5JH6A

Crystal structure of tl10-92 bound to tak1-tab1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
288
Chain Sequence
SLHMIDYKEIEVEEVVGRGAFVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7,TGF-beta-ac
publication title Structure-guided development of covalent TAK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 288
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jh6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jh6A01
5CU6A 4U6RA 5AAGA 5ICPA 3KREA 4QQCA 1NT2A 4L44A 3F69A 1NVRA 4B8LA 3HZTA 3QTSA 4PP7A 2ITNA 4QP4A 3HMMA 3PZHA 5AV4A 4F70A 5L3AA 5KBQA 4FVRA 5DFPA 3SX9A 2QONA 5JRQA 3I4BA 3VJOA 1S9IA 4IVCA 3RZFA 3IO7A 3R28A 4DITA 2XKDA 2C6EA 2QKRA 4M66A 4KABA 3MFRA 1IR3A 2C6IA 5DEWA 3RALA 1ZYDA 2J0IA 3EQCA 3OOGA 2I0VA 3OROA 4WBOA 4I5PA 4KIPA 3NW6A 3KXGA 2GFSA 4H3QA 4QMXA 4ZOGA 4UALA 4C8BA 4UX9A 3F3VA 1LEWA 1OIQA 4U7ZA 5KMLA 2JKMA 3FMLA 1U54A 1Y6BA 3EFJA 3EZVA 4XYFA 5A4QA 3DDPA 3E7OA 3Q52A 3CJGA 5M09A 3IG7A 2PVNA 4TKSA 5JGBA 4BFMA 1DM2A 4OGRA 4EL9A 5ANEA 2DWBA 1RW8A 5C9CA 3REPA 5J8IA 5EOLA 5EW8A 4QMUA 3ZO4A 3GCSA 1OL2A 2R7BA 4DINA 3POZA 4P4CA 4ITHA 5D1JA 3TV4A 4EOJA 2ZOQA 4DFLA 3SXFA 5CALA 3HV4A 2PL0A 2FO0A 2UUEA 5AUWA 4BB4A 4DC2A 4F7LA 4L3JA 1PYEA 3OWLA 4BC6A 5F95A 4TT7A 2R3RA 2REIA 3CPCA 3LVPA 1R39A 5A4LA 3EZRA 4O1PA 2HAKA 4G3EA 2VTJA 2ZB0A 2WO6A 4FTUA 4O0VA 4RVLA 4UYAA 3BCEA 3S00A 5DYJA 4YURA 4KKEA 5HG7A 5IG1A 1Q41A 4FT3A 3EQRA 3U87A 4RX5A 4ZJIA 1RQQA 5DR2A 5CAPA 1BYGA 1H28A 3TDWA 2YERA 4OTDA 2W9ZB 5A3XA 3SXSA 2AC3A 5D9HA 4CRLA 5BX0A 4IZ5A 3FLWA 3I7BA 2H34A 4N6ZA 2JDOA 4ANMA 4RVTA 4BDDA 2VO6A 3ZC5A 3NUUA 4U9AA 3RHXA 2YCQA 1M2PA 1QMZA 4QO9A 4EONA 4EH7A 4FV9A 4I5HA 4EH4A 1Y6AA 4CG8A 3F7WA 1GOLA 5CEIA 5IQIA 2YITA 3DKFA 3F3ZA 1JAMA 3O0GA 4R3CA 4QD6A 4HOKA 2YM6A 3NUNA 3FLNC 4MD7E 3TIYA 4DEAA 2XIXA 3DXNA 4YHJA 3HX4A 3VS2A 1GIHA 3DBCA 2QOLA 2VTIA 3NWWA 1BUHA 1OPJA 3GU6A 4PY1A 3NUSA 4RIXA 3PWYA 3PWDA 4XNEA 5HCZA 5HIBA 4NK9A 3E3BX 5GINE 2P3GX 3EH9A 3OUKA 4FT5A 5T68A 1KSWA 3GFEA 5CT0A 3TT0A 2OH4A 1Q8YA 2BILB 2Q0BA 1YWRA 3R01A 2Q0NA 5AR3A 4KIKA 3IDBA 5CSXA 3ZU7A 4ZMEA 4UWBA 3QUEA 3MB7A 2EXMA 2XNNA 2YAAA 3LHJA 4LOPA 4U8ZA 4ZIMA 3ZM9A 3DDQA 3HYHA 2WHBA 1UWJA 3GC7A 4IWQA 4LQMA 2UZWE 3MY1A 4BTKA 2C5OA 2R3FA 2ERZE 2JDSA 1Q8UA 2C0TA 3AD6A 5ANKA 4BY9E 2EWAA 3UPZA 2W5BA 4O7ZA 2JFLA 4BTMA 4CV8A 3L9LA 4MVFA 4GYIA 2OO8X 1YXTA 4FKJA 4F6WA 5IEYA 5DRBA 1K2PA 2W1GA 1OIRA 5AAEA 3TUBA 4U3ZA 5I9ZA 2Z2WA 4BR3A 3PE2A 3H30A 4JIAA 3I1AA 2W7XA 4MNEB 3R9HA 4XLIA 3OC1A 2WTVA 4RZWA 5DA3A 3SOAA 4FA2A 1KE7A 4ALWA 4FEUA 4D2SA 1A06A 2PU8A 3NAYA 5J9ZA 3TACA 4IBMA 2WMRA 3D2KA 4K6ZA 4J96A 2WGJA 4MWHA 2C6TA 3OBGA 1OL7A 1DAYA 5M57A 4MAOA 3ZBFA 3UC4A 3PSBA 5FUTA 3DQXA 4FSUA 2NP8A 2YFXA 5CSVA 4YZMA 4ARKA 3K5VA 3RVGA 5ETIA 4DEGA 4BYIA 5M06A 3G9LX 4XHKB 3ZFYA 4FTRA 4IJ9A 5C26A 4O7RA 4PP9A 1K9AA 2ITXA 3C0IA 2V62A 4I0SA 1CKIA 2OBJA 2OSCA 5HLWA 3WZEA 4C34A 4O21A 1PRYA 3F3TA 4FV1A 1CTPE 4V01A 4CTCA 4JG7A 4R1YA 4KIOA 4YNOA 4CGAA 3R2BA 4M8TA 1LR4A 2WB8A 3VIDA 2XM9A 3QGYA 4DEEA 3LW0A 4JL9A 4AA4A 3R8ZA 3GU8A 3JY9A 5HLNA 3N4VA 4EK3A 3II5A 2V55A 4LL5A 4U80A 3BHHA 4C3RA 4DGGA 5AAFA 3IECA 4E5BA 4FSNA 4I0TA 5I9YA 4O38A 1P2AA 3F5GA 4KINA 4ASZA 3DQWA 4I6FA 4LOOA 5I9XA 4JQ7A 4IFCA 2YCSA 1Z5MA 5JZJA 4EOQA 4XG6A 4ACHA 3UC3A 3UE4A 4L45A 1YQJA 3QC4A 5HGIA 3H3CA 5JFSA 4JX7A 4BCJA 3NYOA 4DT9A 4KAOA 3R9NA 3G0FA 2X6EA 4WHZA 3A99A 5CU2A 4DHFA 4GK2A 3IK3A 4HGLA 4I5MA 3SOCA 3TNIA 1BX6A 3AD5A 2BDJA 4LUEA 4QNAA 4V0GB 1XR1A 4CKJA 4AFJA 3AC3A 4YC6A 2HY81 2UW4A 2QO7A 4PDPA 5M51A 2XKFA 3CQWA 5JZNA 1S9JA 4FZAB 2QOFA 2A1AB 3ZO2A 4YJNA 1DAWA 2UW3A 1PJKA 4MKCA 4FSMA 4ZSEA 3DJ6A 4C02A 2HELA 3DJ7A 4TNBA 3OWPA 4BCFA 4RIWB 2UW5A 5ETAA 4B6LA 1GJOA 4LYNA 4U45A 4QP6A 2EB2A 1OKYA 1BI8A 1WBWA 1XH5A 4ASDA 5LWNA 1XKKA 4O7VA 1YHSA 4H36A 4FTTA 3R8PA 3T9TA 4RQKA 1ZYJA 2YCFA 4WNKA 4CZYB 2ONLA 3RWPA 3ZO3A 5I9VA 4QRCA 3KMUA 4GMYA 3SDJA 1CM8A 1GAGA 5EDPA 2R0UA 5IF1A 5BUJA 1GNGA 3KK8A 1WZYA 3MJ2A 3V8WA 5G6VA 3H0ZA 4J97A 3PA3A 3DZQA 4R7IA 2YDIA 3A60A 3S0OA 4WKQA 3LAUA 4O82A 5E8ZA 3VS0A 4ZTQA 3SV0A 1DS5A 2ZDUA 4C7TA 3QZIA 5FBOA 4I5CA 4F63A 1JPAA 3HLLA 4MK0A 3L8VA 1W82A 3R63A 4PDOA 3FMKA 4RJ3A 2C6MA 3IDCA 5JFVA 2O8YA 3HAMA 3OP5A 2WEVA 4F6UA 4TW9A 5FTQA 3EL8A 4HPUE 4ZEGA 1PXJA 3KN6A 5IUHA 4APPA 2A19B 3UZPA 5L8KA 1P4OA 3BYVA 5HCYA 3ATSA 4RA4A 4ZMFA 3LJ2A 4FOCA 4JAIA 3MTFA 1H24A 1M7QA 4O0SA 4BGHA 1UU7A 2EUFB 3EN9A 3EL7A 1XH4A 4BYJA 2GHLA 3AOXA 1PXNA 2IZSA 5AM6A 3R83A 3L9NA 3UVQA 1OUKA 5I9WA 3OS3A 2X9FA 3N4UA 4KBCA 2I0HA 3TZ8A 1OI9A 4I1ZA 4HGTA 5IISA 2PVJA 2PK9A 3AMYA 5KMMA 1ZARA 4IB0A 4LV5A 1BKXA 