4DH5A

Room temperature x-ray structure of camp dependent protein kinase a catalytic subunit with high mg2+, adp, phosphate, and ip20
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
333
Chain Sequence
b'VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Low- and room-temperature X-ray structures of protein kinase A ternary complexes shed new light on its activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dh5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dh5A02
4N4SA 2QKWB 3C0IA 4BCOA 2FSTX 4FKQA 4HNIA 5DEWA 5A9UA 2J50A 4OT5A 3M11A 4MH7A 5HBHA 5JZNA 3UODA 5AP2A 2NNWB 3EQFA 2QHMA 3E64A 3ATTA 1JKSA 5FRIA 5FP5A 3ZO3A 4AUAA 5M4IA 4KKHA 5LCKA 3ZBXA 4KNBA 3NEWA 4PP9A 3UP7A 4NW6A 5E92A 4I4FA 1OIQA 2OICA 3QQFA 4KWPA 5H8BA 3SW4A 4BGGA 5A4CA 3ZCLA 2C30A 3FMDA 2UVZA 2ACXA 5M06A 1YI6A 4YU2A 3P7AA 4YBKA 3QKLA 4OBQA 1ZWSA 4O1PA 4PMSA 4E6DA 3QWJA 2W1DA 3DKFA 3QKMA 5FM3A 3SD0A 3Q96A 3EFJA 2R3RA 2FYSA 1RDQE 4EH3A 3HGKA 4D58A 5M4FA 3LFDA 3ZFYA 4DG2E 4H3QA 2XYNA 2OZOA 2XA4A 4AZSA 3ROCA 5FLFA 3R0TA 3I79A 2VTJA 2RL5A 4EH7A 3ZOSA 2CJMA 4UYAA 2HZ4A 2YHVA 4DITA 4IE9A 3OT3A 2QOOA 4O84A 1OI9A 5DMZA 3KA0A 3OTVA 4FKSA 3SX9A 4E5BA 5IKWA 4IX4A 2C0TA 3QZIA 3A99A 3VHEA 2FGIA 2A19B 4P2KA 5KHWA 3UIUA 3SG8A 1OM1A 3CBLA 3PTGA 4BGQA 3E3PA 5DT0A 3H30A 3BYUA 3O2MA 2X0GA 2ITVA 3R7EA 4F7LA 2GFCA 3NUSA 4ZMEA 5IMEA 1B39A 4I24A 4JAJA 4U6RA 5IQEA 3C4FA 4AZWA 3Q6UA 3HV6A 4FOCA 5J9LA 3AOXA 1VZOA 4HZRA 4K8AA 3TWJA 4FKPA 4I3ZA 2VX3A 4XRLA 4FTTA 1U54B 4XLIA 5JRQA 4MXYA 4JBVA 2HZIA 5CU2A 3L9MA 3RPRA 4H1JA 4OTWA 3PA4A 2PE1A 3KRRA 4EONA 1SNXA 3R71A 4XUFA 1PXKA 2YIXA 4MHAA 2AC3A 2BKZA 3NUAA 4K0YA 3VUTA 4E3CA 3QC4A 4O81A 3BHYA 4XV2A 3ZZEA 3DLSA 2UW5A 3LMGA 1OKYA 4Z7GA 5EW3A 3QRIA 2W99B 1KSWA 3OC1A 2UZWE 2XF0A 4BZNA 1DS5A 5EQPA 3FY0A 3MH0A 1WBPA 2Y0AA 3LFFA 3ZFXA 2F7EE 4IAYA 4J96A 2VD5A 2XJ0A 3C4XA 4G3FA 4UWBA 4XRJA 5IG1A 4XJ0A 3LCDA 4GH2A 5HCZA 3BYVA 4I94A 5TO8A 4FKVA 3FI8A 4DF3A 3UZRA 5AV2A 3IDCA 3QCYA 3FZRA 5A3XA 5I9XA 3R7VA 1KOBA 4QMPA 4FYNA 2I7QA 3K3IA 5ETCA 3LLTA 4PDSA 2E2BA 2JAMA 3POOA 2W06A 4L45A 3P9JA 3KULB 3PIZA 5EDPA 3TV6A 1M2RA 3A7JA 2Y8OA 3QGYA 4KKGA 2J5FA 5C8KA 5KCVA 5AP0A 3ZSGA 4JDKA 2RG5A 4YC6A 4WG3A 2WTKC 3ZHPC 3TZ9A 1JNKA 5AAFA 2CMWA 3U9CA 2XK3A 2ZMDA 4ALVA 4EHZA 4PP7A 4D2RA 5CVGA 5CSPA 3LFEA 2O65A 4IFGA 4P5QA 4PMTA 4I22A 1OL1A 3QRUA 2R3JA 1Q99A 2BZKB 3MY5A 3PA5A 5EYKA 3LMIA 4CT2A 4R5YA 4X3FB 4O0RA 5IH5A 4QNYA 4CRSA 4GKIA 1WBNA 4DTBA 3KMWA 5HNBA 3DQXA 4XEYA 3AC8A 5CEPA 2OH4A 3VW6A 2G2FA 2P0CA 3QQGA 4I6HA 4KB8A 3FMNA 3A60A 3DU8A 4JT3A 4L3JA 4FSWA 1H0WA 3UMWA 1OL5A 5IUHA 5HU3A 3MVLA 3MJ1A 3UTOA 4Y73A 4LRKA 4FKGA 2G2HA 5KMOA 1LP4A 1H08A 3PG1A 4YZMA 2B52A 3V8TA 5FG8A 4E7WA 2NP8A 4DFZE 4RX7A 2RF9A 4L52A 4YJNA 3AC2A 4O6EA 2YDIA 4DYMA 2GHMA 3SLSA 4D2VA 5M51A 5HIBA 2XIYA 4AU8A 3ACJA 3ZTXA 2PMLX 3PP1A 4HGSA 3H10A 4HYIA 1YXSA 5DT3A 3HKOA 3QXPA 4CFVA 3C4CA 3Q5ZA 4WBBB 3F9NA 2F4JA 2EWAA 5GJGA 4F9BA 4JRVA 3W1FA 3HV7A 4AT4A 4CFMA 2UW3A 4OW8A 2HZNA 3OOMA 3MESA 3BU6A 4BVUA 2V0DA 2Y6MA 3GCSA 3QUDA 4ANNA 2GNGA 5E1SA 3U4WA 3PXYA 1ZMWA 1O6YA 5IA4A 4AZTA 1OMWA 3IW6A 3RM6A 4V04A 3VBQA 1UNHA 5J79A 3W33A 4JQEA 3D94A 1CTPE 1QPEA 2YJRA 5EI2A 5EYCA 3RKBA 4HGEA 2VTLA 5LWNA 5IEXA 4BF2A 3CY2A 2X4ZA 4XYFA 2CN8A 4O82A 1CKJA 2I0YA 2QHNA 4YBJA 5HG9A 5CWZA 4BCQA 4OTDA 4CRLA 4CGAA 1JAMA 3OZ6A 5J87A 3W18A 5I9VA 3OCSA 2BPMA 3PWDA 1Y91A 3GCQA 4HCUA 4J53A 4XX9A 4QYFA 3EFKA 2XKEA 2R3PA 3CE3A 2WQBA 4ASXA 1O6KA 5LMBA 2ITXA 4ALUA 2WTWA 3R2BA 4TRLA 3F69A 1H1PA 3F6XA 5EHLA 2ETRA 2R5TA 3G9LX 3FBVA 4CYIA 4EOKA 4PMMA 3TIYA 3FMMA 1KV1A 4PL5A 4CFWA 4J99A 5CAOA 2WMTA 5CF5A 1Q8TA 4RRVA 2WMRA 5I3OA 4NL0A 3GC8A 3HVCA 4WSYA 2PTKA 3P86A 2YDKA 3KGAA 1SMHA 1H1SA 3BEAA 3O96A 4QQJA 4XG3A 4ZEGA 3UP2A 3THBA 2GNFA 4FNZA 3G6GA 2WIHA 2P55A 2XJ1A 4X2NA 4OLIA 2JDSA 4GYIA 4I20A 3R8ZA 3V5JA 3TNWA 1WFCA 3BQRA 1BI7A 3KFAA 4CZUA 4UMRA 2VO0A 4RWLA 3VRZA 4AQCA 3D83A 4L3LA 5JQ8A 2BR1A 3D15A 2YM3A 5D10A 3R1SA 2C6TA 4H36A 3N4UA 4E93A 5AUVA 4F1MA 3RPYA 3NYVA 4YGAA 4U3ZA 3D5XA 4ANLA 4L01A 4EKKA 2E9UA 3NGAA 5C27A 4IQ6A 4RJ6A 3B2WA 3F3UA 4MD9E 3NW6A 4I0SA 3OCTA 3QUPA 3ZC5A 4XG4A 4B9DA 5IZFA 4BDJA 5AWMA 3PJ8A 5AR8A 2WQOA 2ZJWA 3EWHA 4YLJA 4YZBA 4FL2A 4NIFA 3VN9A 3AMYA 2C47A 3QCQA 3HRFA 4GT5A 4U97A 3IG7A 1EH4A 4FTKA 4IZAA 1H1QA 4JBOA 2QOCA 3PRIA 2Y6OA 4J95A 4ZJIA 3MFRA 5KMIA 1V0PA 4KUJA 4D2PA 4ANMA 2GCDA 1FVRA 4FTCA 5DFPA 2QODA 4I5PA 2XK4A 2Z2WA 3AGMA 3CLYA 4FVQA 3TTIA 4HW7A 3BGQA 4KABA 3TM0A 1KE6A 5JEBA 2PVHA 4TW9A 5J9YA 1XH7A 4G3EA 3TT0A 4N6ZA 5ETIA 3NIEA 3KMMA 3RK7A 4D2WA 3ZUVA 4TZRA 5JN2A 2LGCA 2VRXA 2E9VA 3TN8A 2WTIA 4B7TA 4GT4A 4ANOA 4GVAA 3ANRA 5ANEA 3GCVA 3HP2A 4TTHB 4F6WA 2DQ7X 4QMVA 3BWFA 2XKCA 1A06A 1OITA 4YZNA 2YCQA 5LVNA 2X7OA 1NT2A 1L8TA 5M56A 5DR6A 4CMUA 3FZ1A 3C4WA 2QQ7A 2XYUA 5C01A 4FKIA 4PDOA 3QUEA 2PMIA 4M13A 3WIGA 4D4RA 2IG7A 4O7SA 4MBIA 3NLBA 4H1MA 3AT4A 1PRYA 4U42A 3W10A 2R0UA 4IADA 4YO6A 3KRXA 4M0ZA 3L1SA 5I9YA 2P2HA 5L3AA 4NFNA 3R7IA 5D41A 2W05A 1YHVA 4EHGA 3UNZA 3CCNA 2JFLA 5DR2A 4YMJA 4C4GA 