4DH5A

Room temperature x-ray structure of camp dependent protein kinase a catalytic subunit with high mg2+, adp, phosphate, and ip20
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Low- and room-temperature X-ray structures of protein kinase A ternary complexes shed new light on its activity.
pubmed doi rcsb
source organism Mus musculus
total genus 105
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dh5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dh5A02
4YJVA 4YBKA 2OO8X 2VNWA 3P7BA 1QPCA 3ZS5A 2OIDA 4TNBA 1HCKA 2F7ZE 3VW6A 4J96A 1W7HA 3JY9A 3PA5A 4C4FA 2UZNA 5GZ9A 5M4UA 4L45A 4DCEA 2OF2A 4L52A 3SD0A 2ERZE 5A4CA 4Y85A 5KBRA 3TG1A 4PTGA 2P33A 4R1YA 3HDMA 4GS6A 1VYZA 3GU8A 4CZYB 4XV1A 4BDAA 2ITPA 1ZYLA 3BBTB 2B7AA 3ET7A 4FTRA 3FDNA 5F95A 4E26A 2YERA 1L3RE 4FOCA 4O0YA 2QO9A 4ZTLA 3RHKA 4ZZOA 4DTKA 3QAME 5A3XA 4EOKA 2XK6A 3WI6A 3SGCA 2J0JA 3LFAA 4NFNA 3FLSA 1UU3A 2BTRA 4O2PA 5HO7A 5HORA 4EH2A 1QPEA 4UXQA 4F65A 5AUZA 2I0YA 3MB7A 4IZYA 4ACMA 3ZRMA 3UQGA 2YM6A 1P4FA 1YVJA 4KNBA 4FKOA 5AWMA 2VO7A 4ZY6A 4AW5A 3QLGA 5KNJA 2OIBA 3FZSA 4M8TA 3LFEA 4AFJA 2F57A 4U0IA 2O8YA 2XKFA 3QZGA 4HGSA 2UW9A 1OIYA 4FZAB 4XV3A 3VUDA 4BBFA 5I0BA 2ZV7A 4AF3A 5DHJA 4FEVA 2XZSA 4BZNA 3DBEA 1UV5A 2WMUA 4ZP5A 3DK6A 4RIYB 3RK5A 3CTQA 4UALA 2IG7A 4RC4A 4BCQA 4FYNA 5FLFA 5L6WL 5IISA 2CJMA 5JFWA 3FKOA 4RRVA 4CMOA 2ITQA 3FLYA 4J1RA 2JDTA 3BQCA 4FEWA 4UV0A 4RJ4A 3F7WA 4UWCA 4TYEA 2I1MA 4KKGA 4QPAA 3SAYA 1F0QA 3UOHA 3Q2JA 2JDOA 4EK5A 3E93A 4ZIMA 3KXGA 3OUKA 3D2KA 5ANKA 4JRNA 4A9RA 1PMEA 2YABA 3I6UA 4AOIA 1W83A 5CU2A 4YTFA 5IH4A 4H39A 3D15A 4P4CA 5FGKA 4O0UA 4DEEA 5IZFA 3RMFA 4AW0A 4HYUA 5IUIA 4XG8A 4J8MA 3TV4A 4NYEA 4L44A 4L7FA 4G3FA 5DRBA 4CVAA 4I24A 4GFOA 5JZJA 5BVWA 3CBLA 3OCTA 4HGTA 1U54B 5CEMA 3HP5A 4CMTA 3L9MA 4WRGA 5DT4A 2R3QA 1FPUA 2C6KA 1KSWA 3Q9ZA 4Z9LA 3ACKA 3FUPA 3QA0A 1H24A 4XRJA 2OFUA 3WF7A 2OK1A 3HA6A 4AOJA 4Z7HA 2G2IA 2BZJA 3E87A 3II5A 3VJOA 2H34A 4HNFA 3QX4A 1R1WA 3DT1A 3IECA 5M55A 4F63A 4NJ3A 2UW8A 4YZNA 3UVPA 2P2HA 3HLLA 4JJRA 5CT0A 3ZC6A 4QMPA 4I0SA 3O17A 2BFXA 3AT3A 5C03A 3R83A 4OGRA 4DEBA 5IKWA 5AR3A 2PVJA 2VWWA 2J50A 2XUUA 3AC1A 2NPQA 4I6BA 4RVLA 3MV5A 2IWIA 2GCDA 3OEZA 2IW9A 3TV7A 3KRXA 3R73A 1ZMUA 2CNVA 2C5NA 1ZAOA 3LXPA 1OPLA 3QCSA 4B9DA 4ERKA 3HMMA 1KE7A 2WNTA 2CLQA 3QTWA 4I0RA 4QD6A 2HY0A 4LRKA 5HICA 4XP0A 4FKRA 3QTZA 4MF0A 4RT7A 3CY2A 2RFDA 5AR8A 3VJNA 4RX7A 1H00A 4ARKA 2HXLA 4G1WA 1OL7A 5AP4A 4Q9SA 4F9YA 5C26A 3P7AA 5HTIA 4RFMA 5AAGA 4QMUA 2QHNA 2UW6A 4GJ3A 3G2FA 4FTLA 4NTSA 3VBYA 3EIDA 1OVEA 4PTEA 4QMMA 5CSHA 5CEPA 5L3AA 1DAYA 4FTNA 3EN7A 3SXSA 4YLLA 3NUAA 4P5QA 5M51A 3C5IA 4L00A 4RPVA 4WIHA 3TKHA 2BZIB 2JIUA 4FC0A 2UVZA 4UN0C 1BX6A 3C9WA 4FIGA 2WEVA 1Y6AA 4I3ZA 3VBQA 5KUPA 5M09A 4XJ0A 4KINA 3EL7A 4H05A 4FSNA 4BKYA 4AGUA 4EC8A 3P1AA 3QHWA 4UBAA 4FI1A 3W18A 4DC2A 2OLCA 1RE8A 3OT3A 1R0PA 4ACGA 2YEXA 4IAZA 3RKBA 2Q83A 2BILB 3UIUA 5M4IA 3HAMA 2A0CX 5HNGA 4CQGA 5AJQA 3HGKA 4L46A 4NCTC 1PHKA 3TT0A 5CZHA 2JC6A 5EKNA 4YJPA 5J8IA 2JKKA 3AG9A 4FTUA 1FQ1B 3Q5IA 4C3RA 4K8AA 5EM7A 4QMLA 2W05A 4U5JA 3UVQA 2VWYA 3PE1A 3ZEWA 2PZRA 3ZH8A 2F7EE 4S34A 4XG4A 4J95A 3QD2B 5TR6A 1Q8TA 4F7JA 3ORPA 5D41A 5H8GA 5HGIA 1GIIA 3UODA 3MIYA 3IPHA 4F0GA 2PUNA 5IDPA 4BB4A 2PVRA 4EZ5A 3CC6A 4GCJA 4KBCA 5D12A 4O7TA 2R3NA 2C6OA 5HG5A 5IQGA 4WNKA 5A4TA 2BRGA 3E63A 4NU1A 5I9YA 4O7RA 3WZJA 3A8WA 4OBOA 4HGEA 5A9UA 4EEVA 4O7NA 2VNYA 4Q2AA 2VGOA 4E5BA 5DEWA 3DKCA 4B0GA 1YOMA 4YC8A 3WILA 4AA0A 5C1QB 2EVAA 4E6AA 4HPTE 3UZRA 3LFSA 4EHEA 1PMNA 2WU6A 3MPMA 4OTIA 5HLWA 5FEDA 3VS2A 5KKRB 1YDTE 4IWOA 1NT2A 5TO8A 3KRLA 3UYTA 3EJ1A 3HDNA 3QKLA 3QU0A 2HWPA 2VWIA 1CKIA 2GNGA 4ALWA 3Q3BA 4KAOA 2HZIA 3CTHA 1XWSA 2HZ4A 5CY3A 3IW7A 4GYIA 4OT5A 4USEA 1JNKA 2YM3A 3IONA 5EOLA 3QCYA 2BR1A 4IAAA 4YZ9A 3UGCA 2R3PA 4CYJA 5AV4A 1PMUA 2VO6A 4FIJA 3ZLSA 3KULA 3N4VA 4YZBA 3ALOA 3HV7A 4JXFA 3C4WA 1J7UA 3SW7A 3EN4A 5AA8A 1XR1A 4EOJA 4KIQA 4XV9A 3C1XA 3I60A 2V5QA 4QP7A 5A4LA 3G0FA 1BI7A 5M44A 3Q6UA 2XK4A 3LVPA 3WBLA 4O7VA 5CF8A 4BDKA 1JSTA 4WOVA 1GZ8A 3A7GA 3DK7A 3DZOA 2IW8A 1NVRA 3DNDA 4QP9A 2IZUA 2VZ6A 5JGDA 2J0KA 5LMKA 2YIXA 4RJ3A 4GU6A 1U46A 5ANGA 5CF5A 4ITHA 2UVXA 4IZ7A 3NNXA 4TTHB 4RWLA 3KMUA 4MNFA 1ZYCA 2VTAA 4QMQA 4RIOA 2ZMCA 5TOZA 4FTAA 1BMKA 3OOGA 3WF9A 3FXWA 3VAPA 5AX3A 2WPAA 3OOMA 5JFVA 3OROA 3BLHA 1V0OA 3EQDA 4DF3A 2X9EA 1OKWA 3VF9A 3CQEA 2E2BA 3MDYA 4D0WA 1FVTA 4YUQA 3HV6A 3ALNA 3R8PA 2A2AA 4AACA 2R3LA 4AN9A 5K5XA 1FOTA 1V0BA 3D5WA 4TWPA 1REJA 4X3FA 3KXZA 2O65A 4RLKA 5IG1A 3FHIA 5ANDA 3BZ3A 3KXNA 4U42A 2WKMA 4CQEA 3BI6A 3JUHA 2X1NA 3UPXA 1O6YA 3G9NA 3D7TB 4ANBA 5H8EA 5KMJA 4IAIA 4UEUA 2P55A 3R8UA 2HCKA 3PXKA 2CGWA 5I9UA 2G15A 3FI3A 4QQCA 5ANEA 4AAAA 4FL3A 3O8PA 4DEDA 3NW6A 4R6VA 4JQEA 3UJGA 4JBQA 1URCA 4FL2A 4HVIA 5DGZA 4DLIA 3GVUA 5J1VA 3I7BA 4ALUA 3DB8A 4K77A 5LXMA 4F7SA 1PY5A 4E6CA 3I4BA 3R01A 4R3PA 4M66A 5DNRA 4ANMA 1P5EA 4CT2A 3W55A 5DEYA 3D0EA 4G3GA 3KRJA 1OKYA 2ZYBA 4HOKA 3VQHA 1U5QA 4W4XA 4BCMA 4DINA 1Q3WA 3UDBA 5L8LA 1RW8A 3TL8A 5GZAA 5AR5A 4IX5A 1CKPA 3T8OA 