5C8NA 5F20A 2EU9A 5JH6A 4XRLA 5E4HA 2UW7A 3MYGA 5DE2A 4G3DA 2O3PA 5AA9A 3PXYA 2PE2A 4E73A 2GNJA 3PUPA 3V5LA 2VTAA 4F7NA 5AR7A 5BYLA 4MWIA 3DB8A 3R71A 4OAUC 2BAQA 2GTMA 3FY2A 2HW6A 3NYVA 2W4KA 4FZ6A 4JXFA 3V04A 4RVMA 4HW7A 3VJNA 3LE6A 3L8SA 3R0TA 4YHFA 4MBIA 4CVAA 3KRXA 3Q2MA 5AP3A 4CFXA 3S3IA 1J1CA 4ZSLA 4PL3A 1TKIA 5ACKA 3KMMA 5LMKC 3PDTA 3CEKA 1OIYA 3VAPA 2LAVA 4AN9A 4MQ1A 4USEA 2R3JA 3WARA 2BKZA 1ZXEA 4OUCA 2JKOA 3AMAA 1OKWA 1FVRA 5L4QA 5IMEA 1SVEA 3VN9A 4MXYA 3F61A 2J2IB 2JLDA 4KS7A 3KKVA 4MF0A 3WILA 3QKLA 4UN0C 3IKAA 3VRYA 1Q8WA 2R7IA 5M53A 4NUSA 3R1NA 4R3PA 4GFGA 3I5ZA 2J7TA 4LMNA 4AZVA 4GT4A 4FYNA 3E63A 1XH9A 2XIZA 5BMSA 4S2ZA 3U9NA 5CEMA 3G5DA 2OJIA 4TWCA 4O0WA 2EXEA 3DK6A 4WO5A 3ERKA 4HNIA 2J0KA 4QMYA 4BN1A 3QYZA 4RIOA 2FSTX 4C4JA 5L8LA 5EYMA 2CJMA 3HNGA 4BI0A 4C2VA 2WNTA 3KXNA 4IACA 4TTHB 3FSKA 4C3FA 3FI3A 3GQLA 3R7IA 2JIUA 5BYZA 4PQNA 3R7EA 3TN8A 1MQBA 3ORLA 3BE9A 3C0GA 1PMNA 3GCPA 3HGKA 4MEDA 1FMOE 2QR7A 4NKSA 4R1VA 4XJ0A 3F2RA 4YGAA 3KF7A 3QWJA 3RTPA 1M17A 2BKKA 4RWKA 2UZNA 5EYCA 4GG7A 3ACKA 1UU3A 5CVHA 3EN5A 4BCHA 3O71A 4FE2A 1H07A 4A9YA 4EZ7A 5E8TA 1I09A 4ANQA 5I4NA 4D4YA 1YOMA 3QCYA 4QYYA 4EWHA 4AGWA 3QC9A 3DNDA 5HIEA 2OXYA 5KMKA 5I9UA 4IZ7A 4E20A 3UOKA 4BWPA 1YXVA 2XIKA 2LGCA 2HIWA 4FSRA 1F5QA 4GIHA 4YZ9A 2UW8A 4XG2A 4B8MA 4FKOA 3VF9A 3E8CA 3GI3A 1KE9A 4UMPA 2QOIA 4AA0A 3S4QA 4BGQA 4OBOA 5KUPA 3BLHA 3ZOSA 4NJ3A 4I93A 4RJ7A 3POOA 2YM8A 3AMBA 3P86A 5IKWA 2W1IA 3F5UA 5EYKA 3VBVA 4IWPA 2F2CB 3OEZA 3MPMA 4BTFA 4F0GA 3KXXA 2B7AA 2IVUA 4O96A 4MCVA 3BU3A 4D4SA 3QD3A 4JG6A 4TY1A 3WF6A 4QMLA 2OKRA 3EN4A 4GK4A 2HWOA 4QP8A 2YISA 3ORMA 4W4YA 3V5QA 1YWVA 2QLQA 4CYIA 1JOWB 2BTSA 1OBDA 2C3LA 4ACMA 4FV5A 3QXPA 4X2JA 3ENMA 2GU8A 4X6RA 4ZTLA 5M55A 5JGDA 3NUPA 3KMWA 4FTQA 4ANBA 2VNYA 3D7ZA 3FZTA 4KBAA 4BGGA 3QQLA 1T46A 1PXMA 2WTCA 4QMWA 4D2WA 2XKCA 4CCUA 3TIZA 4YTIA 2W1DA 4Q2AA 3EN6A 1MQ4A 3TJDA 4V04A 5EI6A 3EQGA 2WMAA 3GU7A 5FDXA 3BI6A 4RGJA 4E93A 5IZFA 2ETKA 4EBWA 4BCQA 3TXOA 3ACJA 2R3QA 4I92A 3ZLYA 4C38A 4CSVA 3UG2A 3Q2JA 3QTZA 5ANJA 3R30A 4BZDA 3ODZX 4DGLC 4ENYA 3UNKA 5IH4A 3L8PA 2BCJA 2V0DA 5E1SA 3V5PA 2W5HA 1G5SA 3CY3A 2WMTA 3AGLA 5M4CA 1IAJA 3A7HA 4H1JA 3OW3A 3LM5A 5DWRA 5TT7A 3FHRA 2JKQA 3NZ0A 5BQ0A 3T3UA 4S32A 3AXWA 3G15A 3FMJA 5EKNA 5AFVA 3CTJA 2Y9QA 2CKQA 4XX9A 5LVOA 3DBFA 4F1OA 2I0EA 4FNXA 3RPYA 4LRJA 4ANNA 3CGOA 3FMEA 4GT5A 5CAQA 2O65A 4M12A 5FRIA 4EH2A 2VTLA 3DCVA 1ND4A 2GS6A 4RC3A 4F09A 4DTBA 2B4SB 5HNBA 2R0IA 4UWYA 5DMZA 5C01A 4Z9LA 3TNQB 3JS2A 2X9EA 5LJJA 1GZOA 5BVFA 3OEFX 4P5QA 3C4FA 1FMKA 2CNUA 4WSYA 3QZFA 2RFDA 2X8IA 3OCTA 3PXKA 4ZTNA 3RP9A 1PY5A 3WE8A 3F3WA 2VTNA 3RINA 3O8UA 3UOLA 2CN5A 4DH5A 4DTKA 5L2WA 2GHMA 1Y8GA 3PG3A 5IQHA 2WOTA 4LM5A 3SXRA 4ALVA 3NCGA 3M2WA 3QA8A 4MNEA 2YABA 1T45A 4L53A 3FI4A 4MNFA 5K0KA 5CU3A 3UNJA 1H27A 4CNHA 4J7BA 3HA6A 3H9OA 3ODYX 5DN3A 2JBOA 2X7GA 2F7ZE 5DIAA 3PIZA 3QD4A 4BBEA 3N51A 2IZUA 1IAHA 4BBMA 5C4LA 2BHHA 4RSSA 2F9GA 4YJSA 4JDJA 4IXPA 3TNWA 2WPAA 4ZLZA 3PPJA 2KULA 4I21A 4DTAA 3FKLA 3NAXA 3OXTA 3A4OX 3QQHA 2A4LA 2P2HA 1H26A 2QHMA 5I3RA 2CLQA 1YI6A 4FIFA 5FDPA 1QPEA 1IA9A 4U0IA 4ACCA 5GJDA 3D0EA 4IM0A 2X2KA 1Y57A 4TNDA 4A4OA 1H1QA 5K9IA 2R9SA 4GT3A 3BKBA 4X3FB 1PXPA 4RFZA 4D2RA 4D5KA 3FMHA 5I5ZA 4QTBA 2QKWB 2YA9A 3RKBA 3ZFMA 5JKGA 2EXCX 1J3HA 3JPVA 3HMNA 3TTJA 5JK3A 3MESA 4F99A 3BRBA 2XK6A 3LCSA 4M3QA 4KB8A 2QODA 2XRUA 3A8XA 4FKWA 3NNWA 4FKVA 4UMRA 4L9IA 2NPQA 4YPSA 5H8GA 4FEQA 3G0EA 4GUEA 3CIKA 4ZLYA 3BGQA 3Q96A 4O7TA 3ZHPC 3COMA 2CHLA 4RPVA 2W5AA 3COHA 4IANA 4MBJA 2WMSA 3A4PA 1YWNA 2X4ZA 4TYJA 1L8TA 5CYIA 3I81A 4C59A 4F9BA 2IPXA 5A4EA 2O2UA 3DAEA 4V0GA 5HNGA 4NEUA 4ZZMA 4D2TA 2B52A 2VWZA 3LFDA 5IEVA 2BRHA 5EFQA 4B99A 3L8XA 4Z3VA 4ORKA 1A48A 3KRWA 5AR4A 3KVWA 3BQCA 4AU8A 3SRVB 2PMLX 3FKOA 4RIWA 2XB7A 3Q32A 5LOHA 1WMKA 4BIDA 5HX8A 4BDFA 2RG6A 4D5HA 5E8YA 2PZRA 3GC8A 1V0OA 2OZAB 1UV5A 3H9RA 1UU8A 3LLTA 2Y7JA 3OY1A 3TKIA 4UY9A 4GV1A 2HK5A 4AWIA 4EH8A 3FHIA 1OKVA 5EM7A 3RI1A 2JD5A 3ROYA 4Y83A 3C5IA 4FTOA 4AZEA 1H1SA 4NWMA 3JXWA 5M07A 3QL8A 3FLSA 4I41A 4BDJA 1ZOEA 2C6KA 5DPVA 4DFNA 4E3CA 4RX7A 4ONAA 3TJCA 3KRJA 3KRRA 1VEBA 1XWSA 4G16A 3AT4A 4PNIA 3GGFA 4XV2A 1PMUA 1BLXA 4QYEA 3ZYAA 5J1VA 4O86A 2ETMA 3BX5A 3TM0A 3W2RA 4GIIA 2J0LA 3V6SA 5A46A 5DH3A 4FKTA 3B2WA 4XP2A 3FKNA 4XV9A 4OR5A 2HW7A 2OXDA 4BKZA 1VR2A 2ETRA 4JI9A 3PSDA 4JVGA 3CTHA 5KBRA 3UO6A 4IB1A 1YOJA 2C47A 1WVYA 4O7SA 2J0MB 5AR2A 5DNRA 3PJ2A 2C5XA 4AW2A 3RK7A 2DQ7X 1SNUA 4BHZA 4D4RA 2UZLA 1PXOA 4G6LA 2QO2A 2J9MA 4JX3A 4MQ2A 2XJ0A 4IJPA 3R7VA 5KHWA 3PXZA 1QPCA 1Z9XA 4FTNA 4JRNA 4EHZA 1ZYSA 1ZRZA 2WKMA 4AOIA 5IQFA 