKA 4MBJA 4MNEA 5BVOA 2JGZA 3O96A 1BMKA 3KULA 4PDPA 4ZTLA 5A4EA 2RFEA 4DE4A 4IWPA 5E8YA 4N57A 4IAYA 2HY0A 4BWPA 4V01A 3QGYA 2O3PA 2GSFA 3FYKX 4BDBA 4XYFA 4E5BA 2OH0E 3Q4TA 3R9HA 3MVMA 3OEZA 4L00A 4XP3A 1JNKA 2NP8A 4M0ZA 3VS0A 4ANSA 4DFYA 2A2AA 4J95A 4UN0C 1YDTE 3VUTA 1YOMA 1XH4A 1WVXA 5A9UA 3R04A 4E26A 5FEEA 3DXNA 5G6VA 4AZSA 3E8CA 3SHEA 4YSJA 3TN8A 3EWHA 3MH2A 2XZSA 4NFNA 4F99A 4HGTA 5CAQA 4YTHA 3SW7A 2ZM3A 4A9TA 4U6RA 2R3JA 4YZ9A 4BCJA 4BCFA 1MRVA 3PSDA 3CS9A 3R6XA 3ZXZA 2WOTA 4FT3A 2R3LA 5ACBC 4FV6A 5AP0A 5BVFA 4FUYA 2QOCA 3TZMA 2RSVA 2CKEA 3CIKA 4BDEA 2GS6A 2W5AA 3IGOA 4FE2A 3U55A 2W17A 3FSKA 5FRIA 3QU0A 3BCEA 3PRFA 1WMKA 3F7WA 3KGAA 3RBWA 4CTCA 4RC4A 3ZTXA 3C4EA 3F82A 2B54A 2VTIA 4O38A 2C69A 3M2WA 3FLSA 4FEQA 1UNGA 4CMUA 3M42A 2PE2A 2IZTA 2CLQA 3BGZA 4G3GA 2PULA 5FDPA 3PFQA 2HENA 3BEGA 1ATPE 4K11A 4NU1A 4X3JA 4ANNA 1YHWA 4G1WA 4K9YA 5GJFA 4ZK5A 3CP9A 5AUVA 2I1MA 4K18A 3VBYA 2J90A 3QAME 1KWPA 5HO8A 2IVTA 3QCSA 3EQGA 3ODYX 5IUGA 1PXKA 5L2IA 3U4WA 4Z7HA 3PPJA 2Y4IB 2XKFA 2BHHA 4GFOA 3UMWA 4Q9ZA 4RVLA 3ZEPA 4BI0A 4BGQA 4J8MA 5AX3A 3AC3A 4FG7A 3AMBA 2RGPA 3IDBA 3I0QA 2XNOA 5KUPA 2OKRA 4UZHA
chains in the Genus database with same CATH superfamily
3O8UA 2YN8A 1FVRA 4YR8A 4FIEA 3PJ3A 5C8KA 2OJGA 5L6PA 4DTBA 3UVRA 3RTPA 5HNIX 3ZO1A 4AZFA 4QQJA 1OKZA 4A06A 4QP2A 1REJA 1QCFA 2VTOA 4AOTA 4FTMA 5CWZA 4E8AA 4BDFA 1QPCA 4N4SA 4YO4A 3NCZA 1OI9A 5LWMA 5IEYA 4DA5A 3R9NA 3EKNA 4HNFA 2JAVA 4QP4A 4U79A 1APME 4X2NA 4FMQA 2BZHB 3UGCA 2F57A 4RJ3A 2B4SB 4MEDA 2J2IB 3S4QA 3C4ZA 3L1SA 4ZAUA 3A62A 3QCQA 2W1EA 1SYKA 4NH1A 3MTFA 3FZPA 2PUIA 4AZVA 4M68A 5JFWA 3SG8A 5CTPA 5AP4A 4F0FA 3LCDA 2VO6A 2HIWA 3SA0A 4PP9A 4II5A 4FKWA 2WEVA 4DYMA 2GS2A 4DHIB 2IWIA 2Z8CA 4R5SA 4A7CA 3CR0A 5D7VA 3MSSA 2OFUA 4UMPA 3IKAA 4I93A 4NCTA 4QTBA 4QPMA 4RGJA 1XH6A 4LGHA 3E3BX 4CMOA 