4R3RA 5FXSA 3VIDA 1IAHA 4IX3A 3GC8A 4L3PA 2R3RA 3L8SA 3DKOA 4O1PA 4F64A 4BCPA 4M97A 4QPSA 5B2KA 4C62A 4N6YA 3TI1A 4ASDA 4CMUA 2C3IB 3LM0A 4A4XA 3E62A 4I6FA 5IQFA 1Z9XA 4MEDA 5AV1A 1W84A 2CN5A 1WFCA 2R3KA 3RK7A 2QO2A 2XM8A 3EN9A 2A1AB 2ZDUA 3KULB 3KXXA 4JAIA 4CRLA 4ORKA 3QKKA 3TZMA 3MH2A 1UWHA 1JKLA 5EHLA 2YA9A 1F3MC 4NEUA 4G31A 3JPVA 4JG6A 5DN3A 3VS6A 5C4KA 2AUHA 1IR3A 4O81A 3W33A 3TJCA 4BWKA 1FGIA 2ZV2A 4DG0E 3LCTA 3R2YA 5ETCA 2G2FA 2IVSA 4QTAA 1KE5A 4F9BA 4EBWA 3E3BX 3IG7A 3OCSA 5H3QA 5BPYA 2PUIA 2WAJA 4IWDA 4WSQA 4ALVA 5HTCA 3V8WA 4RVKA 5FRIA 4F09A 3BGQA 2IVVA 3AMBA 4BWPA 2ONLA 4V0GA 5M53A 4JI9A 3EQRA 2J5EA 2QU5A 3ACJA 5ITAA 2NNWB 5AP7A 3DJ6A 4U3YA 3P79A 2PZYA 5E8UA 3R7UA 1CM8A 4ZTMA 5HO6A 2OIQA 1PXMA 2BRHA 2HIWA 3EYGA 3IDCA 4WG3A 4FNXA 4TN6A 5HESA 3UG1A 3UP7A 3L8XA 1YXXA 1KWPA 4RVMA 3V3VA 3GGFA 1SVHA 2ZB1A 4X3FB 4BDGA 3P08A 4AOTA 4E93A 1DM2A 2F2UA 2X2KA 4YHTA 2YCQA 4D2WA 5EOBA 4X2KA 2F7XE 3B8RA 3QRKA 4V05A 5J9ZA 3UMWA 3U9CA 4XP3A 2GFSA 4ZJJA 1JKKA 2YCFA 3OXZA 3SX9A 3DXPA 4FKWA 3D83A 2LGCA 4XV2A 2VUWA 3ODZX 3ZSIA 3UPZA 2PHKA 3BHVA 3V6RA 3JXWA 4DBNA 1YRPA 2G2HA 3QXOA 4GFMA 3KQ7A 3ZUUA 3PVGA 1QMZA 4PMSA 3RPVA 3TNQB 5HX6A 2GS2A 3D5XA 2QHMA 3RPSA 4MXOA 2R3MA 4CCUA 1GAGA 4S31A 2E9PA 2GTNA 5H8BA 1QPDA 2JDSA 2R5TA 3ULIA 1WBVA 3I0QA 4G6LA 3U8WA 2HAKA 5EYKA 4IB3A 3EOCA 4W4YA 3FKNA 4BDHA 4R7HA 4M67A 4AT4A 4KWPA 2X4ZA 4DTBA 4FX3A 3PPZA 3FZPA 3EH9A 3POZA 4WBOA 5HE0A 3DZQA 3R8VA 2JDVA 3VBWA 5EQYA 1K9AA 4EOMA 3WIGA 3BCEA 1H8FA 3WZUA 4HPUE 5CSVA 5LVOA 1SNUA 5HE3A 4DFBA 3LJ2A 4WD5A 3NYVA 2X7GA 5CENA 3UOJA 3KKVA 1OITA 3UMXA 4D9TA 3DCVA 4WUAA 5CVFA 1OPJA 3HMIA 2XJ0A 4P2KA 4HYHA 3IK3A 4BR3A 4PX6A 5LQFA 4TWNA 3CD3A 4RC3A 3T3VA 2B9IA 4U80A 4Y46A 4FSYA 4FEQA 4CFXA 3DFCB 5K0KA 4D4RA 4EQUA 3D5VA 4R7IA 4PV0A 4HW7A 4ITJA 1ATPE 1Y8YA 2J4ZA 4YLJA 3M1SA 1QCFA 4F6SA 4ZZNA 2QO7A 1J1BA 3QBNA 2R0UA 2ZVAA 1S9JA 5EYDA 3RNIA 4CKJA 3VNTA 2UZEA 3BHYA 2X81A 5HKMA 5IUGA 3O96A 5FBNC 3N9XA 3DJ7A 3F66A 4C2WA 5BQ0A 5BMSA 1M2PA 3JVSA 3OZ6A 3FEGA 1H01A 2PVHA 4C4EA 3GU6A 2VTNA 4IJPA 2W1FA 4N4SA 4GK3A 4G3EA 4E4NA 3ID6C 3BU3A 3R22A 5JT2A 2VTIA 4GEOA 2W5AA 3HMPA 3NCZA 1LP4A 1YDRE 4V0GB 2XBJA 5B0XA 4V04A 3FY0A 4YJQA 4QYGA 4IIRA 2XBAA 4IFGA 4IM0A 3ZLXA 4EONA 2GMXA 3EMGA 3M42A 4MNEB 3QC9A 4FVRA 2BCJA 4GH2A 4TY1A 4GT5A 4H1JA 5A14A 2W1ZA 1MQ4A 4YJSA 2BKZA 2QI8A 3VRYA 3SV0A 5IQIA 5IMXA 1Y57A 4WSYA 3OEFX 3ORMA 3WIKA 4J71A 4XX9A 3WZDA 3ZHPC 4DAWA 4MD8E 1B39A 4FNZA 5AP6A 4EZ7A 2ZOQA 4IZAA 4LOQA 5CLPA 1AGWA 1Q8UA 4JG8A 4TXCA 5CS6A 4DHFA 2J5FA 3I81A 3P5KA 4U6RA 3QRIA 3DGKA 5E8SA 5JQ8A 1YQJA 5LCKA 4BDIA 1SM2A 3N51A 4M84A 3RCDA 5AM7A 3SOCA 4FVPA 4H3BA 4M14A 3AMAA 4HNIA 2NO3A 1ZRZA 4ZSGA 1E1XA 4BCNA 5CAVA 3BYOA 3L1SA 3SOAA 3Q32A 4OLIA 4QMTA 1WZYA 5J5TA 3SXFA 3IDBA 4AZEA 3PXRA 1I44A 4LL5A 4O0VA 1PYXA 4ANOA 2DWBA 3NUSA 4F4PA 4ZMEA 1GZKA 3H9OA 3WF6A 4FV2A 1YOLA 4J99A 4FIIA 3TEIA 4E73A 4O2ZA 4ZZMA 4S33A 4XRLA 5D1JA 3LQ3A 2VWVA 3DBFA 5FXRA 4IB0A 4PL4A 5CTPA 5A54A 4I93A 5IU2A 1OECA 2UW3A 2G9XA 4C61A 2R3IA 4IH8A 4IHPA 4YTHA 1E9HA 4ERWA 4QP4A 2VTQA 3A7IA 5A4EA 2WTWA 5LWNA 4PDPA 4E5WA 3V8SA 3FQEA 2W4OA 4OT6A 5EDRA 3FI4A 3VO3A 5HNIX 5KX8A 4OAUC 3LLAA 2C68A 5CQWA 2WB8A 3QQGA 5L4QA 5HG7A 2RIOA 2QOBA 2DS1A 4CFMA 3COHA 1BI8A 3PJ8A 3PRIA 3CGFA 1ZZLA 4F1OA 3GEQA 3C7QA 3LXLA 5HNBA 4U81A 2O63A 3GI3A 3HRCA 4YZMA 1G8SA 1WMKA 3FMHA 1KOAA 2OJFE 4QTBA 2BAJA 2CN8A 4IDVA 4OR5A 3AXWA 3ORZA 5CASA 4GU9A 2Q0NA 3KFAA 3EKKA 4IM3A 5IQEA 4R5YA 4BCKA 3VN9A 1XBBA 3OVVA 4AS0A 4P7EA 2V0DA 4UB7A 5IDNA 4FG7A 4PUZA 4BFMA 1WVYA 2R64A 3ZU7A 4BIEA 3KRRA 3R1SA 3OG7A 3R71A 4MBLA 5GJFA 2W4KA 3RJCA 4M3QA 1GNGA 3C50A 3D94A 3KGAA 4W8DA 1PXNA 2FO0A 4IBMA 4O27B 4FA2A 4O86A 2ZAZA 3D7ZA 3FC2A 3MJ1A 3HNGA 3REPA 2IW6A 4EJNA 2Z7LA 3FYJX 4RJ7A 5H9BA 4AZSA 4I5HA 5HLNA 5DR9A 4R7BA 4V01A 5L8KA 2ITOA 2PMOX 3R02A 2RF9A 2X7FA 4F1MA 2CMWA 4TW9A 4U44A 4WNMA 4XG9A 3EQBA 1OM1A 4N6ZA 4FT7A 2QOLA 5CALA 2I40A 4BBEA 4QMOA 4YP8A 3FBVA 2WXVA 3PG3A 5CF6A 3VS3A 1Q24A 4RGJA 3EN6A 3W8QA 2XNGA 2GHLA 3NX8A 4BCOA 2YM5A 5EQPA 3HX4A 4JG7A 2C4GA 1WCCA 3AC4A 2UW5A 3KXHA 5KMIA 3MB6A 2I0EA 5HCXA 1OL1A 3LQ8A 3ZO1A 3CJGA 2UZTA 3GU4A 1KE9A 2YHVA 4Y72A 1WVXA 5TE0A 3SKCA 5J7HA 3Q9YA 4X7QA 4F0FA 3MSSA 3ZYAA 5LCJA 4L3LA 2GNJA 4YSJA 4HCTA 2WMXA 2GQGA 3ZZEA 3MVHA 5F20A 5ETFA 4CG9A 3B2TA 4JDJA 3UIMA 3FQSA 3DNEA 4KD1A 4IX6A 5JQ5A 4KUJA 3EB0A 2YDKA 3P23A 3MGYA 2XH5A 3DU8A 3QXPA 4RLLA 5JGAA 5M57A 4E7WA 4C35A 2GNIA 2WMWA 3MFUA 4PY1A 3ZSHA 4FV6A 3BPRA 3N4TA 4IDTA 2VO0A 3PSDA 4ENYA 2WTKB 2P0CA 3LFNA 4FKVA 5J1WA 3GCUA 3ZO3A 5DT0A 1XH8A 2ITTA 3A8XA 4B7TA 2UUEA 4O6EA 1PW2A 3ANRA 1IEPA 4BL1A 3QD0A 5CNOA 2WQBA 3QA8A 3EQFA 4EUUA 4GG7A 2I0VA 2J0IA 2WMBA 2WOUA 4QT1A 3OCBA 3HECA 1KV1A 1ZYDA 3AOXA 3IW4A 2WMQA 1GOLA 4IX4A 3Q6WA 3GOPA 3NIZA 4BCGA 4O0XA 4N70A 4NKAA 4XBRA 4JIAA 4KB8A 1P2AA 5BNJA 5FBOA 4IANA 5HO8A 3WE4A 3ZO4A 3LFBA 4EI4A 4AZFA 4EOQA 2Y7JA 4DT9A 3HUBA 4BYIA 1JPAA 2XCKA 1WBNA 3LMIA 2JEDA 4JR7A 4M68A 3BYSA 2PVFA 3QTRA 2XP2A 3A62A 3IGOA 3W2CA 1J7IA 4AGDA 3PDTA 1R3CA 2JIIA 5GJGA 