2OGVA 2VWIA 3SXSA 2BFXA 4DBNA 4HGTA 4APCA 3QGWA 3UZTA 3BI6A 3KF4A 3S2PA 5ETFA 3OF0A 4WRSA 1NA7A 4FV7A 1NW1A 2EB3A 3I1AA 4IAZA 3R9NA 2UW7A 4FEUA 2UZOA 4WNMA 1Q24A 4DFBA 2CLQA 3C9WA 3RCDA 4NCTC 3W2RA 5AUUA 1J7UA 3WOWA 4FG7A 5HD7A 4FT0A 2WMVA 4IDVA 4UZDA 4RLKA 4UYNA 5CEIA 3VAPA 4FK3A 1T45A 2B1PA 5DBXA 4P7EA 5A4TA 2VTSA 5DYJA 3NNUA 4CD0A 4EWHA 4NJ3A 4KINA 3VULA 4A9SA 3SW7A 1YWVA 2IVUA 2G9XA 4MXOA 3V51A 4AGDA 3C7QA 3MV5A 4GYGA 1OGUA 3DK6A 3NIZA 3QLGA 5EYMA 3GGFA 2QONA 1H25A 2ITTA 1ZOEA 3GB2A 3MH3A 3O23A 4PPBA 5HE2A 2E9PA 3TNIA 3T9TA 4CZTA 3GP0A 5DE2A 5AUTA 4CFNA 3JS2A 3MY0A 4RWKA 3NUNA 3WF9A 3FMKA 1XH6A 1XH9A 1WBWA 4BCMA 5FGKA 4ASDA 3ORLA 2PULA 4JI9A 4QNAA 1E9HA 1STCE 4BCKA 1GIHA 3DB6A 5EFQA 2WNTA 2PZIA 3GEQA 1P2AA 4C3RA 3GC7A 2R7BA 5IA5A 1YOLA 3D4QA 5DA3A 4AG8A 4BWPA 3UIXA 4AN9A 1GZ8A 4D9TA 5KKRC 3TL8A 4OBPA 4LM5A 5E8ZA 3BHTA 3JY0A 5DG5A 4ANQA 3PJCA 2BALA 5EW8A 2ZVAA 3TKHA 2OBJA 3U87A 4IEBA 1OBGA 2A4LA 2CDZA 4GMYA 4GU9A 4OTRA 3ZZWA 3NYNA 1F3MC 3TUBA 5EDRA 4EKLA 5AR4A 4G5JA 4F6SA 3PZHA 3LZBA 4YHFA 4FV0A 2V62A 5DT4A 2GNJA 2YZAA 4YSMA 5E1EA 3S00A 3R1NA 2A1AB 3S1HA 4L43A 5HG7A 4DG0E 2PWLA 5EK7A 4BCGA 3FKNA 2GSFA 4M84A 4E5AX 4U7ZA 1XH4A 4FTLA 3BX5A 4DGOA 5FQDC 1R78A 2H9VA 3C51A 4WRGA 4FT3A 5IUIA 3VC4A 4AGUA 5EOBA 5FXSA 4LFIA 3R8MA 4BTKA 5BQ0A 1WVXA 2HZ0A 2HWPA 3KRLA 4C4IA 3QKKA 4FKWA 2C6OA 4AE6A 2R3LA 3EQIA 4DE4A 1UKIA 2HXLA 4IM2A 5KMLA 1G8SA 3Q9XA 4LG4A 4G17A 4FG9A 4AFJA 4Q5EA 2ONLC 5L8LA 1I09A 3VUGA 3VS0A 2WMXA 3LLAA 2WTVA 1OL7A 4JDHA 4CT1A 5DH3A 3HRCA 5CVFA 1OKVA 3DZOA 4EUUA 4QTCA 3O50A 4YPDA 4RC4A 4I5MA 2W1IA 4CKJA 2XM8A 3REPA 1KE5A 3L8XA 3QQUA 1JKLA 5DNRA 1YWNA 4DH8A 3Q5IA 4C4EA 4I6FA 3QF9A 4FKJA 4B99A 4C2VA 4QP1A 3UO5A 1Y6BA 3CIKA 4ENXA 4FGBA 4D5HA 3OBJA 3F66A 1U46A 4M3QA 4G6OA 1NVRA 5HX6A 1H00A 2YIRA 3HMNA 2PMOX 4YR8A 2YWPA 2UZTA 4V0GA 4G3CA 1P5EA 1ZARA 2WEIA 3PXZA 4AF3A 2GTNA 3LKMA 4XCUA 4TT7A 5EQYA 1S9JA 3DNEA 2HELA 3ZLWA 4FIJA 2Z60A 4MAOA 4D1SA 1BMKA 4FTUA 2R9SA 2BDWA 4OGRA 1J7IA 3KQ7A 1PXOA 1UU7A 4DAWA 2QOLA 4M14A 1P4OA 4TWPA 4EC9A 4DH7A 4PX6A 2FVDA 5DI1A 2JKMA 5JFXA 1PXNA 4JR3A 3FQHA 3MVMA 3HP5A 3VQUA 2W1GA 3PY3A 4JL9A 4LMNA 5JFWA 1SZMA 5AIRA 3EL7A 1OECA 3G5DA 2AC5A 3KF7A 1WVYA 5CU6A 2J51A 3VS2A 5AP3A 4EK5A 4F09A 5IQHA 2V22A 5DLSA 2XNEA 4UWCA 4GT3A 5I3RA 2IVVA 3ITZA 4UXQA 5IISA 1YOMA 3V5PA 3IOPA 5E4HA 2OU7A 4GG7A 5EHYA 5K0KA 1OPJA 3QQHA 5EOLA 3LIJA 3PY0A 3MDYA 4FIHA 3DOGA 3Q9YA 4IAKA 2PL0A 3FV8A 1UWHA 1RJBA 1IA9A 1Z9XA 5EI8A 2GFSA 4CQGA 5CEKA 5HOAA 2VTNA 3R1YA 3VF9A 3CQUA 1T46A 5FXRA 4IZ5A 2XEYA 1YI4A 2DWBA 4LI5A 5G1XA 2OZAB 3JYAA 2C3KA 4PRJA 4QYYA 3TDWA 4J71A 2UW0A 2BFYA 3R7GA 1XJDA 5AM6A 3DBQA 4I92A 4P4CA 3TNPC 3ELJA 5CVHA 2XH5A 4H39A 4ERKA 1K3AA 4L8MA 3I60A 4D4SA 2HCKA 3EQDA 5BPYA 3NNXA 3G9NA 4JNWA 4A07A 3RPVA 2ZDUA 3QAME 4YZ9A 3DDPA 5IF1A 4YTCA 3GQLA 3RK5A 5ACKA 5M57A 3LW0A 4UWYA 2VNWA 1BKXA 3OVVA 4FZDB 4BDHA 4QMYA 1Q62A 3A8XA 3Q4ZA 2YAKA 3VRYA 2JITA 3GU7A 2B0QA 2J0KA 4FIFA 3MS9A 1YDRE 5F20A 4HPUE 5JGBA 5CF6A 3QTXA 2C5XA 4OR5A 5CNNA 4LV8A 1OUKA 4PNIA 4EH9A 3BYMA 3OEZA 3ZUUA 1XKKA 3DCVA 5J7HA 5DPVA 1PF8A 2HOGA 4HCVA 4IWOA 4WNKA 3UC4A 2VAGA 4FL1A 3LAUA 4HJOA 4D4VA 4E8AA 4TXCA 3ZFMA 4KSQA 4WT6A 1Q8WA 4CTCA 4C4JA 5J5SA 4F9CA 1R39A 4F70A 3HA8A 5JT2A 2YABA 5CS6A 4N57A 2PZRA 4EYJA 5CANA 3F88A 2E9OA 1BLXA 3E87A 4BGHA 3F3VA 4UX9A 3RWQA 5EHOA 4QYGA 3FC1X 2WOTA 2HK5A 1BX6A 4M68A 3LMHA 3N4TA 2XB7A 3Q2MA 2J0IA 3CR0A 4N0SA 1OB3A 3E88A 4NW5A 1UV5A 1E1XA 4D5KA 4EQCA 1DM2A 3LFNA 5HHWA 5LXMA 5F95A 4CKRA 1MRUA 4GUBA 2CCHA 2WEVA 4EBWA 2JBPA 4YP8A 3Q4CA 4KIKA 5A6OA 3ORTA 3QX2A 2XNOA 4YJRA 2VNYA 4B8LA 2CHLA 4GRBA 5J9ZA 1FPUA 1Q8ZA 4GV1A 5AA8A 4MEDA 2BTRA 4QMWA 5AX3A 3R9HA 3FE3A 4AS0A 4FTAA 5CASA 5EM7A 3Q9WA 2H6DA 1CDKA 1KE9A 3ZEWA 2G1TA 3EJ1A 3NUYA 3ZC6A 4PY1A 4CFFA 1GOLA 1ZZ2A 5D12A 4XBRA 4LYNA 5KMNA 4OAVB 5L2TA 1MQBA 2Y7JA 3GOPA 2VWWA 5ANOA 5JRSA 4DHFA 3U6IA 3G15A 4TYJA 5FTGA 4CLJA 3WE4A 4GG5A 1SM2A 4FIGA 2QVSE 3D7TB 3R2YA 4UEUA 3DBFA 2B9JA 4OAUC 1L3RE 4C61A 4U3YA 5LMKC 4D0XA 4D2TA 3WILA 3DAEA 3BHHA 4X2JA 4EBVA 3QD0A 5I9UA 4W8EA 5GIOE 4O38A 4BL1A 1AQ1A 3QCXA 5AV1A 1PY5A 2UZLA 4LUEA 3ID6C 5M07A 5L4QA 2ITOA 4Y5QA 2JDOA 3EB0A 4F9WA 5M44A 4DH3A 1PMNA 4ZXTA 4IM0A 4CEGA 3COIA 1PW2A 5AV3A 3UVPA 2GMXA 3LM0A 4XV1A 3MWUA 5C8MA 3FKOA 4O86A 2FO0A 4FV9A 1H0VA 3KY2A 3DB8A 5HNGA 5B2KA 3EN6A 4BDDA 2JEDA 5HO6A 5HLWA 2W9ZB 3MTLA 2PE0A 3F2NA 4YJOA 2W7XA 4LOOA 3C0HA 3I7CA 4ZTLA 2P4IA 4OTGA 3FWQA 4XOYA 5IEVA 4TKSA 3BIZA 3EKNA 4FE2A 3UOHA 3PJ1A 1U5QA 1P4FA 1UNLA 4Q2AA 4BFMA 3BYSA 1IASA 2HY81 4NCTA 4IVBA 4U79A 4MBLA 2W1EA 4F9YA 4FKTA 3KKVA 4U9AA 2J2IB 4ZS4A 5H3QA 5TF9A 3QLFA 1R1WA 1JWHA 1ZLTA 5BVEA 3UG1A 4H3BA 4FGRA 4QMQA 3F5XA 3IK3A 2WQNA 3HMMA 3QQKA 4QMOA 5CYIA 4EOMA 3E8DA 1R3CA 2QR8A 2C5YA 3DZQA 3U9NA 4EC8A 2RGPA 5FTQA 1YI3A 3EZRA 2F2UA 3D2IA 3K5VA 2YM4A 1TKIA 3OUKA 3KXGA 3QD4A 4WIHA 4CLIA 4FTNA 4U43A 3P5KA 4QOXA 4ITHA 4EH4A 3RAIA 3DXQA 1XQZA 3C50A 3DFCB 1YXXA 1H4LA 3C0GA 4M69A 4XHKB 3IQ7A 3R9OA 5A4QA 4HVSA 4IVCA 5DHJA 2BRNA 4ZLOA 4RIOA 3W8QA 3R8PA 