5LMBA 1O6LA 2R64A 4YHFA 4RFZA 5JGAA 2OG8A 5M4IA 2WPAA 4U80A 4N6ZA 2OK1A 3ACJA 1BL7A 5IA4A 3PG3A 4HCTA 4NIFA 4WG3A 2YCSA 3H0ZA 5E9EA 4GT3A 3PP0A 4ONAA 2CLXA 3EQIA 5C9CA 2VX1A 3OG7A 4XOYA 1IG1A 3PVWA 4D2RA 4CV8A 2P2HA 1J1CA 3PUPA 4D0XA 4BCOA 5HCYA 4HGEA 4L7FA 3R30A 1YI4A 2IZSA 4G3CA 3CGFA 3NR9A 1A48A 1E1XA 2CHLA 4A9UA 3D4QA 3TWJA 3QF9A 4FV7A 4DTKA 1OGYA 1NXKA 5AJQA 1XH8A 3PXZA 5AR5A 3P5JC 5EM6A 4AN9A 2QHMA 4QMMA 3C7QA 4M3QA 4G17A 3UZPA 4XUFA 1STCE 1ZARA 3HUCA 4KSQA 4BGGA 5FTOA 5M53A 1OIYA 3PWYA 1J3HA 3R9OA 5AADA 5LJJA 4AXCA 5D9HA 2LGCA 4IADA 3P5KA 1PHKA 3MB6A 3IGGA 5T68A 3R8PA 4B99A 4E4NA 4OTFA 4ZLOA 4JL9A 4CFXA 2X8DA 3F66A 4XG6A 3TG1A 4B8MA 4CRLA 3L9LA 5DEWA 3TNHA 3AC5A 3Q6UA 3CGOA 2FA2A 4LFIA 2IVSA 4XEYA 3QA0A 4MQ2A 5DA3A 1H08A 3EOCA 2C6MA 3NAXA 3VRYA 3OOMA 4E93A 2OSCA 2F7EE 2XJ1A 3CLYA 3QTRA 3R1SA 1XMLA 5KX8A 2YCFA 3JXWA 4KBAA 3OD6X 4HW7A 1U59A 5CALA 5L2SA 1WBSA 3SD0A 4YTIA 4EYMA 3PG1A 2BTSA 3LFAA 4NUSA 4PNIA 3E93A 3SOCA 1ZYDA 4FV9A 5AP6A 4XH6A 3PSBA 3TMOA 2QLUA 4FV2A 4ZTQA 3BI6A 3HV6A 2PSQA 5FLFA 3UOHA 4XHKB 2GQGA 4FL2A 3CE3A 3ZXTA 4QP1A 4L53A 4TPTA 5H8GA 1LP4A 3M11A 4GUEA 4AE9A 1T45A 4FSRA 2PTKA 4GU9A 4QD6A 3D5VA 4GT5A 4O0UA 4JAJA 1J7UA 3BL7A 3R1QA 3BYSA 5BVNA 2GMXA 4BR3A 3FQHA 3LKMA 2R0UA 3DFCB 2G15A 1GNGA 4AGWA 4AF3A 4D4YA 2XKCA 5CAOA 4KB8A 4AA5A 5BUEA 2ZM4A 3HRBA 4G34A 2BHEA 3MESA 3I79A 3RWPA 2QHNA 3NUUA 3Q9WA 3TL8A 4FKGA 3R83A 3D14A 3LVPA 4NKAA 2ZDTA 3QLGA 1A06A 3H9RA 4TZRA 3F3VA 1LR4A 2RIOA 3RM6A 4MBLA 2A19B 3GB2A 3U54A 3T9TA 5DT3A 4B0GA 4R78A 3DBFA 3ORXA 4NM3A 5CVHA 4JBQA 4O4FA 3OW4A 2JKKA 2OXXA 3AT3A 4XRLA 4E73A 2GHLA 1GAGA 4LGGA 2XUUA 2OZAA 2W05A 4WO5A 4JG7A 3T3VA 3DU8A 4OBOA 3PDTA 3BQRA 5JGDA 3NUSA 5CQWA 3ACKA 4MXOA 3QQJA 5AWMA 4C0TA 2C5YA 3TKHA 3B2TA 1Y57A 2V7AA 2B52A 1RW8A 4K33A 5TO8A 3KF7A 2OJ9A 2YA9A 1H00A 2UW3A 4RJ5A 