4DH5A

Room temperature x-ray structure of camp dependent protein kinase a catalytic subunit with high mg2+, adp, phosphate, and ip20
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Low- and room-temperature X-ray structures of protein kinase A ternary complexes shed new light on its activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dh5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dh5A02
2J7TA 3Q5ZA 2IW8A 3MTLA 3TT0A 1ZRZA 2YDKA 1GZ8A 1U46A 4ZTNA 5AADA 2QKRA 4BKYA 5H2UA 3DJ7A 3LFSA 2XNBA 4FT7A 5M51A 4FV2A 5GNKA 4AXAA 3MIYA 2YM6A 2OXXA 4D58A 4C4IA 3IW5A 1YI3A 1O6LA 2C6TA 2JEDA 3C7QA 3E62A 3OOGA 4X7QA 2VTJA 5EW3A 4C0TA 3V8SA 5CEMA 5JKGA 2PVYA 3BKBA 3MH1A 1Y6AA 4NM3A 5I9UA 5HTBA 4ZY6A 1WFCA 1ZARA 2WTJA 2HWPA 3MDYA 5CT7A 1Y91A 4BWKA 2EWAA 4FZ7A 4NUSA 3GB2A 2WQMA 4MF1A 4W4WA 4EJ7A 1XH5A 4WBBB 5HCYA 3PA3A 4IX5A 4RQVA 5ANJA 3DV3A 4JDKA 5EM8A 5HVYA 5JFWA 3KB7A 1ZYCA 3IG7A 5EKNA 3BHTA 2QHNA 2W05A 4EH2A 4IXPA 1QCFA 2PVHA 5IA1A 4FMQA 4DGGA 5IMXA 3EJ1A 5LMAA 4S32A 3VUTA 4O0YA 4BCIA 3D5XA 4CQEA 3ORMA 3MFSA 2I6LA 2ZDTA 5CSHA 4LGGA 3EHAA 2R4BA 4R6VA 2GQSA 2IJMA 3GFWA 5BYLA 3V5JA 2EVAA 2HYYA 4MXAA 3TCPA 1ZOHA 4BYJA 2PUNA 5CU4A 5E90A 4FYOA 4GT3A 5CEIA 3P9JA 2HY81 2XIRA 3PVBA 4X2GA 4UN0C 3UNKA 3DCVA 5H9BA 3HX4A 1JKTA 3K2LA 4QMVA 4R3RA 3VBQA 3O51A 1NA7A 4IAZA 4Z9LA 3W8LA 4QP9A 3QWJA 3WF5A 3DK7A 4E93A 5HU3A 3BLRA 4ZS4A 1UU7A 2W4KA 5IU2A 2FB8A 3PJ2A 4HGLA 3UIXA 2GS6A 4LRKA 4BDJA 5DGZA 1PY5A 3DAEA 3BBWA 3EYGA 4LMNA 2PK9A 5BVEA 3AC5A 4LOQA 3TV6A 3G9LX 3IKAA 4BIEA 4DTKA 2NPQA 4AAAA 1M14A 2F57A 1CMKE 5TF9A 1YI4A 4ERWA 3I81A 1YW2A 3KRJA 4O7VA 4P2KA 5IEYA 2VTRA 2X0GA 3IS5A 4RVMA 4YLJA 5CASA 4F9YA 1PXKA 4FKLA 4NJDA 1QL6A 2QURA 3W2QA 4AE6A 1H1QA 3QD4A 2VO3A 4MKCA 3WIKA 1V1KA 2BR1A 2PMLX 4RFYA 4FTQA 3OTUA 5L6OA 3GC7A 3FEGA 4BI0A 1BYGA 2GCDA 4OLIA 3VULA 1F3MC 4BKZA 2UW4A 3DAKA 4F1MA 4FZFB 4FKQA 4FSRA 2GPHA 3TKUA 1ZYLA 2P55A 3U9CA 5CNNA 5CWZA 5HX8A 5AP6A 4V05A 3H9FA 4CD0A 3OS3A 4FODA 3VVHA 3UQGA 4NL0A 5AP4A 2ITUA 3AXWA 4NM5A 1E1VA 4OTWA 3RBWA 2J4ZA 3D2IA 3LFEA 2VTLA 1Y57A 4FKIA 1PXJA 4RX9A 3D94A 4ANBA 5IG1A 4HYSA 5DE2A 4GMYA 3RINA 2JFLA 4FV7A 4BKJA 4EH6A 2EU9A 4EOSA 4QTDA 4BFMA 4PDOA 5JFSA 3JXWA 4W9WA 1JLUE 1IEPA 1XHAA 4IM2A 3HZTA 1GAGA 4DEIA 2RFDA 4WG4A 4G3FA 2XIZA 2OO8X 2JIUA 2JDOA 2PVNA 4XYFA 4GV1A 5I9ZA 4YHFA 4UWYA 5JFXA 1WVXA 4A9UA 4G5PA 2GNHA 4FL3A 4LGDA 5F1ZA 2R7IA 4HCVA 5C8NA 4BCNA 4O7WA 2Z2WA 3C4FA 4TYHB 3THBA 3UP7A 2ZAZA 3QFVA 3MJ2A 2QOBA 2W1FA 1WBNA 2XKEA 3QA8A 4TYEA 3G6HA 2ETMA 3ALNA 2ERZE 3QQJA 3Q04A 4FYNA 5JRSA 3F61A 3UODA 2ETRA 4F99A 2YZAA 4ZJIA 5EQEA 2OLCA 5ETFA 2P4IA 3AC8A 4IB3A 4EH7A 3LCTA 3F2RA 3O2MA 4FSTA 4UV0A 3C4WA 4J99A 4Z55A 5BUJA 2E2BA 3FLSA 3FYJX 3COMA 4FGBA 5DH3A 4GCJA 3CTHA 3T9TA 2NRUA 3BYOA 2WEVA 2YDIA 3Q53A 2E9NA 3FPQA 2IZTA 1FVVA 1WZYA 2OK1A 2WMUA 3WILA 1FPUA 1PXLA 2UZUE 4R7BA 3DXNA 4IVBA 2QNJA 4OTIA 1VYZA 3HVCA 3CBLA 4M0ZA 3VW8A 1XWSA 2EUFB 2GQGA 4Q9ZA 4O0RA 1G5SA 2GHLA 5CX9A 3U87A 4F6SA 2OW3A 2VWVA 3PY1A 4O0SA 2BROA 3BWJA 3ATTA 3F2AA 3OCTA 4BCQA 1B6CB 2QLQA 2YIQA 3QQLA 4RT7A 4U0IA 4HVSA 3LFBA 4TYHA 3GFEA 2O2UA 3QCQA 2FUMA 1S9JA 4C3FA 4BCOA 4UWBA 1UU8A 2XNEA 3UVQA 3LFNA 3D2KA 3GU5A 3RTPA 3RWQA 4C8BA 3A7HA 1YOJA 4X6QC 3LVPA 3TNIA 3R9HA 5HTCA 4NH1A 3Q52A 4KWPA 4MD9E 4O0UA 4FVQA 4F6UA 3W8QA 4K0YA 5C1QB 4X2FA 5DWRA 3H3CA 2Q0NA 3WZUA 4IZYA 1P14A 2QONA 3P0MA 3TZ9A 3VRZA 3V5PA 1R78A 4JG6A 3LFDA 3IO7A 3HUBA 4HJOA 3QC9A 5HU9A 3FL4A 3TTJA 3UPZA 4O7NA 4EEVA 1JNKA 2W0JA 4DLIA 5E4HA 2O64A 3PJ3A 1XKKA 2XYNA 5HD4A 5HE2A 4MQ1A 2QOHA 3H4JA 3KC3A 2P33A 1PXPA 3E7VA 4X2NA 3E3PA 3OWJA 4XV2A 1Q5KA 3A60A 3UZTA 4ACMA 4CMOA 1DM2A 2WQNA 3LOKA 4LL0A 3PLSA 5AIKA 5K5NA 4WUAA 5EYKA 4PNKA 2UVXA 2WELA 4FG9A 4N6YA 5FQDC 4I6HA 4RBLA 4TKSA 3CQEA 3LCOA 3OUNB 2I0EA 3PXFA 3ET7A 3DZQA 4YTIA 4FICA 5B2KA 3VRYA 3UZRA 3AT4A 3BEAA 4L00A 4FA2A 1JKSA 5J9ZA 3DBCA 4MEDA 5CEPA 3OWPA 5JH6A 4DEEA 1HCLA 2JIVA 4W8EA 2X7FA 3VUMA 3C9WA 3VQHA 3QBNA 4O7SA 3SLSA 2UW9A 2VNYA 3SG9A 4DHFA 3T3VA 4DFBA 3FDNA 3DLSA 4EC8A 3A7JA 4RX8A 4B9DA 3CPCA 5FXSA 5I3RA 1TKIA 5CSWA 5M55A 4WG3A 5DYJA 2XK7A 5HG9A 1FMKA 1BL6A 4HOKA 5TR6A 2VX0A 3DKCA 3FHRA 2UZOA 2VTMA 3FV8A 5I4NA 4OUCA 5DIAA 4KUJA 3C0IA 2CKOA 4QYFA 4LOPA 3PG1A 4ZIMA 5TE0A 3C1XA 1I44A 5TOZA 2V22A 5CXHA 2X8EA 4GG5A 4QP2A 4KAOA 4QP1A 5M09A 3MTFA 1URCA 2QD9A 4M7IA 3VS0A 3AC2A 2YLEA 4BDHA 5IQEA 4DTBA 2WTCA 3MPMA 4YJUA 4I5MA 4J7BA 5HKMA 3BQCA 4BGHA 5HBEA 3UMXA 2I0HA 4F9AA 4FVPA 5BX0A 4LM5A 3LFCA 4FEQA 4DH3A 4ASEA 2WU6A 4IIRA 5HIDA 3EWHA 3HDNA 5HG8A 3PRIA 4YURA 2BFXA 4O6EA 2CGWA 2X4ZA 3GT8A 2QOLA 2BZKB 2CGXA 4U79A 3OW3A 2J5FA 1H1WA 4FT3A 2P0CA 4QPSA 4EK4A 3PP1A 3FUPA 4RPVA 2VTOA 4FTOA 5DT0A 3L9PA 4J98A 4GJ2A 2XP2A 5A4CA 3ZEPA 4O21A 4MNEB 4S34A 5IA2A 5FG8A 4D4SA 2HZIA 2C3JA 4F64A 4K11A 4C4EA 2PVFA 1Q8UA 3AOXA 3IOKA 2A1AB 4QMPA 4RIWB 5AUTA 1MUOA 5HE3A 2VX1A 2HAKA 3K54A 4X0MA 3QX4A 2YIRA 5HIEA 4JBPA 3TUDA 2IN6A 5T3QA 1JBPE 3RMFA 2IPXA 2CN5A 4GFOA 4O91A 4XP2A 3FY0A 5J87A 5LMKA 4DG0E 3DU8A 3EQFA 2V7AA 1IAHA 4JDHA 