2JDRA 4R7HA 4ALUA 3R02A 2R2PA 2FUMA 4DEDA 3U54A 3UP2A 5F1ZA 5JQ5A 4BI1A 2PTKA 5DBXA 2A2AA 3VC4A 4W4XA 1ZY5A 4DH7A 4JR3A 3VS3A 1OL6A 3CGFA 3IQ7A 3ET7A 3F66A 3ITZA 5M4UA 4XG3A 4ZZOA 2I6LA 3FY0A 2YM5A 3K54A 5HE3A 4AS0A 4ASXA 1G3NA 4FIEA 4WUNA 5LVNA 2PYWA 4DFYA 3QZGA 5LMAA 3Q4TA 3QQJA 5LWMA 1YDSE 3MIYA 5JN2A 1J7LA 3P1AA 4RJ8A 4BDGA 5AEPA 4HZSA 4YPDA 2W17A 2WOUA 3BYUA 2C1AA 2RG5A 2WTKC 4FMQA 1PKDA 4FTAA 4DCEA 4GS6A 1H0WA 4QMTA 4DLJA 2X2LA 1YDTE 5IA0A 1ZMVA 4N0SA 1LPUA 1WAKA 3FC2A 4EJNA 4LGHA 4NW6A 2XIYA 3MH0A 3GENA 3AC1A 4YO6A 4GFOA 1CMKE 4YU2A 3GXLA 3PP0A 4JBOA 5HO8A 4EJ7A 2ZM4A 3O2MA 3Q3BA 5CTPA 3ZRKA 2JDTA 3QHWA 3LQ3A 5EQEA 3AC2A 4DF3A 1O6KA 3EFLA 2UZEA 4FF8A 5CY3A 3RK9A 3QALE 4IWOA 4KKHA 3NIEA 3IGOA 4QQJA 5L8JA 4F64A 4F7SA 2B55A 4HYUA 4LGDA 4WD5A 3ROCA 3LPBA 2YZAA 3UIXA 2OF4A 4FZDB 2OU7A 3GP0A 1SYKA 3QZHA 4ZJVA 3KN5A 2ESMA 1W98A 5DLSA 2C5NA 5IA5A 2VO3A 2WMBA 5DT4A 4QYHA 3PJ8A 3TUDA 2Y6MA 2QOHA 3MPAA 3NCZA 5AJQA 2WMVA 3R1SA 1Q8TA 4QYFA 4ZTRA 4FK3A 5HKMA 4HCUA 3NPCA 4IFGA 3FLZA 3HAVA 4A9SA 3LFSA 4O0RA 3D7TB 3P9JA 5A54A 3BGPA 4CFMA 2G15A 5EM6A 3C4WA 1CSNA 3R22A 3ZCLA 1GZNA 3ZFXA 3BEGA 4RC2A 4FGRA 1FBNA 5FXSA 3WF9A 2Z7SA 4W4VA 1JKKA 4GW8A 1YKRA 5CAOA 4USDA 3EB0A 4GEOA 5AP1A 3T9IA 2J90A 3NNUA 5F9EA 2E9NA 1P5EA 3QU0A 3QUDA 4J8NA 4U42A 5KMIA 3U6IA 2YLFA 4EOMA 4M0YA 3ZUTA 2XUUA 3VW6A 3BIZA 3E92A 3BYOA 3CP9A 4MX9A 3LFQA 1ZAOA 1ZYLA 4ZSAA 5EHOA 4GL9A 4Q5HA 5FEQA 4BBFA 3TEIA 4QMMA 4DAWA 1AGWA 2WU7A 3NIZA 4AF3A 2X81A 2ITYA 2YM7A 3QXOA 4FKUA 3GCQA 2WEIA 4QMOA 4OTPA 4NSTA 4YUQA 2CKPA 5IQAA 3LZBA 3NLBA 2P2IA 3V5WA 1W7HA 4BCKA 2XNPA 2OF2A 4L52A 5EM8A 3LFFA 4IVDA 5LQFA 5A14A 3JR1A 2GQGA 2WQNA 3E3PA 2OGVA 4NCTA 5CASA 4O1OA 3N4TA 4UXLA 2GS2A 2VTRA 3UIBA 2AUHA 4OTWA 4BVUA 2WQEA 3C9WA 3U6JA 4UZDA 3A7JA 3FL5A 4HCVA 2WQBA 2XK3A 5ANIA 5M44A 3HA8A 4E5AX 4AQCA 5IA1A 4S30A 5E7RA 3ZS5A 4YO4A 4NIFB 3D15A 2C30A 2RFSA 4FV8A 4JS8A 4S31A 4YJOA 3CJFA 3QQUA 5TE0A 3DPKA 2F4JA 2RL5A 5CXHA 1XHAA 1XQZA 4E6DA 5KO1A 2OG8A 2X4FA 4R5SA 2BRMA 1FGIA 4FSYA 2QG5A 4ZY4A 1QPJA 1MRVA 2VTMA 3A2CA 4FKIA 2R3OA 4L00A 1JVPP 4DGNA 4ZAUA 4LG4A 1KV2A 2R3PA 2SRCA 5J9LA 4WA9A 3R9OA 2XVDA 1PF8A 3Q5ZA 4E6AA 4PL4A 5KKRB 4II5A 4F1MA 4BCPA 4U44A 3VS6A 4Q5EA 5AP4A 4BZOA 4QPSA 5KMOA 1XH8A 2XKEA 3ZH8A 5J79A 1FPUA 4DEHA 5HE1A 1FQ1B 3C1XA 2PE1A 4UWCA 4MD9E 5H8EA 4OT6A 4ASEA 5CU0A 5L6OA 3PG1A 3QRTA 3C4CA 2X7OA 4L7FA 4ACDA 3GU5A 4I22A 4O0UA 2XMYA 3IW7A 5AV0A 3ZZEA 2HZ0A 5E8VA 4FC0A 4BCIA 2PVMA 3ULIA 3D5XA 4BDAA 4CQEA 4N4SA 5DG5A 1H00A 4QOXA 5B0XA 5DR9A 3PVBA 2CNVA 4U43A 2GFCA 5JRSA 2G2IA 3KK9A 4ZTSA 3PSCA 2BZIB 2JIVA 4PPBA 3OCGA 3EQBA 3HL7A 1MP8A 2W99B 3WZJA 4E1ZA 3UODA 4Y5HA 3KB7A 3R8MA 3CBLA 3GCUA 4IEBA 3RPVA 5CZIA 2XRWA 4ZP5A 3RPSA 2JC6A 4NJDA 2VX0A 5IH6A 1FGKA 4X6QC 5AIKA 1Q5KA 3E93A 5AUTA 2ZV2A 3SAYA 3MIAA 4CYJA 5KKRC 5CF6A 2G9XA 1P4FA 2X8EA 2BZKB 4FX3A 4Y8DA 4WT6A 4YLKA 1PW2A 2W4JA 4I3ZA 4C3PA 3KXZA 3BQRA 4ITIA 1ERKA 3P23A 4O2ZA 4MXCA 4EUUA 3QLFA 1UKIA 2PVYA 4O7LA 2F2UA 3DY7A 4CKRA 3R8UA 3VUDA 2J5FA 4EK8A 2E9UA 2PVFA 1B39A 3R2YA 1FOTA 3TV7A 1I44A 2NNWB 1M52A 2YDJA 2H9VA 2PMIA 5J5SA 3HV7A 3I7CA 5EM5A 3GEQA 4XP3A 2QO9A 3NYNA 3QX2A 3DZOA 1H8FA 1CKPA 4TYGA 2X8DA 3FEGA 5EQPA 1W8CA 2CCHA 4HVGA 3GNIB 3FXWA 4D2PA 4F6SA 3ZO1A 4MXXA 4X3FA 3ZZWA 5KX8A 3FMDA 2IG7A 4LFIA 4C58A 4YJVA 4E4NA 4U97A 3VS5A 5F94A 4DBNA 2H96A 4QT1A 4KKGA 1NXKA 3CD8A 2W1CA 3SQQA 4X2GA 4JG8A 2C5VA 3HV6A 1ZOGA 4PTCA 3MW1A 3AG9A 3PY0A 3MV5A 4JT3A 2P4IA 1KE5A 4IIRA 2UZBA 4IB3A 1YXUA 3E5AA 1NY3A 4TYHB 2BIYA 2W1EA 4O83A 3WF7A 3RNYA 4AE6A 2PSQA 4AZSA 5M08A 3RAWA 4EOIA 4PUZA 1H1RA 2ITWA 1OKZA 2BUJA 5KMNA 4EH6A 4ANSA 4NM7A 3W10A 3LCDA 5HTCA 4FI1A 4UEUA 2WTWA 4HVSA 2R3GA 3I79A 4NM0A 1BI7A 2W9FB 4XV1A 3N9XA 4RWIA 2J5EA 1WVWA 4WSQA 3UVRA 4QMQA 4OLIA 4FICA 2CCIA 5CQUA 2XJ2A 3E88A 3IGGA 1EH4A 5AWMA 5J7BA 3ORXA 1YXSA 3LMIA 5E91A 3QRUA 1Y91A 1MRUA 4E6QA 5EHLA 3SRVA 4AW0A 5FGKA 1G8AA 4Z16A 2XNEA 3TKHA 1KE8A 3IPHA 3D9VA 4M13A 4NTTA 3ZLWA 3E64A 3KA0A 4K9YA 5DT3A 4D1ZA 5IQDA 4XMOA 3F2NA 5HG5A 4BCMA 2P55A 4DLIA 2CDZA 5L2IA 1GZKA 2B9HA 2V5QA 3QCQA 4CQGA 5IA4A 1Q4LA 2JITA 2J50A 4BDCA 4DE4A 4KNBA 2VRXA 3PIYA 1YOLA 2IW8A 4TWPA 5BVWA 3QCXA 5CQWA 5D41A 5FQDC 5GZ8A 2XS0A 1U5QA 1UVRA 2GSFA 4C35A 2NRYA 5AV2A 3CQUA 3G33A 3UGCA 3HRFA 2XEYA 3UTOA 3EKNA 3QTUA 1O6LA 3CQEA 3O96A 4A06A 2GTNA 3NW5A 4R3RA 3F82A 4Y73A 2YIQA 2BZJA 3FXZA 3HKOA 4CFNA 3HRBA 4BIBA 2ZV7A 3P0MA 4HVIA 2JDVA 5T6KA 3FC1X 3UNZA 4ANOA 4FNWA 3GUBA 5J95A 4XV3A 4IAYA 2YIWA 3OT3A 1JKLA 2CN8A 2QOQA 3MFTA 5FBNC 4ZY5A 4EHEA 2BZHB 3DFAA 5AUUA 3UOJA 2OFUA 2F7XE 5HVJA 3VBTA 4F65A 5CAVA 1KUTA 