4F63A 3KEXA 2GHLA 1H8FA 1DI8A 4GIHA 1IR3A 2O3PA 3K2LA 2R0IA 2PK9A 2OFVA 3MYGA 4EHEA 3PPZA 5LCJA 3FLSA 4E5WA 2GU8A 5BUEA 3RPOA 2Z8CA 3BHVA 2PZ5A 5ITAA 4RSSA 5L6WL 2XJ2A 3COKA 4MQ2A 1ZRZA 4DFUA 3OEFX 2FSOX 4ACHA 4RFMA 5F9EA 1PMVA 4FTQA 4JG8A 1Q8UA 3R7YA 1REJA 4RIWA 1RE8A 4U40A 3ZO1A 4CFXA 2HWOA 3DJ6A 3L8VA 4NM5A 3GCUA 4WKQA 1WCCA 5AR5A 3NUUA 4CFUA 4TYEA 4PWNA 5IH4A 3RZFA 1CMKE 4DEGA 5LVOA 4RLLA 4X7QA 5FBNC 5CSWA 5DIAA 5FP6A 2CKEA 2GS6A 3BCEA 1Z5MA 4I4EA 4AE9A 4ZMFA 4OTIA 3PLAE 1ZMVA 4JQ7A 4ARKA 3SXRA 2ITZA 4BY9E 2A27A 4O7WA 4IB0A 4YJQA 4CVAA 1ZYCA 2WXVA 2OO8X 4GK2A 2BVAA 4A06A 4C7TA 2QKRA 4ZSJA 3CTQA 4KBAA 3OROA 3MPAA 4A9TA 5IEYA 3KREA 3C13A 3TKIA 2ONLA 2PVYA 2YLEA 3R30A 3L8PA 4X2GA 3ZDIA 4USFA 3CSVA 2X7FA 2RFEA 5E8SA 5BNJA 3SV0A 4YJTA 2VTAA 3JUHA 1Q3DA 2QOKA 2YCFA 5F94A 3KMUA 5CEQA 4Z7HA 4EJNA 1APME 5J95A 4NKSA 3Q9ZA 4QMNA 1NXKA 2XUUA 3WZDA 2BRHA 4ZTNA 4QP9A 3GUBA 1ZXEA 3EQHA 4EH5A 5LVPA 1KE8A 3HMIA 3AC4A 3K5UA 3UJGA 4A9RA 4GS6A 2O0UA 3FKLA 4CKIA 3L9PA 4GEOA 1W98A 3Q2JA 3COMA 2DUVA 5EKNA 2IZSA 3OFMA 4L67A 1FOTA 3BV2A 3HMOA 4DGMA 5CSVA 5EI6A 3OP5A 2J9MA 4XOZA 4D0WA 4E4NA 2ESMA 2VTPA 3ERKA 4NM0A 4BRXA 1FMKA 5KO1A 4FX3A 2YIQA 4APPA 4H58A 1PHKA 4EWQA 3A62A 5CU4A 2PPQA 1MRVA 1NVQA 2J0MB 2W9FB 4BTFA 1JSTA 4M7IA 4ZZOA 2HAKA 1IA8A 3GT8A 3TKUA 2ITYA 4JIKA 5A54A 2YAAA 3FLNC 3I0OA 2X2MA 4XG9A 5H8GA 3AC3A 4BYJA 3MFUA 4BZOA 4EQUA 1CKPA 3DDQA 3QU0A 2AYPA 3RM7A 3FPMA 4FEQA 5CU0A 1FBNA 2QI8A 2X8EA 4TYGA 3T3UA 3ZSHA 4AP7A 1YHSA 2NRYA 5IPJA 4HVGA 4O7TA 2IJMA 1IEPA 2X8DA 3KN6A 4J97A 1A9UA 3FZTA 2GS2A 3C1XA 4UMQA 5CU3A 2W1FA 2SRCA 2XP2A 4XG6A 4AOIA 4BBFA 4OTQA 4D2SA 5IA2A 3PVUA 3V5LA 4K1BA 3LCOA 3OW3A 2REIA 2VTMA 3BEGA 3GI3A 1R0EA 4Y5HA 4ACGA 4AXAA 3FPQA 2UV2A 5ICPA 3S0OA 3O0GA 3OXTA 5TR6A 5GIPE 3DBCA 4FKRA 4O21A 3N9XA 3PZEA 4RIYA 3VJOA 1WBTA 4QQTA 5JFVA 4U8ZA 4BCIA 2WTKB 3Q32A 2HY0A 2XRUA 1MUOA 2I6LA 4N6YA 2C5VA 3IDBA 4PL4A 3TZ7A 3V5QA 4RFYA 4CTBA 3I5ZA 4HVDA 2GNHA 1CSNA 4FVRA 4O7RA 4E1ZA 4L6QA 4R1VA 4TY1A 5FEQA 1ND4A 2QNJA 4CG8A 4RA4A 5DWRA 2EXMA 4O0TA 1B6CB 2O5KA 2RSVA 4IC7A 3RPSA 5HIEA 3ALNA 3BWJA 3MH1A 5CY3A 1H01A 3QHWA 4QMSA 4IBMA 4ZZMA 4U0IA 4KBKA 4MNEA 5JSMA 1ATPE 3VBYA 3QTZA 2ZDTA 3DLZA 4C3PA 4XP3A 1M52A 4FTJA 3BKBA 3LJ2A 2IZRA 4YPSA 3KXMA 3R7UA 3Q52A 2BUJA 1UU3A 1OL6A 3G0EA 3JPVA 3WYYA 4EUTA 2YM8A 3QCSA 4JOAA 4QP2A 4C35A 4ERWA 2F7XE 3E3BX 2FSMX 4XP0A 3SRVA 4V0GB 4YC3A 4BDCA 3OHTA 4X2KA 5L2WA 1IAHA 4ZK5A 4IC8A 4E6CA 2BHHA 4CMTA 3OXIA 4GUEA 2Z7SA 4R7HA 3ENHA 4MD7E 4AZEA 4EOJA 4ALWA 2F49A 4ZSGA 2VWXA 3KVWA 1AD5A 3ETAA 3R8UA 3TIZA 1X8BA 4X3JA 3V5TA 4S33A 4ANBA 4S2ZA 1GNGA 4BIBA 2NPQA 4UMTA 4LMUA 3H9OA 2OIBA 2WMAA 3FZSA 4ZIMA 2YITA 1LUFA 4RMZA 3MJ2A 1IAJA 5LVLA 3V04A 3COHA 4IJPA 3FZOA 3ORPA 4FF8A 3E63A 5A6NA 1CM8A 3OBGA 3F2AA 3SOCA 2X6DA 3EZVA 4IVDA 3LCTA 2VTTA 5DN3A 2EU9A 3S4QA 3V6RA 4BICA 4YSJA 4WO5A 2QO7A 3LFQA 5D11A 3FSFA 3KXNA 4MTAA 4RBLA 3RINA 4C0TA 2GQGA 2OXYA 4W4WA 4AN3A 3A61A 4USDA 5CENA 2CKOA 3ZYAA 2BAQA 2VTOA 3EH9A 3HDNA 4RJ4A 2WMWA 2EXCX 5B0XA 2OF4A 2C1AA 3EN7A 4BIDA 4YC8A 4BI0A 3FYJX 4GJ3A 3G2FA 5ANDA 4GK4A 4PL3A 3VO3A 3MH2A 2YEXA 3NCGA 1OL2A 3ZONA 1OIYA 1XH5A 2A0CX 3IW8A 3QBNA 5HG8A 2OXDA 5CTPA 1G5SA 3ULIA 5LMKA 2ITNA 3T9IA 1QPJA 4U41A 2XIRA 4YJVA 3ORZA 2PVJA 3HV3A 5BMSA 3HV5A 3PDTA 3LJ1A 3E8NA 3RMFA 2YDJA 5HX8A 4PUZA 3DFAA 5FD2A 4CSVA 4BC6A 2GTMA 2RFSA 4GFOA 1IRKA 4RWJA 4C38A 2VWBA 5M08A 4NWMA 4Z16A 1FMOE 1QMZA 5FWKK 1JSVA 4Y72A 2XK9A 3P08A 2PZYA 3W2OA 4L68A 3F3ZA 2R64A 2W1CA 4AN2A 1M17A 3VBWA 1U54A 4BWKA 4F0GA 2B9FA 3KXXA 1I44A 2B4SB 4ASEA 2CNQA 4QMMA 1MQ4A 3ORMA 4J8NA 4RC3A 3DS6A 4MBJA 2ITPA 1VEBA 4FV4A 3PSDA 3TV4A 2IO6A 5HU9A 3LOKA 3CC6A 4RVLA 4UBAA 4YURA 5KNJA 2XZSA 4IAAA 4E6AA 5IH6A 3FI2A 3FYKX 5BVKA 5CX9A 2R3HA 5I9ZA 3SG9A 2ZB0A 2YZLA 5IDPA 2VWZA 3LCSA 3Q4TA 4FNYA 4J98A 4E73A 4DG3E 5JZJA 2QOBA 2XK6A 3F7WA 3I6WA 3CGFA 4FSQA 3WZKA 3LFSA 3BLHA 3KCKA 3RTPA 1W8CA 4DH5A 2C0OA 3HV4A 1J3HA 4S32A 2OJGA 4OTHA 1JSUA 3GCPA 3UO6A 4MD8E 3RHXA 3UMXA 5E9EA 2A2AA 1K9AA 2QO9A 2CGWA 3RZBA 2FSLX 3R00A 2WKMA 4FZAB 4KIKB 3QHRA 3E5AA 3TZMA 4AX8A 3KU2A 4IHPA 3O8TA 1WBSA 4EZ5A 1QL6A 3ALOA 4TNDA 3PVWA 4C8BA 4NH1A 4D9UA 4M15A 5CALA 2WB8A 2OJFE 5JMSA 3NAXA 4Q9SA 4W9WA 5J1WA 3GU8A 4QMXA 4BWXA 4AW2A 3PG3A 5JGDA 3DKGA 2JDTA 2XNPA 2YFXA 4QP8A 4RIXB 5BVWA 3FY2A 2UZEA 3ENMA 3EFWA 4U80A 5JQ5A 4DT8A 2XIZA 3S3IA 3QRKA 4XBUA 1VYWA 4G2FA 4EH6A 1KUTA 3P7CA 3NW5A 4QP3A 1H1WA 2I1MA 3LE6A 1JQHA 4PPAA 3K54A 4QQ5A 3UYSA 2YLFA 4R7BA 2FH9A 3Q6WA 4ZSEA 5EYDA 5HTCA 4RX9A 2X7GA 2PU8A 5L2QA 4X3FA 2PSQA 1Q8YA 3FLWA 3R8VA 3ZLXA 5I0BA 2HYYA 5KZ0A 1PMUA 3VW8A 3W2CA 3BU3A 3L8SA 2O8YA 4AT5A 3KN5A 3MPMA 4DFYA 4ZZNA 3PE2A 3CQWA 5CZHA 1OKWA 5HESA 4F7NA 3E93A 2ZAZA 3UZPA 5C4KA 3HL7A 3O51A 5D7VA 3MA3A 3MI9A 3AD6A 3WZEA 4KBCA 2Z7QA 4AOJA 4G3GA 3DXPA 3LFAA 4AW0A 1LPUA 1SNUA 2OJIA 3MB7A 2XS0A 2WMQA 4K11A 4RJ3A 4BCNA 4D4YA 4UV0A 3ZM4A 5J5TA 2UW4A 4ZOGA 3PLSA 2IVTA 4LV5A 1VR2A 4FYOA 2OFUA 5C1QB 3JY9A 5F1ZA 3QC9A 2OWBA 4BTJA 3M2WA 4KRCA 1UKHA 2YISA 4N70A 3RCJA 3AMAA 4BI1A 4UXLA 4Y85A 