5FEQA 3G51A 5EYDA 3C4CA 3PPZA 1FVVA 4JBOA 5EOLA 5C8NA 3PYYA 4OTDA 5IPJA 2H8HA 5HO6A 2WMRA 2BDJA 4NW5A 4BTKA 4IW0A 5KHXA 5KNJA 3QQHA 5JFVA 3FPMA 3PIXA 2HZ0A 2PZYA 3F2AA 4IB0A 4FK6A 5EI6A 3WZKA 1KE6A 3C4FA 2YM7A 4FK3A 2G2HA 4GT4A 5KMLA 4O7NA 2BR1A 2QO9A 2XK4A 4O0TA 2W1HA 3DKFA 1XKKA 2XH5A 4E1ZA 5J9ZA 3WZDA 4LUDA 5TE0A 1JSVA 2BILB 3WYXA 2Y7JA 4MXZA 4XLVA 3QKKA 4DEDA 1OL6A 1RDQE 2XKEA 4XV9A 4EH3A 5L2TA 3NW7A 3OT3A 2RFSA 3SG9A 3HDMA 1GJOA 4ENXA 4EOOA 2CN5A 5HESA 4OTHA 2NRUA 2DQ7X 4O7WA 4FSMA 4AW5A 3QYZA 5EH0A 4YNOA 4J53A 2C30A 4QMOA 3CQWA 4IVBA 4XNEA 3VS5A 4RZWA 4TXCA 1PYEA 3BEAA 3G6GA 3TZ8A 3R7EA 2OJFE 2VGOA 3FKOA 1Q3DA 4KRDA 5J9LA 3AC4A 4BJJB 3DNEA 3KRWA 4J1RA 1KV2A 3W0SA 1KUTA 4LV5A 3QKMA 3AD4A 4YC3A 4AT4A 4QQTA 3F3ZA 3FZRA 2CN8A 5I4NA 3FL5A 4TNDA 4K77A 4OR5A 3OY1A 4JDKA 3THBA 4DH8A 4NCTC 1XQZA 5CI6A 2XNPA 4EOPA 4M84A 4BBFA 3LFCA 2QR8A 3NVKI 3TNIA 3R01A 4L3LA 1JWHA 2VNYA 3BWJA 3MY1A 4B9DA 3BKBA 4EEVA 2WQOA 3K5VA 4EKKA 4BWXA 3EQBA 1NW1A 1MRYA 3I60A 3FC1X 3CXWA 3DKGA 5IUHA 1W8CA 2W5BA 3K3JA 3NS9A 3RNIA 3GCQA 1PMEA 4GH2A 3MJ2A 2GFSA 5KMKA 3FWQA 5KCVA 4JVGA 3C0GA 3R9DA 3UIUA 4EQCA 5J7BA 3CTHA 5HHWA 4IM2A 3LXPA 2BALA 2SRCA 4AGUA 5B0XA 2XK6A 4I0SA 4TYIA 5KO1A 1FQ1B 3V3VA 2GNLA 4FKSA 4E20A 4IJ9A 1GZOA 3RAKA 4DN5A 1TQPA 2JDTA 5DFPA 4QPSA 5A54A 2R3PA 3I4BA 2W1CA 3FMNA 4AW2A 3QCYA 4F9CA 4G16A 4KKHA 4C36A 4CFMA 4A9RA 2BAKA 2OXYA 3R8MA 3WF5A 3VBWA 5AFVA 4JT3A 4QYEA 4F1TA 4FNZA 3R8ZA 4HVGA 4PY1A 4L6QA 3SGCA 1LUFA 4JRVA 4KWPA 5CEQA 1Q8UA 5EYCA 2XNGA 2WQBA 4YJTA 2ZFYA 3ODZX 2FSMX 5E4HA 4BDIA 4J71A 2BDFA 4YZBA 3H9OA 3P7CA 5M09A 5LVLA 1H28A 3DAKA 4HZSA 3EQHA 3KMUA 4S31A 5CASA 3OCSA 3VUIA 3ZSGA 4AW1A 4BGHA 3HA8A 3UG2A 4XV2A 4B6LA 1DS5A 4H58A 3C1XA 2JC6A 4GV1A 4MVFA 1JOWB 3E64A 3U6IA 2X39A 3UE4A 4FSZA 2X7FA 1MQ4A 5A3XA 3QC4A 4OTPA 2EXEA 3ZOSA 3DJ5A 2X9FA 