4BL1A 1Z57A 4IC7A 4XOYA 4CT2A 3OWKA 3MPTA 3FZ1A 3MVLA 3CPBA 5G1XA 4H05A 3LFBA 2BRGA 3RBWA 3TNPC 4PNKA 4OBPA 5EI2A 4TL0A 3MBLA 3D5WA 3LFAA 1OB3A 2VGPA 4G3GA 4GVAA 3AGMA 4YJPA 1VYWA 3PVGA 4EQMA 4EYMA 4F4PA 5H2UA 2UZOA 4Z55A 5IH5A 5KMJA 2YJSA 4D9TA 3UZTA 4CRSA 4DEIA 4R5YA 4XLVA 3KU2A 3MJ1A 4ENXA 1OUYA 2UZTA 2B9IA 3BBWA 4PDSA 2OJJA 3SC1A 2WMUA 4ITJA 2WMQA 4RZVA 3NUAA 3CKXA 4ACGA 2F7EE 3MY5A 4CFVA 2QLUA 4MF1A 3BWJA 2OICA 4OTFA 3Q53A 5GHVA 4C37A 5JFWA 5M4FA 5D10A 3GBZA 5CF4A 3E7VA 4MYGA 3QD2B 4FG7A 3DXQA 4AN2A 4GU6A 4JBQA 4L68A 2GDOA 3MB6A 4GRBA 2F57A 3EWHA 3NVKI 3WIKA 2XCHA 2ZM1A 4ZLOA 4DBXA 4OW8A 3RM7A 3QWKA 4RIYB 3ORIA 4OTRA 3BHUA 4D4VA 3WZDA 3IW6A 3K3IA 3UIUA 2VTPA 4GSBA 4NW5A 4RLKA 4UV0A 3V8SA 3SA0A 5LARA 2Y8OA 3LJ0A 3QLGA 4XG8A 4BDEA 2ITVA 1M7NA 2FGIA 2VO7A 4FIHA 5HLPA 1R1WA 3BLQA 3QRKA 3QTQA 4P2KA 3OCSA 4RFYA 3W2PA 4R6VA 5IA2A 1XBAA 2UV2A 4NFMA 3BBTB 3QRJA 4G5JA 5CENA 4BCNA 1KWPA 4TWOA 3CS9A 3WZUA 1YI3A 4QP3A 2VTTA 2BFXA 4H3BA 4J53A 4CMOA 4BZNA 3AT2A 2E9PA 4K2RA 1WBOA 4IC8A 4KWPA 2XNBA 3RAHA 4ERKA 3ZXZA 1YHVA 3Q5IA 3D5VA 4FTMA 5LXMA 4AT3A 2BDWA 4LV8A 3M42A 1V0BA 2UVXA 2XZSA 3S2PA 5A6NA 2J51A 2PE0A 4A9TA 3AQVA 3F7ZA 3RGFA 3R21A 5M4IA 1FINA 5GJFA 1DI8A 3RZBA 4WRGA 5CWZA 4I0RA 3HMPA 4KS8A 3ORZA 4B0GA 3LM0A 4ERWA 1OZ1A 5AV3A 3NSZA 4FVPA 1SZMA 4PRJA 4PTEA 5E1EA 4NFNA 3PY1A 5J9YA 3SVVA 3ID6C 3DT1A 4BIEA 2JGZA 4X0MA 4FV2A 3O17A 4UXQA 5HIDA 1GY3A 3MA3A 3TKUA 4FKGA 4CMUA 3I5NA 1YRPA 3PA4A 5DRDA 2XK4A 4CZTA 4O0XA 2Z7QA 4YBJA 3S1HA 3PVUA 2ZAZA 4YJUA 5TO8A 4UB7A 4B9DA 2VWXA 3U51A 5CXZA 1Q8ZA 1SVGA 5DHJA 2OI4X 4PPCA 4RA5A 4L6QA 4EHVA 3KFAA 5CANA 4W8EA 3I6UA 5L2TA 2P33A 3LXNA 3O7LB 4LOQA 4DH3A 2JEDA 3AC5A 3FYKX 3D2IA 3SKCA 3CLYA 4XG7A 5HE2A 4AP7A 3FLQA 2BDFA 5E8XA 4CFFA 3BGZA 4K1BA 5L2SA 2XBAA 5EG3A 5IA3A 3QCSA 2V7OA 1XJDA 4IX6A 4D0WA 5FEEA 1X8BA 4YTCA 2OZOA 5E8SA 4AZTA 2EVAA 3LCKA 3PRFA 4EH3A 5J5TA 2UW0A 4U3YA 3PFQA 2YN8A 3UMWA 4FUYA 2RF9A 2XF0A 3VRZA 3TZ7A 4NU1A 1UNGA 4H1MA 4L7SA 3DS6A 3DBQA 4I4FA 3ATTA 4NIFA 3MSSA 3VNTA 4O91A 4RT7A 4O7NA 1JKTA 4HJOA 5FXQA 3KY2A 4HGSA 5DR6A 1H01A 1ZZ2A 2XNGA 4M84A 1A9UA 2BALA 4IADA 4MXOA 4PMSA 4JJRA 3KF4A 3R6XA 4CCBA 4LRKA 2ZVAA 4YTFA 2Z02A 4L43A 3ZSHA 4O7WA 2B9FA 2C3KA 3SD0A 4FEVA 2I7QA 4QPMA 2ZYBA 3VHKA 5HOAA 3VUTA 3NS9A 1ZZLA 1JLUE 3RNIA 5C4KA 3LLAA 3HV5A 2CLXA 2FYSA 3HDNA 4FG9A 4ZSGA 3R1QA 4ZZNA 3UMXA 2RSVA 4GJ3A 4DG0E 4QQ5A 4ZTHA 2QOCA 4UMTA 3V01A 2XM8A 3ZEWA 4BCGA 2XK7A 4FGBA 3VUHA 3ZUUA 4Q9ZA 1H0VA 4MBLA 3HECA 4Y46A 4DN5A 4FZFB 5C1QB 3SW7A 2R4BA 3FWQA 5GJGA 3U4UA 5AIRA 4FTKA 3MS9A 3VUGA 5LVMA 5HD4A 1E9HA 2RGPA 4AOJA 3NR9A 4RMZA 2HZ4A 4L8MA 3VW8A 3WI6A 1XBBA 5LVLA 5C8KA 4N70A 4X2NA 3BWFA 5IEXA 5HE0A 2W96B 4FTCA 4J71A 3EYGA 4FYOA 1IA8A 3A7IA 4PMMA 2BRNA 2BRBA 2I0YA 3SG9A 2FH9A 1IG1A 3AD4A 3MVHA 3SLSA 4A07A 5GNKA 2J6MA 5HNIX 3OTUA 2R3NA 5J7HA 2YZLA 3S95A 3O8TA 3HVCA 1OMWA 4X21A 3QA0A 3ZM4A 4MH7A 1KE6A 3FQEA 5AA8A 5LVPA 4FUXA 4J95A 2BMCA 3UO4A 4O2PA 4IH8A 3ZXTA 4JDHA 3TTIA 3VHEA 3W2SA 5I0BA 2F49A 2C68A 2ZMCA 3OD6X 4C4EA 2CPKE 5KHXA 1SMHA 5M56A 3KXMA 3PXQA 5TF9A 2OJ9A 1PXKA 4O81A 5D12A 5CVGA 4EZ5A 2Z60A 2WAJA 3A8WA 3W55A 5HU3A 4OTIA 4TN6A 2ONLC 2PUIA 2CKEA 2XNOA 3MTLA 3TWJA 3PY3A 3P7AA 2B9JA 4RC4A 1U5RA 4JDKA 1OL1A 5HVKA 2ITPA 4QMSA 4ZTMA 4O0TA 4DT8A 3EN7A 4FOBA 4G9CA 4QMZA 4IWDA 5EKOA 5AUVA 5IQBA 3O50A 1OPLA 5GZ9A 4NKAA 2G1TA 4EOPA 1Q3WA 2XJ1A 3IW5A 4ZK5A 4BICA 4JBVA 2PHKA 5D11A 4AAAA 3O23A 5CEKA 3A7FA 1OL5A 4Y85A 4JOAA 4HYSA 1Q3DA 2HXQA 4C4IA 4K11A 1AD5A 1VYZA 4FL1A 1U46A 2WTKB 3MA6A 2ITUA 3OF0A 3LCTA 4CEGA 2VV9A 5E8WA 1TVOA 4R7BA 2C0IA 4BKJA 4USFA 2UVYA 1O9UA 1URCA 3F3UA 3LMGA 3NW7A 2A27A 5LMKA 4TYHA 2WTJA 3DBEA 3FMNA 2YHVA 5FP5A 2WTIA 5B2LA 4S33A 3DAKA 5H3QA 3W32A 4FEWA 2XIRA 3TDVA 2YDKA 4LL0A 4RWLA 5GIPE 5E8UA 4I6BA 2VO0A 4RLLA 2YACA 4EK4A 1OIUA 1ZMUA 5EH0A 5EQYA 5ACBC 3C4XA 3CTQA 3GU4A 2PZYA 4B7TA 3UQGA 2VD5A 4FSTA 4YMJA 4W4WA 3VWAA 4BDBA 3NDMA 4C36A 5IMXA 3LOKA 4WNMA 4XG4A 3V3VA 3W18A 3BHTA 4IMYA 4GG5A 2CKOA 1ZOHA 2BVAA 3FI2A 3NUYA 4EEVA 5A9UA 4PTGA 4AGUA 5DEYA 2CGVA 3EQDA 5EW3A 3O51A 3PJCA 5EI8A 3UJGA 4AGDA 3F5PA 3H9FA 4MHAA 4D1XA 4DGMA 1J7UA 2VUWA 1QPDA 3GCVA 5IUGA 4ZS0A 3TI1A 4AFEA 1ZLTA 2XBJA 2QCSA 5FP6A 4F9AA 4M97A 2XNMA 4CG9A 4DCAA 2BAJA 4L67A 4YLJA 2XEZA 5ANOA 2Y0AA 2BTRA 4RJ6A 5ITAA 3H10A 1H1PA 3LFEA 3R8LA 3WF5A 4Y95A 2O5KA 4WG4A 2HZNA 5HTBA 4C2WA 3JY0A 4XBRA 4AG8A 4C62A 4LUDA 4RBLA 4W8DA 4E7WA 4WIHA 3W2QA 3QTWA 2GNLA 1WBVA 4IAZA 4D9UA 4FTIA 4TYEA 3PZEA 4WRSA 4TXCA 5JEBA 1STCE 2GMXA 4CKIA 1VZOA 4G2FA 5KE0A 4PF4A 2WXVA 4A7CA 5CEPA 4NM5A 4NYEA 4FIIA 4EORA 2OIQA 5BPYA 4DGOA 3OW4A 