3WYXA 3DJ5A 4UMUA 3FI4A 5HZNA 5AR3A 3P23A 3B2TA 5C4LA 3BBTB 2XNGA 4G6NA 2ERKA 4WUNA 5G6VA 3U8WA 2R3NA 4KS8A 3OW4A 4QP7A 5A4LA 2VU3A 4GL9A 3P78A 4O7LA 4W9XA 1YWRA 4FR4A 5AADA 2JBOA 3P1AA 2VO6A 2PVRA 4TYHA 3SOAA 5I5ZA 4DTAA 5AR7A 2GQRA 3FLQA 5CAQA 3BGPA 4FVPA 4DLJA 3AMBA 1PYXA 5AUYA 5AP5A 3TUCA 3OD6X 3UGCA 4PQNA 2XIXA 2YCRA 3QD3A 4Z55A 3WZUA 5CSXA 5A46A 4PTEA 4IZYA 4F64A 2C3IB 4BB4A 3VUHA 2J4ZA 4XV9A 1GZKA 1URCA 3ZSIA 2WD1A 3R6XA 3H0YA 3BELA 4I6QA 1XO2B 4RVTA 2BRMA 4GJ2A 3W2QA 3DGKA 2F9GA 4ZTHA 1W7HA 2ZOQA 1DAYA 1BI8A 3R63A 3UOKA 5FUTA 4KSPA 4EOPA 4S31A 3U54A 2C6DA 3IECA 5D7AA 3RAKA 2OI4X 2BILB 3MGYA 3TCPA 2B9IA 4FV8A 5BVOA 5HORA 4MXCA 3OWPA 4A7CA 5IA3A 4KRDA 1YKRA 3CJGA 4O27B 2QU6A 4O91A 5JFSA 4JBQA 2IW8A 4MVFA 2W0JA 4MK0A 4O2PA 2W5HA 3VUIA 4MXXA 5LJJA 3IW4A 5GJDA 2CNUA 2XM9A 3HECA 2PVNA 5ANKA 4LGHA 2JKOA 5CI7A 2WIPA 4J1RA 2IZTA 2WGJA 5K9IA 4O0VA 4QPMA 3V01A 4C2WA 5IDNA 5HTIA 5AP6A 2QCSA 5JH6A 4H3PA 4R3CA 4IW0A 4PMPA 2QOHA 3BLRA 5GZ8A 3EFLA 3OY1A 2VTQA 3WF5A 4BCJA 2XKFA 3AC5A 1UA2A 4EEVA 4O7VA 2X81A 5LQFA 3I6UA 4O2ZA 3CGOA 4EL9A 4NTTA 3G90X 4FL3A 5H9BA 3V8SA 4E6QA 3H9RA 4TPTA 3JVRA 4HVIA 3W2SA 2C4GA 3KXHA 4L53A 4PDYA 3T3VA 4EK3A 3CPBA 1ZYSA 5IA1A 2VO7A 2FA2A 2GNLA 3F5UA 3HLLA 3RALA 3U6HA 4PTCA 1F5QA 2KTYA 1Q4LA 1J7LA 3R01A 4QTEA 3I7BA 4GIIA 3AXWA 5CI6A 5T3QA 1ERKA 3NSZA 4BZDA 3HDMA 4JLCA 4BN1A 2HIWA 2B53A 3RJCA 3NVKI 2JKKA 3VBTA 5J7BA 4RPVA 5ETAA 1BL6A 2BDFA 3OT8A 2ETMA 2WPAA 3TJCA 3O8PA 3ZDUA 2CKPA 2O63A 4YJUA 4R78A 3UPZA 3W32A 2R3KA 4UALA 2QOFA 4JG7A 4HVHA 5AAGA 3FLYA 3GU4A 4JAIA 4RA5A 2OSCA 1MP8A 2UW9A 3GVUA 4IH8A 5HO7A 3SAYA 4IX3A 5C03A 4JJRA 4EK6A 4HGLA 2C68A 3S95A 3LFBA 3EN9A 4NM3A 2CCIA 3ZLSA 4WD5A 4BCHA 4EZ7A 3E7VA 3GU5A 1H07A 1KWPA 4IB3A 2R3QA 4ZY6A 4XG2A 3PJ2A 2BKKA 5DEYA 3Q04A 3UDBA 4B0GA 2VTRA 5KX8A 4MXZA 1Z57A 1OUYA 4MWIA 5AIKA 3ZRKA 4Q9ZA 2R3MA 4O96A 1OIRA 4U5JA 2P3GX 3DQWA 5CNOA 5CSHA 3TTJA 2YERA 2PE2A 4IANA 2I0HA 5IU2A 3DNDA 3DPKA 2QLQA 3EL8A 2X9FA 4ASZA 4TL0A 2VX0A 4NTSA 3HUCA 4V01A 1REKA 2Y4IB 2YIYA 3DTWA 3IW5A 3DAJA 3MIAA 5FBOA 4HCTA 3ZS5A 1TQMA 2WQEA 4LGDA 2W96B 3FQEA 4JRNA 5A4EA 5ACBC 2WTJA 4L3PA 4XS2A 5CAUA 4FEXA 3NVMB 1OBDA 1W83A 1JBPE 3CY3A 2EUFB 2XK7A 3FC2A 3OXZA 4FIIA 4U81A 3IGOA 4XP2A 4HYHA 4RIYB 3KK8A 4K18A 3UPXA 4CYJA 3ZUTA 4G9RA 2YM6A 3MN3A 3Q4UA 4PPCA 4ACDA 4FNXA 4BKYA 5B2MA 4O83A 2EXEA 3CQEA 3IONA 3NCZA 1BYGA 2P2IA 4AACA 2QOQA 3ZM9A 4TN6A 2E9NA 3FMJA 3MTFA 4BR3A 4BDAA 4AZFA 1IG1A 1J1CA 4LQMA 3R9RA 4QRCA 4NKAA 2QLUA 3NS9A 4ZTQA 2G2IA 2R4BA 1LEZA 3CD3A 3I81A 4JIAA 4FV5A 5HIDA 3FHIA 3A7HA 3UO4A 4D28A 5BVDA 5L2SA 4I23A 3QTWA 4WG5A 5L2IA 1FINA 4EH2A 2PHKA 2QC6A 2Z7LA 1TVOA 2F7ZE 4MNEB 2V7AA 3PFQA 1PXJA 3IW7A 1QPCA 2IN6A 3QQJA 1NY3A 2X2KA 3UBDA 3ULZA 5E8YA 5HBEA 3UQFA 5IQCA 2R3FA 3CTHA 4M0YA 3BHUA 1PKGA 4IZ7A 3NAYA 4KIOA 4ZAUA 1OZ1A 2B55A 3PE1A 4JX7A 3SKCA 3F61A 2UZDA 2JGZA 4L7FA 2IWIA 3FZPA 3NRMA 4FKUA 4FT9A 4AW1A 3LQ3A 5IQDA 4DEBA 3FL5A 3O8UA 4JG6A 1HCKA 4AFEA 2ZM1A 3GFWA 3GOKA 1V0BA 2Q0NA 4G34A 4R1YA 5HVYA 2WU6A 3ANQA 3KXZA 1K2PA 3MFTA 4IB5A 4QTAA 3HRBA 4WSQA 3RI1A 3VS3A 5M4UA 2WOUA 4H05A 3P4KA 1OIUA 2V7OA 1YXTA 3AD5A 5AUWA 3D5VA 3OG7A 4ENYA 2OG8A 4O0YA 3ZXZA 3E8EA 1JLUE 3GC0A 3PP0A 2QR7A 4FSUA 4I0TA 2CGUA 4FNWA 4G3DA 3W55A 4I5CA 4TYIA 4RC2A 3G51A 2ETKA 5HE1A 1YXVA 5AEPA 4QPAA 4CV9A 4C62A 2DS1A 3U55A 3R02A 1PMEA 2J5EA 2PMNX 5GZ9A 3NUPA 4NIFB 5J8IA 4CMOA 2I0EA 1JOWB 3WZJA 2PUIA 3VS6A 2CKQA 3NYOA 4AA0A 4M12A 3M1SA 5CT0A 2RFDA 3DBDA 5EG3A 4FBXA 2WELA 4FSYA 3MVHA 4X6RA 1VYZA 3ORKA 4GW8A 2BTSA 1G3NA 4FKLA 4QPSA 1G8AA 3VUDA 3VUMA 3JR1A 3WI6A 4E4XA 4IX5A 1A48A 1JKTA 4R3PA 4I0RA 3EYHA 4X0MA 5BMMA 1RQQA 2GHGA 4DEHA 4DEAA 2ZM4A 1LR4A 3FDNA 4GKHA 5LVMA 3BGZA 1BL7A 4BDBA 5M53A 2BRGA 2C6KA 4BDEA 3OS3A 2BAKA 4F6UA 2C5OA 1GIIA 2J7TA 2W17A 3PXKA 4PNKA 5HBJA 3PVBA 3A4OX 2VV9A 3AD4A 2YJSA 3ROYA 3Q60A 3VJNA 5KUPA 2CGXA 4ZTRA 3P7BA 3PUPA 3OUNB 3C4ZA 5M4CA 3QA8A 3FEGA 3HYHA 4DINA 1M2PA 5EDQA 2VTIA 4BYIA 4RGJA 5AP1A 4J8MA 3NNWA 3R22A 3EQBA 4X3FC 3RK9A 3WF8A 1WVWA 4ZTMA 5CQUA 5DGZA 3SC1A 2J90A 4FSRA 4GFGA 2JC6A 4JDJA 3ZEPA 1HOWA 1GY3A 4GFMA 4A9YA 2FB8A 5JGAA 3U6JA 3TDVA 4S34A 2RIOA 1Y57A 4FOBA 3SQQA 3NYXA 2NRUA 4I93A 2PUPA 4IX6A 3VVHA 4EI4A 1SVHA 3FI3A 3LPBA 4XG8A 3FJQE 5L6OA 1PXMA 1WMKA 4YZCA 4DCEA 4D55A 4KIQA 5E91A 5IQBA 4PV0A 5CF8A 4WBOA 2BZHB 4G1WA 4LOQA 4EOOA 3JVSA 2R3OA 4TWOA 2BHEA 5EW9A 4WG4A 4FMQA 3I0QA 3CTJA 5FTOA 3R1QA 4IJ9A 4F0IA 5E8UA 2VTHA 2H96A 4QT1A 3B8QA 3ODZX 4DEIA 5EQEA 4NSTA 1H26A 4RJ5A 4BBMA 4DFXE 3F5PA 3UVRA 1ZOGA 5CEOA 1FGKA 2JAVA 4YNOA 3AG9A 2UW8A 3HAVA 4MYGA 4X2FA 5GZAA 4F1TA 5CAVA 3BU5A 4LUDA 5CQWA 2HW6A 1PYEA 5KMKA 5T6KA 5CXZA 4EOSA 2JDRA 3PXQA 3KC3A 3TNHA 4II5A 5HI2A 2IPXA 5M55A 3UOLA 3V6SA 1U5RA 4M97A 3UYTA 4K6ZA 4CNHA 4O7YA 4I21A 4K33A 3NR9A 3VQHA 1KE7A 4IWDA 2C5NA 5HEZA 4F08A 4MXAA 5AP4A 4JVGA 2ERZE 4XLVA 3CKWA 5L8KA 3WBLA 2JLDA 2OZAA 4O0UA 4DA5A 1H27A 5HVJA 3QZFA 3VWAA 3DAKA 2XKDA 1Y6AA 3FXXA 3H3CA 3TXOA 4WOVA 2LAVA 4ZTSA 3AT2A 2HW7A 3N51A 2BRBA 4FK6A 1W84A 4FIEA 4ID7A 2C6MA 4IB1A 