4O7TA 3L1SA 2HZ0A 2UZBA 5ANEA 2BTSA 3ZUUA 1URWA 4I6FA 3EL8A 4P4CA 5FEQA 3QAME 2OXYA 2R64A 5L2TA 3WE4A 4BTFA 3BBTB 1ND4A 3NVMB 4U7ZA 4DITA 3N4UA 3QZHA 3WF8A 1VR2A 3QQGA 4JQ8A 4KRCA 2YZLA 3Q4TA 1WAKA 2WMWA 2JGZA 1JAMA 5K5XA 4I4EA 5LXMA 1XJDA 3FLWA 3OTVA 4BI2A 3KU2A 2P2IA 2IO6A 4L67A 4DEGA 1YI6A 2H8HA 3MSSA 1Q3WA 4M84A 1PJKA 5AR4A 1OIRA 1OPKA 1Q8WA 2ZV7A 1RDQE 5J7HA 2GNIA 3ZZWA 2W1CA 1KV2A 1PYEA 1L3RE 2XNNA 4O22A 3R7EA 1J7IA 3KKVA 1S9IA 3FJQE 4FTLA 4DTAA 1XBBA 4FX3A 4L68A 3BYUA 2W1DA 3F3UA 1YHSA 5HNGA 3DB8A 3WARA 3UO4A 4IE9A 4K77A 3SX9A 4F6WA 2WGJA 5C8MA 3CGOA 4S2ZA 2CGVA 3DBDA 4CMTA 2HIWA 4M67A 4DFLA 3JVSA 4BHNA 5JN2A 5BUIA 2IZRA 5KHXA 3HV6A 4H3PA 5CVFA 2VTPA 5LMKC 2WTIA 3NX8A 2WKMA 2IVSA 2ZB0A 2R3IA 4EOLA 5LWMA 5BMMA 3W10A 1FGIA 4FTAA 2C68A 5L2IA 3E7OA 2ITPA 5JGBA 5KO1A 3M11A 4ANNA 3LW0A 2QOKA 4W8DA 4F9WA 5K4IA 3HGKA 3AT3A 3ZUTA 2C30A 1JKKA 4AW5A 2WMBA 2PE0A 4O2ZA 1F0QA 3ZO3A 5HGIA 4AT3A 4E26A 2UZTA 4UMPA 3MIAA 1BI7A 3P86A 5ANGA 2QO9A 2IW6A 3G0EA 1YWVA 1APME 1JVPP 3I6WA 5EI6A 2GU8A 3ANQA 2XM9A 4MH7A 3RP9A 4IANA 5DEYA 3PRFA 3GP0A 4II5A 4PPAA 4G3GA 4Y46A 5EH0A 4FT9A 3IGGA 4PL3A 1H4LA 3R8VA 4CZUA 3AQVA 3Q6WA 5AP5A 4UMUA 2WMVA 2PZIA 3FAAA 5JSMA 1A48A 2W4JA 2Y7JA 3BLQA 4Q5HA 4XOYA 4EK6A 4FE2A 3GU6A 3MWUA 4RSSA 4YSJA 5AV3A 3PSDA 2XK4A 1M17A 2DWBA 4RIYB 2RF9A 4NFMA 3RPSA 5DT3A 2RG5A 3PIZA 3P78A 4DN5A 4ENYA 3LXLA 4F7SA 3U6HA 4RLLA 4MXYA 3R9NA 1UNHA 3FZPA 3V5TA 3DT1A 3LFAA 4QNYA 4WNKA 4IM3A 3MVLA 3NUPA 4HCTA 3C4XA 1FGKA 3QUPA 5FBNC 4ZZNA 4IB5A 4NTTA 1MQ4A 3DGKA 4FL1A 3TXOA 4AFJA 3QTXA 1IRKA 2X4FA 4A9YA 3U55A 4TYGA 3DK3A 4RRVA 3SXSA 4FV6A 1Z9XA 3QKLA 4LFIA 5E9EA 5KMLA 3SG8A 1WBPA 3ZFYA 3S3IA 4DT9A 3QRUA 3AD4A 3FQSA 3QQKA 4TWNA 5CNOA 5CXZA 4MX9A 3FMEA 4TWOA 4WBOA 1GOLA 5HCZA 3HA8A 5CEKA 1QPEA 4I93A 2GQRA 1H07A 4RGJA 4CVAA 2W1IA 2FGIA 3ZONA 5I0BA 2C0IA 1UWJA 3VS3A 2YM5A 3GCVA 2C5NA 5HD7A 4B7TA 2X7GA 5D11A 3C4ZA 2CKPA 2WXVA 2RFSA 1H28A 3MFUA 4MYGA 5LVOA 3R7OA 2X6DA 4FNWA 3PXZA 3DXQA 2B4SB 4RMZA 3W16A 5J1WA 4HGEA 2BUJA 5BNJA 2QC6A 2W1EA 5AIRA 4ACGA 3TNWA 2O8YA 4B0GA 5CSVA 1PKDA 3O7LD 5E8ZA 3AT2A 1NVSA 1YXTA 2UZLA 2XRWA 3N4VA 4L01A 3UIUA 4A9SA 5T68A 5LVMA 1OKVA 3CTQA 4V04A 4NW6A 2O3PA 2VWIA 3LZBA 4L44A 3ZHPC 4MWIA 4BCMA 4FV1A 3MI9A 3QD3A 1R39A 2WTKB 4EQCA 4U3YA 5FLFA 5KHWA 3HMMA 2VNWA 3QALE 2Z60A 3MB6A 3V04A 4PDYA 2BHEA 2PHKA 3AD5A 4L43A 5L8JA 3A8WA 3PDTA 1BX6A 5FM3A 3R8UA 3M1SA 3P08A 4L52A 5HVKA 2HELA 3EN4A 1AD5A 4PDPA 4D1ZA 4R7HA 4JQEA 3PSBA 2BFYA 4FKWA 5L2QA 2OXDA 4L8MA 4JVGA 4EK3A 3UOHA 3VNTA 3U8WA 4CRLA 2XH5A 2EB3A 4PV0A 5E7RA 1KE8A 2P2HA 2QU6A 3T8OA 3ZO1A 4CCUA 4N57A 1E9HA 5AV4A 5CVHA 1DS5A 1TVOA 4XRLA 4YJTA 5DPVA 5FP6A 3TJCA 2PULA 3E64A 3ORXA 4I94A 3RM7A 2Y0AA 5I5ZA 3QA0A 3FMNA 4G3CA 3W18A 4D2WA 5KCVA 4L3PA 3U54A 2ZM1A 4ANMA 3QUDA 3GOPA 3VS7A 3FI4A 3ZC5A 2CPKE 2NRYA 3UPXA 4GVJA 2DUVA 4FV4A 2C6OA 3EQIA 4B4LA 1UVRA 2SRCA 4U6RA 3NVKI 4D28A 2OGVA 4FZAB 4UWCA 5EG3A 3DKGA 2VV9A 5ACBC 3ZM4A 4EHZA 4MXOA 4PMSA 3R00A 3PPKA 5DR6A 5HG5A 3KRWA 5L8LA 5LVNA 1GIHA 2R2PA 5LMBA 3KY2A 4JRNA 3IK3A 3D7TB 2JKQA 1NT2A 4AQCA 4F7JA 2WNTA 3R7GA 4J1RA 4KIKB 3ZDIA 1GJOA 2BIKB 3QX2A 4ID7A 4GT5A 4YJPA 5AR7A 4AW2A 3BCEA 3B8QA 2HWOA 3LJ1A 3VUHA 4BCPA 4ZMFA 4Y8DA 5CSPA 3TDWA 4D5KA 2HOGA 2CMWA 2VTIA 5M53A 2YLFA 2UZVA 2NP8A 4IC7A 4ITHA 4JI9A 4AT5A 4BVUA 5TKDA 3UVPA 1YDSE 2GS2A 2R3FA 4U41A 2CCIA 4YZMA 2RG6A 3VF8A 5CALA 4W4XA 4R3PA 4WO5A 4UBAA 1XH7A 2C47A 3D9VA 1FVRA 3R0TA 3TIZA 5AP3A 4BCGA 3LQ5A 2YWPA 4FKUA 2WTWA 3BWFA 3R8PA 3T9IA 2WMSA 5BVOA 5JZJA 3EYHA 5A6OA 3F5UA 4MXCA 4NK9A 2V5QA 4BTMA 1RJBA 4AGWA 5H8EA 2V55A 2CLXA 2FVDA 1CM8A 3HV7A 4HYUA 4E6DA 5K9IA 3GQLA 4YHTA 4FKGA 5AX9A 5LOHA 2B7AA 3BHVA 4CYJA 5FBOA 1WCCA 3D7TA 3S2PA 4CLJA 5FTOA 2QR7A 4TWPA 4DFXE 1H0VA 3LQ8A 3FZOA 5DEWA 5CANA 4O1OA 3LXKA 4KIKA 2KTYA 3KVXA 5HE1A 3SKCA 3UVRA 4D0XA 2C3LA 4QMXA 3SC1A 1LEZA 4DC2A 3VJOA 2X81A 4K18A 3SV0A 4YSMA 3OFMA 3BV2A 3F3ZA 1WVWA 3KXMA 4K9YA 2A0CX 4LOOA 5CU2A 2WO6A 2RSVA 4FIHA 4RJ3A 4USDA 2OJ9A 4JX3A 4YJRA 3R8MA 3RAKA 3U51A 1OM1A 2WPAA 3A2CA 3PG3A 4I1ZA 5I9YA 4WRGA 4EHEA 3BELA 3Q4CA 5AX3A 4E73A 1W0XC 1WBSA 2PMOX 4HPUE 4EQMA 2YJRA 5D1JA 3DA6A 5K4JA 5EHOA 3VBVA 2BKKA 2XK6A 4OT5A 2WB8A 5DI1A 5KE0A 2G2FA 4FIJA 3C0GA 4C58A 4F1OA 4ZSJA 3OEFX 3VS2A 5CF6A 1G8SA 4XX9A 4AOTA 4PY1A 5KNJA 3OCGA 2VWUA 3HA6A 2W9FB 3AMAA 1H0WA 2CNUA 4M12A 1HCKA 4CKRA 3CTJA 4XV1A 2HCKA 1YRPA 3F7ZA 1V0BA 3PE1A 2R0UA 3R73A 3WOWA 4EH4A 4L7FA 5J8IA 3II5A 4UALA 4Y5HA 5IA4A 3MPTA 3B2TA 5KKRC 3LLAA 4WNPA 3VJNA 4EJNA 3R1QA 4RJ4A 4MVFA 2W4OA 1Y6BA 3W2CA 5HORA 3C4EA 5K0KA 3PVUA 2QOOA 1PYXA 3QRJA 5DFPA 5LARA 3COHA 5JZNA 4F4PA 3MY5A 3W2RA 2BHHA 3AC1A 3F6XA 3FZSA 3KULA 4E8AA 4FSYA 4GIIA 3RHKA 4M8TA 4YMJA 4IVDA 4ZTHA 4YR8A 2JAVA 2ZV8A 4FKRA 4U81A 2PVJA 1OKYA 4J53A 3VC4A 3MGYA 4HPTE 1BI8A 4HGSA 5A46A 4C4JA 5FUTA 1SYKA 4ZY4A 4J96A 4XV3A 4E1ZA 5EQPA 4FF8A 5J9YA 2WMRA 3PXKA 3A7GA 3NNXA 4JNWA 3ODZX 3VO3A 2UZEA 4V0GA 3PXQA 3BX5A 2JBPA 2BPMA 2UZNA 3OCBA 4YNEA 4JIKA 3L8PA 4R5SA 3PZHA 2PL0A 3NIZA 5EOBA 4ZTLA 1OL7A 2OICA 