1WVWA 4E5WA 3E5AA 3PXRA 2B9HA 1OBGA 3KB7A 2UW8A 4B8LA 2VWBA 4RVTA 3NSZA 3RPSA 1G8SA 3IQ7A 5FGKA 5IQDA 5DH3A 3ALNA 3BE9A 4WBBB 4QMUA 5H2UA 5HG5A 3EKKA 4AZEA 3N4VA 3DT1A 2P2IA 4FYOA 4IJPA 4JQEA 2BMCA 4J97A 4QQ5A 3PXFA 3TTIA 3F2RA 3QZIA 3VRZA 3AXWA 4ITJA 5ETCA 3ALOA 4DF3A 5FBNC 4GFMA 3UMXA 3AQVA 3QBNA 2J0IA 4FGBA 3D2KA 5CT7A 5HLNA 3VF8A 3W2CA 3DJ6A 4LRJA 4YBKA 3R7IA 4ZEGA 4EHEA 2X2KA 4OTWA 4PTEA 5DOSA 4KIOA 4NWMA 3MI9A 5CF5A 3MB7A 4MQ1A 2I0HA 2REIA 2WMQA 5B2MA 2WTKB 4F7NA 2F2UA 5JZJA 3FYJX 2PVLA 4GRBA 1OITA 5KMNA 4O4BB 3RAWA 4Y83A 1KE7A 2CSNA 2A27A 4QQCA 3DBEA 3NRMA 4O0XA 4ZS0A 2PE0A 3EH9A 3MA6A 1ZXEA 2NO3A 4R7IA 4Y73A 3GOPA 4C3PA 3P79A 5FUTA 4W4XA 3NW6A 4BTFA 3MTLA 2XK8A 1P4FA 1YXXA 4LMUA 4UMUA 2X0QA 5AA8A 5I9YA 1BI8A 2KTYA 3C4XA 3LIJA 4K1BA 5CF8A 5DHJA 3BHTA 3EFLA 2EVAA 4MNFA 2VWWA 5FG8A 4S34A 2F7XE 4H1MA 4RFMA 3ZMMA 3OBGA 5CNOA 3N4UA 2LAVA 4HCUA 4BDJA 3LM0A 4H3QA 5C26A 1YDSE 2W1FA 5AMNA 2WD1A 1FBNA 3W18A 3DK6A 1UVRA 3R9RA 1W83A 3ZYAA 2XARA 5AV3A 2ACXA 3F5XA 2JDOA 3IOPA 3R2YA 3EN5A 5CVFA 2OJJA 4ZTHA 3RKBA 4PDYA 3EZRA 5AR4A 3MS9A 4I5HA 3HL7A 5AAFA 4BYIA 1TQIA 3D2IA 1ST4A 3ZLXA 4DCAA 5I9UA 2PPQA 5CSWA 3AD6A 3SXFA 2W1GA 4DLIA 2W4JA 2WFYA 3EN9A 1PYXA 1KOBA 3KK9A 5AP3A 4X6RA 4O82A 3IW5A 4L45A 1CTPE 2XIYA 1ST0A 3HV5A 5CZHA 4G31A 4FSQA 4UBAA 4F0GA 2XP2A 2BZIB 3NEWA 2BTRA 3VUHA 2X7OA 3E8EA 4UWBA 4ZSLA 3EFKA 5GZ9A 2HZ4A 1O9UA 4GJ3A 4C2WA 4ZLZA 3PZEA 3DCVA 3GGFA 3P7AA 4KIKB 1ZOGA 2J5EA 5HVJA 4ZTMA 1U5QA 5AIRA 5E7RA 3ROYA 1H0VA 4IFCA 2X4ZA 4G3EA 5ANEA 4TL0A 5IQAA 1YOJA 5K0XA 3GT8A 5GJGA 2Y6OA 4J96A 2F49A 2KULA 2V55A 4YTCA 2CMWA 4M15A 2YCRA 2WQNA 4IC8A 4P5ZA 4BICA 4CV9A 1H1SA 3A4OX 3OWLA 3OCBA 2XBJA 3QKLA 3PXQA 3E87A 5IA2A 3ANQA 3FE3A 4UWCA 4GKIA 2VD5A 5KZ0A 3W0PA 3ENMA 3CBLA 3K5UA 3UO6A 3KXMA 4NTSA 3ZC5A 1G8JA 3G0EA 3MA3A 4RWJA 2BRHA 3ZZEA 5JK3A 