4ZSLA 3PIYA 3CP9A 2BAJA 3HEGA 3F5GA 2X1NA 5DVRA 4F65A 5IMXA 5HICA 4NUSA 4YO4A 4FSTA 5HGIA 3LXKA 5BYZA 4TWNA 5AMNA 4J7BA 2B54A 1Y8YA 4YNEA 5DOSA 2QO2A 3FL4A 4QMZA 3WF6A 2UVXA 3EQRA 2DYLA 4FZ7A 3N4VA 4NYEA 1XBCA 2JIUA 4RJ7A 3EQPA 5HQ0A 2BZJA 2VN9A 3LXPA 5K4IA 4DTKA 5CXHA 1Q61A 4L00A 5GINE 1PXIA 4R5SA 4XH6A 4RX8A 3PSBA 3PYYA 3H0ZA 4P90A 5AUZA 4MCVA 1JKKA 3DXNA 4A4XA 4FV3A 1WBVA 5IA0A 4UN0C 5AR2A 2BIYA 4F9AA 3P0MA 4DBXA 5KZIA 2WTDA 4E4LA 4KA3A 1V0OA 4CZYB 3SDJA 3GENA 3PIXA 3UOJA 3ZH8A 5TE0A 5KBRA 4YLKA 4B6LA 1PJKA 3RGFA 3EQGA 3KRWA 3ZMMA 3EOCA 5CF4A 2J0LA 2JIIA 3A7GA 1GJOA 3II5A 1YRPA 4M66A 1P14A 4DEEA 5KE0A 4K77A 4TYHB 2IZUA 3R7OA 3RP9A 4DFNA 2W5BA 2XIKA 4QYHA 3OWJA 4TWCA 4BTMA 1XH8A 2C6LA 3QXOA 3E7OA 4KKEA 4S30A 3PY1A 4DGGA 5TOZA 3DK7A 2WQMA 3HUBA 1R0PA 3OMVA 3OY3A 4U45A 5HE3A 1O6LA 2ZB1A 4IM3A 1CKIA 3F7ZA 3KVXA 4W4VA 2W4OA 4XNEA 3VS7A 4MX9A 4C37A 2BROA 3O71A 4KD1A 3NZ0A 4UMPA 3UNKA 2OIDA 3PSCA 4AT3A 4X6QC 1TQIA 4R7IA 1H24A 2CN5A 3UQCA 3QALE 1JVPP 1ZYLA 3ATSA 4FT7A 4IMYA 1U59A 3RAWA 4MWHA 4O7ZA 4C33A 4E4MA 3M42A 2X4FA 2X6EA 3EN5A 1FQ1B 2G15A 4NZWB 2XMYA 3O17A 2XNBA 5AM7A 1RW8A 4Y95A 1PXLA 2WHBA 3RBWA 5KMMA 1GIJA 5IQGA 3V8WA 3LCKA 4MKCA 4QMTA 2OJJA 1QCFA 4RQKA 3D7TA 2PUUA 2R7IA 3TZ8A 4BDIA 3LVPA 4LL5A 4G31A 3LQ8A 2B9HA 3P79A 4JS8A 4WNPA 3ZRMA 3F3TA 4A9UA 1WZYA 3AGLA 4FICA 2GS7A 4BCPA 2UUEA 4IWPA 3L9LA 3VUKA 4X21A 3IKAA 5EKOA 4IDTA 2W1HA 4OUCA 2WU7A 3GC9A 5C26A 4FEWA 4ZS0A 5DRDA 4R3RA 5JK3A 3OWLA 2GQSA 3MY1A 4YHTA 2H8HA 3VF8A 4C57A 1UVRA 5CT7A 1XBBA 2PZPA 1M7NA 4FSMA 4CG9A 1XHAA 4RJ8A 2EVAA 4OBOA 4RQVA 1M14A 5CLPA 3I4BA 5K5NA 1W0XC 3LXLA 3FMHA 3I5NA 2C6IA 3QFVA 1UNGA 3GBZA 5T68A 3VS1A 4CCUA 1B38A 5LARA 2F57A 2YIWA 4FTRA 4HPTE 4AGWA 2UZVA 4C02A 5AA9A 3LQ5A 3L9NA 2WTCA 1S9IA 2VX1A 1ZMUA 4QTBA 2RFNA 4TNBA 4F4PA 3TG1A 1J1BA 1ZOHA 1GAGA 2OF2A 3R73A 2OH0E 4K2RA 4AW5A 4L9IA 4BBEA 3G33A 4BKJA 3HAMA 5IQIA 2PVMA 5EH0A 1GZNA 3UC3A 4RG0A 2Q83A 2OKRA 2I40A 2JIVA 4YZDA 5HTBA 4YJSA 2W4KA 4ZP5A 4FT5A 2YA9A 4EOLA 5I4NA 1Q41A 3QTIA 3PA3A 3PRFA 3ORXA 3JXWA 3QWKA 3TJDA 4C4FA 1O9UA 2Z7RA 1OVEA 4KAOA 4USEA 4G5PA 5EM5A 4C36A 4FUXA 4G16A 3GFEA 2BIKB 3LM5A 3UG2A 4RWIA 1OPKA 3D5WA 2YN8A 4HZSA 3F2RA 4DEDA 4RZWA 4GK3A 2WMSA 5CEMA 5IQFA 5AX9A 3DY7A 4FTMA 2JD5A 2HENA 4ZJJA 3EHAA 3A7FA 5B7VA 3CPCA 3AT3A 4L42A 5KMJA 4RX5A 3PWYA 3VNTA 3WF7A 5AFVA 4QP6A 4K9YA 4OT6A 3IDPA 4YUQA 3QA0A 3R9DA 3TUDA 4Z3VA 2B7AA 3ORIA 3UE4A 5J1VA 4NEUA 2BZIB 3A8WA 3UNJA 5I9WA 4WUAA 3CXWA 2I0VA 4FZ6A 3D2KA 5H8EA 3W16A 4C4HA 3Q53A 4M8TA 3HX4A 5AAEA 4EJ7A 2QOIA 3NX8A 1XWSA 4D1XA 5M09A 5L6PA 4EQMA 3MIYA 4Y46A 3EIDA 3MPTA 2QD9A 2V55A 3QX4A 2PUNA 3VBXA 4IWQA 4FG8A 1M7QA 1VJYA 3BZ3A 5K3YA 3ZBFA 2CLXA 2CSNA 4O1OA 5HVKA 4MQ1A 2WFYA 2P33A 3IPHA 3R8LA 3IGGA 4EZ3A 2OK1A 3DBEA 3ORNA 4CV8A 3QRTA 4DLIA 4IFCA 5FDXA 3EYGA 2WMUA 3MBLA 5HLPA 1SYKA 5IQAA 2F2CB 2R3IA 3MW1A 5FEDA 2BMCA 4O22A 4IIRA 4I5HA 3KULA 4ZLZA 2VWVA 3C5UA 3BYOA 2CPKE 4B8MA 3UIBA 4JBPA 3PJ3A 3VBVA 4ORKA 4P5ZA 5H2UA 4GU6A 4LRMA 3KRJA 4ITIA 2YM5A 2ZMCA 3KL8A 2WZJA 4FUYA 3BQCA 5AP7A 4BKZA 2PVFA 3G0FA 5DRBA 2O2UA 3CS9A 4DGNA 2VGPA 3ZXTA 4FODA 2QG5A 4QQCA 3D9VA 3WIKA 1LEWA 3D0EA 3RAHA 2VWYA 4GSBA 4OTFA 4QO9A 2J6MA 4QMLA 5E8XA 4FV1A 3QZHA 3RVGA 4BDKA 4ZY5A 4DT9A 1FVVA 3W8LA 2RKUA 3FQSA 3KK9A 1XR1A 4RT7A 3AC1A 4BCFA 3DJ7A 3PPJA 4NK9A 5GHVA 4R8QA 4FI1A 3SXFA 5CZIA 3HZTA 3V3VA 3WARA 2W1ZA 2XCHA 3F3WA 3CKXA 4DH1A 3MA6A 2HXQA 1F0QA 4HOKA 3ZO4A 4C34A 2PYWA 1YDSE 1UU9A 2AUHA 2ZV9A 3A4PA 4LRJA 4RFZA 5E8VA 1XBAA 2XRWA 3FXZA 3G6HA 2XNMA 3UIMA 2VWUA 4BDFA 5KHXA 4I41A 4NJDA 2XBAA 3AQVA 4ITJA 2R3GA 2O64A 5D9HA 4YHJA 3QTRA 3R28A 3RWPA 3NMUF 4EYMA 5HCXA 5BVNA 3BBWA 4E26A 4C3FA 3D5UA 5BX0A 4CQEA 5E90A 2OJ9A 3QTQA 2NO3A 5KBQA 3CD8A 3R83A 1MRYA 4UB7A 4DN5A 1Q5KA 2X8IA 4FV2A 2ITWA 2OW3A 3ZU7A 2VGOA 4EK8A 2PVKA 3DKCA 2C3JA 3FUPA 1AGWA 3WE8A 2X39A 3IS5A 4L7SA 3E92A 4CCBA 4NFMA 5CAPA 2VO3A 4HNFA 4RZVA 3CJFA 3DK3A 4WNOA 3DA6A 3DTCA 5F4NA 1Y8GA 4W8DA 5FDPA 4FSNA 2R2PA 3R04A 2XCKA 3BE9A 2ZV8A 4QTDA 3GXLA 3TACA 1U4DA 5LMAA 4WHZA 1PXPA 3QL8A 1J91A 4JDIA 5L8JA 4W4YA 3BLQA 3H9FA 3IOKA 4YTIA 3U51A 3RHKA 5K4JA 2W4JA 5HLNA 3BV3A 3ET7A 5HNIX 1YOJA 2C6EA 2IVSA 3V5WA 3A2CA 4AWIA 2J0JA 3ODYX 2Q0BA 5C9CA 3ZRLA 1DAWA 4M69B 1FGIA 5EM6A 2H34A 3ZLYA 3C5IA 4FTIA 4ZSAA 4MF0A 5BYYA 3BE2A 4EOIA 4F7JA 5BUJA 2GPHA 4PTGA 4F99A 4AAAA 1ZZLA 4PDPA 3FLZA 3VHKA 3OTUA 2FUMA 2UW6A 5AV4A 5KKRB 2YCSA 4ACCA 4YTFA 2CGVA 4F1OA 3EMGA 2XNNA 4F0FA 1YDTE 3TI1A 3O7LD 5IUGA 4L46A 3SHEA 4JQ8A 4QYEA 3DT1A 4LOPA 2JFMA 3OWKA 4LGGA 4FTOA 4G6LA 4O0SA 4EH8A 4PF4A 2XK8A 2XBJA 3OCBA 3PVGA 4I6BA 4YTHA 4V05A 1OKZA 3H4JA 3SA0A 3EQCA 2C0IA 3W2PA 4RIWB 5BVFA 1KV2A 4ZY4A 2UZUE 3RNIA 1YXUA 5HO8A 5HE0A 5AV0A 3UVQA 4FC0A 1YVJA 3MSSA 4YLLA 5JKGA 2W5AA 4FV6A 3E62A 4EK4A 1UU8A 2C69A 2WAJA 3LHJA 2IW9A 3D14A 4BIEA 4G9CA 1YW2A 3VIDA 4Y83A 4L44A 3IO7A 4DC2A 3ZO2A 3MVJA 1ZYJA 2GNIA 3QTSA 4O6LA 3VS5A 3LFCA 3NPCA 5TT7A 2Z02A 3SVVA 3QZGA 4IAFA 2ZV2A 5LOHA 4DCAA 3LJ0A 3C4EA 3VS4A 3NW7A 1H1RA 5DR9A 3U4UA 4YJPA 4KS7A 1YHWA 2KULA 