4ZAUA 2RKUA 4L53A 3RAWA 2ITYA 4YNOA 4FV8A 3KK8A 3U6IA 1XH9A 5M07A 3O23A 2OJIA 2PL0A 5EM8A 4AT5A 4FTTA 5H2UA 2BALA 3NR9A 4DITA 1G5SA 5IQHA 3DY7A 3L8PA 1V1KA 3ZOSA 4R8QA 2W1CA 4AU8A 4ZOGA 3WZEA 4BYJA 3DTCA 2LAVA 3FZOA 2ITXA 2R9SA 3ZUVA 4MD7E 3CCNA 4USFA 4FKGA 4WT6A 5EI6A 5IEVA 3I5NA 4AW2A 3QKMA 3R28A 5K9IA 4JR3A 4RWIA 3RVGA 3DJ5A 2HW7A 3K3JA 4ZXTA 4R5SA 4YJNA 3NZ0A 5E8ZA 4C02A 4ZJVA 5EW9A 3R7YA 4Y73A 2BHEA 3DBCA 1H1PA 4P90A 4BRXA 4J53A 4EK3A 4U41A 2BAKA 4MK0A 4PP9A 5AAEA 4QMWA 3PFQA 3PWDA 4FTMA 3UTOA 3MPTA 3TZ8A 4PDSA 4FZFB 5AR4A 2CNUA 3NGAA 5J9LA 3QWJA 1PXPA 2QD9A 2WZJA 4C7TA 1Y8GA 4PRJA 2OF4A 4RX9A 5FD2A 1O6LA 3DS6A 3TM0A 1Y6BA 1OL5A 3E8NA 3ZFMA 3C4ZA 4G5JA 5HI2A 1J7LA 3GENA 4C4JA 4C59A 2R3FA 4IC7A 5EW3A 4DYMA 5CEQA 3H3CA 2EB3A 2QNJA 3U4WA 1Z5MA 4ENXA 2Y0AA 2JFLA 4CFFA 2XEZA 2J6MA 3LJ0A 3NAXA 2XYUA 1JAMA 2PVLA 4RJ5A 5FEQA 4D4SA 3LZBA 1YXTA 4NCTA 4A4LA 3Q4TA 1OGUA 3NCGA 4TYHA 4UMUA 4BTKA 3F3WA 3FMEA 4XOYA 3ZMMA 4DH5A 1YOJA 3FSFA 1H26A 4HVSA 4AGCA 3OY3A 4MXZA 5M4FA 3OWJA 1RJBA 4BY9E 3POOA 3TNIA 3IKAA 4XOZA 4U7ZA 5AA9A 4N57A 5HIDA 3BV2A 4NUSA 4C37A 5LVMA 4JT3A 1MQBA 3R7IA 1YW2A 4JQ7A 3MA6A 4XMOA 3TJDA 2BDFA 2JKQA 4GIHA 4FSUA 4YO4A 3M2WA 4TPTA 2BDWA 5CEOA 4KIKA 3CY3A 4MWIA 5FUTA 4PMPA 5JGBA 3DDPA 2FVDA 4A07A 4TNDA 4EHZA 3MVLA 3Q4UA 3UQFA 5EYCA 4L8MA 5E4HA 3L8VA 5IEXA 5KMNA 1GZNA 3QHRA 4IAKA 4IXPA 1JQHA 3DA6A 1OBDA 1FGKA 2VTMA 4CT1A 3MVJA 3F69A 1OUKA 1DI8A 3GCVA 4YJRA 4E3CA 3VS0A 5L2TA 3TNPC 3V5LA 2CDZA 4MQ2A 4S30A 3FI8A 2X8IA 3P7CA 1O9UA 3Q52A 4I1ZA 3PSBA 4BI2A 3NAYA 1DS5A 5IEYA 4U97A 2VTOA 2X6DA 2VAGA 3BHHA 2JD5A 5KKRC 4I20A 2VO3A 4I22A 3HMOA 5LWMA 3LM5A 5HBEA 3LPBA 3GCPA 4BCHA 4U79A 2CKOA 2X6EA 4X2NA 3EQIA 4RIXA 4W9WA 3LW0A 3BRBA 3QQKA 4YHJA 5GHVA 3RAHA 4X6QC 1FBNA 4TZRA 4AT3A 2XA4A 3LCSA 3PZHA 4FGBA 4NTTA 3NVMB 2O0UA 4IZ5A 2OJJA 3V6SA 2IZRA 3EFLA 5CZIA 2PZIA 2V22A 4QQ5A 1M14A 3CGOA 2PY3A 5JEBA 4WRSA 2BFYA 3F5UA 2C3LA 4E6DA 2AYPA 2X8DA 2C69A 2WQOA 3ZONA 2DQ7X 2XMYA 5HIBA 1SVEA 2YAKA 4ZK5A 2WEIA 2BZHB 1Q62A 5AIRA 2Y4PA 5CX9A 1VR2A 3FMKA 4LRMA 5LMBA 3MFSA 1T46A 3CD8A 1XO2B 3LXNA 3UBDA 5AUWA 2YJRA 2FSOX 2PZ5A 4IB5A 3UOLA 1H27A 4XCUA 2B9JA 2C3JA 3HL7A 5AUXA 3WF5A 3LE6A 3ZEPA 5JFSA 3PTGA 4ZTHA 3DPKA 4D5KA 4OTPA 3R9DA 2VWZA 2PE0A 5EK7A 1ND4A 4FKQA 2I0HA 3H4JA 5EG3A 1ZYSA 2CKQA 3NUUA 3VULA 2GU8A 4JX7A 2WOTA 3DTWA 1FMKA 4G2FA 3GQLA 4QNYA 4TYIA 3ZFYA 4D28A 2XRWA 1K3AA 1LEWA 2QLUA 3PPKA 2V7AA 3QRJA 3C0HA 3H0ZA 1LR4A 4MBJA 4TWOA 4YZCA 4DBXA 3KMMA 2ZDTA 5CYIA 3EQGA 4TYHB 4DCAA 3D5UA 4G34A 1TQMA 2UZWE 4QTCA 4NKSA 1R78A 3LFFA 2OG8A 4JDIA 3VUIA 3B8QA 4LL0A 2AC5A 2FSMX 4LGHA 5FM2A 2ETKA 4J98A 4EK4A 4PPAA 3SVVA 4NL0A 5DR2A 2VTHA 2Z60A 3DXQA 1ZARA 2PK9A 2ZV9A 3E3PA 3OXIA 4UWYA 4X2FA 2PULA 5AV2A 4AE6A 1W82A 1KE6A 1WVWA 3AMYA 3RNYA 4CTCA 3G15A 5K4IA 4FKIA 5IQCA 5HOAA 4WO5A 4KIKB 2RFEA 3PXZA 4Y83A 3LMHA 2CGUA 3CPBA 3FMNA 3C4XA 4GUEA 3LCOA 3TDVA 5EM6A 3F5GA 1OL2A 2BRNA 2XK3A 4MXAA 4ZY5A 3DQWA 3ORLA 4BDEA 3COKA 5IQDA 4E5AX 3FMJA 2YZAA 3DLZA 5BUEA 4EJ7A 4PL5A 3BYUA 4EOOA 2B9HA 4IAFA 1L8TA 5EI8A 2NRYA 3HEGA 3HRFA 3AT4A 4FG9A 4BZOA 2ITVA 2XNEA 4JX3A 3CPCA 3RGFA 3QUPA 5D10A 4A9TA 2YCRA 3JR1A 4EK8A 1Q41A 4CEGA 1YWVA 1M17A 4C3PA 3HV4A 4FKTA 4PDOA 3V51A 3S95A 4RJ8A 2W5HA 2WTIA 4ZSLA 5CAPA 3OTVA 5DBXA 3PVWA 5T68A 4CNHA 4WHZA 1PXJA 3UP2A 2PMLX 5IA4A 2ITUA 3ZUTA 3ZC5A 5HD4A 5HLPA 4DEAA 1DI9A 1Q4LA 3OXTA 4MH7A 5K5NA 2QOQA 3KA0A 3RM7A 1ZXEA 2J9MA 2VTPA 3QTIA 4RMZA 4LV5A 1J91A 5AV3A 4A7CA 2VX0A 4AXAA 3BLQA 4OAVB 3ENHA 4FG8A 3QWKA 2X9FA 4TYJA 4IM2A 2RL5A 3NNWA 3EQHA 3BHTA 4BDDA 4O1OA 1IASA 3TXOA 4I5CA 4O96A 4RA5A 3GCQA 5JK3A 2R4BA 3NYNA 5E91A 2PPQA 1TQPA 5LMKC 4FTIA 4UX9A 3PWYA 3GU5A 3R7EA 3ZO2A 5E8WA 2FA2A 3D2IA 4EK6A 1BUHA 5C4LA 3LJ1A 4ZJIA 1P14A 1ZOHA 1JSUA 4BZDA 1M7NA 3FMLA 3B2WA 5FM3A 5I3RA 5BVOA 3SA0A 5L6OA 3OWKA 4ZLZA 3F5XA 2OI4X 3TWJA 4CSVA 1WBTA 4XP2A 4EUTA 5EDQA 5J5SA 4BKZA 3NUNA 4NM7A 5D7AA 4FMQA 3UNZA 3K5VA 4JRVA 3E92A 4D55A 4X0MA 1X8BA 4QP3A 3OY1A 2OH4A 1XH7A 5KBQA 1XHAA 2BKKA 3G6HA 3HV3A 3V01A 4GT4A 3VBXA 1YXVA 5GINE 5ANOA 2XKDA 2W99B 3R30A 4CZTA 2WMRA 4UYAA 2WU7A 5D11A 1OPKA 4EOIA 2XNOA 3RTPA 3R7VA 5J87A 2XK7A 4EYMA 3DAKA 3PSCA 1KV2A 2I6LA 4LGDA 3BLRA 3E5AA 3DB6A 1ZY5A 3DBDA 3Q5ZA 4MKCA 4FR4A 4H3QA 5JSMA 3PXQA 3H0YA 3QD4A 3OHTA 4XG7A 2JAMA 1BKXA 2P2IA 3PXYA 1Q5KA 3C4FA 3IDPA 4BTMA 2XNMA 1JOWB 3S1HA 4Q5HA 2QONA 1BYGA 4BCJA 5HE2A 5FDPA 2C0OA 5CSPA 3KMWA 3NYXA 4GV1A 4ZS0A 5G1XA 4D58A 4WG4A 4O7LA 2BVAA 4HVGA 5M08A 3KF4A 4C0TA 2OJ9A 3DFAA 4FICA 4M13A 5J95A 3MPAA 4FT5A 3TDWA 4F08A 1YWNA 4EHGA 5DG5A 3BGZA 3ZLYA 4MF1A 4TL0A 3GU7A 3O2MA 3MW1A 4L7SA 3VUGA 3TIYA 1YKRA 1UNLA 3FXXA 4NH1A 2OZAA 2QODA 2X39A 4CGAA 3BYVA 4IJ9A 4YC3A 2X2MA 4IACA 5F94A 4L3JA 4D4YA 3NUYA 1AD5A 5DLSA 2B1PA 1AQ1A 4Q9ZA 4LMNA 4LOOA 1REKA 3DQXA 4ANNA 4S32A 3A99A 4TKSA 3IW8A 2GNFA 3MBLA 4DFLA 5AEPA 4EORA 3IOPA 2R3OA 4FKLA 1ZY4A 4FIHA 3AT2A 3R63A 5HCZA 1QPJA 2XIXA 2GDOA 3G51A 5T6KA 1PXLA 3DAJA 3BEGA 3QTSA 4HZRA 2EU9A 4EQMA 3MI9A 5HU3A 1CMKE 2HOGA 3NW7A 3OT8A 5K3YA 1VZOA 2WMVA 4W8EA 