4QMMA 2YA9A 3E8NA 5E8SA 3ZM9A 5GHVA 5HLNA 4IJ9A 4DEBA 4FSWA 5KUPA 2PZPA 2PVKA 3HEGA 1YHWA 4JR3A 2GFSA 1OL1A 4ZJJA 3F9NA 3WZEA 4DLJA 3TKIA 4XUFA 1WBWA 3R71A 2C6LA 3P4KA 3Q32A 5CI7A 5AV2A 3HL7A 3UIMA 1ZMVA 3SGCA 3CPBA 3QHRA 5IUGA 2Y6MA 3FBVA 3GGFA 3KRLA 3PZEA 5DVRA 2J0KA 1R0PA 2O65A 4PNIA 2WQOA 5KMJA 4BGGA 3PVGA 5BVWA 2HZ4A 3FC1X 1OL6A 4GIHA 4IZ5A 5FGKA 5L3AA 3RNIA 1LUFA 4FV3A 4E4XA 5E8YA 4PUZA 2PVLA 2Y8OA 1OIUA 3NDMA 1Q97A 3TNPC 2YITA 2ONLA 3QQUA 2ZOQA 4EUTA 4DE4A 3FSKA 4YJVA 3Q96A 4BBEA 4BZDA 4F08A 5IDNA 5IDPA 2BALA 2C3IB 4JDJA 1DI9A 4E6QA 4F70A 1SVEA 3E8EA 3FC2A 4UEUA 5JRQA 4GU6A 2E9UA 2A2AA 1CKPA 2VTNA 3I7CA 5AM6A 3L9LA 4RWLA 4C4GA 4BTKA 1OVEA 2VD5A 2QQ7A 4Q2AA 4QPMA 1JQHA 4IZAA 4H36A 4NKAA 5AUUA 4FTMA 2IVVA 4CFWA 5CZIA 2PPQA 4O27B 3E5AA 4X2JA 3UC3A 4HNIA 4MXXA 2G2HA 1OPJA 5EFQA 1K3AA 3QHWA 3FMMA 4XRJA 5CF8A 1P4FA 5EM7A 4HVIA 2OZOA 3I5ZA 3Q6UA 4D2PA 5CU0A 4D9TA 4R7IA 5E8UA 4ZLOA 2C69A 4DINA 2BCJA 3DFAA 2WTVA 2X2MA 4LG4A 5CQUA 1UU3A 2XK3A 4O0XA 4H58A 4AT4A 5CAVA 3F7WA 5E8WA 5IA3A 3HUCA 3RAHA 3QRIA 2B0QA 1QMZA 1W84A 1ZOGA 4H39A 2XK9A 4QYGA 3AC3A 2R3OA 5M08A 1E1XA 4M14A 5AUZA 5DHJA 4XMOA 5EW8A 3V01A 3V8TA 1W98A 4LUEA 1O6YA 4U43A 5GJDA 2ONLC 4G3EA 4A7CA 4BBMA 3G33A 4F0FA 1BL7A 3COKA 3FI3A 2WOTA 3F3TA 3QTWA 4CFUA 5AP2A 5DBXA 3QCYA 3QUEA 3IONA 4P5QA 3EN6A 3QRKA 3LXPA 2C6MA 2GMXA 2JKOA 4LMUA 4RJ5A 1U5RA 3I79A 2VU3A 4U97A 5LVLA 4C33A 1PRYA 2UW5A 4EOOA 3POZA 3VUDA 2CHLA 5KMKA 4JRVA 5L2WA 3FMKA 4PL5A 3HECA 3PA4A 4RIXA 2V62A 1PMNA 3FMJA 4RZWA 2UW3A 3V5LA 3BHUA 2Z7RA 4WOVA 4FEWA 2ESMA 3RHXA 4DEDA 4UYNA 1YKRA 4APPA 4E4NA 4IX3A 5HIBA 4FIGA 4XH6A 3R7UA 4YJOA 4RZVA 3IDBA 3U6IA 3Q9YA 3O7LB 1CKIA 4BICA 1NVRA 2QOQA 4IBMA 5CAPA 3KXXA 5L2SA 1RE8A 4FZDB 3UIBA 4FV5A 1H08A 3E3BX 4OBPA 3B8RA 5IQFA 2C6KA 3HMOA 2H6DA 2CSNA 2VWWA 3IW6A 3R02A 4PL4A 4QP7A 3TWJA 4QP6A 4A06A 4XLVA 4OTHA 4UMTA 2G1TA 1YXXA 3OXZA 4I41A 3RPOA 3TV7A 4FT5A 4H3QA 2PUUA 5IH4A 2REIA 3SQQA 5FWKK 2ITWA 1KUTA 2X8IA 1Q99A 4L46A 3ZSIA 4Z7GA 1OIYA 1T46A 4GS6A 4I23A 2FSLX 5DOSA 2QHMA 3D5WA 3OXTA 1REKA 2G01A 3VUIA 4B8LA 2YCRA 3IDCA 4GG7A 3RPRA 3TZ8A 4E6CA 3TDVA 2B52A 5E92A 5CEQA 4PRJA 4ACHA 4IQ6A 4GEOA 3POOA 4B8MA 2XKDA 3R7VA 3U9NA 3BHYA 3ACKA 3ROCA 3CKXA 3NUUA 1OKZA 4B99A 4D2RA 3BGZA 2F4JA 3OP5A 3DBQA 4G9RA 3BGPA 4XG2A 5FP5A 2OJJA 4JR7A 2QODA 5EHYA 4YHJA 5J95A 3BQRA 3MFTA 5ANKA 2B9FA 1H24A 2C3KA 4BN1A 5EDQA 2RFNA 5GINE 5F4NA 5KZ0A 2JDRA 3ZCLA 5AR5A 2IVTA 1OECA 2PZRA 4EOPA 4EK8A 3LAUA 2HXLA 2QU5A 4LV8A 3WBLA 4A9RA 5HG7A 2W1ZA 3SW4A 4JXFA 1Q8YA 1VYWA 2YABA 3NYVA 3ETAA 5FTGA 3QKMA 3WZKA 3WZDA 4E6AA 4LI5A 1LPUA 4J52A 3FXWA 3MB7A 2AUHA 5JQ5A 3JR1A 5E91A 3SHEA 4YC3A 4KSPA 3NAXA 3ZRKA 4JT3A 4EYMA 2BAKA 4FTCA 3TL8A 3ZO4A 5CF4A 1CSNA 2YM3A 2WMTA 3O96A 4RC4A 1CDKA 3R01A 3BI6A 4FZ6A 3OVVA 3PA5A 3HP2A 3FKNA 3DBEA 2B53A 1DAWA 3H9RA 4RC3A 4DAWA 4O7RA 4RWKA 1Z5MA 1CTPE 3KREA 4EWHA 3A7FA 2VTTA 3LM0A 3LMGA 4HYHA 3AGMA 2YAKA 3ZXZA 4AACA 4KB8A 2YAAA 3D5UA 2FSMX 3CD3A 4XOZA 4QMLA 4EORA 3NW6A 2PE2A 4GUBA 1PW2A 3FXZA 5ACKA 4FIIA 4GUEA 3ORZA 3W2SA 1OZ1A 3UQCA 1UA2A 4XHKB 4QP3A 3NCGA 4TWCA 4IM0A 4RVKA 2J2IB 2GHMA 5HNIX 2VWXA 1U59A 2GNLA 2XJ1A 3ZUVA 4GK3A 3N9XA 3DFCB 3PXYA 3FMHA 4PP7A 3NUSA 4Y73A 4D4YA 2X39A 1NXKA 3UG1A 1XH8A 3N51A 3DOGA 1XH6A 2YM7A 5IQDA 2H9VA 2EXCX 1PXOA 3R2BA 4E20A 4FTTA 2PUPA 3TACA 5TT7A 4LGHA 3FZ1A 2OJGA 4M97A 4ONAA 4UXQA 2XRUA 4WRSA 4YO4A 4NT4A 4IX4A 3RZBA 5J1VA 4PTEA 2UZDA 4FV8A 1STCE 5A9UA 4NW5A 3K3JA 5KMOA 4M68A 4MBIA 3HDMA 2WD1A 4C3RA 2XZSA 4GKHA 3QQHA 1DAYA 4O7YA 2BRBA 2XCKA 5HI2A 5IUIA 1YXUA 4PDSA 3MY1A 4NU1A 3LCSA 4QD6A 4FVRA 3UNZA 4AZWA 4BTJA 3FMDA 2YACA 3LFFA 5IA0A 1J7UA 3W33A 4I6BA 3P7AA 4U40A 3R83A 3I5NA 1YQJA 4C4FA 5CAUA 3RK5A 4FOCA 5LCJA 4AW1A 3CKWA 5KZIA 4ANOA 3PTGA 2XIXA 1OBGA 3RWPA 4EYJA 2W96B 4ALWA 2ERKA 3REPA 5LVPA 4GU9A 5CAQA 3OBJA 4FKOA 5G1XA 4C37A 4FSMA 3QTIA 4NJ3A 3DNEA 5AJQA 2EXMA 2HW7A 3W2PA 4HNFA 5DLSA 1J1CA 2YJSA 4MD7E 1A9UA 1YXSA 2XB7A 4XBRA 4AN3A 4O84A 3ZH8A 4CZYB 4AA0A 4TYJA 4F1TA 1SM2A 5G6VA 3MS9A 3ORKA 1YWRA 3IPHA 4FG8A 4WA9A 4E5WA 5M4UA 3PFQA 4TL0A 5DG5A 1NW1A 3QXPA 1VZOA 2DQ7X 3RJCA 4NYEA 4K1BA 3VBXA 3ZFXA 1B39A 2C5YA 2OZAB 4D4VA 1KE9A 3Q9XA 5EI2A 5IQIA 2R9SA 1K9AA 2CKQA 3BE9A 3D83A 3E63A 3NZ0A 3QLGA 4I22A 4PMTA 3QXOA 4XG7A 2QOIA 3KMWA 4USFA 3E8DA 3W1FA 4DCEA 4K33A 3I6UA 3DTWA 4RWIA 3ZU7A 5C01A 3NWWA 2VZ6A 3QWKA 4U8ZA 2CGUA 4I20A 3HLLA 4HVDA 3L9MA 2R3PA 3QZIA 5IQGA 3WF9A 2B1PA 5AA9A 3S1HA 5CENA 3EKNA 3ZXTA 5JK3A 4FEVA 2BRGA 3LLTA 3KFAA 4IX6A 3U4WA 4S30A 4BRXA 3RK7A 2FO0A 4UMRA 1PF8A 4JG7A 3EZRA 3ZLWA 3LQ3A 2UW6A 3O8PA 3OZ6A 4IB0A 1YVJA 4DEAA 4CYIA 4EONA 4KKEA 4CFMA 4DCAA 1O6KA 3GCSA 4R1YA 4A4OA 4NEUA 3R21A 2OZAA 2ITOA 3OBGA 2I0VA 3MN3A 2PSQA 5D41A 4BY9E 3OXIA 4ZSEA 4EWQA 3BYSA 4ALVA 3ODYX 4LQMA 5IUHA 1ZMWA 4G17A 4MTAA 2WEIA 4ZZOA 3G2FA 3HP5A 3NUNA 5HO7A 4MBJA 2UW8A 2GHGA 1Y8GA 2IWIA 3JY0A 5ANIA 3KGAA 4M3QA 4O38A 4UYAA 4BDIA 4EOQA 3F82A 4P90A 3C5UA 2YWVA 1Q41A 3FKLA 4CRSA 2PE1A 1OMWA 4O0VA 3P1AA 2H34A 2IVUA 1XO2B 5HESA 3ZSGA 4AWIA 4C2VA 4EKLA 