2HXLA 3PJ2A 3QTUA 4O0VA 3BPRA 3D7TB 3RCJA 3ZCLA 4EH8A 4U7ZA 5AX9A 3TUBA 2OLCA 2UVZA 1J7LA 4OTGA 4AS0A 4APCA 5HVYA 2W9FB 3Q9YA 3MV5A 3Q4ZA 3VS3A 4QP7A 4ANMA 4OTRA 4D9TA 3TV6A 3LXNA 1SMHA 1GIHA 3LW0A 4O0YA 4JXFA 4RC2A 1KV1A 4RG0A 5E8TA 5IA3A 4JRNA 5L6OA 2X7GA 4XOZA 1T46A 1Q62A 4RIYB 3U51A 4JG8A 4M0YA 1R0EA 2GCDA 4GIHA 5HLWA 4FYNA 2XK3A 5IEVA 2XNBA 3DGKA 2WMWA 3LJ1A 2BKZA 2NNWB 1PXPA 4G6OA 4ZJIA 5EKNA 2XJ0A 2XNMA 4CG8A 1GIIA 3WIKA 2IF8A 3KXNA 3RMFA 4D5KA 1OUKA 4U97A 2X0PA 4XG4A 5EDRA 4M12A 2QI8A 3UJGA 4BCHA 4FKPA 2Q0BA 5BYYA 4KS8A 3UZTA 3ZDIA 3MFUA 1OKWA 1M2QA 4Z16A 3EIDA 1H1QA 3QA8A 4ZZMA 3WF6A 4DFUA 4TRLA 1GZKA 3W33A 4QMVA 5IA5A 2G2FA 1Q4LA 4IEBA 4CT1A 2ZV9A 3QHWA 4NSTA 2FYSA 4BZNA 4DFZE 4ALWA 3Q04A 4OAUC 3BLQA 3KMMA 3ENHA 3VVHA 3EJ1A 3F5UA 3FKNA 1OM1A 5BMMA 3ZBFA 4UYAA 1SM2A 4O7TA 3A7GA 5IMEA 1BI7A 5LMKA 4BVUA 1H24A 5B2KA 4L67A 3UDBA 4O6LA 4O4EA 5KMOA 4IB5A 4YJUA 4YPDA 3TDWA 2YM3A 4YLJA 4RWKA 2WNTA 4LOOA 3VS2A 4NW6A 5HNBA 2RKUA 2UW9A 4M69B 5IA0A 1CSNA 1ZY5A 2R3HA 4S2ZA 4CLJA 4X2GA 2QOLA 4AQKA 3KXZA 3PIZA 3W2OA 3BU6A 4WSYA 3WYYA 3FC2A 1W82A 2Y6MA 2I0EA 5M56A 2EU9A 4BDKA 4I92A 5CSPA 4LV7A 4I23A 3NIEA 1Q8TA 3L8SA 4FV8A 3CKXA 2CNQA 1H25A 4O22A 5E8UA 3DA6A 4ZSJA 2QD9A 1Q99A 4KSPA 3N51A 2JAMA 5ANDA 3W2QA 3G2FA 3ULZA 4FKVA 5TR6A 3NVMB 3AD5A 4JX3A 4PP7A 4YNEA 3LM5A 3T8OA 3UODA 3R1NA 2X2LA 3P86A 4AXAA 1M17A 3FLWA 4XG2A 3UOLA 3SXSA 4BYJA 4H3PA 4Y85A 4EJ7A 4Y8DA 3F3WA 2WTCA 4NK9A 4O27B 4PWNA 3HYHA 1AGWA 5HBHA 5CEOA 2YLEA 5D1JA 5HG7A 5BUIA 5IH5A 4ASXA 4O0SA 4AXEA 4MXAA 5CENA 1ZYCA 5LMAA 2OWBA 4JR7A 4DGGA 5HO7A 4I6LA 2V5QA 2W4OA 3II5A 4C02A 2RFNA 2VTJA 3KC3A 4LRKA 4PV0A 4EOLA 3HV3A 4GK4A 5DIAA 3CD3A 5AP1A 3HAMA 4DEEA 1ND4A 1HOWA 2UW7A 3CY2A 4RIXB 2OBJA 3PRIA 1JPAA 3FKLA 3H10A 1XH5A 3O7LD 4V0GB 4Z9LA 3LQ3A 3U4UA 3L8VA 5AUZA 3CQEA 3OMVA 4X7QA 4U40A 2XIZA 