5DMZA 2W4JA 4QYHA 5FG8A 3BU6A 4L68A 1Q99A 4ZTQA 4X3JA 3EN5A 2ACXA 3MTFA 3S0OA 1H25A 3ELJA 3HYHA 4OTGA 4TT7A 5KZIA 5EKOA 2FSTX 5E7RA 4FL1A 4O7YA 1TKIA 2GFCA 1GZOA 5FWKK 2X0GA 2YIRA 3WOWA 2WMTA 3DV3A 4KSPA 4QRCA 5FP5A 4PQNA 5FXQA 2XYNA 3VUHA 4PMMA 4IB1A 2ZJWA 2JKOA 3FWQA 4MQ1A 4JDHA 4D2RA 1ZWSA 3PE2A 4KS7A 4QNAA 2A4LA 2WQNA 3MVMA 2GS7A 3AC5A 2CSNA 1M2QA 3G9LX 5HVYA 1TVOA 4PF4A 2PMNX 3MY5A 4O38A 2JKMA 4KA3A 2C5XA 3RAKA 5TT7A 3F3UA 3JYAA 2QURA 3V5PA 3GFEA 3GQIA 3PZEA 4BICA 4FGRA 2PVNA 4FTCA 4AN2A 4AZWA 3SRVA 3K5UA 3EZVA 4NT4A 5HIEA 5CEKA 4G17A 2BDJA 4H1MA 3V04A 1IAJA 4EOPA 1PKGA 2O64A 3CR0A 2PZPA 4O0SA 3U9NA 3KCFA 1WBPA 5DOSA 5KMLA 5HE1A 5BYZA 3VS1A 1PYEA 5E1SA 3V5TA 2CGVA 1JWHA 4C2VA 2C6TA 2ZB0A 4IADA 4RZWA 5GZ8A 3SW4A 5IA1A 3GB2A 2B55A 3QL8A 2ZMDA 4BHZA 5M06A 3QTUA 4AW1A 3ULZA 3ITZA 3WYYA 4RX8A 5DFPA 2W9ZB 3PPJA 2W5BA 4E4XA 4K18A 5AUVA 3O8UA 3ZZWA 1NY3A 3EWHA 5AR2A 4CG8A 3I7CA 2XNPA 2UV2A 5E9EA 4YTIA 1HCLA 4AWIA 3A4OX 4DGOA 3NW5A 4BDBA 4ZLYA 4DH1A 4CFWA 2PUPA 2PVMA 1FINA 5GIPE 2B53A 4RVTA 3MWUA 5EHYA 4FIFA 5A6OA 4J52A 2C47A 1JBPE 4YSMA 5TKDA 2YACA 2QOKA 4ZTNA 1BL6A 4J97A 4U9AA 3ORTA 4A9SA 4CLIA 3W2QA 4FF8A 2C6MA 3GXLA 4L43A 3HA8A 3W8LA 4BTJA 4FVQA 1SYKA 5G6VA 2PSQA 3Q9WA 3W32A 2GS6A 5HZNA 5HHWA 3SG9A 4AE9A 4X6RA 3G6GA 2UZOA 3H9RA 2CKEA 3E8DA 3F82A 4ACDA 3VHKA 4FYOA 4C8BA 2PU8A 4UMQA 4G3DA 3R7GA 2VWBA 3T3UA 4HYIA 1NXKA 4KRDA 3HZTA 1QL6A 4J7BA 2HW6A 3FZTA 4UXLA 5D7VA 5DVRA 4DGLC 2W96B 3BHUA 1ZMVA 2BRBA 2J0MB 3QGWA 4H3PA 5LVLA 3EFKA 3UOKA 3S4QA 1R39A 2J7TA 3GOKA 2WFYA 3QALE 1BL7A 2Y4IB 4JAJA 3RWQA 2PWLA 4QMXA 4MBIA 1FMOE 3UZPA 3PP0A 4FODA 4AZVA 5B2MA 2PE2A 2WO6A 4O21A 2J0LA 5CU3A 3SDJA 2CCHA 3BQRA 4A06A 4ZMFA 2XIYA 2R0IA 4XH6A 4AN3A 5I5ZA 2PTKA 3OC1A 4CCBA 4FTJA 4G6OA 3UVRA 4QTEA 4B4LA 4K0YA 2G1TA 3EYHA 4DEHA 4R77A 5CEIA 5AADA 2VTLA 4G3CA 1A9UA 4C34A 3K3IA 2JITA 2QCSA 4JL9A 4QP1A 2YIQA 3COMA 4AFEA 4WG5A 3AGMA 3GFWA 3GUBA 4I4EA 3CKWA 3KY2A 5IH6A 4ZSAA 1H1RA 2XIRA 1XBCA 2ESMA 5J79A 2EXCX 3NNVA 1Q61A 2QOOA 4K9YA 3F9NA 4DN5A 4MCVA 4EBVA 4LUDA 2ITZA 2UZLA 3E7VA 4U45A 4O0RA 4BDCA 1G8AA 2OXXA 3P86A 4BVUA 3QFVA 4GJ2A 5FP6A 4MTAA 2J90A 2WELA 4FV5A 5I9ZA 3W1FA 3R9OA 3RAIA 3PY1A 4NM0A 2C5VA 2XKEA 1MUOA 1YXUA 1R0EA 3QQJA 4LI5A 2XCHA 2OGVA 2CPKE 2R7BA 3ORKA 5CSWA 2YM8A 4EHVA 4ZY4A 4XUFA 3DK3A 3OD6X 4QP2A 4AP7A 2CNQA 3GNIB 4I23A 3C0IA 2XK8A 4YHFA 5ANJA 5FEEA 2E9NA 2YN8A 4QQTA 3FLWA 5KHWA 5DE2A 5HD7A 3MIAA 2YITA 4NW5A 4JS8A 2W1GA 5C8NA 4JLCA 4XEYA 4BN1A 3TUBA 5BVDA 3IOKA 2GTMA 2IJMA 4FV9A 5HBHA 4XHKB 4ZEGA 4OTQA 4BGHA 4DEIA 1OIRA 4RC2A 2IVTA 2WTKC 4TWCA 4U8ZA 3UIBA 5IF1A 5TF9A 1JSVA 5IQBA 3FZ1A 4CXAA 4BIDA 1M7QA 2YLEA 4L9IA 1Q8YA 4XS2A 5IA3A 2BUJA 4BBMA 2PVKA 4IEBA 3VUMA 3MYGA 3IGGA 5KMMA 3JVRA 4NWMA 4UMPA 1YHVA 4WNPA 3I6WA 2E9VA 3IQ7A 2O5KA 3RCJA 4F6UA 2SRCA 3FMDA 3KB7A 4O84A 1H28A 2VRXA 3VF8A 3BIZA 3H30A 4GYGA 4JOAA 4B6LA 1PF8A 3KU2A 3FHRA 5B7VA 4BDJA 2V62A 5KCVA 3CSVA 3D9VA 4O91A 1OIUA 1TQIA 5HCYA 2JFMA 2QU6A 4KKHA 1XH5A 3QD3A 3RBWA 3VHEA 4DG3E 2FH9A 4DH3A 3QCQA 4GRBA 4I0TA 3W2RA 1OUYA 3LLTA 3FQHA 3A61A 4EQCA 2R2PA 4BF2A 4F9CA 3ZBFA 4GT3A 2WTJA 4UMTA 2BAQA 4RWKA 5JFXA 4APPA 2C5OA 4O83A 5CF4A 1YI4A 1Q3DA 4FKPA 2NP8A 3FYKX 2EXEA 2W9FB 2GNHA 2CGXA 4CKRA 2JLDA 4ANLA 3UC4A 3RALA 2XRUA 4QYFA 5ACKA 1MRYA 4BWXA 3FPQA 5M56A 2C30A 4QMZA 4RFZA 1UVRA 4FEUA 3UNJA 4K1BA 4D2TA 5CVGA 4QO9A 3QC4A 4IVBA 4G9RA 4PDYA 2GHGA 4KBAA 3FJQE 5K0XA 4I41A 2O3PA 2X2LA 3I79A 1LUFA 3QTQA 4QTDA 5DIAA 3RZBA 3TZ7A 2GQSA 3ZSGA 3R1NA 1IA9A 4XYFA 3FXZA 1BLXA 4L67A 2YZLA 3BELA 4E1ZA 2HY81 4KBKA 1XJDA 4DH8A 3EKNA 4C4HA 3P9JA 3LFDA 5BUIA 3U6HA 5I9WA 4H58A 3TZ9A 1CKJA 3AD4A 3LHJA 4IVAA 3IO7A 4OTRA 3W10A 3ATSA 4FSRA 5E8TA 4NZWB 3R21A 4LFIA 3KL8A 3ZCLA 2Z8CA 4I6HA 1JKSA 2B52A 3HRBA 4GL9A 4MX9A 4CTBA 4MXYA 2QOFA 5HBJA 1NW1A 4RFYA 3O50A 4A9YA 3MS9A 4RG0A 3DLSA 3R9NA 1YI6A 4OUCA 5DT3A 2JIVA 4MXXA 3I1AA 3S2PA 4CYIA 4IFCA 2ITNA 5HVKA 3QLFA 3LCKA 5LVPA 4O0WA 2EB2A 3RZFA 3S00A 4FUXA 4LUEA 4FT0A 4DLJA 1YWRA 5E1EA 2W7XA 5DWRA 3QQHA 4I4FA 4NK9A 3F2NA 2JGZA 4ZSEA 2PMIA 4FSTA 3QX2A 5E8YA 3CTJA 2YWVA 5EDPA 1UNHA 2HENA 2WIPA 5HVJA 5T3QA 4L42A 2OKRA 5L6PA 1O6KA 4L6QA 2BMCA 2HK5A 4M12A 3U6JA 5ETAA 5FTGA 2J2IB 2R3GA 3R0TA 3LQ5A 2YJSA 5FDXA 1K2PA 3ZLWA 3BGPA 3NMUF 1ZMWA 5IA0A 3H9FA 4RQVA 2XS0A 3LAUA 5AUYA 5CT7A 4B8LA 1LPUA 2P3GX 3EL8A 4Z16A 3GCSA 4H36A 3ODYX 5EFQA 3U51A 2QKRA 3M11A 2WHBA 2WMAA 3ORIA 4AGWA 3VWAA 3UYSA 4DEGA 1KE8A 3TN8A 4MD9E 4U40A 5AP3A 3ENMA 2Z7RA 3F7ZA 2RSVA 3Q9XA 4FSZA 4XBUA 5ANIA 5CAOA 5DR6A 2VWXA 4X21A 3F5PA 3KRWA 1PKDA 3Q53A 2UW7A 2WMSA 4GVAA 3LIJA 4ACCA 1UU8A 2FGIA 2GPHA 3KK9A 4O7SA 2UZBA 2PYWA 4NJDA 4HGLA 4KIPA 3DOGA 3R04A 4PTCA 4M7IA 3TACA 4D4VA 2WTCA 2VX3A 3RPOA 3W2PA 4EH5A 1ZLTA 3UNKA 2RG6A 1ERKA 4QP6A 1H1QA 5AFVA 3TNWA 4Z55A 4DH7A 4LYNA 5JRSA 1H0WA 1UKIA 3KREA 4EKKA 2Z7SA 4E4LA 1W0XC 3BWJA 3CE3A 4IW0A 2REIA 4D2VA 1W8CA 3QUEA 3F2AA 2BHHA 3QRTA 4EC9A 4K33A 3LKMA 3SC1A 2W0JA 4QMNA 3NIEA 4F1TA 3UO4A 5JKGA 2UZDA 2H96A 3CEKA 4O6LA 3TCPA 5ICPA 2XB7A 5I4NA 4OW8A 2OICA 3PUPA 