5ETIA 3V6SA 2V0DA 4AZVA 5C4LA 4OR5A 4TZRA 1OGUA 4L6QA 3DBFA 4JLCA 5EM6A 4G5JA 3MVHA 5AMNA 4PF4A 4FTUA 4ORKA 4AZTA 2RIOA 1FBNA 4EH3A 2OI4X 1K2PA 4J97A 5A4QA 4I0SA 1G8AA 3AMBA 3CE3A 3TJDA 4J71A 4ASZA 3GOKA 4KINA 3R8ZA 2Z02A 5IQCA 3E93A 3RCDA 1P2AA 4FG7A 3TN8A 3UE4A 3HRCA 4K6ZA 1JWHA 1YWNA 4U42A 1CKJA 1MRUA 3K5VA 5L4QA 5J79A 4GKIA 3DTCA 3H0ZA 3R22A 5CYIA 1Z57A 4KBCA 4OTPA 2YCQA 4RA4A 3LCDA 2FYSA 5C27A 2W1HA 5I9WA 2XVDA 3V6RA 3PY0A 3A62A 2R3KA 3PY3A 2WFYA 2XBAA 3Q3BA 4C35A 3PJ8A 4FSUA 4FR4A 4FEXA 1KE7A 4HZRA 4RIOA 5F95A 3NEWA 4WSQA 3ZFMA 3MBLA 4EH8A 2R3NA 4FV9A 1PXNA 2BVAA 5HICA 5J5TA 3CJGA 4BBFA 5BUEA 3GBZA 4QMTA 4O86A 3C4CA 1Q3DA 2ZYBA 3BYMA 1YOLA 1W7HA 4NTSA 4AP7A 1TQIA 3W55A 3F88A 4D55A 3IDPA 4JX7A 3A4PA 3CGFA 3P7CA 4YTCA 5LJJA 2X2LA 3DDPA 4FKJA 4H1JA 4R8QA 4X2KA 4FKTA 4YPSA 3IOPA 4C34A 3DNDA 3V51A 4CFVA 2XYUA 2ACXA 4WKQA 3S00A 2Y4IC 1R0EA 1PKGA 3NRMA 4GSBA 4PTCA 4YTHA 2ZV9A 1GZOA 4BI1A 4IAAA 5EDPA 5IQHA 3EKKA 3AMYA 3JVRA 3MH3A 5B0XA 4ZLYA 3ANRA 2FA2A 4C4HA 4YJNA 4EZ3A 2O5KA 3OWKA 4FV0A 4M0YA 3V3VA 3DB6A 4IW0A 3EMGA 4N4SA 4ZJVA 4CT2A 3MW1A 4OBQA 1YXVA 2OKRA 2WMXA 3GU8A 2X2KA 5I9XA 1YDTE 3NGAA 3PSCA 3IQ7A 1J91A 2XKCA 5EYMA 4ANQA 1W82A 4I5PA 4BDAA 5BMSA 2I0YA 2F7ZE 1NY3A 2X9EA 5AAGA 5HBHA 1YDRE 3H10A 1SZMA 4IWPA 3ROYA 4BDCA 5IH6A 4HGTA 4IC8A 3BIZA 4YLKA 4C3PA 2XCHA 4X21A 3VHEA 5CTPA 4W4VA 4WG5A 4DBNA 4DG2E 3EN9A 4I92A 4PX6A 4D1XA 2ZM3A 3RVGA 3VWAA 3GQIA 4I0RA 5KKRB 4QTCA 1ZXEA 5AUWA 5BVFA 4DF3A 3P79A 1JOWB 2WTDA 4IDTA 1U5QA 2XK8A 4JJRA 3OD6X 2C0OA 1F5QA 4CXAA 3DQXA 3Q2MA 3MVJA 5FRIA 2ZV2A 4R1VA 3VIDA 1GIIA 2EXEA 3PXRA 4ARKA 3R9OA 5A54A 1XQZA 1MP8A 1V0PA 3S4QA 2CLQA 1OUKA 4S33A 3SAYA 3GC0A 3VS6A 3EOCA 3NUYA 2BZIB 5GZ9A 5M06A 4LL5A 4M13A 4MWHA 3R7YA 5A6NA 2CNVA 4QQJA 2WOUA 3ZOSA 4F63A 2WMQA 2OWBA 4CG8A 4CKJA 3GXLA 4UZDA 5A14A 4ZZMA 1T45A 1LP4A 2Y9QA 3QL8A 4L7SA 4W4YA 3IW4A 5E8VA 4TYIA 3H0YA 4XG3A 4YO6A 2A19B 3KXNA 3DS6A 3R1YA 4M15A 2PZ5A 1RQQA 3FKOA 2VN9A 4QYEA 4BCHA 3ZTXA 4AA4A 4EK5A 2VWBA 3FLZA 3SA0A 4PMPA 5BPYA 3FLQA 5M44A 4FTKA 3R1SA 3VBTA 1M2PA 5IF1A 1QPJA 4NFNA 4NWMA 1R1WA 4QT1A 5HE0A 4QQ5A 3ZEWA 4G3DA 2XJ0A 4CLIA 4EOKA 2R3LA 4JS8A 5AAFA 3JPVA 3HV3A 2R3MA 3QZFA 4Q5EA 4BDFA 2CJMA 4P5ZA 4RQKA 1SNUA 2C5OA 2PZYA 4GYGA 3R7IA 5KMIA 2PU8A 1ZAOA 2XUUA 3QTZA 5HX6A 5F94A 3I60A 4Z7HA 5HTIA 1U54A 3VUGA 4BC6A 5IQBA 3H30A 4RG0A 1Q61A 5B2MA 2WQBA 4YZDA 4G9CA 1GY3A 4C57A 4JAJA 5M57A 5H8BA 3KULB 4YJQA 2UVYA 2OJIA 5AWMA 3QTRA 1UV5A 4GL9A 4FTIA 2QG5A 2OSCA 4FNZA 4N6ZA 4NIFB 4F7LA 3ZDUA 1ATPE 5DN3A 4QMQA 1GZKA 4FUYA 3RAWA 3D5VA 2J90A 4E4LA 4GVAA 4DH8A 3ENMA 3FWQA 3OWLA 5L6PA 2OF2A 4GJ3A 5GIPE 3DDQA 2YM4A 1EH4A 1XBCA 5H3QA 3EQDA 2ITNA 1XBAA 2YIYA 3R1NA 4V0GB 3R8LA 4OAUC 3NNVA 1MRYA 4M69A 5J5SA 3JUHA 2OU7A 1Y8YA 2JKMA 2R5TA 3HMNA 5AP1A 1FQ1B 1KOBA 2XM8A 3L8XA 2F7EE 4GK2A 1XH4A 4UZHA 4CNHA 4E5BA 5GIOE 3PLAE 2J5EA 4IAIA 3DJ6A 3HAVA 3FLYA 1OI9A 2RFEA 1H1SA 1B38A 2VRXA 3E92A 4TXCA 5GJGA 4MHAA 4ZXTA 3NNWA 4MK0A 3MPAA 5T6KA 1WVYA 3TG1A 1BLXA 4BZOA 4P7EA 4I24A 3P5KA 4BYIA 4UY9A 3QYWA 3R28A 3DKOA 4AU8A 4EH9A 1I09A 2NO3A 5AEPA 3O17A 5IQAA 2B55A 4ZTRA 5AUYA 4IDVA 4NIFA 1P4OA 4TNBA 2OFVA 5EW9A 2DS1A 4DFUA 5C03A 3FXXA 2C0TA 1WMKA 3BV3A 3MH0A 4C62A 2OBJA 2B9IA 3ORTA 5FDPA 4H05A 3GVUA 3K3IA 1ZYSA 3KF4A 2XNPA 2IZSA 4QMYA 3V5WA 4BDKA 1OBDA 2VAGA 3TEIA 2XNGA 2GNFA 4WSYA 3R30A 2XJ2A 3ULZA 5EQYA 1WBTA 2XIKA 4QP8A 2QO2A 4UXLA 4YU2A 3F3WA 4KA3A 4Y83A 4FTJA 4ZS0A 4EZ5A 3ELJA 4FC0A 4HVGA 2JDSA 3R04A 4PTGA 4JBVA 4NSTA 5F9EA 3QF9A 5BYYA 4I21A 3F3VA 3AD6A 4O7LA 4FK3A 3EFWA 4GK4A 5HLWA 4TT7A 4XP0A 4OBOA 2W1GA 4RLKA 1BUHA 1A06A 2QR8A 3A61A 4JQ7A 5L8KA 4CZTA 3KXGA 4IWDA 4IJPA 4ACCA 3N4TA 2YIXA 2I1MA 4IB1A 3OT8A 3EQGA 2E9OA 4GT4A 3FMLA 3FY2A 4EUUA 3QRTA 4WT6A 5AR3A 3UC4A 1FOTA 1PMVA 3GENA 3ZLSA 1SNXA 2J0MB 2R3HA 4KRDA 3PYYA 4U80A 3VAPA 2IW9A 3PE2A 4FEUA 4QTBA 4IAKA 3OY3A 4CGAA 2FH9A 1KOAA 2WQEA 2X6EA 3EB0A 3LMIA 2XNOA 4WHZA 3JY9A 5EDRA 3LJ2A 2QVSE 3D7ZA 5B7VA 3FQHA 4KD1A 2UW7A 3QTQA 3S0OA 4IAYA 3V5QA 3W2OA 4AZSA 3C50A 3KMMA 4ZTSA 4IWQA 3UQFA 1ZYDA 2RGPA 1IA9A 1PMEA 1IR3A 4L53A 5AAEA 4G2FA 2HK5A 3G90X 2PWLA 3COIA 3EN7A 3EZVA 3KQ7A 3DPKA 1OUYA 5CEOA 3OC1A 3CSVA 3FE3A 2G15A 2BDJA 3UOLA 3FL5A 1Q8ZA 2BDFA 1PXMA 4ZSLA 2R0IA 3LXNA 2W5AA 3QU0A 5CZHA 4QRCA 4QMUA 3P23A 2PYWA 2J0JA 3CXWA 3SOCA 2GNJA 2YM8A 2XA4A 4AFEA 4D5HA 3TIYA 2RKUA 4RIXB 3ZLYA 1UWHA 2GDOA 4NZWB 2GTMA 4ASXA 1KSWA 2YFXA 3O8TA 3T3UA 4PPCA 5GJFA 4RC2A 5ICPA 5HO8A 3IGOA 4D4RA 2WAJA 2C4GA 1BKXA 2PY3A 3UZPA 2VTSA 3ORNA 3Q9ZA 4GH2A 4XJ0A 5IPJA 4RA5A 3BU3A 5LQFA 3D0EA 3HMIA 4KBAA 5AM7A 2PUIA 3PPJA 3HMPA 2VGOA 4HCUA 4DFYA 2C6EA 4O82A 4FOBA 2OF4A 4MBLA 4D2TA 3MY0A 5JQ8A 3UYTA 5KBRA 4J95A 4UMQA 4WIHA 3VS5A 2BZJA 4A4XA 2ZJWA 3CY3A 4A4LA 3NIEA 3NW5A 5KBQA 1KWPA 2PMIA 3KVWA 3QYZA 2ZVAA 3FI8A 4RX5A 4NCTA 2ITVA 1ZY5A 3NYOA 3QC4A 3EQPA 3KRRA 4IVCA 2HW6A 1H00A 4LYNA 4XS2A 3UMWA 3VN9A 1H8FA 4JL9A 1ZY4A 5EK7A 4YPDA 3UOJA 4JDIA 2VTAA 3C0HA 2QI8A 2VTHA 4XBUA 3UYSA 2V7OA 4KS8A 5ANDA 3CEKA 4DA5A 1UKIA 1ZZLA 1L8TA 4O0TA 