4KRDA 4PV0A 4YZNA 5EK7A 4EHGA 3IOKA 4EZ3A 4G3CA 3FQHA 5HG9A 4FKLA 4NH1A 1JNKA 2PWLA 4DH8A 2VTQA 3KVXA 4L3PA 3UYTA 1H25A 1SNXA 2EB3A 3DLSA 3HEGA 3RHKA 3DK7A 4J99A 1TQPA 4IB5A 1W0XC 3FPQA 2ZV9A 4DA5A 3CCNA 3V8TA 3AT3A 1WBTA 1WCCA 2UZDA 3MI9A 2GS7A 3NEWA 4MXZA 4PMPA 3Q4CA 4J98A 3VQHA 1ZY4A 2XH5A 4G6OA 4FTLA 4NZWB 2ZM3A 1J1BA 1P14A 2YCRA 5E92A 5HO7A 3LXKA 4WOVA 4QP7A 1M2QA 1UA2A 4GFMA 3SG8A 1UWHA 4XH6A 3P78A 4RJ4A 4DEBA 4TYIA 4BDHA 3ZSIA 1YHWA 4BDKA 4KBKA 3TL8A 3ZONA 5HBEA 3BHYA 4OT5A 2C3JA 4U40A 2P0CA 5IPJA 3GT8A 4O22A 4J52A 5K4IA 2IVTA 5AP0A 4AT5A 5B2MA 4HVDA 3ORTA 4YLLA 1JSUA 1R0EA 3ALOA 4DG3E 4M14A 5I3OA 1IEPA 3PIXA 4GUBA 3EJ1A 3QQGA 3U4WA 3PPKA 2W1HA 5CVFA 3FUPA 3NUXA 2HXLA 3TZ9A 3U8WA 4IDTA 3TZMA 4K77A 5CSPA 5J1WA 2GCDA 4E4LA 5LCJA 2YEXA 1R78A 4JDIA 3LCOA 4WNOA 4KRCA 2WELA 3NVMB 2FSMX 4O0YA 3Q4UA 4WUAA 4C0TA 4Y72A 1TQMA 3BEAA 4MTAA 1R0PA 4AA5A 5HEZA 3UVPA 5C8MA 3ZRLA 4KUJA 2PVHA 3E8NA 2VNWA 3DTWA 3OUNB 4RIYA 3G9NA 3U9CA 4QP9A 2RFNA 4CLIA 5AP5A 3TUCA 4EH5A 3EFWA 3UG1A 4D2VA 4J1RA 3DNEA 3FPMA 3GOKA 3DTCA 4FVQA 4EOSA 5BUIA 4QYGA 5FTOA 2A0CX 3RWQA 1LP4A 4FL3A 3BV2A 3CXWA 1M2RA 2PY3A 3NYXA 4G5PA 2C6OA 2WZJA 2GNGA 4HZRA 3R9DA 3UIMA 4DFXE 1NVQA 3KC3A 3FSFA 3KULB 4OTGA 4E4MA 1KV1A 1OBGA 2E9VA 3GC9A 4X2KA 5CU4A 1UNLA 5FM3A 5CS6A 5HBHA 3BZ3A 3ZBXA 5EDQA 3OXZA 4X3JA 3TCPA 4OTHA 4K18A 5AUZA 4RWJA 2W4OA 3P79A 2G2HA 1L3RE 2J4ZA 4QTDA 5IDPA 3QTIA 3W2CA 2X39A 3A61A 2O0UA 4BI2A 3PJ1A 4S34A 4FNYA 2QU5A 2XK9A 3C4EA 3GOPA 3W16A 1WVXA 3R9RA 1UU9A 3F9NA 4I94A 4PL5A 4EKKA 4M7IA 4HYHA 5ANDA 3WOWA 4DYMA 2E9OA 2YJRA 4XEYA 3RJCA 3IOPA 4BF2A 1NVSA 5CI7A 5BVEA 3KGAA 1HCKA 3PPZA 5K5NA 4EKLA 4DH1A 2GNFA 4FKQA 2PZ5A 3WE4A 5CAUA 2OLCA 4C57A 2BHEA 3VULA 4YSJA 3MDYA 2CMWA 2IZTA 2QI8A 2OXXA 2UW6A 3OWJA 3QBNA 4QTAA 4WG3A 4EOKA 5A4CA 5JT2A 1XO2B 1XH6A 4WNPA 4ZY6A 1GIIA 4QQTA 3GFWA 3B2TA 5JSMA 3WZKA 5CEQA 4HPTE 2JAVA 2ITOA 4N6YA 3HUBA 2FSLX 3P08A 2ZMDA 2IN6A 2IO6A 3D14A 3HP2A 3RPOA 3ZLXA 4F9YA 5FTGA 5K3YA 2I1MA 5BYYA 4R77A 2ZV8A 4GJ2A 2ITZA 4EI4A 3OG7A 4IZAA 3DKOA 4RJ5A 3G6GA 5JQ8A 4M68A 3FZOA 5ETFA 5C03A 4QMNA 2OIDA 3SW4A 3ULZA 4UMUA 2BAKA 3R7YA 5L6PA 3R7GA 3L1SA 2YWPA 4GCJA 2VWVA 3PRIA 2WIHA 1RJBA 5JFXA 1NA7A 3FZSA 1V0PA 5AUYA 4A9RA 4ID7A 3EQHA 3HV3A 3RAIA 4EQCA 3DXPA 4DFBA 4G34A 2PVKA 4WG5A 3F5XA 4LGGA 4F7JA 4IAAA 1YVJA 3QYWA 4HCTA 3UDBA 4HYIA 4EC8A 1FVVA 1OVEA 3FAAA 5AV1A 3ZSGA 3OBJA 2QD9A 2VWYA 4BTJA 4YZBA 5HICA 2AYPA 3EHAA 3DA6A 3CR0A 1UKHA 2C6LA 3DK3A 1B38A 4AUAA 3PA5A 1OPKA 3VS7A 1NW1A 1R3CA 3M11A 4AW1A 2PPQA 3FXXA 4FSZA 4IM3A 2C6DA 5FWKK 3QD0A 1JKSA 1OGUA 5IQGA 2C0OA 2YLEA 4I23A 3D5UA 2ZB1A 3OMVA 2GNHA 4IAFA 3PLAE 2XCKA 2VWWA 4M15A 4YNEA 3RM6A 4FSWA 3W33A 2KTYA 2NRUA 4G3FA 4FV7A 3KQ7A 4V05A 3QAME 4U5JA 3MGYA 4M69B 4KD1A 2WQOA 4Z7HA 3VO3A 2HENA 4YP8A 3GVUA 3GQIA 4PMTA 4YHTA 4D1SA 3V6RA 4ANLA 4E8AA 3WIGA 1V1KA 4EOOA 3KCKA 4D28A 4IAIA 4H39A 3LFNA 4XS2A 3ORKA 4CLJA 2Z7LA 4XP0A 1H4LA 4F1TA 2VAGA 2DS1A 1WBPA 4BWKA 1GZ8A 3KL8A 5GZAA 4FV3A 2PZIA 5AADA 5HG8A 3JYAA 2E2BA 4FL2A 2WTDA 4CT1A 5FG8A 2VX3A 3A62A 3I0OA 2R3IA 3Q6WA 4NT4A 4AE9A 5HVYA 4EH9A 1Q97A 5IQEA 1PKGA 4BRXA 1LEZA 3IW8A 3W8LA 3E62A 1QCFA 4H58A 3VUKA 2GHGA 4J8MA 4EC9A 3BU6A 3DKGA 2XK8A 5BUEA 3G6HA 3K5UA 5BVOA 2IW6A 1REJA 4XBUA 3LMHA 5ETCA 2UZVA 2OH0E 4D55A 3V51A 3RK5A 3ZDIA 4IQ6A 1XBCA 2HYYA 3C4ZA 4G17A 4A9UA 3QKKA 2H8HA 2JFMA 4FBXA 2C69A 2CGUA 4E6CA 2I40A 4L46A 3C7QA 4X2FA 5CSWA 1DI9A 2X2MA 2DYLA 3MVMA 3LQ5A 2RKUA 3VQUA 2RFEA 1BL7A 2DUVA 3NNXA 2OZAA 5IQCA 2ACXA 4BWXA 3B8QA 2QU6A 3ALNA 3PYYA 2QQ7A 2VGOA 5A6OA 3UP7A 4F0FA 4H3PA 5FXRA 3HP5A 2CNQA 3DJ5A 2OWBA 1E1VA 3E8EA 3FZPA 1M14A 2OJGA 4KIQA 5AR8A 3FDNA 5E90A 1URWA 4E4XA 2NO3A 3F2AA 2JAMA 3MVJA 3QTRA 3VBQA 3WYXA 1U54B 1VJYA 4XOZA 5HQ0A 4U41A 4I6QA 2FB8A 3ANQA 3MH1A 1ZWSA 3ZLSA 2W05A 1SM2A 2OIBA 3UBDA 4APCA 3F88A 3ANRA 4KA3A 5HCXA 5D7AA 1E1XA 2GQSA 4YSMA 4O7YA 2FVDA 3NX8A 4IVAA 2QC6A 4EK6A 3THBA 3DAJA 4FT0A 3C5UA 5BMMA 3FJQE 4LI5A 3L9PA 3AC8A 4AZFA 2J0JA 2XYUA 3SHEA 4TRLA 4I24A 3IDPA 2C3IB 4IM2A 5CF5A 5DT0A 1GIJA 5K4JA 1Q24A 2PZPA 4EWQA 3Q4ZA 2IVSA 4F0IA 2W06A 4X7QA 5CF8A 3QUPA 2QOBA 1B6CB 3B8RA 3P5KA 3T3VA 5K0XA 2G01A 2VWBA 2VTOA 2W1FA 1YDRE 4KSPA 1F3MC 2VTHA 2GPHA 5AP2A 4A4LA 2YIYA 4GVJA 4FT7A 4GK3A 2YWVA 4JAJA 4MD8E 4MXAA 4JQEA 4CFWA 4E26A 2HOGA 5HBJA 2Q83A 3QRIA 2YM3A 4JIKA 3TNHA 3LXPA 3CE3A 4FTJA 5HD7A 2Y4IB 1K3AA 3GC0A 4XCUA 3WBLA 5FM2A 1UNHA 1LUFA 1REKA 2CSNA 3BYSA 4YZCA 1J7IA 3NRMA 5GIOE 1YXXA 3I6WA 4JQ8A 4AT4A 2JKKA 4IZYA 4LMUA 1J91A 3IS5A 5KNJA 3ORPA 2W1ZA 3TG1A 4IX4A 1Q99A 2X0GA 1JQHA 3DU8A 4IDVA 4NM3A 3FZRA 2ERKA 2QOOA 5DVRA 3R7OA 