1Z57A 3D14A 3KN6A 4RA4A 3GC0A 4O22A 4G6NA 3ZRKA 1G3NA 3KF7A 5JN2A 4DT8A 2HZNA 5BYLA 5L2WA 1H0VA 1J3HA 4Z7GA 2X7OA 5M4CA 2HYYA 1YHSA 2VV9A 4J8NA 5AV0A 4FOBA 3U4UA 2DYLA 2VTJA 2C0TA 3HMNA 4QP8A 3MH3A 2ZV8A 4XG2A 3LMGA 4D1ZA 3IW6A 4AG8A 1WBOA 3ERKA 5LJJA 4NFMA 3TV6A 2W06A 3R7OA 3L9LA 4BCIA 2QR8A 5EQEA 3D7TA 4E20A 4LG4A 5J9YA 2OBJA 4C36A 4GK2A 5CXZA 3MESA 5ACBC 2BIYA 4A9UA 4BTFA 4GSBA 5CXHA 2YAAA 4DGGA 3CQUA 4FSWA 2W1HA 4GMYA 5CI6A 4D9UA 1YDSE 1PXOA 1UU9A 4I92A 1UU7A 2XNBA 4N0SA 3R1YA 2BRMA 5HG8A 3FL5A 2Z02A 4ZLOA 4F9WA 4UY9A 5E92A 2ETMA 5KE0A 1SVGA 1PXIA 4RIWA 4C4IA 1CSNA 4F99A 1CDKA 3E64A 5KMOA 5FQDC 1FVVA 4QMYA 3F3TA 1SZMA 2IN6A 5L2IA 1CTPE 4PP7A 4FTKA 2YFXA 4JDKA 2QG5A 4YBJA 2BPMA 3R8LA 5CANA 2WTVA 5CNNA 5BYYA 3OMVA 3S3IA 4EH8A 3V5JA 2XNNA 4QYEA 4BC6A 2E9OA 2CHLA 4NIFA 3V8TA 1YI3A 4Y5QA 4QOXA 3OUNB 2E9UA 5L2QA 3OW4A 4JQ8A 3G33A 3OWPA 3IS5A 3FE3A 4RJ6A 3OBJA 1ZOGA 2X4FA 4NM3A 3BBWA 2A27A 2C6IA 1M2RA 2JDRA 2FYSA 2W1IA 5IUHA 3PA3A 2QOHA 2Y6OA 3O7LD 4FV3A 4RBLA 4FKJA 2RGPA 4LM5A 3G0EA 5ETIA 4K11A 2F2CB 3A60A 4F9AA 2OSCA 3UE4A 5HTBA 2WQMA 3R6XA 3ZBXA 4FZDB 3ZXZA 4APCA 4D0XA 4DGMA 2OXYA 2C5YA 4FNWA 4RWJA 2YM7A 1URWA 4RX5A 4JBPA 4WUNA 1F5QA 2R7IA 4LGGA 4ONAA 2W1DA 5AAFA 5DA3A 1OL6A 1YHWA 4Z3VA 5HX8A 4FSQA 3F3VA 3Q96A 2XEYA 3CKXA 2F4JA 3HKOA 3NDMA 4FBXA 2B0QA 5GIOE 2EWAA 1IRKA 3ZTXA 4M0YA 3FV8A 3OTUA 4I6QA 2YCSA 2O2UA 4KIOA 2C3KA 2R3HA 4FTOA 4FSMA 3MFTA 1HOWA 4GK4A 3V5QA 3R00A 4DA5A 4Q5EA 4RIXB 3AQVA 2ZM1A 4PMTA 4CKIA 4MHAA 4CFNA 3BV3A 1I09A 4MYGA 2VTRA 2OH0E 5LARA 1MRVA 4QPMA 2XKCA 3KEXA 3SLSA 4F0IA 3LFQA 3CLYA 4FZ6A 5KHXA 3UIXA 2XJ1A 5DH3A 4KS8A 1VYWA 3AD6A 4NW6A 2IPXA 4XG6A 1OMWA 4QMSA 3PJCA 5AM6A 3VBTA 3HVCA 3Q04A 3BU5A 1U4DA 2YIYA 3NRMA 4F6WA 3UO5A 5EW8A 3GT8A 4DFNA 5IA5A 4DGNA 4UMRA 3E88A 4YJTA 1IA8A 3V5WA 2VN9A 3ETAA 1OKVA 1FVRA 2GNLA 2YM4A 4O0TA 3VQUA 4D1SA 4BIBA 5JRQA 4ITIA 5AP2A 4EKLA 5C27A 3Q60A 2ETRA 3TTJA 4CFVA 2B9FA 3Q2MA 3VW8A 4UZHA 3TTIA 5GNKA 2PUUA 3FAAA 3L9NA 4F7NA 4JIKA 4OBQA 2BROA 4O7ZA 3TUCA 3KC3A 1OZ1A 3QQLA 4W4VA 4QYYA 2KULA 1RDQE 2Q0BA 1VJYA 4FTQA 4FZ7A 3RPRA 3FL4A 4RIWB 2PVYA 3BE9A 5DPVA 3PJ2A 1Q97A 2B54A 3ROYA 2HELA 3OWLA 3COIA 5AUTA 3GC7A 3O7LB 1U5RA 3KVWA 1B6CB 4U3ZA 5JMSA 3QTXA 1SMHA 3NSZA 4G5PA 3OS3A 1UNGA 3OF0A 4WNOA 4X3FC 2YIWA 4S2ZA 4E4MA 1J1CA 2VD5A 4NIFB 4BI0A 2HWOA 3VRZA 3T9TA 2VU3A 4I21A 5KO1A 3HAVA 4JBVA 2HXQA 3PY3A 5EHOA 4UWBA 4ASZA 4WKQA 2PE1A 3A7JA 2H8HA 4WBBB 5C9CA 5F1ZA 2F49A 3ZM9A 4FT9A 5A46A 4AA5A 2RG5A 2Y6MA 3A7HA 1XKKA 4MWHA 4R1VA 4AQCA 3KXMA 5HQ0A 4FK6A 4GW8A 3MY1A 4KRCA 3A4PA 4FV4A 4IWQA 3ATTA 4YZDA 3WF8A 3PRFA 5CQUA 2FB8A 3HV5A 3ANQA 1H4LA 2UZUE 3NYOA 4OTDA 1OIQA 1NVQA 3BX5A 4C4GA 3P4KA 4CV9A 4ZS4A 3RI1A 1DAWA 3AGLA 3D4QA 2ZM3A 2YDJA 4PNIA 2YISA 3ZDIA 5HU9A 4I5MA 1GJOA 3FSKA 4CRSA 1U59A 2RFNA 3NLBA 4FT3A 4EWQA 4I5PA 2ZM4A 2Y8OA 5E8XA 3C4EA 4FNYA 3R9HA 4GKHA 3BEAA 4YPDA 2XVDA 4ZSJA 5E90A 3OW3A 1GIJA 4ACHA 3DAEA 4B8MA 1KUTA 3VS7A 1PJKA 4CFUA 5IA2A 3BYMA 3OBGA 3N4UA 4MNEA 3GBZA 4U43A 3QQFA 5AX9A 1XH4A 2XK9A 5I3OA 4KSQA 4YGAA 4FKSA 3QYZA 4QMVA 3TKUA 4B99A 4ID7A 3U55A 2FUMA 4CD0A 4EOLA 2I7QA 4Y5HA 2OXDA 2FSLX 4YTCA 4FV1A 1STCE 1PMVA 4M0ZA 4MXCA 1IG1A 4ZTRA 3ZFXA 4GKIA 2C0IA 2WQEA 3PVBA 4O7WA 5IH5A 2EXMA 3L9PA 5BVEA 4YO6A 1JKTA 3UQCA 3R9RA 2XJ2A 3MH0A 3WYXA 1GIHA 3A2CA 2QG7A 5C8MA 4LQMA 2JBOA 4NM5A 5A4QA 2CKPA 3CQWA 2B4SB 2BTSA 1Q8WA 3TIZA 3JS2A 3O51A 4ZTSA 5LVNA 5D9HA 5BVFA 4FE2A 3KVXA 3ORNA 4CZUA 5LMAA 4EL9A 1UA2A 1KOBA 1PXKA 5AMNA 3FPMA 3RK9A 4AA4A 2ONLC 3O71A 4Y95A 5FTOA 5IPJA 4YR8A 4YC6A 3JY0A 3IW5A 4GIIA 1WBSA 4OTWA 1VEBA 3QF9A 4EYJA 3SG8A 2A19B 3F6XA 4XG3A 1V0PA 5BVNA 4RQKA 1SNXA 5AP1A 3FKLA 4UYNA 5DYJA 4WA9A 5LOHA 3FY2A 4M15A 3I0OA 1JVPP 4CV8A 2Y9QA 2CLXA 5HEZA 1GY3A 4YURA 2BZKB 4XNEA 3WZKA 4BDFA 2DUVA 3OCGA 4UZDA 4L01A 3PP1A 4JBOA 2R3JA 3QCXA 4RSSA 4E8AA 3NNUA 4BHNA 4I94A 1A06A 2NRUA 2OU7A 1JLUE 3WE8A 3QUDA 4DG2E 4PPCA 4IQ6A 4USDA 3PG1A 3VVHA 4R78A 3VBVA 3ORXA 4NSTA 1EH4A 1Q8ZA 4X2GA 3QQUA 3VUTA 5BMMA 4QQJA 4D1XA 2F9GA 4AUAA 1UKHA 3UG2A 3VUKA 5JH6A 3T9IA 4ANQA 1A48A 2C1AA 2XIKA 5AUUA 3EHAA 4PPBA 3PA4A 4GUBA 5BUJA 3G5DA 1E1VA 2XM9A 3G90X 3TKIA 3F61A 5CAQA 2UW4A 3NPCA 3EQPA 2QVSE 3FC1X 2X8EA 3OP5A 3PLSA 3FLZA 3DKFA 4FKUA 3QYWA 4HZSA 5L8JA 3ZDUA 3GP0A 3W2SA 4RZVA 4BGGA 4EOSA 4CLJA 5B2LA 2EUFB 2BIKB 4PNKA 4E6QA 3RPYA 4LRJA 4OTHA 4YNEA 4AZTA 3QZFA 3EFWA 5IQAA 2XF0A 3O0GA 4GG5A 2Z7QA 4IAYA 3UZTA 2OZAB 3MH1A 4FV7A 5EYMA 3CJFA 1MP8A 3MJ2A 4LV8A 3DBQA 4LMUA 2Y4IC 3C4CA 4IVDA 4EH4A 3MY0A 1UWJA 4JNWA 4HVDA 3LXKA 3AC8A 5J7BA 2VGPA 3PXFA 2QOIA 1OBGA 1ZZ2A 5AR7A 3VS5A 4EH9A 2VX1A 2GQRA 1P4OA 5C8KA 3DDQA 3PLAE 2IZTA 4LOPA 2UW0A 3MTLA 2QKWB 4AX8A 4BKJA 2QOCA 3PYYA 3SXRA 5GJDA 4BGQA 3F88A 3FZRA 3F2RA 4M69A 1XQZA 5AP0A 1ZOEA 3AC3A 4FUYA 2V55A 3FMMA 3QZIA 2C6EA 4II5A 3RWPA 5IMEA 3K54A 1WBWA 3AD5A 4FV0A 2CCIA 3TUDA 5CWZA 3Q4ZA 3EFJA 5C01A 2UVYA 3E8EA 4MAOA 2WTDA 4C3FA 3BWFA 3NWWA 1W98A 5F9EA 4DFYA 2VTSA 2RFSA 3Q4CA 3R8ZA 3NEWA 1APME 3C5UA 4HCUA 5BVKA 2C6LA 2UZVA 4ASXA 1Y91A 3HP2A 2KTYA 3C13A 