5D12A 2IG7A 3GCPA 4G31A 5IH5A 1MRVA 4O81A 4B6LA 3EIDA 3CC6A 3BEGA 3BPRA 4FT0A 4OTQA 2F9GA 2DYLA 2JLDA 5BVNA 3D4QA 3PIYA 2LAVA 3ZO2A 5E8XA 4USEA 1IAJA 3I0OA 4KKGA 3GU4A 5FTQA 5HZNA 3EH9A 4YNOA 5FXQA 1H1RA 2FSOX 1REJA 4OTDA 1QPDA 4O0WA 2OIDA 4IMYA 4BCFA 3VHKA 4F9CA 2C5VA 3U4UA 3R2YA 4FKVA 3G9NA 3TTIA 2GFCA 4JAIA 4Y5QA 4O7ZA 2UUEA 5CY3A 3ALOA 4YBKA 5AR2A 4L45A 3UO5A 4NM7A 4EQUA 4KS7A 4DFZE 4YTFA 3BU6A 3UOKA 3GEQA 1ZYJA 1FINA 4FL2A 3ZSHA 3KF7A 3DLZA 4EBWA 5J7BA 4R78A 1SVGA 4GYIA 3C51A 1UKHA 4FGRA 2BILB 3VQUA 4CFFA 2YIWA 3E87A 5DNRA 4YC8A 5ETAA 2B9JA 3RALA 4TRLA 3TM0A 2J50A 5AR8A 4EBVA 3ZBXA 4IVAA 4NCTC 4TPTA 4C38A 5HQ0A 4QYYA 4ZEGA 2VX3A 3L8SA 1M7NA 4ZSAA 2YERA 3WYYA 2JC6A 3WE8A 1M2RA 4R3CA 2BIYA 2YEXA 1OPLA 4QTAA 3SD0A 4EC9A 2WZJA 2CCHA 4RFMA 3CLYA 2X9FA 3MFRA 1TQPA 3ORPA 5D7VA 2J6MA 2C1BA 4GFGA 4ITJA 4BCKA 4XG8A 3QCXA 5CU6A 3SVVA 2OIBA 5IZFA 2VWZA 2YDJA 3KXZA 2C6DA 5EYDA 4JOAA 3TZ7A 1GIJA 2Y6OA 3P7BA 4JBOA 4F0IA 2W06A 4I3ZA 4XG9A 4QMNA 4HW7A 4OTRA 4BB4A 4DFNA 1GNGA 4ZSGA 4C02A 4ZTQA 5HO6A 4A07A 4HZSA 4D1SA 3SW7A 1NVQA 2XF0A 3MA6A 4L3LA 4MQ2A 3HAMA 1ZLTA 3OUKA 5I3OA 5A4EA 5I9VA 3KCKA 4D2SA 3EL7A 3Q9WA 2VWYA 4U45A 4EL9A 3NW7A 4OW8A 4YC6A 4R5YA 3JS2A 3F69A 5JEBA 3IECA 2X7OA 1XH9A 4QMSA 5AV1A 3K5UA 2J0LA 4F0GA 4RJ6A 3ERKA 3PIXA 4ZP5A 3ZRLA 3OHTA 2Z8CA 3HRFA 2VO6A 5C9CA 3OF0A 4BWPA 3ACJA 4PWNA 2OH4A 4C61A 2ZB1A 2C6IA 5L6WL 4DYMA 3NPCA 4DH5A 5K3YA 2F2UA 5BVDA 3EFKA 2G2IA 4D0WA 5C8KA 1UNLA 4QQTA 2W7XA 4AZEA 3R9DA 5E8TA 4U44A 3G15A 3WF7A 4EHVA 3KCFA 3Q5IA 4BL1A 1J7LA 1BMKA 4FTRA 4KBKA 4LV5A 2J9MA 1RW8A 2ZMCA 5F20A 4D9UA 4BR3A 3I7BA 1M2QA 5M56A 4MD8E 2HY0A 4BCJA 4KABA 3JYAA 4AS0A 4DGOA 4GW8A 2BRNA 3WIGA 3QD0A 1QPCA 2OH0E 2HENA 5D7AA 3KXHA 2UV2A 4I5CA 2Q83A 4LRMA 2VGPA 4IH8A 4G16A 1OIQA 3GC8A 5TO8A 3MVMA 4M66A 2QG7A 4O96A 3MJ1A 5J9LA 2YHVA 4EHGA 3L8VA 3TNHA 5ETCA 3ZC6A 2BRHA 3DJ5A 3GCQA 2VUWA 3HNGA 4J8MA 4RFZA 4AF3A 4C59A 2BDWA 4IACA 1XR1A 5M4IA 2OJFE 3F5PA 3PPZA 4EOMA 4HVHA 2YN8A 5JMSA 3O71A 4DBXA 1FMOE 4DGLC 2LGCA 4D2VA 2BMCA 3BRBA 4XEYA 3CS9A 3GC9A 3PWDA 4ITIA 4PMMA 2J0IA 1G3NA 4BDEA 5C4KA 4G6OA 5JGDA 4BDBA 4CFNA 4DH7A 5GZ8A 2XS0A 3DY7A 5JGAA 3CJFA 3DZOA 3IW7A 5AA8A 5DRDA 3G0FA 1H01A 2E9VA 4L3JA 4EOIA 1H25A 4DGMA 2C5XA 2PTKA 4FK6A 2X8DA 2JIIA 2QO7A 5IEVA 2A27A 5A4TA 4DH1A 4DGNA 2F49A 2WMAA 3OT3A 4R77A 3DK6A 5EI8A 4CG9A 2PVMA 4V01A 2O63A 4HYIA 3MV5A 3LCKA 3RPYA 4E5AX 2WU7A 3RM6A 5H8GA 4TNDA 4YLLA 1H26A 4FI1A 3RPVA 4ZAUA 4FNYA 4AOJA 3O0GA 4EI4A 4DT8A 2G9XA 2BRMA 2CDZA 1Q62A 4TN6A 2JDVA 3SXFA 3A4OX 4W9XA 3PUPA 2OIQA 1KE5A 3CR0A 5FXRA 3HV5A 3TUBA 2NNWB 4ZMEA 3LKMA 4TTHB 4O2PA 1OL2A 4FSZA 3EN5A 3FPMA 4G6LA 2I40A 5BYZA 4Z3VA 1JSVA 4I6QA 3B2WA 3ORLA 4I4FA 2XMYA 4N70A 2PMNX 3ENHA 4A9TA 4MNEA 4X6RA 5IISA 2B9HA 3QTUA 1JSTA 3U6JA 4AUAA 2ITQA 4QPAA 3TI1A 3WI6A 1AGWA 3Q4UA 4RVLA 5M4CA 1OKWA 5DR9A 2B54A 4NKSA 2R3RA 4ENXA 3OEZA 3S95A 5IA5A 3QTSA 4KIQA 2I7QA 2P3GX 4RIWA 4XG6A 5ITAA 4L42A 1HOWA 1MQBA 2FSTX 3L9NA 4FSNA 1R3CA 4AE9A 2ZM4A 3BLHA 2HZNA 2QLUA 4K8AA 3KK8A 5IMEA 4CTCA 1AQ1A 2QKWB 2JDTA 2UZWE 3LE6A 1V0OA 4WUNA 4ZK5A 4AW0A 2WHBA 3PJCA 4G1WA 1Q4LA 3RAIA 2ITXA 4L9IA 2YISA 3PWYA 4CEGA 4ZTMA 5M07A 1UU9A 2A4LA 2Y4IB 5JT2A 1M7QA 4EZ7A 4QMWA 5HEZA 3M2WA 2VTQA 1ZWSA 1PXIA 4H3BA 3O50A 2Q0BA 3VS4A 2CN8A 2BAJA 3BU5A 4ANSA 4F7NA 3M42A 3KN5A 5A3XA 4O6LA 5CU3A 4FTNA 3UDBA 3MH2A 4QQCA 4E7WA 3FHIA 4CT1A 1W8CA 4FSQA 3KRXA 3NUAA 5FDXA 3TUCA 1M52A 4QP4A 3EFLA 3FZRA 3G5DA 5D9HA 4CCBA 3OROA 4RWJA 3Q2JA 4E3CA 3FSFA 4RJ8A 3R9RA 2KULA 4IFGA 4FIEA 3SDJA 3ZMMA 3FZTA 3QKKA 4KSQA 3LFQA 4ACDA 5K0XA 4U3ZA 3LHJA 2UW0A 5DA3A 5EOLA 3ATSA 4KIPA 4JBQA 5E1SA 3QGWA 1WBVA 3MA3A 5CS6A 4MCVA 5DRBA 3MESA 5CVGA 2ITZA 3SOAA 5A4LA 3GCUA 3UJGA 2GTNA 3I1AA 5FD2A 4XCUA 5E1EA 3G6GA 4KKHA 5CI6A 3FI2A 4BIBA 2O0UA 2XNMA 4RJ7A 3VBYA 4E4MA 2IZUA 4IEBA 3SXRA 4DG3E 3SRVB 4C36A 1ZZ2A 3NS9A 3DAJA 4ZOGA 3RI1A 4ERKA 3NMUF 3CIKA 5CT0A 4ZLZA 4CKIA 4AGUA 3BYVA 3HKOA 4BWXA 1WBOA 4PQNA 1Q24A 2JD5A 3CY2A 4WNMA 1J3HA 3NLBA 4KNBA 4IZ7A 1JKLA 4WNOA 3NSZA 4F65A 1TQMA 3CD8A 4G6NA 3WYXA 3O23A 5AUXA 4QO9A 4IFCA 1PMUA 1W83A 3F5GA 2R7BA 3KMUA 4I0TA 3DKFA 4WD5A 3ZYAA 3A99A 5LCKA 3HYHA 4IHPA 4JG8A 4N0SA 3QGYA 5ANOA 3UBDA 4ASDA 4BDDA 2QOCA 2ZDUA 3MYGA 4IWOA 5FEDA 2WIPA 2PVRA 4OTGA 2X1NA 4IAFA 3NCZA 2EB2A 4ANLA 5HNBA 4BZNA 3EQRA 2H96A 2AC5A 1DI8A 3GUBA 3D15A 2AC3A 1VEBA 4OGRA 3F66A 2JKKA 4MXZA 3Q4ZA 4JIAA 4UB7A 4RIYA 4YZ9A 3PVWA 3SRVA 1PHKA 5DR2A 4AZFA 4O83A 2BZHB 3F2NA 3G51A 4QTEA 3QD2B 5HLPA 3FLNC 2GSFA 1KV1A 4C2WA 3LM5A 4CSVA 3PJ1A 4U9AA 3HV4A 3ID6C 3RKBA 4FKPA 5EYCA 4TW9A 3R6XA 3LJ0A 4XNEA 1JPAA 3FQEA 3UG2A 5AFVA 4MNFA 4BDGA 4AN9A 2YCFA 4YZCA 3WZJA 3BHHA 2JBOA 5AUVA 3NAYA 1IASA 2Z7QA 5FEEA 2XEZA 4Y95A 4X3FB 4CV9A 3E8CA 3LPBA 3NNUA 4EKKA 4QMZA 4PP9A 1H1PA 4KIOA 4MAOA 5HHWA 2ETKA 2JITA 4QNAA 4ALUA 4I5HA 4OTFA 4APCA 4UX9A 3GI3A 4ZY5A 2J51A 3AG9A 3KN6A 2XIYA 2W5HA 3D14A 3RZFA 5BQ0A 2VO0A 4FNXA 2VO7A 2HXQA 3ULIA 3VUKA 4BGQA 2BAQA 3AGLA 1ZOEA 4FUXA 4YBJA 4BIDA 4CTBA 5DT4A 4IADA 3A7IA 1ERKA 4YJSA 5EHLA 3RNYA 