3IK3A 4K8AA 4ZS4A 1J91A 4EHZA 4I41A 1M14A 2YLFA 4TTHB 5EHYA 3TEIA 4U41A 2YIRA 3R21A 3R00A 1UKHA 3DQWA 4DHZA 2H6DA 4QTCA 3TZ9A 3A7JA 2ETKA 4EWQA 3RHKA 5L8JA 4AT3A 4ACHA 4PTCA 5GZ8A 2BRBA 3GEQA 3PY1A 5DYJA 2QKRA 4BDDA 4AQCA 4XS2A 5EG3A 4C59A 4DG3E 4OAVB 2O65A 2X81A 4MAOA 5H9BA 1BKXA 3TV7A 3PE2A 3UNJA 3W55A 3QUPA 2BIYA 2ITPA 5JZNA 5AUUA 4F78A 5DPVA 5HICA 3GU7A 4I5MA 2O8YA 3IS5A 4FV3A 4FTJA 4AAYA 3FY2A 1URWA 4I5CA 4USEA 4IWDA 2JFLA 4FTIA 4PPCA 4U9AA 5LCJA 4R7BA 1JQHA 5CU4A 1G3NA 2BZJA 4EBWA 4O1OA 1GZNA 1VJYA 2Z7LA 3QD3A 4F65A 4UEUA 4I6BA 5DGZA 2PZPA 4X3FA 1E1VA 3QX4A 4L68A 2R7BA 5AUWA 2ERZE 2VN9A 4G6NA 3VUMA 4O7YA 5IQEA 4JBVA 3DJ7A 1P5EA 4KIPA 2F2CB 3NAYA 4FTLA 4YJOA 5CXHA 3FPQA 4PMMA 3UQGA 3N4TA 1XBAA 3SLSA 2CNUA 3VS6A 4G2FA 3OROA 3PY3A 5KKRB 1W2CA 2AC5A 2R9SA 4AA4A 4A9SA 4JI9A 3PPKA 2Z2WA 4FEXA 4BRXA 5I0BA 5IDNA 4FGRA 5E8XA 2VU3A 3KRRA 4HVHA 4BJJA 3RWQA 3TM0A 3RZFA 5A14A 3U87A 4AW0A 3ZO4A 1P14A 4DHJA 5GIOE 4OBQA 3D5UA 3DLZA 4EORA 2WU7A 3AC1A 4EHGA 5CANA 3WF8A 2ZVAA 3EL8A 2QOKA 4F6WA 3NNVA 3W0RA 1ZZLA 2JFMA 5CQUA 5KBRA 2UVXA 5KMIA 4AXDA 4NL0A 5JEBA 1DAWA 4ITIA 1IAJA 4BBEA 4ZZOA 3ULIA 4XG3A 2BDWA 2C3IB 4FV5A 5BYZA 1R3CA 4FTUA 1GZ8A 4PUZA 4PPAA 1JBPE 3VW8A 3ELJA 4O2ZA 5GIPE 4MD7E 1S9IA 4YSMA 5HCXA 2GS7A 4FL3A 4QP8A 3GQLA 3VUDA 1SVGA 4HGSA 3Q32A 5JFSA 3OWJA 3ID6C 4FICA 4W8DA 5LMKC 5G1XA 5C4LA 3DKCA 3QLFA 3I6WA 3V04A 2Y8OA 5ANIA 3HMOA 5K4JA 4FA2A 4QYYA 3UZRA 3ZBXA 1OIQA 3MH1A 2DWBA 1BLXA 3G15A 5M51A 3E63A 3MBLA 3UOKA 4CZYB 3R7GA 4TYGA 4HNIA 3UPZA 3GBZA 5E92A 3R8LA 1UU8A 2ITTA 5D41A 2QC6A 5BMSA 3KEXA 5HIBA 2ZV7A 3TNPC 2J50A 4G6LA 4FZFB 5IQBA 1XJDA 4CQGA 4C37A 4CFFA 5AR7A 4EQMA 1W84A 3LXLA 5TKDA 2GNHA 4KAOA 3MJ1A 3D5XA 3FSFA 3V6SA 1IRKA 5LVNA 2RFDA 2UZVA 3OS3A 5LARA 2UVYA 2VTNA 3RP9A 1WZYA 2GPHA 4K2RA 4ZJVA 4FTKA 2F4JA 3CY3A 2QOHA 4WT6A 2GNGA 