4PL3A 3KN5A 3RINA 4YJUA 3ZM4A 4ASEA 5CAUA 3NUPA 3F3ZA 4YJOA 2H9VA 2ITWA 4G16A 4DFUA 4XLIA 4O82A 3FLNC 3O8TA 1YXSA 2WGJA 3LOKA 5CU6A 3ROCA 4YU2A 2V7OA 4FK3A 4EH6A 1OI9A 3LFCA 3R1QA 3FI2A 3ZXTA 3MFRA 1S9IA 1H1SA 3PY0A 1NA7A 4TRLA 4X2JA 3P0MA 4EH3A 2OJGA 2AC3A 3E7OA 3EZRA 4G9CA 2WIHA 4IC8A 3FLQA 4FIEA 3PVUA 4TYGA 4KKEA 2GHMA 2IVUA 3UO6A 4DE4A 3THBA 5FTQA 3H10A 3UC3A 2YDIA 2JAVA 3E8CA 2C1BA 4HYSA 4R3CA 2VTTA 3KCKA 4W4WA 1MRUA 5KZ0A 3WARA 4EZ3A 3U54A 2G01A 3PJ3A 2W17A 4A4OA 5CSXA 3U87A 3W2OA 4K6ZA 2XIZA 2QQ7A 5BX0A 2J51A 3SRVB 3PIXA 4IE9A 3DXNA 4C38A 4C58A 1H1WA 4C57A 2Z2WA 4P5ZA 4IMYA 2QC6A 2GSFA 4ANSA 2IZSA 3I5ZA 4YMJA 4W9XA 3CXWA 4GFGA 2VWUA 1XBAA 4HJOA 4D2PA 2QR7A 1B38A 3QGYA 5EH0A 4F7LA 3NVKI 2W1EA 3RM6A 4RIYA 5I9VA 2H6DA 3EQCA 3ZRLA 2YWPA 3W16A 2OWBA 5AP5A 3NUXA 4HCVA 3C0GA 5F4NA 4IVCA 3AC2A 4Y8DA 2C6DA 4IWPA 3SHEA 1WAKA 1LEZA 4JVGA 3A7FA 5DRDA 1OB3A 5EM5A 2YLFA 4EWHA 1H08A 5KMKA 1ZYJA 4XLVA 4OTFA 1RQQA 4BCFA 3VC4A 1NVSA 3VS4A 2JBPA 2QLQA 5HG9A 3BE2A 3HUCA 5DI1A 2HZ0A 2OFVA 4HVHA 5K4JA 1M52A 3P78A 3DKGA 1H07A 4DFXE 4C33A 3TNHA 4F70A 2OW3A 3OFMA 3PIZA 5CU0A 1XH6A 3CP9A 4YLKA 4D5HA 3QZHA 3CIKA 3PIYA 4M69B 5CVHA 5CU4A 3CS9A 3K2LA 4PWNA 5CI7A 3R8MA 5JZNA 5L2SA 1U54A 4GVJA 5I9XA 2WD1A 4KABA 5AIKA 3C51A 4K2RA 1OKZA 3SQQA 5EI2A 4EH7A 2OZOA 4MVFA 3PJ1A 1T45A 2ERKA 4D2SA 5A6NA 4BI1A 3GC9A 4YPSA 4OBPA 2P4IA 3BKBA 3MA3A 3MN3A 1PRYA 3RHXA 3NS9A 5E8VA 3R2BA 3QRUA 4DFZE 3LCDA 4FEXA 4DTAA 2IO6A 3RP9A
chains in the Genus database with same CATH superfamily
4YJVA 4YBKA 2OO8X 2VNWA 3P7BA 1QPCA 3ZS5A 2OIDA 4TNBA 1HCKA 2F7ZE 3VW6A 4J96A 1W7HA 3JY9A 3PA5A 4C4FA 2UZNA 5GZ9A 5M4UA 2XALA 4L45A 4DCEA 2OF2A 4L52A 3SD0A 2ERZE 5A4CA 4Y85A 5KBRA 3TG1A 4PTGA 2P33A 4R1YA 3HDMA 4GS6A 1VYZA 3GU8A 4CZYB 4XV1A 4BDAA 2ITPA 1ZYLA 3BBTB 2B7AA 3ET7A 4FTRA 3FDNA 5F95A 4E26A 2YERA 1L3RE 4FOCA 4O0YA 2QO9A 4ZTLA 3RHKA 4ZZOA 4DTKA 3QAME 5A3XA 4EOKA 2XK6A 3WI6A 3SGCA 2J0JA 3LFAA 3W0OA 4NFNA 3FLSA 1UU3A 2BTRA 4O2PA 5HO7A 5HORA 4EH2A 1QPEA 4UXQA 4F65A 5AUZA 2I0YA 3MB7A 4IZYA 4ACMA 3ZRMA 3UQGA 2YM6A 1P4FA 1YVJA 4KNBA 4FKOA 5AWMA 2VO7A 4ZY6A 4AW5A 3QLGA 5KNJA 2OIBA 3FZSA 4M8TA 3LFEA 4AFJA 2F57A 4U0IA 2O8YA 2XKFA 3QZGA 4HGSA 2UW9A 1OIYA 4FZAB 4XV3A 3VUDA 4BBFA 5I0BA 2ZV7A 4AF3A 5DHJA 4FEVA 2XZSA 4BZNA 3DBEA 1UV5A 2WMUA 4ZP5A 3DK6A 4RIYB 3RK5A 3CTQA 4UALA 2IG7A 4RC4A 4BCQA 4FYNA 5FLFA 5L6WL 5IISA 2CJMA 5JFWA 3FKOA 4RRVA 4CMOA 2ITQA 3FLYA 4J1RA 2JDTA 3BQCA 4FEWA 3TYKA 4UV0A 4RJ4A 3F7WA 4UWCA 4TYEA 2I1MA 4KKGA 4QPAA 3SAYA 1F0QA 3UOHA 3Q2JA 2JDOA 4EK5A 3E93A 4ZIMA 3KXGA 3OUKA 3D2KA 5ANKA 4JRNA 4A9RA 1PMEA 2YABA 3I6UA 2IEWA 4AOIA 1W83A 5CU2A 4YTFA 5IH4A 4H39A 3D15A 4P4CA 5FGKA 4O0UA 4DEEA 5IZFA 3RMFA 4AW0A 4HYUA 5IUIA 4XG8A 4J8MA 3TV4A 4NYEA 4L44A 4L7FA 4G3FA 5DRBA 4CVAA 4I24A 4GFOA 5JZJA 5BVWA 3CBLA 3OCTA 4HGTA 1U54B 5CEMA 3HP5A 4CMTA 3L9MA 4WRGA 5DT4A 2R3QA 1FPUA 2C6KA 1KSWA 3Q9ZA 4Z9LA 3ACKA 3FUPA 3QA0A 1H24A 4XRJA 2OFUA 3WF7A 2OK1A 3HA6A 4AOJA 4Z7HA 2NYAA 2G2IA 2BZJA 3E87A 3II5A 3VJOA 2H34A 4HNFA 3QX4A 1R1WA 3DT1A 3IECA 5M55A 4F63A 4NJ3A 2UW8A 4YZNA 3UVPA 2P2HA 3HLLA 4JJRA 5CT0A 3ZC6A 4QMPA 4I0SA 3O17A 2BFXA 3AT3A 5C03A 3R83A 4OGRA 4DEBA 5IKWA 5AR3A 2PVJA 2VWWA 2J50A 2XUUA 3AC1A 2NPQA 4I6BA 4RVLA 3MV5A 2IWIA 2GCDA 3OEZA 2IW9A 3TV7A 3KRXA 3R73A 1ZMUA 2CNVA 2C5NA 1ZAOA 3LXPA 1OPLA 3QCSA 4B9DA 4ERKA 3HMMA 1KE7A 2WNTA 2CLQA 3QTWA 4I0RA 4QD6A 2HY0A 4LRKA 5HICA 4XP0A 4FKRA 3QTZA 4MF0A 4RT7A 3CY2A 2RFDA 5AR8A 3VJNA 4RX7A 1H00A 4ARKA 2HXLA 4G1WA 1OL7A 5AP4A 4Q9SA 4F9YA 5C26A 3P7AA 5HTIA 4RFMA 5AAGA 4QMUA 2QHNA 2UW6A 4GJ3A 3G2FA 4FTLA 4NTSA 3VBYA 3EIDA 1OVEA 4PTEA 4QMMA 5CSHA 5CEPA 5L3AA 1DAYA 4FTNA 3EN7A 3SXSA 4YLLA 3NUAA 4P5QA 5M51A 3C5IA 4L00A 4RPVA 4WIHA 3TKHA 2BZIB 2JIUA 4FC0A 2UVZA 4UN0C 1BX6A 3C9WA 4FIGA 2WEVA 1Y6AA 4I3ZA 3VBQA 5KUPA 5M09A 4XJ0A 4KINA 3UDTA 3EL7A 4H05A 4FSNA 4BKYA 4AGUA 4EC8A 3P1AA 3QHWA 4UBAA 4FI1A 3W18A 4DC2A 2OLCA 1RE8A 3OT3A 1R0PA 4ACGA 2YEXA 4IAZA 3RKBA 2Q83A 4AXFA 2BILB 3UIUA 5M4IA 3HAMA 2A0CX 5HNGA 4CQGA 5AJQA 3HGKA 4L46A 4NCTC 1PHKA 3TT0A 5CZHA 2JC6A 5EKNA 4YJPA 5J8IA 2JKKA 3AG9A 4FTUA 1FQ1B 3Q5IA 4C3RA 4K8AA 5EM7A 4QMLA 2W05A 4U5JA 3UVQA 2VWYA 3PE1A 3ZEWA 2PZRA 3ZH8A 2F7EE 4S34A 4XG4A 4J95A 3QD2B 5TR6A 1Q8TA 4F7JA 3ORPA 5D41A 5H8GA 5HGIA 1GIIA 3UODA 3MIYA 3IPHA 4F0GA 2PUNA 4JMQA 5IDPA 4BB4A 2PVRA 4EZ5A 3CC6A 4GCJA 4KBCA 5D12A 4O7TA 2R3NA 2C6OA 5HG5A 5IQGA 4WNKA 5A4TA 2BRGA 3E63A 4NU1A 5I9YA 4O7RA 3WZJA 3A8WA 4OBOA 4HGEA 5A9UA 4EEVA 4O7NA 2VNYA 4Q2AA 2VGOA 4E5BA 5DEWA 3DKCA 4B0GA 1YOMA 4YC8A 3WILA 4AA0A 5C1QB 2EVAA 4E6AA 4HPTE 3UZRA 3LFSA 4EHEA 1PMNA 2WU6A 3MPMA 4OTIA 5HLWA 5FEDA 3VS2A 5KKRB 1YDTE 4IWOA 1NT2A 5TO8A 3KRLA 3UYTA 3EJ1A 3HDNA 3QKLA 3QU0A 2HWPA 2VWIA 1CKIA 2GNGA 4ALWA 3Q3BA 4KAOA 2HZIA 3CTHA 1XWSA 2HZ4A 5CY3A 3IW7A 4GYIA 4OT5A 4USEA 1JNKA 2YM3A 3IONA 5EOLA 3QCYA 2BR1A 4IAAA 4YZ9A 3UGCA 2R3PA 4CYJA 5AV4A 1PMUA 2VO6A 4FIJA 3ZLSA 3KULA 3N4VA 4YZBA 3ALOA 3HV7A 4JXFA 3C4WA 1J7UA 3SW7A 3EN4A 5AA8A 1XR1A 4EOJA 4KIQA 4XV9A 3C1XA 3I60A 2V5QA 