4AX8A 3VUMA 4FEXA 4DFUA 2YAKA 2G2FA 3I60A 1U59A 3VS1A 5FLFA 4E5WA 3DB6A 2QVSE 2BPMA 4O27B 3RCDA 4CXAA 1APME 2PUNA 1WBNA 3O8PA 5H9BA 3KXHA 2ZJWA 4FK6A 3W1FA 2WMWA 4FT9A 3R04A 4I4EA 4RFMA 1ZYCA 2VWIA 3ZTXA 1YI4A 3P7BA 3SGCA 3VBYA 3UOHA 3D4QA 2JIIA 2CGWA 3JVRA 1W84A 4RIXB 5L2QA 4B4LA 1KOAA 3R8VA 4CMTA 3QTXA 4ZS4A 1JBPE 3HRCA 1PYXA 2XYNA 5CSHA 5H8BA 4AZWA 3CY2A 4D0XA 2BROA 3DKCA 2QURA 4M67A 5LMBA 3NNVA 4IX5A 1G8SA 5CT7A 4ZXTA 3OY3A 5TKDA 1F0QA 3Q6UA 1JSTA 2W0JA 4KIKB 5ANGA 2VTSA 4K0YA 3C51A 3FL4A 3ETAA 3VUIA 2Y4IC 4TPTA 5CNNA 5DI1A 5AUXA 3U6HA 3OOMA 2HWPA 3CD3A 5HI2A 5C27A 2WU6A 2O64A 2R64A 2FA2A 3IONA 4W9WA 4OAVB 3VBWA 1Y8YA 2FSOX 2H6DA 4OTQA 3G2FA 3OTVA 3R00A 3FMMA 3LIJA 3EQFA 3PTGA 3QGWA 2Z7RA 3G51A 3PLSA 4FODA 2YIRA 3BELA 2GQRA 2HY0A 3FLYA 2YIXA 2PMNX 3D7TA 2VX1A 4JLCA 4U79A 5CX9A 3VF8A 2HZIA 4YC3A 3ZDUA 1CKJA 5K5XA 4QMVA 2HCKA 3BYMA 3COKA 3DV3A 1IASA 1BL6A 3FBVA 2WQMA 4A4XA 3EMGA 1H1WA 2BFYA 3A7GA 3BV3A 4EQUA 1HOWA 3KEXA 3WYYA 3ZEPA 4BKYA 3VS4A 3MH2A 4AN3A 2PULA 5FEDA 4AXAA 4K33A 1Q62A 4P90A 4PX6A 3GB2A 3OT8A 4QP1A 4G31A 5AX3A 2V7AA 4IAKA 4F9WA 2BR1A 2VZ6A 3CC6A 4G9RA 2ZDTA 4FG8A 3T8OA 4C61A 4IW0A 2QHNA 5L6WL 4FR4A 3R7UA 3WF8A 4BDIA 3KRLA 3HMIA 3MN3A 5TR6A 5IUIA 2O63A 4HNFA 4O84A 4F08A 2IZRA 3V5TA 3DBDA 3UQFA 3ZC6A 5CZHA 4EYJA 4L01A 4AGCA 1U4DA 4FV0A 4YZDA 3FE3A 3ENHA 3P4KA 3QQKA 2Y4PA 5HU9A 3H4JA 4NCTC 4QPAA 2IJMA 4K8AA 3RAKA 3UQCA 3FQSA 3Q9WA 2PVLA 3FI8A 3HMOA 3OFMA 3V5JA 3JVSA 1ZMWA 2VWUA 3RCJA 4O6EA 5B2KA 5HESA 3LXLA 4I20A 4TZRA 5A4TA 4FIJA 4YBKA 3TV6A 1YW2A 3QFVA 2XA4A 3KULA 4IE9A 3K3JA 4L42A 1Q61A 3EQPA 5CNOA 1FVTA 5T3QA 2QNJA 3UPXA 1HCLA 4YJRA 3UZRA 5BVKA 2B1PA 4HVHA 3O7LD 3QQFA 2JBPA 4JBPA 4JNWA 4CTBA 2PVRA 4BCOA 3C13A 4P7EA 2X7FA 3M1SA 3D83A 2AC5A 3Q9YA 1PXLA 3H0YA 4P5ZA 4YC8A 4JR7A 3DGKA 5IDNA 2XP2A 2X1NA 3PJ3A 5AR5A 5HORA 4GKIA 3MFUA 4O6LA 3UO5A 2B0QA 3FYJX 3JUHA 4AW5A 3PP1A 3R73A 1WBSA 3NMUF 2Z8CA 4R8QA 1CDKA 2QG7A 4FSQA 5JGAA 3HDMA 3LFCA 3BE2A 2WMXA 4UBAA 5EYDA 4G1WA 4BHNA 4CD0A 2PUPA 3PXFA 4EBVA 3LKMA 3PXRA 3UYSA 5AX9A 4W9XA 4DG2E 4I6HA 4JRVA 4Q9SA 2IWIA 1JWHA 3ZRMA 1KOBA 3BU5A 2Y6OA 5B7VA 3RMFA 3QKMA 2IW9A 4TWNA 5LCKA 5HHWA 4Y5QA 2WIPA 2WFYA 3G90X 3P7CA 4FIGA 4WBBB 2YM4A 3EIDA 5J87A 3QF9A 3DFCB 3QHRA 5AP6A 1OITA 2UVZA 3F6XA 4YJQA 5DGZA 3EKKA 3Q9XA 4YTHA 2UZUE 5BVNA 1OECA 3I0QA 3CKWA 5KZ0A 4R78A 3OXIA 3RPRA 1OM1A 4NL0A 2OFVA 1H08A 3MWUA 3BLRA 1PXIA 2X6DA 3NGAA 5F4NA 4RQVA 5HO6A 2GNIA 4C4HA 3MFSA 2QR8A 4IVBA 2R3MA 4QP2A 5EHYA 1IRKA 4PDYA 3W2OA 2PMOX 3PE1A 4L3LA 5IU2A 2R5TA 5AP7A 5TOZA 4QNYA 3OHTA 4FKSA 4FZ7A 1XH7A 4CV9A 4D58A 4GH2A 3OVVA 2B53A 4EK5A 2R3HA 4RG0A 4ZJJA 1ATPE 3Q60A 3EYHA 2R3LA 1PMEA 4QMPA 4N57A 4XG9A 3HUCA 2UW9A 3MH3A 5HZNA 1MRYA 4FNZA 4IHPA 4AOTA 4FV6A 1RE8A 2ITQA 3IW4A 4QTCA 5DOSA 5AMNA 3VVHA 4RX8A 2CGXA 1WFCA 2OW3A 4HGEA 4CFUA 3C50A 4ZSJA 3R1YA 1PHKA 4OBQA 4M69A 4RX9A 4C4GA 3DLZA 5CEOA 5HTIA 4GU9A 4M0ZA 5BVDA 3ZUVA 4FKPA 3ZMMA 4IX3A 2C1BA 4X3FC 3C0HA 4RVKA 2V22A 5FD2A 5KZIA 4CZUA 5EW9A 1JSVA 3QX4A 4KSQA 4Z7GA 1MUOA 3BHVA 4GYGA 3OZ6A 4UZHA 4DFZE 4XUFA 3DOGA 3VBXA 3COIA 2OK1A 3E87A 3ORNA 5EOBA 5CI6A 4PPAA 3PVWA 1BMKA 4F9CA 5D7VA 2B54A 5BNJA 4LRMA 1QL6A 2C4GA 5AM7A 2R3KA 3EOCA 1O6YA 4RRVA 5CLPA 4QTEA 2IVVA 2OJFE 3BPRA 4NTSA 3EQIA 4C33A 2ITTA 3CSVA 5E9EA 3AC4A 5EDRA 3E8DA 4PWNA 2PUUA 1PMVA 1AQ1A 3L9MA 3Q9ZA 3Q04A 3MY0A 4EOLA 3ELJA 3LJ1A 4FV4A 2BIKB 2VU3A 4UMQA 4YR8A 2RIOA 3D94A 3FV8A 2C5YA 4EUTA 4GKHA 1TQIA 1RDQE 4UYNA 2QOKA 5JMSA 3LQ8A 3W8QA 1W83A 4U81A 4YJTA 4C4FA 5KCVA 3KCFA 3OCBA 3U55A 2WD1A 3EFKA 4G6NA 4FKRA 4XRJA 5HX6A 4AACA 3K2LA 2VN9A 1SVHA
chains in the Genus database with same CATH superfamily
5CU6A 4U6RA 5AAGA 5ICPA 3KREA 4QQCA 1NT2A 4L44A 3F69A 1NVRA 4B8LA 3HZTA 3QTSA 4PP7A 2ITNA 4QP4A 3HMMA 3PZHA 5AV4A 4F70A 5L3AA 5KBQA 4FVRA 5DFPA 3SX9A 2QONA 5JRQA 3I4BA 3VJOA 1S9IA 4IVCA 3RZFA 3IO7A 3R28A 4DITA 2XKDA 2C6EA 2QKRA 4M66A 4KABA 3MFRA 1IR3A 2C6IA 5DEWA 3RALA 1ZYDA 2J0IA 3EQCA 3OOGA 2I0VA 3OROA 4WBOA 4I5PA 4KIPA 3NW6A 2XAOA 3KXGA 2GFSA 4H3QA 4QMXA 4ZOGA 4UALA 4C8BA 4UX9A 3F3VA 1LEWA 1OIQA 4U7ZA 5KMLA 2JKMA 3FMLA 1U54A 1Y6BA 3EFJA 3EZVA 4XYFA 5A4QA 3DDPA 3E7OA 3Q52A 1G8JA 3CJGA 5M09A 3IG7A 2PVNA 4TKSA 5JGBA 4BFMA 1DM2A 4OGRA 4EL9A 5ANEA 2DWBA 1RW8A 5C9CA 3REPA 5J8IA 5EOLA 5EW8A 4QMUA 3ZO4A 3GCSA 1OL2A 2R7BA 4DINA 3POZA 4P4CA 4ITHA 5D1JA 3TV4A 4EOJA 2ZOQA 4DFLA 3SXFA 5CALA 3HV4A 2PL0A 2A98A 2FO0A 2UUEA 5AUWA 4BB4A 4DC2A 4F7LA 4L3JA 1PYEA 3OWLA 3AKLA 4BC6A 5F95A 4TT7A 2R3RA 2REIA 3CPCA 3LVPA 1R39A 5A4LA 1W2FA 3EZRA 2HAKA 4O1PA 4G3EA 1TZDA 2VTJA 2ZB0A 2WO6A 4FTUA 4O0VA 4RVLA 4UYAA 