5HBJA 4FTNA 3P08A 3ORLA 4MHAA 4IACA 1B38A 2WXVA 5M4UA 4EONA 4FJVA 2QO7A 3UPXA 5KBQA 4ZMFA 3WI6A 3DK3A 3DBDA 2R3IA 3FMHA 2XRUA 4B7TA 1FMOE 1W0XC 2JKOA 4BDHA 4R77A 1XH7A 4DEIA 5E90A 2I7QA 4FSUA 4IZYA 3NNXA 2W1IA 1JKTA 2VAGA 2OZOA 2XEZA 5L8LA 3PWDA 2Y0AA 4BKJA 2OXDA 5F95A 4YU2A 5FWKK 2C3JA 3LFQA 3G9LX 5BV3A 4EK4A 1QPJA 3AMAA 5LXMA 2GTNA 3O8TA 4ANOA 3QALE 4AXFA 2O0UA 3O17A 3ORIA 3FLNC 2Q0NA 3Q2MA 3RNYA 5EI8A 1U54B 2YDKA 4GEOA 1NT2A 4GVJA 1ZLTA 2UZBA 3QXOA 4MF0A 3TNWA 3LJ0A 5IISA 4M97A 2ERKA 2R5TA 4LGDA 4BIDA 3F9NA 4AFJA 5CNNA 1FMKA 2J9MA 3VIDA 1DAYA 1M2RA 1WBNA 4DEGA 4ALUA 3ITZA 4NT4A 4TKSA 5J7HA 4RVMA 2VTHA 1OUYA 2XNNA 5J95A 4FTRA 4X21A 4H1JA 2B9JA 5AM7A 5GHVA 3VNTA 3ZS5A 5IDPA 2WHBA 3NDMA 1VYZA 4KD1A 1JKKA 2PHKA 3MGYA 5EW3A 5B7VA 5IG1A 4C4FA 5JRQA 3QRJA 1G8AA 3PFYA 4O7SA 4EZ5A 4RX5A 1HCKA 3JUHA 2V62A 3MY5A 4BDAA 1YWVA 3A7FA 4AACA 4V04A 5LVOA 3PA5A 4PX6A 5CS6A 2XEYA 5FP5A 2QONA 2R0IA 4XJ0A 4LM5A 3MVLA 4AZTA 4LYNA 1P4OA 3LLTA 5IQFA 5HGIA 5HIDA 2QCSA 1W2FA 4E4LA 4I0TA 3VJNA 4EOQA 4X3FC 3EQDA 3T3UA 3HV7A 2Z02A 4FVRA 3GQIA 5JMSA 3EZVA 2WMBA 4TYJA 2UW6A 4WG5A 3RGFA 5AP7A 4D58A 3ZH8A 5HX6A 3NUXA 5EW9A 2E9NA 2XALA 1GY3A 3GC9A 2VTTA 3DY7A 3LFNA 1H1WA 2C0TA 1VLRA 3TCPA 3ZHPC 3BLRA 2X1NA 3IPHA 2IW6A 4MNEB 4PDOA 4R1YA 5D7AA 3FMKA 4O7RA 3TUDA 3KULB 2CKQA 4BKZA 2JKQA 4JIKA 4YJVA 4RZVA 4HZRA 1CDKA 1OPLA 3SDJA 3WIGA 4D4RA 2DYLA 4HVIA 3ERKA 4BCGA 4C4IA 4FX3A 2OU7A 2ZB1A 3NYNA 4IVAA 3S00A 2R3KA 4MX9A 4AE6A 4I3ZA 3CQUA 2PMIA 1I09A 2C0IA 2E9VA 3VBQA 3P1AA 2F9GA 3C0IA 3HECA 3VULA 3HDNA 3BHHA 4EOIA 2QOIA 2W1DA 2XKDA 3GNIB 4LI5A 4TYHA 4CVAA 3QRTA 2WZJA 1Z5MA 4APPA 4QYGA 3KF4A 4I94A 3BYUA 4JS8A 4CFNA 5HG9A 1FOTA 2UZEA 4RJ7A 1VEBA 3Q4CA 1VZOA 4NTTA 1YVJA 3TACA 3UDTA 3BX5A 4OW8A 4EH9A 3D7TA 1CM8A 3OP5A 4IAZA 3AC8A 4GFGA 3AT2A 3OTVA 4HVDA 2XK9A 4AWIA 2XVDA 4W4WA 