4QP7A 5A4LA 3G0FA 1BI7A 5M44A 3Q6UA 2XK4A 3LVPA 3WBLA 4O7VA 5CF8A 4BDKA 1JSTA 4WOVA 1GZ8A 3A7GA 3DK7A 4FRFA 3DZOA 2IW8A 1NVRA 3DNDA 4QP9A 2IZUA 2VZ6A 5JGDA 2J0KA 5LMKA 2YIXA 4RJ3A 4GU6A 1U46A 5ANGA 5CF5A 4ITHA 2UVXA 4IZ7A 3NNXA 4TTHB 4RWLA 3KMUA 4MNFA 1ZYCA 2VTAA 4QMQA 4RIOA 2ZMCA 5TOZA 4FTAA 1BMKA 3OOGA 3WF9A 3FXWA 3VAPA 5AX3A 2WPAA 3OOMA 5JFVA 3OROA 3BLHA 1V0OA 3EQDA 4DF3A 2X9EA 1OKWA 3VF9A 3CQEA 2E2BA 3MDYA 4D0WA 1FVTA 4YUQA 3HV6A 3ALNA 3R8PA 2A2AA 4AACA 2R3LA 4AN9A 5K5XA 1FOTA 1V0BA 3D5WA 4TWPA 1REJA 4X3FA 3KXZA 2O65A 4RLKA 5IG1A 3FHIA 5ANDA 3BZ3A 3KXNA 4U42A 2WKMA 4CQEA 3BI6A 3JUHA 2X1NA 3UPXA 1O6YA 3G9NA 3D7TB 4ANBA 5H8EA 5KMJA 4IAIA 4UEUA 2P55A 3R8UA 2HCKA 3PXKA 2CGWA 5I9UA 2G15A 3FI3A 4QQCA 5ANEA 4AAAA 4FL3A 3O8PA 4DEDA 3NW6A 4R6VA 4JQEA 3UJGA 4JBQA 1URCA 4FL2A 4HVIA 5DGZA 4DLIA 3GVUA 5J1VA 3I7BA 4ALUA 3DB8A 4K77A 5LXMA 4F7SA 1PY5A 4E6CA 3I4BA 3R01A 4R3PA 4M66A 5DNRA 4ANMA 1P5EA 4CT2A 3W55A 5DEYA 3D0EA 4G3GA 3KRJA 1OKYA 2ZYBA 4HOKA 3VQHA 1U5QA 4W4XA 4BCMA 4DINA 1Q3WA 3UDBA 5L8LA 1RW8A 3TL8A 5GZAA 5AR5A 4IX5A 1CKPA 3T8OA 4R3RA 5FXSA 3VIDA 1IAHA 4IX3A 3GC8A 4L3PA 2R3RA 3L8SA 3DKOA 4O1PA 4F64A 4BCPA 4M97A 4QPSA 5B2KA 4C62A 4N6YA 3TI1A 4ASDA 4CMUA 2C3IB 3LM0A 4A4XA 3E62A 4I6FA 5IQFA 1Z9XA 4MEDA 5AV1A 1W84A 2CN5A 1WFCA 2R3KA 3RK7A 2QO2A 2XM8A 3EN9A 2A1AB 2ZDUA 3KULB 3KXXA 4JAIA 4CRLA 4ORKA 3QKKA 3TZMA 3MH2A 1UWHA 1JKLA 5EHLA 2YA9A 1F3MC 4NEUA 4G31A 3JPVA 4JG6A 5DN3A 3VS6A 2ZFYA 5C4KA 2AUHA 1IR3A 4O81A 3W33A 3TJCA 4BWKA 1FGIA 2ZV2A 4DG0E 3LCTA 3PFYA 3R2YA 5ETCA 2G2FA 2IVSA 4QTAA 1KE5A 4F9BA 4EBWA 3E3BX 3IG7A 3OCSA 5H3QA 5BPYA 4O4DA 2PUIA 2WAJA 4IWDA 4WSQA 4ALVA 5HTCA 3V8WA 4RVKA 5FRIA 4F09A 3BGQA 2IVVA 3AMBA 4BWPA 2ONLA 4V0GA 5M53A 4JI9A 3EQRA 2J5EA 2QU5A 3ACJA 5ITAA 2NNWB 5AP7A 3DJ6A 4U3YA 3P79A 2PZYA 5E8UA 3R7UA 1CM8A 4ZTMA 5HO6A 2OIQA 1PXMA 2BRHA 2HIWA 3EYGA 3IDCA 4WG3A 4FNXA 4TN6A 5HESA 3UG1A 3UP7A 3L8XA 1YXXA 1KWPA 4RVMA 3V3VA 3GGFA 1SVHA 2ZB1A 4X3FB 4BDGA 3P08A 4AOTA 4E93A 1DM2A 2F2UA 2X2KA 4YHTA 2YCQA 4D2WA 5EOBA 4X2KA 2F7XE 3B8RA 3QRKA 4V05A 5J9ZA 3UMWA 3U9CA 4XP3A 2GFSA 4ZJJA 1JKKA 2YCFA 3OXZA 3SX9A 3DXPA 4FKWA 3D83A 2LGCA 4XV2A 2VUWA 3ODZX 3ZSIA 3UPZA 2PHKA 3BHVA 3V6RA 3JXWA 4DBNA 1YRPA 2G2HA 3QXOA 4GFMA 3KQ7A 3ZUUA 3PVGA 1QMZA 4PMSA 3RPVA 3TNQB 5HX6A 2GS2A 3D5XA 2QHMA 3RPSA 4MXOA 2R3MA 4CCUA 1GAGA 3W0NA 4S31A 2E9PA 2GTNA 5H8BA 1QPDA 2JDSA 2R5TA 3ULIA 1WBVA 3I0QA 1VLRA 4G6LA 3U8WA 2HAKA 5EYKA 4IB3A 3EOCA 4W4YA 3FKNA 4BDHA 4R7HA 4M67A 4AT4A 4KWPA 2X4ZA 4DTBA 4FX3A 3PPZA 4AXDA 3FZPA 3EH9A 3POZA 4WBOA 5HE0A 3DZQA 3R8VA 2JDVA 3VBWA 5EQYA 1K9AA 4EOMA 3WIGA 3BCEA 1H8FA 3WZUA 4HPUE 5CSVA 5LVOA 1SNUA 5HE3A 4DFBA 3LJ2A 4WD5A 3NYVA 2X7GA 5CENA 3UOJA 3KKVA 1OITA 3UMXA 4D9TA 3DCVA 4WUAA 5CVFA 1OPJA 3HMIA 2XJ0A 4P2KA 4HYHA 3IK3A 4BR3A 4PX6A 5LQFA 4TWNA 3CD3A 4RC3A 3T3VA 2B9IA 4U80A 4Y46A 4FSYA 4FEQA 4CFXA 3DFCB 5K0KA 4D4RA 4EQUA 3D5VA 4R7IA 4PV0A 4HW7A 4ITJA 1ATPE 1Y8YA 2J4ZA 4YLJA 3M1SA 1QCFA 4F6SA 4ZZNA 2QO7A 1J1BA 3QBNA 2R0UA 2ZVAA 1S9JA 5EYDA 3RNIA 4CKJA 3VNTA 2UZEA 3BHYA 2X81A 5HKMA 5IUGA 3O96A 5FBNC 3N9XA 3DJ7A 3F66A 4C2WA 5BQ0A 5BMSA 1M2PA 3JVSA 3OZ6A 3FEGA 1H01A 2PVHA 4C4EA 3GU6A 2VTNA 4IJPA 2W1FA 4DHZA 4N4SA 4GK3A 4G3EA 4E4NA 3ID6C 3BU3A 3R22A 1OGYA 5JT2A 2VTIA 4GEOA 2W5AA 3HMPA 3NCZA 1LP4A 1YDRE 4V0GB 2XBJA 5B0XA 4V04A 3FY0A 4YJQA 4QYGA 4IIRA 2XBAA 4IFGA 4IM0A 3ZLXA 4EONA 2GMXA 3EMGA 3M42A 4MNEB 3QC9A 4FVRA 2BCJA 4GH2A 4TY1A 4GT5A 4H1JA 5A14A 2W1ZA 1MQ4A 4YJSA 2BKZA 2QI8A 3VRYA 3SV0A 5IQIA 5IMXA 1Y57A 4WSYA 3OEFX 3ORMA 3WIKA 4J71A 4XX9A 3WZDA 3ZHPC 4DAWA 4MD8E 1B39A 4FNZA 5AP6A 4EZ7A 2ZOQA 4IZAA 4LOQA 5CLPA 1AGWA 1Q8UA 4JG8A 4TXCA 5CS6A 4DHFA 2J5FA 3I81A 3P5KA 4U6RA 3QRIA 3DGKA 5E8SA 5JQ8A 1YQJA 5LCKA 4BDIA 1SM2A 3N51A 4M84A 3RCDA 5AM7A 4LDTA 3SOCA 4FVPA 4H3BA 4M14A 3AMAA 4HNIA 2NO3A 1ZRZA 4ZSGA 1E1XA 4BCNA 5CAVA 3BYOA 3L1SA 3SOAA 3Q32A 4OLIA 4QMTA 1WZYA 5J5TA 3SXFA 3IDBA 4AZEA 1W2CA 3PXRA 1I44A 4LL5A 4O0VA 1PYXA 4ANOA 2DWBA 3NUSA 4F4PA 4ZMEA 1GZKA 3H9OA 5BV3A 3WF6A 4FV2A 1YOLA 4J99A 4FIIA 3TEIA 4E73A 4O2ZA 4ZZMA 4S33A 4XRLA 5D1JA 3LQ3A 2VWVA 3DBFA 5FXRA 4IB0A 4PL4A 5CTPA 5A54A 4I93A 5IU2A 1OECA 2UW3A 2G9XA 4C61A 3ML1A 2R3IA 4IH8A 4IHPA 4YTHA 1E9HA 4ERWA 4QP4A 2VTQA 3A7IA 5A4EA 2WTWA 5LWNA 4PDPA 4E5WA 3V8SA 3W0RA 3FQEA 2W4OA 4OT6A 5EDRA 3FI4A 3VO3A 5HNIX 5KX8A 4OAUC 3LLAA 2C68A 5CQWA 2WB8A 3QQGA 5L4QA 5HG7A 2RIOA 2QOBA 2DS1A 4CFMA 3COHA 1BI8A 3PJ8A 3PRIA 3CGFA 1ST0A 1ZZLA 4F1OA 3GEQA 3C7QA 3LXLA 5HNBA 4U81A 2O63A 3GI3A 3HRCA 4YZMA 1G8SA 1WMKA 3FMHA 1KOAA 2OJFE 4QTBA 4BJJB 2BAJA 2CN8A 4IDVA 4OR5A 3AXWA 3ORZA 5CASA 4GU9A 2Q0NA 3KFAA 3EKKA 4IM3A 5IQEA 4R5YA 4BCKA 3VN9A 1XBBA 3OVVA 4AS0A 4P7EA 2V0DA 4UB7A 5IDNA 4FG7A 4PUZA 4BFMA 1WVYA 2R64A 3ZU7A 4AAYA 4BIEA 3KRRA 3R1SA 3OG7A 3R71A 4MBLA 5GJFA 2W4KA 3RJCA 4M3QA 1GNGA 3C50A 3D94A 3KGAA 4W8DA 1PXNA 2FO0A 4IBMA 4O27B 4FA2A 4O86A 2ZAZA 3D7ZA 3FC2A 3MJ1A 3HNGA 3REPA 2IW6A 4EJNA 2Z7LA 3FYJX 4RJ7A 5H9BA 4AZSA 4I5HA 5HLNA 5DR9A 4R7BA 4V01A 5L8KA 2ITOA 2PMOX 3R02A 2RF9A 