3BCEA 3S00A 5DYJA 4YURA 4KKEA 5HG7A 5IG1A 1Q41A 4FT3A 3EQRA 3U87A 4RX5A 4ZJIA 1RQQA 5DR2A 5CAPA 1BYGA 1H28A 3TDWA 2YERA 4OTDA 2W9ZB 5A3XA 3SXSA 2AC3A 5D9HA 4CRLA 5BX0A 4IZ5A 3FLWA 3I7BA 2H34A 4N6ZA 2JDOA 4ANMA 4RVTA 4BDDA 2VO6A 3ZC5A 3NUUA 4U9AA 3RHXA 2YCQA 1M2PA 1QMZA 4QO9A 4EONA 4EH7A 4FV9A 4I5HA 4EH4A 1Y6AA 4CG8A 3F7WA 1GOLA 5CEIA 5IQIA 2YITA 3DKFA 3F3ZA 1JAMA 3O0GA 4R3CA 4QD6A 4HOKA 2YM6A 3NUNA 3FLNC 4MD7E 3TIYA 4DEAA 2XIXA 3DXNA 4YHJA 3HX4A 3VS2A 1GIHA 3DBCA 2QOLA 2VTIA 3NWWA 1BUHA 1OPJA 3GU6A 4PY1A 3NUSA 4RIXA 3PWYA 3PWDA 4XNEA 5HCZA 5HIBA 4NK9A 3E3BX 5GINE 2P3GX 3EH9A 3OUKA 4FT5A 5T68A 1KSWA 3GFEA 5CT0A 3TT0A 2OH4A 1Q8YA 2BILB 2Q0BA 1YWRA 3R01A 2Q0NA 5AR3A 4KIKA 3IDBA 5CSXA 3ZU7A 4ZMEA 4UWBA 3QUEA 3MB7A 2EXMA 2XNNA 2YAAA 3LHJA 4LOPA 4U8ZA 4ZIMA 3ZM9A 3DDQA 3HYHA 2WHBA 1UWJA 3GC7A 4IWQA 4LQMA 2UZWE 3MY1A 4BTKA 2C5OA 2R3FA 2ERZE 2JDSA 1Q8UA 2C0TA 3AD6A 5ANKA 4BY9E 2EWAA 3UPZA 2W5BA 4O7ZA 2JFLA 4BTMA 4CV8A 3L9LA 4MVFA 4GYIA 2OO8X 1YXTA 4FKJA 4F6WA 5IEYA 5DRBA 1K2PA 5BV3A 2W1GA 1OIRA 5AAEA 3TUBA 4U3ZA 5I9ZA 2Z2WA 4BR3A 3PE2A 3H30A 4JIAA 3I1AA 2W7XA 4MNEB 3R9HA 4XLIA 3OC1A 2WTVA 4RZWA 5DA3A 3SOAA 4FA2A 1KE7A 4ALWA 4FEUA 4D2SA 1A06A 2PU8A 3NAYA 5J9ZA 2NYAA 3TACA 4IBMA 2WMRA 3D2KA 4K6ZA 4J96A 2WGJA 4MWHA 2C6TA 3OBGA 1OL7A 1DAYA 5M57A 4MAOA 3ZBFA 3UC4A 3PSBA 5FUTA 3DQXA 4FSUA 2NP8A 2YFXA 5CSVA 4YZMA 4ARKA 3K5VA 3RVGA 5ETIA 4DEGA 4BYIA 5M06A 3G9LX 4XHKB 3ZFYA 4FTRA 4IJ9A 5C26A 4O7RA 4PP9A 1K9AA 2ITXA 3C0IA 2V62A 4I0SA 1CKIA 2OBJA 2OSCA 5HLWA 3WZEA 4C34A 4O21A 1PRYA 3F3TA 4FV1A 1CTPE 4V01A 4CTCA 4JG7A 4R1YA 4KIOA 4YNOA 4CGAA 3R2BA 4M8TA 1LR4A 2WB8A 3VIDA 2XM9A 3QGYA 4DEEA 3LW0A 4JL9A 4AA4A 3R8ZA 3GU8A 3JY9A 5HLNA 3N4VA 4EK3A 3II5A 2V55A 4LL5A 4U80A 3BHHA 4C3RA 4DGGA 5AAFA 3IECA 4E5BA 4FSNA 4I0TA 5I9YA 4O38A 1P2AA 1OGYA 3F5GA 4KINA 4ASZA 3DQWA 4I6FA 4LOOA 5I9XA 4JQ7A 4IFCA 2YCSA 1Z5MA 5JZJA 4EOQA 4XG6A 4ACHA 3UC3A 3UE4A 4L45A 1YQJA 3QC4A 5HGIA 3H3CA 5JFSA 4JX7A 4BCJA 3NYOA 4DT9A 4KAOA 3R9NA 3G0FA 2X6EA 4WHZA 3A99A 5CU2A 4DHFA 4GK2A 3IK3A 4HGLA 4I5MA 3SOCA 3TNIA 1BX6A 3AD5A 2BDJA 4LUEA 4QNAA 4V0GB 1XR1A 4CKJA 4AFJA 3AC3A 4YC6A 2HY81 2UW4A 2QO7A 4PDPA 5M51A 2XKFA 3CQWA 5JZNA 1S9JA 4FZAB 2QOFA 2A1AB 3ZO2A 2AEGA 4YJNA 1DAWA 4AXCA 2UW3A 1PJKA 4MKCA 4FSMA 4ZSEA 3DJ6A 4C02A 2HELA 3DJ7A 4TNBA 3TYKA 3OWPA 4BCFA 4RIWB 2UW5A 5ETAA 4B6LA 1GJOA 4LYNA 4U45A 4QP6A 2EB2A 1OKYA 1BI8A 1WBWA 1XH5A 4ASDA 5LWNA 1XKKA 4O7VA 1YHSA 4H36A 4FTTA 3R8PA 3T9TA 4RQKA 1ZYJA 2YCFA 4WNKA 4CZYB 2ONLA 3RWPA 3ZO3A 5I9VA 4QRCA 3KMUA 4GMYA 3SDJA 1CM8A 1GAGA 5EDPA 2R0UA 5IF1A 5BUJA 1GNGA 3KK8A 1WZYA 3MJ2A 3V8WA 5G6VA 3H0ZA 4J97A 3PA3A 3DZQA 4R7IA 2YDIA 3A60A 3S0OA 4WKQA 3LAUA 4O82A 5E8ZA 3VS0A 4ZTQA 3SV0A 1DS5A 2ZDUA 4C7TA 3QZIA 5FBOA 4I5CA 4F63A 1JPAA 3HLLA 4MK0A 3L8VA 1W82A 3R63A 4PDOA 3FMKA 4RJ3A 2C6MA 3IDCA 5JFVA 2O8YA 3HAMA 3OP5A 2WEVA 4F6UA 4TW9A 5FTQA 3EL8A 4HPUE 4ZEGA 1PXJA 3KN6A 5IUHA 4APPA 2A19B 3UZPA 5L8KA 1P4OA 3BYVA 5HCYA 3ATSA 4MUQA 4RA4A 4ZMFA 3LJ2A 4FOCA 4JAIA 3MTFA 1H24A 1M7QA 4O0SA 4BGHA 1UU7A 2EUFB 3EN9A 3EL7A 1XH4A 4BYJA 2GHLA 3AOXA 1PXNA 2IZSA 5AM6A 3R83A 3L9NA 3UVQA 1OUKA 5I9WA 3OS3A 2X9FA 3N4UA 4KBCA 2I0HA 3TZ8A 1OI9A 4I1ZA 4HGTA 5IISA 2PVJA 2PK9A 3AMYA 5KMMA 1ZARA 4IB0A 4LV5A 1BKXA 5C8NA 5F20A 2EU9A 5JH6A 4XRLA 5E4HA 1TFFA 2UW7A 3MYGA 5DE2A 4G3DA 2O3PA 5AA9A 3PXYA 2PE2A 4E73A 2GNJA 3PUPA 3V5LA 2VTAA 4F7NA 5AR7A 5BYLA 4MWIA 3DB8A 3R71A 4OAUC 2BAQA 2GTMA 3FY2A 3W0RA 2HW6A 3NYVA 2W4KA 4FZ6A 4JXFA 3V04A 4RVMA 4HW7A 4AXFA 3VJNA 3LE6A 3L8SA 3R0TA 4YHFA 4MBIA 4CVAA 3KRXA 3Q2MA 5AP3A 4CFXA 3S3IA 1J1CA 4ZSLA 4PL3A 1TKIA 5ACKA 3KMMA 5LMKC 3PDTA 3CEKA 1OIYA 3VAPA 2LAVA 4AN9A 4MQ1A 4USEA 2R3JA 3WARA 2BKZA 1ZXEA 4OUCA 2JKOA 3AMAA 1OKWA 1FVRA 5L4QA 5IMEA 1SVEA 3VN9A 4MXYA 3F61A 2J2IB 2JLDA 4KS7A 3KKVA 4MF0A 3WILA 3QKLA 4UN0C 3IKAA 3VRYA 1Q8WA 2R7IA 5M53A 4NUSA 3R1NA 4R3PA 4GFGA 3I5ZA 2J7TA 4LMNA 4AZVA 4O4BB 4GT4A 4FYNA 3E63A 1XH9A 2XIZA 4DDIA 5BMSA 4S2ZA 3U9NA 5CEMA 3G5DA 2OJIA 4TWCA 4O0WA 2EXEA 3DK6A 4WO5A 3ERKA 4HNIA 2J0KA 4QMYA 4BN1A 3QYZA 4RIOA 2FSTX 4C4JA 5L8LA 5EYMA 2CJMA 3HNGA 4BI0A 4C2VA 2WNTA 3KXNA 4IACA 4TTHB 3FSKA 4C3FA 3FI3A 3GQLA 3R7IA 2JIUA 5BYZA 4PQNA 3R7EA 3TN8A 1MQBA 3ORLA 3BE9A 3C0GA 1PMNA 2X0PA 3GCPA 3HGKA 4MEDA 1FMOE 2QR7A 4NKSA 4R1VA 4XJ0A 3F2RA 4YGAA 3KF7A 3QWJA 3RTPA 1M17A 2BKKA 4RWKA 2UZNA 5EYCA 4GG7A 3ACKA 1UU3A 5CVHA 3EN5A 4BCHA 3O71A 4FE2A 1H07A 4A9YA 4EZ7A 5E8TA 1I09A 4ANQA 5I4NA 4D4YA 1YOMA 3QCYA 4QYYA 4EWHA 4AGWA 3QC9A 3DNDA 5HIEA 2OXYA 5KMKA 5I9UA 4IZ7A 4E20A 3UOKA 4BWPA 1YXVA 2XIKA 2XANA 2LGCA 2HIWA 4FSRA 1F5QA 