3QQLA 3NWWA 4QMUA 5TKDA 3BPRA 2QURA 2Y4IC 2IW6A 4A4OA 3FSKA 4ZJVA 3E8CA 3QTUA 2XEZA 4JR7A 4EOQA 3QYWA 1HCLA 4NU1A 2RG6A 2QG7A 1ZY4A 1M2QA 1ZYDA 3T8OA 3NDMA 4U44A 5E8TA 2BDJA 3PPKA 4M67A 5ANGA 4JXFA 4GCJA 2YWVA 3HA6A 1GZOA 3FMEA 4WA9A 2X2LA 3FAAA 4EORA 4QD6A 2VUWA 3R21A 1ZAOA 3MB6A 3MFSA 2PY3A 4NM7A 4F7SA 4B4LA 3CEKA 4MNFA 3TNQB 4D1ZA 4FA2A 2V5QA 4LL0A 4EHVA 3B8RA 4QP4A 2XVDA 4DGLC 1SVGA 1WAKA 4UY9A 4XV3A 1JPAA 4AOTA 1FVTA 3BRBA 4UZHA 4IVAA 1QPDA 1TQPA 4KIPA 4RVKA 2ZM3A 3TEIA 4DFLA 2GDOA 4Z9LA 2ZYBA 4W4XA 1H28A 5EM8A 3KB7A 3OCGA 4HYSA 4MF1A 2G01A 5FM2A 4AGCA 2WO6A 3K3JA 3O7LB 4FEVA 4IACA 3HNGA 5FEEA 4O7NA 2YACA 3QD2B 3QYZA 5K0XA 2X9EA 4BHZA 2WMBA 4J52A 5GNKA 3ACKA 3F82A 3DKOA 2OLCA 3OOGA 2VZ6A 4FSZA 1Q97A 4C59A 2BCJA 3FMLA 2YM7A 5FXQA 3SGCA 5B2LA 4R77A 2CNVA 4Y8DA 1URWA 4Q5HA 4ANSA 5HD4A 5K5XA 1V1KA 2UZNA 4CXAA 3A7IA 1ZY5A 3NUXA 5GJFA 5A14A 4ONAA 5E8WA 5HCYA 5BUIA 3FHRA 2ITUA 1WBOA 3NNVA 5C8NA 2UZBA 3DV3A 2JKQA 3GU6A 4BDGA 4AA4A 3HMPA 4ACMA 3UQGA 4XG7A 3PXFA 4IXPA 4XMOA 1Q3WA 4FKOA 3EN4A 1PKDA 4HYUA 4R6VA 3D7ZA 1NVSA 1YQJA 4BI2A 1DI9A 3KCFA 2OIQA 5D1JA 4AA5A 2OXXA 2ITQA 1E1VA 4O0XA 5ANJA 2Y4PA 2ZV7A 3PXRA 4JX3A 1KOAA 2PVLA 4OTPA 2JDVA 2Y9QA 4A4LA 3EKKA 5AUXA 5LWMA 4GVJA 2C1BA 5ANIA 1W82A 5E7RA 2EB2A 5AJQA 4E20A 4ZLYA 3GNIB 3QRJA 4RIXA 4IAIA 5HG5A 1BUHA 3TV7A 5HKMA 2QU5A 4I1ZA 3SRVB 1OPLA 3FXWA 1SVEA 2C3LA 3Q3BA 4RVMA 4FZFB 1UWJA 3LXNA 4AZVA 4O0WA 5BYLA 3POZA 3GQIA 4BHNA 3RNYA 4C58A 4NT4A 2UVYA
chains in the Genus database with same CATH superfamily
4N4SA 2QKWB 3C0IA 4BCOA 2FSTX 4FKQA 4HNIA 5DEWA 5A9UA 2J50A 4OT5A 3M11A 4MH7A 5HBHA 5JZNA 3UODA 5AP2A 2NNWB 3EQFA 2QHMA 3E64A 3ATTA 1JKSA 5FRIA 5FP5A 3ZO3A 4AUAA 5M4IA 4KKHA 5LCKA 3ZBXA 4KNBA 3NEWA 4PP9A 3UP7A 4NW6A 5E92A 4I4FA 1OIQA 2OICA 3QQFA 4KWPA 5H8BA 3SW4A 4BGGA 5A4CA 3ZCLA 2C30A 3FMDA 2UVZA 2ACXA 5M06A 1YI6A 4YU2A 3P7AA 4YBKA 3QKLA 4OBQA 1ZWSA 4O1PA 4PMSA 4E6DA 3QWJA 2W1DA 3DKFA 3QKMA 5FM3A 3SD0A 3Q96A 3EFJA 2R3RA 2FYSA 1RDQE 4EH3A 3HGKA 4D58A 5M4FA 3LFDA 3ZFYA 4DG2E 4H3QA 2XYNA 2OZOA 2XA4A 4AZSA 3ROCA 5FLFA 3R0TA 3I79A 2VTJA 2RL5A 4EH7A 3ZOSA 3W0MA 2CJMA 4UYAA 2HZ4A 2YHVA 4DITA 4IE9A 3OT3A 2QOOA 4O84A 1OI9A 5DMZA 3KA0A 3OTVA 4FKSA 3SX9A 4E5BA 5IKWA 4IX4A 2C0TA 3QZIA 3A99A 3VHEA 2FGIA 2A19B 4P2KA 5KHWA 3UIUA 3SG8A 1OM1A 3CBLA 3PTGA 4BGQA 3E3PA 5DT0A 3H30A 3BYUA 3O2MA 2X0GA 2ITVA 3R7EA 4F7LA 2GFCA 3NUSA 4AXFA 4ZMEA 5IMEA 1B39A 4I24A 4JAJA 4U6RA 5IQEA 3C4FA 4AZWA 3Q6UA 3HV6A 4FOCA 5J9LA 3AOXA 1VZOA 4HZRA 4K8AA 3TWJA 4FKPA 4I3ZA 3O5AA 2VX3A 4XRLA 4FTTA 1U54B 4XLIA 5JRQA 4MXYA 4JBVA 2HZIA 5CU2A 3L9MA 3RPRA 4H1JA 4OTWA 3PA4A 2PE1A 3KRRA 4EONA 1SNXA 3R71A 4XUFA 1PXKA 2YIXA 4MHAA 2AC3A 2BKZA 3NUAA 4K0YA 3VUTA 4E3CA 3QC4A 4O81A 3BHYA 4XV2A 3ZZEA 3DLSA 2UW5A 3LMGA 1OKYA 4Z7GA 5EW3A 3QRIA 2W99B 1KSWA 3OC1A 2UZWE 2XF0A 4BZNA 1DS5A 5EQPA 3FY0A 3MH0A 1WBPA 2Y0AA 3LFFA 3ZFXA 2F7EE 4IAYA 4J96A 2VD5A 2XJ0A 3C4XA 4G3FA 4UWBA 4XRJA 5IG1A 4XJ0A 3LCDA 4GH2A 5HCZA 3BYVA 4I94A 5TO8A 4FKVA 3FI8A 4DF3A 3UZRA 5AV2A 3IDCA 3QCYA 3FZRA 5A3XA 5I9XA 3R7VA 1KOBA 4QMPA 4FYNA 2I7QA 3K3IA 5ETCA 3LLTA 4PDSA 2E2BA 2JAMA 3POOA 2W06A 4L45A 3P9JA 3KULB 3PIZA 2X0QA 5EDPA 3TV6A 1M2RA 3A7JA 2Y8OA 3QGYA 4KKGA 2J5FA 5C8KA 5KCVA 5AP0A 3ZSGA 4JDKA 2RG5A 4YC6A 4WG3A 2WTKC 3ZHPC 3TZ9A 1JNKA 5AAFA 2CMWA 3U9CA 2XK3A 2ZMDA 4ALVA 4EHZA 4PP7A 4D2RA 5CVGA 5CSPA 3LFEA 2O65A 4IFGA 4P5QA 4PMTA 2AEGA 4I22A 1OL1A 3QRUA 2R3JA 1Q99A 2BZKB 3MY5A 3PA5A 5EYKA 3LMIA 4CT2A 4R5YA 4X3FB 4O0RA 1ST4A 5IH5A 4QNYA 4CRSA 4GKIA 1WBNA 4DTBA 3KMWA 5HNBA 3DQXA 4XEYA 3AC8A 5CEPA 2OH4A 3VW6A 2G2FA 2P0CA 3QQGA 4I6HA 4KB8A 3AKLA 3FMNA 3A60A 3DU8A 4JT3A 4L3JA 4FSWA 1H0WA 3UMWA 1VLRA 1OL5A 5IUHA 5HU3A 3MVLA 3MJ1A 4QDVA 3UTOA 4Y73A 4LRKA 4FKGA 2G2HA 5KMOA 1LP4A 1H08A 3PG1A 4YZMA 2B52A 3V8TA 5FG8A 4E7WA 3W0QA 2NP8A 4DFZE 4RX7A 2RF9A 4L52A 4YJNA 3AC2A 4O6EA 2YDIA 4DYMA 2GHMA 3SLSA 4D2VA 5M51A 5HIBA 2XIYA 4AU8A 3ACJA 3ZTXA 2PMLX 3PP1A 4HGSA 3H10A 4HYIA 1YXSA 5DT3A 3HKOA 3QXPA 4CFVA 3C4CA 3Q5ZA 4WBBB 3F9NA 2F4JA 2EWAA 5GJGA 4F9BA 4JRVA 3W1FA 3HV7A 4AT4A 4CFMA 2UW3A 4OW8A 2HZNA 3OOMA 3MESA 3BU6A 4BVUA 2V0DA 2Y6MA 3GCSA 3QUDA 4ANNA 2GNGA 5E1SA 3U4WA 3PXYA 1ZMWA 1O6YA 5IA4A 4AZTA 1OMWA 3IW6A 3RM6A 4V04A 3VBQA 1UNHA 5J79A 3W33A 4JQEA 3D94A 1CTPE 1QPEA 2YJRA 5EI2A 5EYCA 3RKBA 4HGEA 2VTLA 5LWNA 5IEXA 4BF2A 3CY2A 2X4ZA 4XYFA 2CN8A 4O82A 1CKJA 2I0YA 2QHNA 4YBJA 5HG9A 5CWZA 4BCQA 4OTDA 4CRLA 4CGAA 1JAMA 3OZ6A 5J87A 3W18A 5I9VA 3OCSA 2BPMA 3PWDA 1Y91A 3GCQA 4HCUA 4J53A 2XAOA 4XX9A 4QYFA 3EFKA 2XKEA 2R3PA 3CE3A 2WQBA 4ASXA 1O6KA 5LMBA 2ITXA 4ALUA 2WTWA 3R2BA 4TRLA 3F69A 1H1PA 3F6XA 5EHLA 2ETRA 2R5TA 3G9LX 3FBVA 4CYIA 4EOKA 4PMMA 3TIYA 3FMMA 1KV1A 4PL5A 4CFWA 4J99A 5CAOA 2WMTA 5CF5A 1Q8TA 4RRVA 2WMRA 5I3OA 3AKKA 4NL0A 3GC8A 3HVCA 4WSYA 2PTKA 3P86A 2YDKA 3KGAA 1SMHA 1H1SA 3BEAA 3O96A 4QQJA 4XG3A 4ZEGA 3UP2A 3THBA 2GNFA 4FNZA 3G6GA 2WIHA 2P55A 2XJ1A 4X2NA 4OLIA 2JDSA 4GYIA 4I20A 4DHIB 3R8ZA 3V5JA 3TNWA 1WFCA 3BQRA 1BI7A 3KFAA 4CZUA 4UMRA 2VO0A 4RWLA 3VRZA 4AQCA 3D83A 