2X7FA 4F1MA 2CMWA 4TW9A 4U44A 4WNMA 4XG9A 3EQBA 1OM1A 4N6ZA 4FT7A 2XANA 2QOLA 5CALA 2I40A 4BBEA 4QMOA 4YP8A 3FBVA 2WXVA 3PG3A 5CF6A 3VS3A 1Q24A 4RGJA 3EN6A 3W8QA 2XNGA 2GHLA 3NX8A 4BCOA 2YM5A 5EQPA 3HX4A 4JG7A 2C4GA 1WCCA 3AC4A 2UW5A 3KXHA 5KMIA 3MB6A 2I0EA 5HCXA 1OL1A 3LQ8A 3ZO1A 3CJGA 2UZTA 3GU4A 1KE9A 2YHVA 4Y72A 1WVXA 5TE0A 3SKCA 5J7HA 3Q9YA 4X7QA 4F0FA 3MSSA 3ZYAA 5LCJA 4L3LA 2GNJA 4YSJA 4HCTA 3W0SA 2WMXA 2GQGA 3ZZEA 3MVHA 5F20A 5ETFA 4CG9A 3B2TA 4JDJA 3UIMA 3FQSA 3DNEA 4KD1A 4IX6A 5JQ5A 4KUJA 3EB0A 2YDKA 3P23A 3MGYA 2XH5A 3DU8A 3QXPA 4RLLA 5JGAA 4QEBA 4DDIA 5M57A 4E7WA 4C35A 2GNIA 2WMWA 3MFUA 4PY1A 3ZSHA 4FV6A 3BPRA 3N4TA 4IDTA 2VO0A 3PSDA 4ENYA 4QDEA 2WTKB 2P0CA 3LFNA 4FKVA 5J1WA 3GCUA 3ZO3A 5DT0A 1XH8A 2ITTA 3A8XA 4B7TA 2UUEA 4O6EA 1PW2A 3ANRA 1IEPA 4BL1A 3QD0A 5CNOA 2WQBA 3QA8A 3EQFA 4EUUA 4GG7A 3O5AA 2I0VA 2J0IA 2WMBA 2WOUA 4QT1A 3OCBA 3HECA 1KV1A 1ZYDA 3AOXA 3IW4A 2WMQA 1GOLA 4IX4A 3Q6WA 3GOPA 3NIZA 4BCGA 4O0XA 4N70A 4NKAA 4O4FA 4XBRA 4JIAA 4KB8A 1P2AA 5BNJA 5FBOA 4IANA 5HO8A 3WE4A 3ZO4A 3LFBA 4EI4A 4AZFA 4EOQA 2Y7JA 4DT9A 3HUBA 4BYIA 1JPAA 2XCKA 1WBNA 3LMIA 2JEDA 4JR7A 4M68A 3BYSA 2PVFA 3QTRA 2XP2A 3A62A 3IGOA 3W2CA 1J7IA 4AGDA 3PDTA 1R3CA 2JIIA 5GJGA 4ZAUA 2RKUA 4L53A 3RAWA 2ITYA 4YNOA 4FV8A 3KK8A 3U6IA 1XH9A 5M07A 3O23A 2OJIA 2PL0A 5EM8A 4AT5A 4FTTA 5H2UA 2BALA 3NR9A 4DITA 1G5SA 5IQHA 3DY7A 3L8PA 1V1KA 3ZOSA 4R8QA 2W1CA 4AU8A 4ZOGA 3WZEA 4BYJA 3DTCA 2LAVA 3FZOA 2ITXA 2R9SA 3ZUVA 4MD7E 3CCNA 4USFA 4FKGA 4WT6A 5EI6A 5IEVA 3I5NA 4AW2A 3QKMA 3R28A 5K9IA 4JR3A 4RWIA 3RVGA 3DJ5A 2HW7A 3K3JA 4ZXTA 4R5SA 4YJNA 3NZ0A 5E8ZA 4C02A 4ZJVA 5EW9A 3R7YA 4Y73A 2BHEA 3DBCA 1H1PA 4P90A 4BRXA 4J53A 4EK3A 4U41A 2BAKA 4MK0A 4PP9A 5AAEA 4QMWA 3PFQA 3PWDA 4FTMA 3UTOA 3MPTA 3TZ8A 4PDSA 1XMMA 4FZFB 5AR4A 2CNUA 3NGAA 5J9LA 3QWJA 1PXPA 2QD9A 2WZJA 4C7TA 1Y8GA 4PRJA 2OF4A 4RX9A 5FD2A 1O6LA 3DS6A 2AEGA 3TM0A 1Y6BA 1OL5A 3E8NA 3ZFMA 3C4ZA 4G5JA 5HI2A 1J7LA 3GENA 4C4JA 4C59A 2R3FA 4IC7A 5EW3A 4DYMA 4LV7A 5CEQA 3H3CA 2EB3A 2QNJA 3U4WA 1Z5MA 4ENXA 2Y0AA 2JFLA 4CFFA 2XEZA 2J6MA 3LJ0A 3NAXA 2XYUA 1JAMA 2PVLA 4RJ5A 5FEQA 4D4SA 3LZBA 1YXTA 4NCTA 4A4LA 3Q4TA 1OGUA 3NCGA 4TYHA 4UMUA 4BTKA 3F3WA 3FMEA 4XOYA 3ZMMA 4DH5A 1YOJA 3FSFA 1H26A 4HVSA 4AGCA 3OY3A 4MXZA 5M4FA 3OWJA 1RJBA 4BY9E 3POOA 3TNIA 3IKAA 4XOZA 4U7ZA 5AA9A 4N57A 5HIDA 3BV2A 4NUSA 4C37A 5LVMA 4JT3A 1MQBA 3R7IA 1YW2A 4JQ7A 3MA6A 4XMOA 3TJDA 2BDFA 2JKQA 4GIHA 4FSUA 4YO4A 3M2WA 4TPTA 2BDWA 5CEOA 4KIKA 3CY3A 4MWIA 5FUTA 4PMPA 5JGBA 3DDPA 2FVDA 4A07A 4TNDA 4EHZA 3MVLA 3Q4UA 3UQFA 5EYCA 4L8MA 5E4HA 3L8VA 5IEXA 5KMNA 1GZNA 3QHRA 4IAKA 4IXPA 1JQHA 3DA6A 1OBDA 1FGKA 2VTMA 4CT1A 3MVJA 3F69A 1OUKA 1DI8A 3GCVA 4YJRA 4E3CA 3VS0A 5L2TA 3TNPC 3V5LA 2CDZA 4MQ2A 4S30A 3FI8A 2X8IA 3P7CA 1O9UA 3Q52A 4I1ZA 3PSBA 4BI2A 3NAYA 1DS5A 5IEYA 4U97A 2VTOA 2X6DA 2VAGA 3BHHA 2JD5A 5KKRC 4I20A 2VO3A 4I22A 3HMOA 5LWMA 3LM5A 5HBEA 3LPBA 3GCPA 4BCHA 4U79A 2CKOA 2X6EA 4X2NA 3EQIA 4RIXA 4W9WA 3LW0A 3BRBA 3QQKA 4YHJA 5GHVA 3RAHA 4X6QC 1FBNA 4TZRA 4AT3A 2XA4A 3LCSA 3PZHA 4FGBA 4NTTA 3NVMB 2O0UA 4IZ5A 2OJJA 3V6SA 2IZRA 3EFLA 5CZIA 2PZIA 2V22A 4QQ5A 1M14A 3CGOA 2PY3A 5JEBA 4WRSA 2BFYA 3F5UA 2C3LA 4E6DA 2AYPA 2X8DA 2C69A 2WQOA 3ZONA 2DQ7X 2XMYA 5HIBA 4QDVA 1SVEA 2YAKA 4ZK5A 2WEIA 2BZHB 1Q62A 5AIRA 2Y4PA 5CX9A 1VR2A 3FMKA 4LRMA 5LMBA 3MFSA 1T46A 3CD8A 3UDSA 1XO2B 3LXNA 3UBDA 5AUWA 2YJRA 2FSOX 2PZ5A 4IB5A 3UOLA 1H27A 4XCUA 2B9JA 2C3JA 3HL7A 5AUXA 3WF5A 3LE6A 3ZEPA 5JFSA 3PTGA 4ZTHA 3DPKA 4D5KA 4OTPA 3R9DA 2VWZA 2PE0A 5EK7A 1ND4A 4FKQA 2I0HA 3H4JA 5EG3A 1ZYSA 2CKQA 3NUUA 3VULA 2GU8A 4JX7A 2WOTA 3DTWA 1FMKA 4G2FA 3GQLA 4QNYA 4TYIA 3ZFYA 4D28A 2XRWA 1K3AA 1LEWA 2QLUA 3PPKA 2V7AA 3QRJA 3C0HA 3H0ZA 1LR4A 4MBJA 4TWOA 4YZCA 4DBXA 3KMMA 2ZDTA 5CYIA 3EQGA 4TYHB 4DCAA 3D5UA 4G34A 1TQMA 2UZWE 4QTCA 4NKSA 1R78A 3LFFA 2OG8A 4JDIA 3VUIA 3B8QA 4LL0A 2AC5A 2FSMX 4LGHA 5FM2A 2ETKA 4J98A 4EK4A 4DHIB 4PPAA 3SVVA 4NL0A 5DR2A 2VTHA 2Z60A 3DXQA 1ZARA 2PK9A 2ZV9A 3E3PA 3OXIA 4UWYA 4X2FA 3AKLA 2PULA 5AV2A 4AE6A 4DDGA 1W82A 1KE6A 1WVWA 3AMYA 3RNYA 4CTCA 3G15A 5K4IA 4FKIA 5IQCA 3TMOA 5HOAA 4WO5A 4KIKB 2RFEA 3PXZA 4Y83A 3LMHA 2CGUA 3CPBA 3FMNA 3C4XA 4GUEA 3LCOA 3TDVA 5EM6A 3F5GA 1OL2A 2BRNA 2XK3A 4MXAA 4ZY5A 3DQWA 3ORLA 4BDEA 3COKA 5IQDA 4E5AX 3FMJA 2YZAA 3DLZA 5BUEA 4EJ7A 4PL5A 3BYUA 4EOOA 2B9HA 4IAFA 1L8TA 5EI8A 2NRYA 3HEGA 3HRFA 3AT4A 4FG9A 4BZOA 2ITVA 2XNEA 4JX3A 3CPCA 3RGFA 3QUPA 5D10A 4A9TA 2YCRA 3JR1A 4EK8A 1Q41A 4CEGA 1YWVA 1M17A 4C3PA 3HV4A 4FKTA 4PDOA 3V51A 3S95A 4RJ8A 2W5HA 2WTIA 4ZSLA 5CAPA 3OTVA 5DBXA 3PVWA 5T68A 4CNHA 4WHZA 1PXJA 3UP2A 2PMLX 5IA4A 2ITUA 3ZUTA 3ZC5A 5HD4A 5HLPA 4DEAA 1DI9A 1Q4LA 3OXTA 4MH7A 5K5NA 2QOQA 3KA0A 3RM7A 1ZXEA 2J9MA 2VTPA 3QTIA 4RMZA 4LV5A 1J91A 5AV3A 4A7CA 2VX0A 4AXAA 3BLQA 4OAVB 3ENHA 4FG8A 3QWKA 2X9FA 4TYJA 4IM2A 2RL5A 3NNWA 3EQHA 3BHTA 4BDDA 4O1OA 1IASA 3TXOA 4I5CA 4O96A 4RA5A 3GCQA 5JK3A 2R4BA 3NYNA 5E91A 2PPQA 1TQPA 5LMKC 4FTIA 4UX9A 3PWYA 3GU5A 3R7EA 3ZO2A 5E8WA 2FA2A 3D2IA 4EK6A 1BUHA 5C4LA 3LJ1A 4ZJIA<