2JAMA 1KE6A 3ZLXA 4BF2A 4DEHA 4QYHA 3TZMA 4QMOA 1P5EA 4XP3A 4NM0A 2Z7SA 3PP0A 3CCNA 2W17A 3OW4A 1H27A 1UNGA 4Z16A 5KMNA 1U4DA 2R3QA 4GFMA 3RGFA 4AN2A 3C5IA 3LMHA 5BVKA 2R3GA 1JSUA 4AGCA 1U54B 4CMUA 3OMVA 3ZZEA 1Q8TA 3KL8A 3QZGA 1O9UA 1ZMUA 4OT6A 4X3FA 1OL5A 3DQWA 5KMMA 2QOFA 3I4BA 4OAVB 3VF9A 2XEYA 3VW6A 4XLIA 2R3JA 2W5BA 3KA0A 3AC4A 3GU7A 4BHZA 5D10A 4Q9SA 2BKZA 5AP7A 5AV0A 4XV9A 3CP9A 4MF0A 2E9PA 4F9BA 5FM2A 3ORIA 3EQHA 4U5JA 1YHVA 5JFVA 2F2CB 4AA5A 1GZNA 5CSXA 4LUDA 4EH5A 3IW8A 2UVZA 2F7XE 2GS7A 3NYXA 5EKOA 4FKSA 3RCJA 4AG8A 5DMZA 4M69B 4C7TA 2BTRA 3R63A 3UNJA 4EOJA 2CKEA 2OFUA 2W9ZB 5CQWA 3TNQB 3VS1A 4F09A 4YGAA 5CF5A 3KK9A 2RL5A 2ITTA 2JFMA 2XBJA 4Y72A 5KX8A 4PPBA 5EM5A 3UO6A 3UTOA 2ITYA 2YCSA 1X8BA 1OB3A 3ZRMA 1IA8A 4FIFA 1VJYA 3NUXA 3QLFA 3OY1A 4RVTA 3F5XA 3UP2A 1SMHA 3ITZA 1LR4A 4TY1A 4Y85A 4AX8A 3W32A 4CQGA 5CAOA 5CLPA 5HBJA 4QOXA 2OG8A 3DXPA 1LEWA 4G34A 4YUQA 3BZ3A 3UGCA 5GZAA 3TV4A 4RX7A 1FVTA 1SVHA 4CFXA 3O8UA 1OITA 3V8WA 4AOIA 3CQWA 2AYPA 4X3JA 3EQCA 2Z7LA 3EQBA 3NYNA 4J8NA 2WTKC 3QCSA 2W99B 3BE2A 3RK9A 3WF6A 4GRBA 4X3FC 3A8XA 3H9OA 4YZNA 5IKWA 4AGDA 5C26A 3LIJA 2C1AA 4O1PA 4LRJA 3CQUA 2CNQA 3I0QA 4S31A 1IG1A 3OG7A 2QCSA 3NR9A 4CV8A 2GNGA 2WIHA 5HOAA 1J1BA 2XKFA 3GNIB 5IEXA 5M4FA 3QQFA 5AP0A 4YP8A 3HRBA 3ZS5A 5LWNA 3ZBFA 2Y4PA 3OOMA 3Q60A 4K2RA 3E88A 5HVJA 3TKHA 3BGQA 3OCSA 3EFJA 2ZMDA 4XG4A 4H1MA 3FYKX 4YZBA 3KEXA 4FBXA 5HCXA 3C13A 1YOMA 3VBWA 5B2LA
chains in the Genus database with same CATH superfamily
2J7TA 3Q5ZA 2IW8A 3MTLA 3TT0A 1ZRZA 2YDKA 1GZ8A 1U46A 4ZTNA 5AADA 2QKRA 4BKYA 5H2UA 3DJ7A 3LFSA 2XNBA 4FT7A 5M51A 4FV2A 5GNKA 4AXAA 3MIYA 2YM6A 2OXXA 4D58A 4C4IA 3IW5A 1YI3A 1O6LA 2C6TA 2JEDA 3C7QA 3E62A 3OOGA 4X7QA 2VTJA 5EW3A 4C0TA 3V8SA 5CEMA 5JKGA 2PVYA 3BKBA 3MH1A 1Y6AA 4NM3A 5I9UA 5HTBA 4ZY6A 1WFCA 1ZARA 2WTJA 2HWPA 3MDYA 5CT7A 1Y91A 4BWKA 2EWAA 4FZ7A 4NUSA 3GB2A 2WQMA 4MF1A 4W4WA 4EJ7A 1XH5A 4WBBB 5HCYA 3PA3A 4IX5A 4RQVA 5ANJA 3DV3A 4JDKA 5EM8A 5HVYA 5JFWA 3KB7A 1ZYCA 3IG7A 5EKNA 3BHTA 2QHNA 2W05A 4EH2A 4IXPA 1QCFA 2PVHA 5IA1A 4FMQA 4DGGA 5IMXA 3EJ1A 5LMAA 4S32A 3VUTA 4O0YA 4BCIA 3D5XA 4CQEA 3ORMA 3MFSA 2I6LA 2ZDTA 5CSHA 4LGGA 3EHAA 2R4BA 4R6VA 2GQSA 3UDTA 2IJMA 3GFWA 1W2FA 5BYLA 3V5JA 2EVAA 2HYYA 4MXAA 3TCPA 1ZOHA 4BYJA 2PUNA 5CU4A 5E90A 4FYOA 4GT3A 5CEIA 3P9JA 2HY81 2XIRA 3PVBA 4X2GA 4UN0C 3UNKA 3DCVA 5H9BA 3HX4A 1JKTA 3K2LA 4QMVA 4R3RA 3KIOC 3VBQA 3O51A 1NA7A 4IAZA 4Z9LA 3W8LA 4DHZA 4QP9A 3QWJA 3WF5A 3DK7A 4E93A 5HU3A 3BLRA 4ZS4A 1UU7A 2W4KA 5IU2A 2FB8A 3PJ2A 4HGLA 3UIXA 2GS6A 4LRKA 4BDJA 5DGZA 1PY5A 3DAEA 3BBWA 3EYGA 4LMNA 2PK9A 5BVEA 3AC5A 4LOQA 3TV6A 3G9LX 3IKAA 4BIEA 4DTKA 2NPQA 4AAAA 1M14A 2F57A 1CMKE 5TF9A 1YI4A 4ERWA 1XMMA 3I81A 1YW2A 3KRJA 4O7VA 4P2KA 5IEYA 2VTRA 2X0GA 3IS5A 4RVMA 4YLJA 5CASA 4F9YA 1PXKA 4FKLA 4NJDA 1QL6A 2QURA 3W2QA 4AE6A 1H1QA 3QD4A 2VO3A 4MKCA 3WIKA 1V1KA 2BR1A 2PMLX 4RFYA 4FTQA 3OTUA 5L6OA 3GC7A 3FEGA 4BI0A 1BYGA 2GCDA 4OLIA 3VULA 1F3MC 4BKZA 2UW4A 3DAKA 4F1MA 4FZFB 4FKQA 4FSRA 2GPHA 3TKUA 1ZYLA 2P55A 3U9CA 5CNNA 5CWZA 5HX8A 5AP6A 4V05A 3H9FA 4CD0A 3OS3A 4FODA 3VVHA 3UQGA 4NL0A 5AP4A 2ITUA 3AXWA 4NM5A 1E1VA 4OTWA 3RBWA 2J4ZA 3D2IA 3LFEA 2VTLA 1Y57A 4FKIA 1PXJA 4RX9A 3D94A 4ANBA 5IG1A 4HYSA 5DE2A 4GMYA 3RINA 2JFLA 4FV7A 4BKJA 4EH6A 2EU9A 4EOSA 4QTDA 4BFMA 4PDOA 5JFSA 3JXWA 4W9WA 1JLUE 1IEPA 1XHAA 4IM2A 3HZTA 1GAGA 4DEIA 2RFDA 4WG4A 2X0OA 4G3FA 2XIZA 2OO8X 2JIUA 2JDOA 2PVNA 4XYFA 4GV1A 5I9ZA 4YHFA 4UWYA 5JFXA 1WVXA 4A9UA 4G5PA 2GNHA 4FL3A 4LGDA 5F1ZA 2R7IA 4HCVA 5C8NA 4BCNA 4O7WA 2Z2WA 3C4FA 4TYHB 3THBA 3UP7A 2ZAZA 3QFVA 3MJ2A 2QOBA 2W1FA 1WBNA 2XKEA 3QA8A 4TYEA 2XAOA 3G6HA 2ETMA 3ALNA 2ERZE 3QQJA 3Q04A 4FYNA 5JRSA 3F61A 3UODA 2ETRA 4F99A 2YZAA 4ZJIA 5EQEA 2OLCA 5ETFA 2P4IA 3AC8A 4IB3A 4EH7A 3LCTA 3F2RA 3AKLA 3O2MA 4FSTA 4UV0A 3C4WA 4J99A 4Z55A 5BUJA 2E2BA 3FLSA 3FYJX 3COMA 4FGBA 5DH3A 4GCJA 3CTHA 3T9TA 2NRUA 3BYOA 2WEVA 2YDIA 3Q53A 2E9NA 3FPQA 2IZTA 1FVVA 1WZYA 2OK1A 2WMUA 3WILA 1FPUA 3AKJA 1PXLA 2UZUE 4R7BA 3DXNA 4IVBA 2QNJA 4OTIA 1VYZA 3HVCA 3CBLA 4M0ZA 3VW8A 1XWSA 2EUFB 2GQGA 4Q9ZA 4O0RA 1G5SA 2GHLA 5CX9A 3U87A 4F6SA 2OW3A 2VWVA 3PY1A 4O0SA 2BROA 3BWJA 3ATTA 3F2AA 3OCTA 4BCQA 1B6CB 2QLQA 2YIQA 3QQLA 4RT7A 4U0IA 4HVSA 3LFBA 4TYHA 3GFEA 2O2UA 3QCQA 2FUMA 1S9JA 4C3FA 4BCOA 4UWBA 1UU8A 2XNEA 3UVQA 3LFNA 3D2KA 3GU5A 3RTPA 3RWQA 4C8BA 3A7HA 1YOJA 4X6QC 3LVPA 3TNIA 3R9HA 5HTCA 4NH1A 3Q52A 4KWPA 4MD9E 4O0UA 4FVQA 4F6UA 3W8QA 4K0YA 5C1QB 4O4EA 4X2FA 5DWRA 3H3CA 2Q0NA 3WZUA 4IZYA 1P14A 2QONA 3P0MA 3TZ9A 3VRZA 3V5PA 1R78A 4JG6A 3LFDA 3IO7A 3HUBA 4HJOA 3QC9A 5HU9A 3FL4A 3TTJA 3UPZA 4O7NA 4EEVA 1JNKA 2W0JA 4DLIA 5E4HA 2O64A 3PJ3A 1XKKA 2XYNA 5HD4A 5HE2A 4MQ1A 2QOHA 3H4JA 3KC3A 2P33A 1PXPA 3E7VA 4X2NA 3E3PA 3OWJA 4XV2A 1Q5KA 3A60A 3UZTA 4ACMA 4CMOA 1DM2A 2WQNA 3LOKA 4LL0A 3PLSA 5AIKA 5K5NA 4WUAA 5EYKA 4PNKA 2UVXA 2WELA 4FG9A 3BLAA 4N6YA 5FQDC 4I6HA 4RBLA 4TKSA 3CQEA 3LCOA 3OUNB 2I0EA 3PXFA 3ET7A 3DZQA 4YTIA 4FICA 5B2KA 3VRYA 3UZRA 3AT4A 3BEAA 4L00A 4FA2A 1JKSA 5J9ZA 