4L3LA 5JQ8A 2BR1A 3D15A 2YM3A 5D10A 3R1SA 2C6TA 4H36A 3N4UA 4E93A 5AUVA 4F1MA 3RPYA 3NYVA 4YGAA 4U3ZA 3D5XA 4ANLA 4L01A 4EKKA 2E9UA 3NGAA 5C27A 4IQ6A 4RJ6A 3B2WA 3F3UA 4MD9E 3NW6A 4I0SA 3OCTA 3QUPA 3ZC5A 4XG4A 4B9DA 5IZFA 4BDJA 5AWMA 3PJ8A 5AR8A 2WQOA 2ZJWA 3EWHA 4YLJA 4YZBA 4FL2A 4NIFA 3VN9A 3AMYA 2C47A 3QCQA 3HRFA 4GT5A 4U97A 3IG7A 1EH4A 4FTKA 4IZAA 1H1QA 4JBOA 2QOCA 3PRIA 2Y6OA 4J95A 4ZJIA 3MFRA 5KMIA 1V0PA 4KUJA 4D2PA 4ANMA 2GCDA 1FVRA 4FTCA 5DFPA 2QODA 4I5PA 2XK4A 2Z2WA 3AGMA 3CLYA 4FVQA 3TTIA 4HW7A 3BGQA 4KABA 3TM0A 1KE6A 5JEBA 2PVHA 4TW9A 5J9YA 1XH7A 4G3EA 3TT0A 4N6ZA 5ETIA 3NIEA 3KMMA 3RK7A 4D2WA 3ZUVA 4TZRA 5JN2A 2LGCA 2VRXA 2E9VA 3TN8A 2WTIA 4B7TA 4GT4A 4ANOA 4GVAA 3ANRA 5ANEA 3GCVA 3HP2A 4TTHB 4F6WA 2DQ7X 4QMVA 3BWFA 2XKCA 1A06A 1OITA 4YZNA 2YCQA 5LVNA 2X7OA 1NT2A 1L8TA 5M56A 5DR6A 4CMUA 3FZ1A 3C4WA 2QQ7A 2XYUA 5C01A 4FKIA 4PDOA 3QUEA 2PMIA 4M13A 3WIGA 4D4RA 2IG7A 4O7SA 4MBIA 3NLBA 4H1MA 3AT4A 1PRYA 4U42A 3W10A 2R0UA 4IADA 4YO6A 2XARA 4BJJA 3KRXA 4M0ZA 3L1SA 5I9YA 2P2HA 5L3AA 4NFNA 3R7IA 5D41A 2W05A 1YHVA 4EHGA 3UNZA 1TFFA 3CCNA 2JFLA 5DR2A 4YMJA 4C4GA 2OGVA 2VWIA 3SXSA 2BFXA 4DBNA 4HGTA 4APCA 3QGWA 3UZTA 3BI6A 3KF4A 3S2PA 5ETFA 3OF0A 4WRSA 1NA7A 4FV7A 1NW1A 2EB3A 3I1AA 4IAZA 3R9NA 2UW7A 4FEUA 2UZOA 4WNMA 1Q24A 4DFBA 2CLQA 3C9WA 3RCDA 1W2DA 4NCTC 3W2RA 5AUUA 1J7UA 3WOWA 4FG7A 5HD7A 4FT0A 2WMVA 4IDVA 4UZDA 4RLKA 4UYNA 5CEIA 3VAPA 4FK3A 1T45A 2B1PA 5DBXA 4P7EA 5A4TA 2VTSA 5DYJA 3NNUA 4CD0A 4EWHA 4NJ3A 4KINA 3VULA 4A9SA 3SW7A 1YWVA 2IVUA 2G9XA 4MXOA 3V51A 4AGDA 3C7QA 3MV5A 4GYGA 1OGUA 3DK6A 3NIZA 3QLGA 5EYMA 3GGFA 2QONA 1H25A 2ITTA 1ZOEA 3GB2A 3MH3A 3O23A 4PPBA 5HE2A 2E9PA 3TNIA 3T9TA 4CZTA 3GP0A 5DE2A 5AUTA 4CFNA 3JS2A 3MY0A 4RWKA 3NUNA 3WF9A 3FMKA 1XH6A 1XH9A 1WBWA 4BCMA 5FGKA 4ASDA 3ORLA 2PULA 4JI9A 4QNAA 1E9HA 1STCE 4BCKA 1GIHA 3DB6A 5EFQA 2WNTA 2PZIA 3GEQA 1P2AA 4C3RA 3GC7A 2R7BA 5IA5A 1YOLA 3D4QA 5DA3A 4AG8A 4BWPA 3UIXA 4AN9A 1GZ8A 4D9TA 5KKRC 3TL8A 4OBPA 4LM5A 5E8ZA 3BHTA 3JY0A 5DG5A 4ANQA 3PJCA 2BALA 5EW8A 2ZVAA 3TKHA 2OBJA 3U87A 1XMLA 4IEBA 1OBGA 2A4LA 2CDZA 4GMYA 4GU9A 4OTRA 3ZZWA 3NYNA 1F3MC 3TUBA 5EDRA 4EKLA 5AR4A 4G5JA 4F6SA 3PZHA 3LZBA 4YHFA 4FV0A 2V62A 5DT4A 2GNJA 2YZAA 4YSMA 5E1EA 3S00A 3R1NA 2A1AB 3S1HA 4L43A 5HG7A 4DG0E 2PWLA 5EK7A 4BCGA 5IQCA 3FKNA 2GSFA 4M84A 4E5AX 4U7ZA 1XH4A 4FTLA 3BX5A 4DGOA 5FQDC 1R78A 2H9VA 3C51A 4WRGA 4FT3A 5IUIA 3VC4A 4AGUA 5EOBA 5FXSA 4LFIA 3R8MA 4BTKA 5BQ0A 1WVXA 2HZ0A 2HWPA 3KRLA 4C4IA 3QKKA 4FKWA 2C6OA 4AE6A 2R3LA 3EQIA 4DE4A 1UKIA 2HXLA 4IM2A 5KMLA 1G8SA 3Q9XA 4LG4A 4G17A 4FG9A 4AFJA 4Q5EA 2ONLC 5L8LA 1I09A 3VUGA 3VS0A 2WMXA 3LLAA 2WTVA 1OL7A 4JDHA 4CT1A 5DH3A 3HRCA 5CVFA 1OKVA 3DZOA 4EUUA 4QTCA 3O50A 4YPDA 4RC4A 4I5MA 2W1IA 4CKJA 4QDEA 2XM8A 3REPA 1KE5A 3L8XA 3QQUA 1JKLA 5DNRA 1YWNA 4DH8A 3Q5IA 4C4EA 4I6FA 3QF9A 4FKJA 4B99A 4C2VA 4QP1A 3UO5A 1Y6BA 3CIKA 4ENXA 4FGBA 4D5HA 3OBJA 3F66A 1U46A 4M3QA 4G6OA 1NVRA 5HX6A 1H00A 2YIRA 3HMNA 2PMOX 4YR8A 2YWPA 2UZTA 4V0GA 4G3CA 1P5EA 1ZARA 2WEIA 3PXZA 4AF3A 2GTNA 3LKMA 4XCUA 4TT7A 5EQYA 1S9JA 3DNEA 2HELA 3ZLWA 4FIJA 2Z60A 4MAOA 4D1SA 1BMKA 4FTUA 2R9SA 2BDWA 4OGRA 1J7IA 3KQ7A 1PXOA 1UU7A 4DAWA 2QOLA 4M14A 1P4OA 4TWPA 4EC9A 4DH7A 4PX6A 2FVDA 5DI1A 2JKMA 5JFXA 1PXNA 4JR3A 3FQHA 3MVMA 3HP5A 3VQUA 2W1GA 3PY3A 4JL9A 4LMNA 5JFWA 1SZMA 5AIRA 3EL7A 1OECA 3G5DA 2AC5A 3KF7A 1WVYA 5CU6A 2J51A 3VS2A 5AP3A 4EK5A 4F09A 5IQHA 2V22A 5DLSA 2XNEA 4UWCA 4GT3A 5I3RA 2IVVA 3ITZA 4UXQA 5IISA 1YOMA 3V5PA 3IOPA 5E4HA 2OU7A 4GG7A 5EHYA 3PFYA 5K0KA 1OPJA 3QQHA 5EOLA 3LIJA 3PY0A 3MDYA 4FIHA 3DOGA 3Q9YA 4IAKA 2PL0A 3FV8A 1UWHA 1RJBA 1IA9A 1Z9XA 5EI8A 2GFSA 4CQGA 5CEKA 5HOAA 2VTNA 3R1YA 3VF9A 3CQUA 1T46A 5FXRA 4IZ5A 2XEYA 1YI4A 2DWBA 4LI5A 5G1XA 2OZAB 3JYAA 2C3KA 4PRJA 4QYYA 3TDWA 4J71A 2UW0A 2BFYA 3R7GA 1XJDA 5AM6A 3DBQA 4I92A 4P4CA 3TNPC 3ELJA 5CVHA 2XH5A 4H39A 4ERKA 1K3AA 4L8MA 3I60A 4D4SA 2HCKA 3EQDA 5BPYA 3NNXA 3G9NA 4JNWA 1W2FA 3RPVA 4A07A 2ZDUA 3QAME 4YZ9A 3DDPA 5IF1A 4YTCA 3GQLA 3RK5A 5ACKA 5M57A 3LW0A 4UWYA 2VNWA 1BKXA 3OVVA 4FZDB 4BDHA 4QMYA 1Q62A 3A8XA 3Q4ZA 2YAKA 3VRYA 2JITA 3GU7A 2B0QA 2J0KA 4FIFA 3MS9A 1YDRE 5F20A 4HPUE 5JGBA 5CF6A 3QTXA 2C5XA 4OR5A 5CNNA 4LV8A 1OUKA 4PNIA 4EH9A 3BYMA 3OEZA 3ZUUA 1XKKA 3DCVA 5J7HA 5DPVA 1PF8A 2HOGA 4HCVA 4IWOA 4WNKA 3UC4A 2VAGA 4FL1A 3LAUA 4HJOA 4D4VA 4E8AA 4TXCA 3ZFMA 4KSQA 4WT6A 1Q8WA 4CTCA 4C4JA 5J5SA 4F9CA 1R39A 4F70A 3HA8A 5JT2A 2YABA 5CS6A 4N57A 2PZRA 4EYJA 5CANA 3F88A 2E9OA 1BLXA 3E87A 4BGHA 3F3VA 4UX9A 3RWQA 5EHOA 4QYGA 3FC1X 2WOTA 2HK5A 1BX6A 4M68A 3LMHA 3N4TA 2XB7A 3Q2MA 2J0IA 3CR0A 4N0SA 1OB3A 3E88A 4NW5A 1UV5A 1E1XA 4D5KA 4EQCA 1DM2A 3LFNA 5HHWA 5LXMA 5F95A 4CKRA 1MRUA 4GUBA 2CCHA 2WEVA 4EBWA 2JBPA 4YP8A 3Q4CA 4KIKA 5A6OA 3ORTA 3QX2A 2XNOA 4YJRA 2VNYA 4B8LA 2CHLA 4GRBA 5J9ZA 1FPUA 1Q8ZA 4GV1A 5AA8A 4MEDA 2BTRA 4QMWA 5AX3A 3R9HA 3FE3A 4AS0A 4FTAA 5CASA 5EM7A 3Q9WA 2H6DA 1CDKA 1KE9A 3ZEWA 2G1TA 3EJ1A 3NUYA 3ZC6A 4PY1A 4CFFA 1GOLA 1ZZ2A 5D12A 4XBRA 4LYNA 5KMNA 4OAVB 5L2TA 1MQBA 2Y7JA 3GOPA 2VWWA 5ANOA 