2CJMA 5BUJA 5L2QA 2UZUE 3FZSA 3ZRLA 4E4MA 4IZ5A 2VRXA 1RE8A 2OFVA 4WRGA 3RK7A 3R71A 4C58A 5HLPA 3QXPA 1MQBA 1SNUA 3FZTA 2R2PA 5FP6A 5J79A 4NYEA 5EQPA 2HYYA 2ITQA 5F1ZA 4QMSA 3VWAA 2YM4A 3POZA 5TF9A 2OJIA 4NFMA 3MIYA 4RIYA 3REPA 3V51A 2IPXA 4UXQA 1PW2A 4UXLA 3ZM4A 3UTOA 3ORMA 4FEVA 5EM8A 3TJDA 3HGKA 4U44A 5EHLA 3E7OA 3ORKA 4DFNA 4F7LA 3UYSA 1YW2A 2UW0A 4HYUA 3ZLYA 3FI4A 4Y72A 2B9FA 4ZP5A 2A4LA 2Z7SA 4WNMA 4PRJA 5J5SA 3U6HA 4C7TA 5HZNA 3R2BA 2IO6A 4LRMA 4AAAA 3B2WA 3FQEA 3DOGA 4EYJA 2HW7A 3V5QA 2IW9A 4MTAA 3MH0A 4DLJA 5M4CA 4I4EA 2GDOA 4UMTA 5CI7A 4FIHA 4M7IA 2WMSA 5EM7A 5CEPA 1QPEA 4OBPA 4D28A 4UZDA 5JQ8A 3DPKA 2CGVA 4BCIA 3KU2A 5EDPA 2UZTA 5I9XA 4RC3A 2Y9QA 4O21A 1KOAA 4DH7A 2IW8A 3FY0A 3FI3A 2WIPA 4LUEA 3O7LB 5J8IA 2JBPA 2O64A 2VWYA 4MYGA 3U9CA 5HD4A 3GCUA 3UDZA 2C1BA 3QZHA 3Q5IA 4QMYA 3C51A 2WIHA 3C5UA 3A8WA 4EH5A 2XIXA 3Q5ZA 2YM5A 1F3MC 4FBXA 4P7EA 2OIQA 4WNKA 4YJSA 3QD4A 4BI2A 4O86A 4NEUA 1LPUA 3N9XA 4RJ6A 3OVVA 3RHXA 1PF8A 3V5JA 4NKSA 4P5QA 3KRLA 3HA6A 4F64A 4IIRA 3A61A 3O50A 4IX3A 4F1OA 5HE1A 5DI1A 3LCKA 3WE8A 2RF9A 3LJ2A 3ZUTA 3ZDUA 3DBQA 4OTQA 5DWRA 4L3PA 4MBIA 4FUXA 4D5HA 4R3CA 4ZZNA 2Q83A 5E8SA 4FEWA 3FBVA 4O7LA 1PMUA 2DS1A 4TW9A 3MFSA 3ZSIA 3R7YA 1ZOEA 1XO2B 2QG5A 5K0KA 3NUYA 1FPUA 3IW7A 1B6CB 1OVEA 5EDQA 5K9IA 3WZJA 2WEIA 4CYIA 5A4TA 3BLAA 5L2WA 2XJ2A 4YLLA 3K3IA 2JIUA 5KMMA 4BDCA 2WMAA 4BCNA 4EH2A 4BL1A 2WMXA 4ACGA 4NIFB 4PQNA 4LL5A 3EFJA 1I44A 3VHKA 2JBOA 2P55A 3LE6A 4MUQA 2YABA 3HLLA 3OBJA 5CVGA 3R73A 2XF0A 3QC9A 1CKIA 3R7OA 2ZV2A 3UOJA 4NJ3A 4QMZA 2W9ZB 3QGWA 5HG8A 4C4JA 3W0QA 1WBVA 4DGOA 2FB8A 4JOAA 2J6MA 4M8TA 4TT7A 4ENYA 3ET7A 3SXRA 1L8TA 3HMNA 5DVRA 5DRBA 4I21A 5ETFA 4YJRA 3SQQA 3WF9A 1CKPA 3G9NA 5HX8A 2CNVA 3JS2A 3MYGA 4UMRA 2R3NA 4IXPA 5HE2A 4FTCA 3UIMA 1FINA 1AD5A 2YIQA 5D11A 5IH6A 4XBUA 3LMGA 2PVRA 4XCUA 3W10A