3DBCA 4MEDA 5CEPA 3OWPA 5JH6A 4DEEA 1HCLA 2JIVA 4W8EA 2X7FA 3VUMA 3C9WA 3VQHA 3QBNA 4O7SA 3SLSA 2UW9A 2VNYA 3SG9A 4DHFA 3T3VA 4DFBA 3FDNA 3DLSA 4EC8A 3A7JA 4RX8A 4B9DA 3CPCA 5FXSA 5I3RA 1TKIA 5CSWA 5M55A 4WG3A 5DYJA 2XK7A 5HG9A 1FMKA 1BL6A 4HOKA 3W0PA 5TR6A 2VX0A 3DKCA 3FHRA 2UZOA 2VTMA 3FV8A 5I4NA 4OUCA 5DIAA 4KUJA 3C0IA 2CKOA 4QYFA 4LOPA 3PG1A 4ZIMA 5TE0A 3C1XA 1I44A 5TOZA 2V22A 2AQXA 5CXHA 2X8EA 4GG5A 4QP2A 4KAOA 4QP1A 5M09A 3MTFA 1URCA 2QD9A 4M7IA 3VS0A 3AC2A 2YLEA 4BDHA 5IQEA 4DTBA 2WTCA 3MPMA 4YJUA 4I5MA 4J7BA 5HKMA 3BQCA 4BGHA 5HBEA 3UMXA 2I0HA 4F9AA 4FVPA 5BX0A 4LM5A 3LFCA 4FEQA 4DH3A 4ASEA 2WU6A 4IIRA 5HIDA 3EWHA 3HDNA 5HG8A 3PRIA 4YURA 2BFXA 4O6EA 2CGWA 2X4ZA 3GT8A 2QOLA 2BZKB 2CGXA 4U79A 3OW3A 2J5FA 1H1WA 4FT3A 2P0CA 4QPSA 4EK4A 3PP1A 3FUPA 4RPVA 2VTOA 4FTOA 5DT0A 3L9PA 4J98A 4GJ2A 2XP2A 5A4CA 3ZEPA 4O21A 4MNEB 4S34A 5IA2A 5FG8A 4D4SA 2HZIA 2C3JA 4F64A 4K11A 4C4EA 2PVFA 1Q8UA 3AOXA 3IOKA 2A1AB 4QMPA 4RIWB 5AUTA 1MUOA 5HE3A 2VX1A 2HAKA 3K54A 4X0MA 3QX4A 2YIRA 5HIEA 4JBPA 3TUDA 2ZFYA 2IN6A 5T3QA 1JBPE 3RMFA 2IPXA 2CN5A 4GFOA 4O91A 4XP2A 3FY0A 5J87A 5LMKA 4DG0E 3DU8A 3EQFA 2V7AA 1IAHA 4JDHA 4O7TA 3L1SA 2HZ0A 2UZBA 5ANEA 2BTSA 3ZUUA 1URWA 4I6FA 3EL8A 4P4CA 5FEQA 3QAME 2OXYA 2R64A 5L2TA 3WE4A 4BTFA 3BBTB 1ND4A 3NVMB 4U7ZA 4DITA 3N4UA 3QZHA 3WF8A 1VR2A 3QQGA 4JQ8A 4KRCA 2YZLA 3Q4TA 1WAKA 2WMWA 2JGZA 1JAMA 5K5XA 4I4EA 5LXMA 1XJDA 3FLWA 3OTVA 4BI2A 3KU2A 2P2IA 2IO6A 4L67A 4DEGA 1YI6A 2H8HA 3MSSA 1Q3WA 4M84A 1PJKA 5AR4A 1OIRA 1OPKA 1Q8WA 2ZV7A 1RDQE 5J7HA 2GNIA 3ZZWA 2W1CA 1KV2A 1PYEA 1L3RE 2XNNA 4O22A 3R7EA 1J7IA 3KKVA 1S9IA 3FJQE 4FTLA 1ST4A 4DTAA 1XBBA 4FX3A 4L68A 3BYUA 2W1DA 3F3UA 2XAMA 1YHSA 5HNGA 3DB8A 3WARA 3UO4A 4IE9A 4K77A 3SX9A 4F6WA 2WGJA 5C8MA 3CGOA 4S2ZA 2CGVA 3DBDA 4CMTA 2HIWA 4M67A 4DFLA 3JVSA 4DDIA 4BHNA 5JN2A 5BUIA 2IZRA 5KHXA 3HV6A 4H3PA 5CVFA 2VTPA 5LMKC 2WTIA 3NX8A 2WKMA 2IVSA 2ZB0A 2R3IA 4EOLA 5LWMA 5BMMA 3W10A 1FGIA 4FTAA 2C68A 5L2IA 3E7OA 2ITPA 5JGBA 5KO1A 3M11A 4ANNA 3LW0A 2QOKA 4W8DA 4F9WA 5K4IA 3HGKA 3AT3A 3ZUTA 2C30A 1JKKA 4AW5A 2WMBA 2PE0A 4O2ZA 4AXEA 1F0QA 3ZO3A 5HGIA 4AT3A 4E26A 3O5AA 2UZTA 4UMPA 3MIAA 1BI7A 3P86A 5ANGA 2QO9A 2IW6A 3G0EA 1YWVA 1APME 1JVPP 3I6WA 5EI6A 2GU8A 3ANQA 2XM9A 4MH7A 3RP9A 4IANA 5DEYA 3PRFA 3GP0A 4II5A 4PPAA 4G3GA 4Y46A 5EH0A 4F78A 4FT9A 3IGGA 4PL3A 1H4LA 3R8VA 4CZUA 3AQVA 3Q6WA 5AP5A 4UMUA 2WMVA 2PZIA 3FAAA 5JSMA 1A48A 2W4JA 2Y7JA 3BLQA 4Q5HA 4XOYA 4EK6A 4FE2A 3GU6A 3MWUA 4RSSA 4YSJA 5AV3A 3PSDA 2XK4A 1M17A 2DWBA 4RIYB 2RF9A 4NFMA 3RPSA 5DT3A 2RG5A 3PIZA 3P78A 4DN5A 4ENYA 3LXLA 4F7SA 3U6HA 4RLLA 4MXYA 3R9NA 1UNHA 3FZPA 3V5TA 3DT1A 3LFAA 4QNYA 4WNKA 4IM3A 3MVLA 3NUPA 4HCTA 3C4XA 1FGKA 3QUPA 5FBNC 4ZZNA 4IB5A 4NTTA 1MQ4A 3DGKA 4FL1A 3TXOA 4AFJA 3QTXA 1IRKA 2X4FA 4A9YA 3U55A 4TYGA 3DK3A 4RRVA 3SXSA 4QDVA 4FV6A 2XALA 1Z9XA 2A98A 3QKLA 4LFIA 5E9EA 3W0SA 5KMLA 3SG8A 1WBPA 3ZFYA 3S3IA 4DT9A 3QRUA 3AD4A 3FQSA 3QQKA 4TWNA 5CNOA 5CXZA 4MX9A 3FMEA 4TWOA 4WBOA 1GOLA 5HCZA 3HA8A 5CEKA 1QPEA 4I93A 2GQRA 1H07A 4RGJA 4CVAA 2W1IA 2FGIA 3ZONA 5I0BA 2C0IA 1UWJA 3VS3A 2YM5A 3GCVA 2C5NA 5HD7A 4B7TA 2X7GA 5D11A 3C4ZA 2CKPA 2WXVA 4BJJB 2RFSA 1H28A 3MFUA 4MYGA 5LVOA 3R7OA 2X6DA 4FNWA 3PXZA 3DXQA 2B4SB 4RMZA 3W16A 5J1WA 4HGEA 2BUJA 5BNJA 2NYAA 3PLAE 2QC6A 2W1EA 5AIRA 4ACGA 3TNWA 2O8YA 4B0GA 5CSVA 1PKDA 3O7LD 5E8ZA 3AT2A 1NVSA 4O4FA 1YXTA 2UZLA 2XRWA 3N4VA 4L01A 3UIUA 4A9SA 5T68A 5LVMA 1OKVA 3CTQA 4V04A 4NW6A 2O3PA 2VWIA 3LZBA 4L44A 3ZHPC 4MWIA 4BCMA 4FV1A 3MI9A 3QD3A 1R39A 2WTKB 4EQCA 4U3YA 5FLFA 5KHWA 3HMMA 2VNWA 3QALE 2Z60A 3MB6A 3V04A 4PDYA 2BHEA 2PHKA 3AD5A 4L43A 5L8JA 3A8WA 3PDTA 1BX6A 5FM3A 3R8UA 3M1SA 3P08A 4L52A 5HVKA 2HELA 3EN4A 1AD5A 4PDPA 4D1ZA 4R7HA 4JQEA 3PSBA 2BFYA 4FKWA 5L2QA 2OXDA 4L8MA 4JVGA 4AXFA 4EK3A 3UOHA 3VNTA 3U8WA 4CRLA 2XH5A 2EB3A 4PV0A 5E7RA 1KE8A 2P2HA 2QU6A 3T8OA 3ZO1A 4CCUA 4N57A 1E9HA 5AV4A 5CVHA 1DS5A 1TVOA 4XRLA 4YJTA 5DPVA 5FP6A 3TJCA 2PULA 3E64A 3ORXA 4I94A 3RM7A 2Y0AA 5I5ZA 3QA0A 3FMNA 4G3CA 3W18A 4D2WA 5KCVA 4L3PA 3U54A 2ZM1A 4AAYA 4ANMA 3QUDA 3GOPA 3VS7A 3FI4A 3ZC5A 2CPKE 2NRYA 3UPXA 4GVJA 2DUVA 4FV4A 2C6OA 3EQIA 4B4LA 1UVRA 2SRCA 4U6RA 3NVKI 4D28A 2OGVA 4FZAB 4UWCA 5EG3A 3DKGA 2VV9A 5ACBC 3ZM4A 4EHZA 4MXOA 4PMSA 3R00A 3PPKA 5DR6A 5HG5A 3KRWA 5L8LA 5LVNA 1GIHA 2R2PA 5LMBA 3KY2A 4JRNA 3IK3A 3D7TB 2JKQA 1NT2A 4AQCA 4F7JA 2WNTA 3R7GA 4J1RA 4KIKB 3ZDIA 1GJOA 2BIKB 3QX2A 4ID7A 4GT5A 4YJPA 5AR7A 4AW2A 3BCEA 3B8QA 2HWOA 3LJ1A 3VUHA 4BCPA 4ZMFA 4Y8DA 5CSPA 3TDWA 4D5KA 2HOGA 2CMWA 2VTIA 5M53A 2YLFA 2UZVA 2NP8A 4IC7A 4ITHA 4JI9A 4AT5A 4BVUA 5TKDA 3UVPA 1YDSE 2GS2A 2R3FA 4U41A 2CCIA 4YZMA 2RG6A 3VF8A 5CALA 4W4XA 4R3PA 4WO5A 4UBAA 1XH7A 2C47A 3D9VA 1FVRA 3R0TA 3TIZA 5AP3A 4BCGA 3LQ5A 2YWPA 4FKUA 2WTWA 3BWFA 3R8PA 3T9IA 2WMSA 5BVOA 5JZJA 3EYHA 5A6OA 3F5UA 4MXCA 4NK9A 1OGYA 2V5QA 4BTMA 1RJBA 4AGWA 5H8EA 2V55A 2CLXA 2FVDA 1CM8A 3HV7A 4HYUA 4E6DA 5K9IA 3GQLA 4YHTA 4FKGA 5AX9A 5LOHA 2B7AA 3BHVA 4CYJA 5FBOA 1WCCA 3D7TA 3S2PA 4CLJA 5FTOA 2QR7A 4TWPA 4DFXE 1H0VA 