5JRSA 4DHFA 3U6IA 3G15A 4TYJA 5FTGA 4CLJA 3WE4A 4GG5A 1SM2A 4FIGA 2QVSE 3D7TB 3R2YA 4UEUA 3DBFA 2B9JA 4OAUC 1L3RE 4C61A 4U3YA 5LMKC 4D0XA 4D2TA 3WILA 3DAEA 3BHHA 4X2JA 4EBVA 3QD0A 5I9UA 4W8EA 5GIOE 4O38A 4BL1A 1AQ1A 3QCXA 5AV1A 1PY5A 2UZLA 4LUEA 3ID6C 5M07A 5L4QA 2ITOA 4Y5QA 2JDOA 3EB0A 4F9WA 5M44A 4DH3A 1PMNA 4ZXTA 4IM0A 4CEGA 3COIA 1PW2A 5AV3A 3UVPA 2GMXA 3LM0A 4XV1A 3MWUA 5C8MA 3FKOA 4O86A 2FO0A 4FV9A 1H0VA 3KY2A 3DB8A 5HNGA 5B2KA 3EN6A 4BDDA 2JEDA 5HO6A 5HLWA 2W9ZB 3MTLA 2PE0A 3F2NA 4YJOA 2W7XA 4LOOA 3C0HA 3I7CA 4ZTLA 2P4IA 4OTGA 3FWQA 4XOYA 5IEVA 4TKSA 3BIZA 3EKNA 4FE2A 3UOHA 3PJ1A 1U5QA 1P4FA 1UNLA 4Q2AA 4BFMA 3BYSA 1IASA 2HY81 4NCTA 4IVBA 4U79A 4MBLA 2W1EA 4F9YA 4FKTA 3KKVA 4U9AA 2J2IB 4ZS4A 5H3QA 5TF9A 3QLFA 1R1WA 1JWHA 1ZLTA 5BVEA 3UG1A 4H3BA 4FGRA 4QMQA 3F5XA 3IK3A 2WQNA 3HMMA 3QQKA 4QMOA 5CYIA 4EOMA 3E8DA 1R3CA 2QR8A 2C5YA 3DZQA 3U9NA 4O4BB 2RGPA 5FTQA 1YI3A 4EC8A 3EZRA 2F2UA 3D2IA 3K5VA 2YM4A 1TKIA 3OUKA 3KXGA 3QD4A 4WIHA 4CLIA 3KIOC 4FTNA 4U43A 3P5KA 4QOXA 4ITHA 4EH4A 3RAIA 3DXQA 1XQZA 3C50A 3DFCB 1YXXA 1H4LA 3C0GA 4M69A 4XHKB 3IQ7A 3R9OA 5A4QA 4HVSA 4IVCA 5DHJA 2BRNA 4ZLOA 4RIOA 3W8QA 3R8PA 4F63A 3KEXA 2GHLA 1H8FA 1DI8A 4GIHA 1IR3A 2O3PA 3K2LA 2R0IA 2PK9A 2OFVA 3MYGA 4EHEA 3PPZA 5LCJA 3FLSA 4E5WA 2GU8A 5BUEA 3RPOA 2Z8CA 3BHVA 2PZ5A 5ITAA 4RSSA 5L6WL 2XJ2A 3COKA 4MQ2A 1ZRZA 4DFUA 3OEFX 2FSOX 4ACHA 4RFMA 5F9EA 1PMVA 4FTQA 4JG8A 1Q8UA 3R7YA 1REJA 4RIWA 3W0OA 1RE8A 4U40A 3ZO1A 4CFXA 2HWOA 3DJ6A 3L8VA 4NM5A 3GCUA 4WKQA 1WCCA 5AR5A 3NUUA 4CFUA 4TYEA 4PWNA 5IH4A 3RZFA 1CMKE 4DEGA 5LVOA 4RLLA 4X7QA 5FBNC 5CSWA 5DIAA 5FP6A 2CKEA 2GS6A 3BCEA 1Z5MA 4I4EA 4AE9A 4ZMFA 4OTIA 3PLAE 1ZMVA 4JQ7A 4ARKA 3SXRA 2ITZA 4BY9E 2A27A 4O7WA 4IB0A 4YJQA 4CVAA 1ZYCA 2WXVA 2OO8X 4GK2A 2BVAA 4A06A 4C7TA 2QKRA 4ZSJA 3CTQA 4KBAA 3OROA 3MPAA 4A9TA 5IEYA 3KREA 3UDTA 3C13A 3W0RA 3TKIA 2ONLA 2PVYA 2YLEA 3R30A 3L8PA 4X2GA 3ZDIA 4USFA 3CSVA 2X7FA 2RFEA 5E8SA 5BNJA 3SV0A 4YJTA 2VTAA 3JUHA 1Q3DA 2QOKA 2YCFA 5F94A 3KMUA 5CEQA 4Z7HA 4EJNA 4DHZA 1APME 5J95A 4NKSA 3BLAA 3Q9ZA 4QMNA 1NXKA 2XUUA 5BV3A 3WZDA 2BRHA 4ZTNA 4QP9A 3GUBA 1ZXEA 3EQHA 4EH5A 5LVPA 1KE8A 3HMIA 3AC4A 3K5UA 3UJGA 4A9RA 4GS6A 2O0UA 3FKLA 4CKIA 3L9PA 4GEOA 1W98A 3Q2JA 3COMA 2DUVA 5EKNA 2IZSA 3OFMA 4L67A 1FOTA 3BV2A 3HMOA 4DGMA 5CSVA 5EI6A 3OP5A 2J9MA 4XOZA 4D0WA 4E4NA 2ESMA 2VTPA 3ERKA 4NM0A 4BRXA 1FMKA 5KO1A 4FX3A 2YIQA 4APPA 4H58A 1PHKA 4EWQA 3A62A 5CU4A 2PPQA 1MRVA 1NVQA 2J0MB 2W9FB 4BTFA 1JSTA 4M7IA 4ZZOA 2HAKA 1IA8A 3GT8A 3TKUA 2ITYA 4JIKA 5A54A 2YAAA 3FLNC 3I0OA 2X2MA 4XG9A 5H8GA 3AC3A 4BYJA 3MFUA 4BZOA 4EQUA 1CKPA 4JMQA 3DDQA 3QU0A 2AYPA 3RM7A 3FPMA 4FEQA 5CU0A 1FBNA 2QI8A 2X8EA 4TYGA 3T3UA 3ZSHA 4AP7A 1YHSA 2NRYA 5IPJA 4HVGA 4O7TA 2IJMA 1IEPA 2X8DA 3KN6A 4J97A 1A9UA 3FZTA 2GS2A 3C1XA 4UMQA 5CU3A 1ST0A 2W1FA 2SRCA 2XP2A 4XG6A 4AOIA 4BBFA 4OTQA 4D2SA 5IA2A 3PVUA 3V5LA 4K1BA 3LCOA 3OW3A 2REIA 2VTMA 3BEGA 3GI3A 1R0EA 4Y5HA 4ACGA 4AXAA 3FPQA 2UV2A 5ICPA 3S0OA 3O0GA 3OXTA 5TR6A 5GIPE 3DBCA 4FKRA 4O21A 3N9XA 3PZEA 4RIYA 3VJOA 1WBTA 4QQTA 5JFVA 4U8ZA 4BCIA 2WTKB 3Q32A 2HY0A 2XRUA 1MUOA 2I6LA 4N6YA 2C5VA 3IDBA 4PL4A 3TZ7A 3V5QA 4RFYA 4CTBA 3I5ZA 4HVDA 2GNHA 1CSNA 4FVRA 4O7RA 4E1ZA 4L6QA 4R1VA 4TY1A 5FEQA 1ND4A 2QNJA 4AXEA 4CG8A 4RA4A 5DWRA 2EXMA 4O0TA 1B6CB 2O5KA 2RSVA 4IC7A 3RPSA 5HIEA 3ALNA 3BWJA 3MH1A 5CY3A 1H01A 3QHWA 4QMSA 4IBMA 4ZZMA 4U0IA 4KBKA 4MNEA 5JSMA 1ATPE 3VBYA 3QTZA 2ZDTA 3DLZA 4C3PA 4XP3A 1M52A 4FTJA 3BKBA 3LJ2A 2IZRA 4YPSA 3KXMA 3R7UA 3Q52A 2BUJA 1UU3A 1OL6A 3G0EA 3JPVA 3WYYA 4EUTA 2YM8A 3QCSA 4JOAA 4QP2A 4C35A 4ERWA 2F7XE 3E3BX 2FSMX 4XP0A 3SRVA 4V0GB 4YC3A 4BDCA 3OHTA 4X2KA 5L2WA 1IAHA 4ZK5A 4IC8A 4E6CA 2BHHA 4CMTA 3OXIA 4GUEA 2Z7SA 4R7HA 3ENHA 4MD7E 4AZEA 4EOJA 4ALWA 2F49A 4ZSGA 2VWXA 3KVWA 1AD5A 3ETAA 3R8UA 3TIZA 1X8BA 4X3JA 3V5TA 4S33A 4ANBA 4S2ZA 1GNGA 4BIBA 2NPQA 4UMTA 4LMUA 3H9OA 2OIBA 2WMAA 3FZSA 4ZIMA 2YITA 1LUFA 4RMZA 3MJ2A 1IAJA 5LVLA 3V04A 3COHA 4IJPA 3FZOA 3ORPA 4FF8A 3E63A 5A6NA 1CM8A 3OBGA 3F2AA 3SOCA 2X6DA 3EZVA 4IVDA 3LCTA 2VTTA 5DN3A 2EU9A 3S4QA 3V6RA 4BICA 4YSJA 4WO5A 2QO7A 3LFQA 4O4DA 5D11A 3FSFA 3KXNA 4MTAA 4RBLA 3RINA 4C0TA 2GQGA 2OXYA 4W4WA 4AN3A 3A61A 4USDA 5CENA 2CKOA 3ZYAA 2BAQA 2VTOA 3EH9A 3HDNA 4RJ4A 2WMWA 2EXCX 5B0XA 2OF4A 2C1AA 3EN7A 4BIDA 4YC8A 4BI0A 3FYJX 4GJ3A 3G2FA 5ANDA 4GK4A 4PL3A 3VO3A 3MH2A 2YEXA 3NCGA 1OL2A 3ZONA 1OIYA 1XH5A 2A0CX 3IW8A 3QBNA 5HG8A 2OXDA 5CTPA 1G5SA 3ULIA 5LMKA 2ITNA 3T9IA 1QPJA 4U41A 2XIRA 4YJVA 3ORZA 2PVJA 3HV3A 5BMSA 3HV5A 3PDTA 3LJ1A 3E8NA 3RMFA 2YDJA 5HX8A 4PUZA 3DFAA 5FD2A 4CSVA 4BC6A 2GTMA 2RFSA 4GFOA 1IRKA 4RWJA 4C38A 2VWBA 5M08A 4NWMA 4Z16A 1FMOE 1QMZA 5FWKK 1JSVA 4Y72A 2XK9A 3P08A 2XAMA 2PZYA 3W2OA 4L68A 3F3ZA 2R64A 2W1CA 4AN2A 1M17A 3VBWA 1U54A 4BWKA 4F0GA 2B9FA 3KXXA 1I44A 2B4SB 4ASEA 2CNQA 4QMMA 1MQ4A 3ORMA 4J8NA 4RC3A 3DS6A 4MBJA 2ITPA 1VEBA 4FV4A 3PSDA 3TV4A 2IO6A 5HU9A 3LOKA 3CC6A 4RVLA 4UBAA 4YURA 5KNJA 2XZSA 4IAAA 4E6AA 5IH6A 3FI2A 3FYKX 5BVKA 5CX9A 2R3HA 1TZDA 5I9ZA 3SG9A 2ZB0A 2YZLA 5IDPA