3LQ8A 3FZOA 5DEWA 5CANA 4O1OA 3LXKA 4KIKA 2KTYA 3KVXA 5HE1A 3SKCA 3UVRA 4D0XA 2C3LA 4QMXA 3SC1A 1LEZA 4DC2A 3VJOA 2AEGA 2X81A 4K18A 3SV0A 4YSMA 3OFMA 3BV2A 3F3ZA 1WVWA 3KXMA 4K9YA 2A0CX 4LOOA 5CU2A 2WO6A 2RSVA 4FIHA 4RJ3A 4USDA 2OJ9A 4JX3A 4YJRA 3R8MA 3RAKA 3U51A 1OM1A 2WPAA 3A2CA 3PG3A 4I1ZA 5I9YA 4WRGA 4LDTA 4EHEA 3BELA 3Q4CA 5AX3A 4E73A 1W0XC 1WBSA 2PMOX 4HPUE 4EQMA 2YJRA 5D1JA 3DA6A 5K4JA 5EHOA 3VBVA 2BKKA 2XK6A 4OT5A 2WB8A 5DI1A 5KE0A 2G2FA 4FIJA 3C0GA 4C58A 4F1OA 4ZSJA 3OEFX 3VS2A 5CF6A 1G8SA 4XX9A 4AOTA 4PY1A 5KNJA 3OCGA 2IEWA 2VWUA 3HA6A 2W9FB 3AMAA 1H0WA 2CNUA 4M12A 1HCKA 4CKRA 3CTJA 4XV1A 2HCKA 1YRPA 3F7ZA 1V0BA 3PE1A 2R0UA 3R73A 3WOWA 4EH4A 4L7FA 5J8IA 3II5A 4UALA 4Y5HA 5IA4A 3MPTA 3B2TA 5KKRC 3LLAA 4WNPA 3VJNA 4EJNA 3R1QA 4RJ4A 4MVFA 2W4OA 1Y6BA 3W2CA 5HORA 3C4EA 5K0KA 3PVUA 2QOOA 1PYXA 3QRJA 5DFPA 5LARA 3COHA 5JZNA 4F4PA 3MY5A 3W2RA 2BHHA 3AC1A 3F6XA 3FZSA 3KULA 4E8AA 4FSYA 4GIIA 3RHKA 4M8TA 4YMJA 4IVDA 4ZTHA 4YR8A 2JAVA 2ZV8A 4FKRA 4JMQA 4U81A 2PVJA 1OKYA 4J53A 3VC4A 3MGYA 4HPTE 1BI8A 4HGSA 5A46A 4C4JA 5FUTA 1SYKA 4ZY4A 3W0OA 4J96A 4XV3A 4E1ZA 5EQPA 4FF8A 5J9YA 2WMRA 3PXKA 3A7GA 3NNXA 4JNWA 3ODZX 3VO3A 2UZEA 4V0GA 3PXQA 3BX5A 2JBPA 2BPMA 2UZNA 3OCBA 4YNEA 4JIKA 3L8PA 4R5SA 3PZHA 2PL0A 3NIZA 5EOBA 4ZTLA 1OL7A 2OICA 4QMMA 2YA9A 3E8NA 5E8SA 3ZM9A 5GHVA 5HLNA 4IJ9A 4DEBA 4FSWA 5KUPA 2PZPA 2PVKA 3HEGA 1YHWA 4JR3A 2GFSA 1OL1A 4ZJJA 3F9NA 3WZEA 4DLJA 3TKIA 4XUFA 1WBWA 3R71A 2C6LA 3P4KA 3Q32A 5CI7A 5AV2A 3HL7A 3UIMA 1ZMVA 3SGCA 3CPBA 3QHRA 5IUGA 2Y6MA 3FBVA 3GGFA 3KRLA 3PZEA 5DVRA 2J0KA 1R0PA 2O65A 4PNIA 2WQOA 5KMJA 4BGGA 3TYKA 3PVGA 5BVWA 2HZ4A 3FC1X 1OL6A 4GIHA 4IZ5A 5FGKA 5L3AA 3RNIA 1LUFA 4FV3A 4E4XA 5E8YA 4PUZA 2PVLA 2Y8OA 1OIUA 3NDMA 1Q97A 3TNPC 2YITA 2ONLA 3QQUA 2ZOQA 4EUTA 4DE4A 3FSKA 4YJVA 3Q96A 4BBEA 4BZDA 4F08A 5IDNA 5IDPA 2BALA 2C3IB 4JDJA 1DI9A 4E6QA 4F70A 1SVEA 3E8EA 3FC2A 4UEUA 5JRQA 4GU6A 2E9UA 2A2AA 1CKPA 2VTNA 3I7CA 5AM6A 3L9LA 4RWLA 4C4GA 4BTKA 1OVEA 2VD5A 2QQ7A 4Q2AA 4QPMA 1JQHA 4IZAA 4H36A 4NKAA 5AUUA 4FTMA 2IVVA 4CFWA 5CZIA 2PPQA 4O27B 3E5AA 4X2JA 3UC3A 4HNIA 4MXXA 2G2HA 1OPJA 5EFQA 1K3AA 3QHWA 3FMMA 4XRJA 5CF8A 1P4FA 5EM7A 4HVIA 2OZOA 3I5ZA 3Q6UA 4D2PA 5CU0A 4D9TA 4R7IA 5E8UA 4ZLOA 2C69A 4DINA 2BCJA 3DFAA 2WTVA 2X2MA 4LG4A 5CQUA 1UU3A 2XK3A 4O0XA 4H58A 4AT4A 5CAVA 3F7WA 5E8WA 5IA3A 3HUCA 3RAHA 3QRIA 2B0QA 1QMZA 1W84A 1ZOGA 4H39A 2XK9A 4QYGA 3AC3A 2R3OA 5M08A 1E1XA 4M14A 5AUZA 5DHJA 4XMOA 5EW8A 3V01A 3V8TA 1W98A 4LUEA 1O6YA 4U43A 5GJDA 2ONLC 4G3EA 4A7CA 4BBMA 3G33A 4F0FA 1BL7A 3COKA 3FI3A 2WOTA 3F3TA 3QTWA 4CFUA 5AP2A 5DBXA 3QCYA 3QUEA 3IONA 4P5QA 3EN6A 3QRKA 3LXPA 2C6MA 2GMXA 2JKOA 3VONA 4LMUA 4RJ5A 1U5RA 3I79A 2VU3A 4U97A 5LVLA 4C33A 1PRYA 2UW5A 4EOOA 3POZA 3VUDA 2CHLA 5KMKA 4JRVA 5L2WA 3FMKA 4PL5A 3HECA 3PA4A 4RIXA 2V62A 1PMNA 3FMJA 4RZWA 2UW3A 3V5LA 3BHUA 2Z7RA 4WOVA 4FEWA 2ESMA 3RHXA 4DEDA 4UYNA 2XARA 1YKRA 4APPA 4E4NA 4IX3A 5HIBA 4FIGA 4XH6A 3R7UA 4YJOA 4RZVA 3IDBA 3U6IA 3Q9YA 3O7LB 1CKIA 4BICA 1NVRA 2QOQA 4IBMA 5CAPA 3KXXA 5L2SA 1RE8A 4FZDB 3UIBA 4FV5A 1H08A 3E3BX 4OBPA 3B8RA 5IQFA 2C6KA 3HMOA 2H6DA 2CSNA 2VWWA 3IW6A 3R02A 4PL4A 4QP7A 3TWJA 4QP6A 4A06A 4XLVA 4OTHA 4UMTA 2G1TA 1YXXA 3OXZA 4I41A 3RPOA 3TV7A 4FT5A 4H3QA 2PUUA 5IH4A 2REIA 3SQQA 5FWKK 2ITWA 1KUTA 2X8IA 1Q99A 4L46A 3ZSIA 4Z7GA 1OIYA 1T46A 4GS6A 4I23A 2FSLX 5DOSA 2QHMA 3D5WA 3OXTA 1REKA 2G01A 3VUIA 4B8LA 2YCRA 3IDCA 4GG7A 3RPRA 3TZ8A 4E6CA 3TDVA 2B52A 5E92A 5CEQA 4PRJA 4ACHA 4IQ6A 4GEOA 2X0QA 3POOA 4B8MA 2XKDA 3R7VA 3U9NA 3BHYA 3ACKA 3ROCA 3CKXA 3NUUA 1OKZA 4B99A 4D2RA 3BGZA 2F4JA 3OP5A 3DBQA 4G9RA 3BGPA 4XG2A 5FP5A 2OJJA 4JR7A 2QODA 5EHYA 4YHJA 5J95A 3BQRA 3MFTA 5ANKA 2B9FA 1H24A 2C3KA 4BN1A 5EDQA 2RFNA 4DDGA 5GINE 5F4NA 5KZ0A 2JDRA 3ZCLA 5AR5A 2IVTA 1OECA 2PZRA 4EOPA 4EK8A 3LAUA 2HXLA 2QU5A 4LV8A 3WBLA 4A9RA 5HG7A 2W1ZA 3SW4A 4JXFA 1Q8YA 1VYWA 2YABA 3NYVA 3ETAA 5FTGA 3QKMA 3WZKA 3WZDA 4E6AA 4LI5A 1LPUA 4J52A 3FXWA 3MB7A 2AUHA 5JQ5A 3JR1A 5E91A 3SHEA 4FJVA 4YC3A 4KSPA 3NAXA 3ZRKA 4JT3A 4EYMA 2BAKA 4FTCA 3TL8A 3ZO4A 5CF4A 1CSNA 2YM3A 2WMTA 3O96A 4RC4A 1CDKA 3R01A 3BI6A 4FZ6A 3OVVA 3PA5A 3HP2A 3FKNA 3DBEA 4O4CA 2B53A 1DAWA 3H9RA 4RC3A 4DAWA 4O7RA 4RWKA 1Z5MA 1CTPE 3KREA 4EWHA 3A7FA 2VTTA 3LM0A 3LMGA 4HYHA 3AGMA 2YAKA 3ZXZA 4AACA 4KB8A 2YAAA 3D5UA 2FSMX 3CD3A 4XOZA 4QMLA 4EORA 3NW6A 2PE2A 4GUBA 1PW2A 3FXZA 5ACKA 4FIIA 4GUEA 3ORZA 3W2SA 1OZ1A 3UQCA 1UA2A 4XHKB 4QP3A 3NCGA 4TWCA 4IM0A 4RVKA 2J2IB 2GHMA 5HNIX 2VWXA 3BL9A 1U59A 2GNLA 2XJ1A 3ZUVA 4GK3A 3N9XA 3DFCB 3PXYA 3FMHA 4PP7A 3NUSA 4Y73A 4D4YA 2X39A 1NXKA 3UG1A 1XH8A 3N51A 3DOGA 1XH6A 2YM7A 5IQDA 2H9VA 2EXCX 1PXOA 3R2BA 4E20A 4FTTA 2PUPA 3TACA 5TT7A 4LGHA 3FZ1A 2OJGA 4M97A 4ONAA 4UXQA 2XRUA 4WRSA 4YO4A 4NT4A 3NFFB 4IX4A 3RZBA 5J1VA 4PTEA 2UZDA 4FV8A 1STCE 5A9UA 4NW5A 3K3JA 5KMOA 4M68A 4MBIA 3HDMA 2WD1A 4C3RA 2XZSA 4GKHA 4I6LA 3QQHA 1DAYA 4O7YA 2BRBA 2XCKA 5HI2A 5IUIA 1YXUA 4PDSA 3MY1A 4NU1A 3LCSA 4QD6A 4FVRA 3UNZA 4AZWA 4BTJA 3FMDA 2YACA 3LFFA 5IA0A 1J7UA 3W33A 4I6BA