4GIHA 4YZ9A 2UW8A 4XG2A 4B8MA 4FKOA 3VF9A 3E8CA 3GI3A 1KE9A 4UMPA 2QOIA 4AA0A 4AQKA 3S4QA 4BGQA 4OBOA 5KUPA 3BLHA 3ZOSA 4NJ3A 4I93A 4RJ7A 3POOA 2YM8A 3AMBA 3P86A 5IKWA 2W1IA 3F5UA 5EYKA 3VBVA 4IWPA 2F2CB 3OEZA 3MPMA 4BTFA 4F0GA 3KXXA 2B7AA 2IVUA 4O96A 4MCVA 3BU3A 4D4SA 3QD3A 4JG6A 4TY1A 3WF6A 4QMLA 2OKRA 3EN4A 4GK4A 2HWOA 4QP8A 2YISA 3ORMA 4W4YA 3V5QA 1YWVA 2QLQA 4CYIA 1JOWB 2BTSA 1OBDA 2C3LA 4ACMA 4FV5A 3QXPA 4X2JA 3ENMA 2GU8A 4X6RA 4ZTLA 5M55A 5JGDA 3NUPA 3KMWA 4FTQA 4ANBA 2VNYA 3D7ZA 3FZTA 4KBAA 4BGGA 3QQLA 1T46A 1PXMA 2WTCA 4QMWA 4D2WA 2XKCA 4CCUA 3TIZA 4YTIA 2W1DA 4Q2AA 3EN6A 1MQ4A 3TJDA 4V04A 5EI6A 3EQGA 2WMAA 3GU7A 5FDXA 3BI6A 4RGJA 4E93A 5IZFA 2ETKA 4EBWA 4BCQA 3TXOA 3ACJA 2R3QA 4I92A 3ZLYA 4C38A 4CSVA 3UG2A 3Q2JA 3QTZA 5ANJA 3R30A 4BZDA 3ODZX 4DGLC 4ENYA 3UNKA 5IH4A 3L8PA 2BCJA 2V0DA 5E1SA 3V5PA 2W5HA 1G5SA 3UDSA 3CY3A 2WMTA 3AGLA 5M4CA 1IAJA 3A7HA 4H1JA 3OW3A 3LM5A 5DWRA 5TT7A 3FHRA 2JKQA 3NZ0A 5BQ0A 3T3UA 4S32A 3AXWA 3G15A 3FMJA 5EKNA 5AFVA 3CTJA 2Y9QA 2CKQA 4XX9A 5LVOA 3DBFA 4F1OA 2I0EA 4FNXA 3RPYA 4LRJA 4ANNA 3CGOA 3FMEA 4GT5A 5CAQA 2O65A 4M12A 5FRIA 4EH2A 2VTLA 3DCVA 1ND4A 2GS6A 4RC3A 4F09A 4DTBA 2B4SB 5HNBA 2R0IA 4UWYA 2XALA 5DMZA 5C01A 4Z9LA 3TNQB 3JS2A 3P5JC 2X9EA 5LJJA 1GZOA 5BVFA 3OEFX 4P5QA 3C4FA 1FMKA 2CNUA 4WSYA 3QZFA 2RFDA 2X8IA 3OCTA 3PXKA 4ZTNA 3RP9A 1PY5A 3WE8A 3F3WA 2VTNA 3RINA 3O8UA 3UOLA 2CN5A 4DH5A 4DTKA 5L2WA 2GHMA 1Y8GA 3PG3A 5IQHA 2WOTA 4LM5A 3SXRA 4ALVA 3NCGA 3M2WA 3QA8A 4MNEA 2YABA 1T45A 4L53A 3FI4A 4MNFA 5K0KA 5CU3A 3UNJA 1H27A 4CNHA 4J7BA 3HA6A 3H9OA 3ODYX 5DN3A 2JBOA 2X7GA 2F7ZE 5DIAA 3PIZA 3QD4A 4BBEA 3N51A 2IZUA 1IAHA 4BBMA 5C4LA 2BHHA 4RSSA 2F9GA 4YJSA 4JDJA 4IXPA 3TNWA 2WPAA 4ZLZA 3PPJA 2KULA 4I21A 4DTAA 3FKLA 3NAXA 3OXTA 3A4OX 3QQHA 2A4LA 2P2HA 1H26A 2QHMA 5I3RA 2CLQA 1YI6A 4FIFA 5FDPA 1QPEA 1IA9A 4U0IA 4ACCA 5GJDA 3D0EA 4IM0A 2X2KA 1Y57A 4TNDA 4A4OA 1H1QA 5K9IA 2R9SA 4GT3A 3BKBA 4X3FB 1PXPA 4RFZA 4D2RA 4D5KA 3FMHA 5I5ZA 4QTBA 2QKWB 2YA9A 3RKBA 3ZFMA 5JKGA 2EXCX 1J3HA 3JPVA 3HMNA 3TTJA 5JK3A 3MESA 4F99A 3BRBA 2XK6A 3LCSA 4M3QA 4KB8A 2QODA 2XRUA 3A8XA 4FKWA 3NNWA 4FKVA 4UMRA 4L9IA 2NPQA 4YPSA 5H8GA 4FEQA 3G0EA 4GUEA 3CIKA 4ZLYA 3BGQA 3Q96A 4O7TA 3ZHPC 3COMA 2CHLA 4RPVA 2W5AA 3COHA 4IANA 4MBJA 2WMSA 3A4PA 1YWNA 2X4ZA 4TYJA 1L8TA 5CYIA 3I81A 4C59A 4F9BA 2IPXA 5A4EA 2O2UA 3DAEA 4V0GA 5HNGA 4NEUA 4ZZMA 4D2TA 2B52A 2VWZA 3LFDA 5IEVA 2BRHA 5EFQA 4B99A 3L8XA 4Z3VA 4ORKA 1A48A 3KRWA 5AR4A 3KVWA 3BQCA 4AU8A 3SRVB 2PMLX 3FKOA 4RIWA 2XB7A 3Q32A 5LOHA 1WMKA 4BIDA 5HX8A 4BDFA 2RG6A 4D5HA 5E8YA 2PZRA 3GC8A 1V0OA 2OZAB 1UV5A 3H9RA 1UU8A 3LLTA 2Y7JA 3OY1A 3TKIA 4UY9A 4GV1A 2HK5A 4AWIA 4EH8A 3FHIA 1OKVA 5EM7A 3RI1A 2JD5A 3ROYA 4Y83A 3C5IA 4FTOA 4AZEA 1H1SA 4NWMA 3JXWA 5M07A 3QL8A 3FLSA 4I41A 4BDJA 1ZOEA 2C6KA 5DPVA 4DFNA 4E3CA 4RX7A 4ONAA 3TJCA 3KRJA 3KRRA 1VEBA 1XWSA 4G16A 3AT4A 4PNIA 3GGFA 4XV2A 1PMUA 1BLXA 4QYEA 3ZYAA 5J1VA 4O86A 2ETMA 3BX5A 3TM0A 3W2RA 4GIIA 2J0LA 3V6SA 5A46A 5DH3A 4FKTA 3B2WA 4XP2A 3FKNA 4XV9A 4OR5A 2HW7A 2OXDA 4BKZA 1VR2A 2ETRA 4JI9A 3PSDA 4JVGA 3CTHA 5KBRA 3UO6A 4IB1A 1YOJA 2C47A 1WVYA 4O7SA 2J0MB 5AR2A 5DNRA 3PJ2A 2C5XA 4AW2A 3RK7A 2DQ7X 1SNUA 4BHZA 4D4RA 2UZLA 1PXOA 4G6LA 2QO2A 2J9MA 4JX3A 4MQ2A 2XJ0A 4IJPA 3R7VA 5KHWA 3PXZA 1QPCA 1Z9XA 4FTNA 4JRNA 4EHZA 1ZYSA 1ZRZA 2WKMA 4AOIA 5IQFA 2JDRA 4R7HA 4ALUA 3R02A 2R2PA 2FUMA 4DEDA 3U54A 3UP2A 5F1ZA 5JQ5A 4BI1A 2PTKA 5DBXA 2A2AA 3VC4A 4W4XA 1ZY5A 4DH7A 4JR3A 3VS3A 1OL6A 3CGFA 3IQ7A 3ET7A 3F66A 3ITZA 5M4UA 4XG3A 4ZZOA 2I6LA 3FY0A 2YM5A 3K54A 5HE3A 4AS0A 4ASXA 1G3NA 4FIEA 4WUNA 5LVNA 2PYWA 4DFYA 3QZGA 5LMAA 3Q4TA 3QQJA 5LWMA 1YDSE 3MIYA 5JN2A 4LV7A 1J7LA 3P1AA 4RJ8A 4BDGA 5AEPA 4HZSA 4YPDA 2W17A 2WOUA 3BYUA 2C1AA 2RG5A 2WTKC 4FMQA 1PKDA 4FTAA 4DCEA 4GS6A 1H0WA 4QMTA 4DLJA 2X2LA 1YDTE 5IA0A 1ZMVA 4N0SA 1LPUA 1WAKA 3FC2A 4EJNA 4LGHA 4NW6A 2XIYA 3MH0A 3GENA 3AC1A 4YO6A 4GFOA 1CMKE 4YU2A 3GXLA 3PP0A 4JBOA 5HO8A 4EJ7A 2ZM4A 3O2MA 3Q3BA 5CTPA 3ZRKA 2JDTA 3QHWA 3LQ3A 5EQEA 3AC2A 4DF3A 1O6KA 3EFLA 2UZEA 4FF8A 5CY3A 3RK9A 3QALE 4IWOA 4KKHA 3NIEA 3IGOA 4QQJA 5L8JA 4F64A 4F7SA 2B55A 4HYUA 4LGDA 4WD5A 3VONA 3ROCA 3LPBA 2YZAA 3UIXA 2OF4A 4FZDB 2OU7A 3GP0A 1SYKA 3QZHA 4ZJVA 3KN5A 2ESMA 1W98A 5DLSA 2C5NA 5IA5A 2VO3A 2WMBA 5DT4A 4QYHA 3PJ8A 3TUDA 2Y6MA 2QOHA 3MPAA 3NCZA 5AJQA 2WMVA 3R1SA 3W0SA 1Q8TA 4QYFA 4ZTRA 4FK3A 5HKMA 4HCUA 3NPCA 3AKKA 4IFGA 3FLZA 3HAVA 4A9SA 3LFSA 4O0RA 3D7TB 3P9JA 5A54A 3BGPA 4CFMA 2G15A 5EM6A 3C4WA 1CSNA 3R22A 3ZCLA 1GZNA 3ZFXA 3BEGA 4RC2A 4FGRA 1FBNA 5FXSA 3WF9A 2Z7SA 4W4VA 1JKKA 4GW8A 1YKRA 5CAOA 2XAMA 4USDA 3EB0A 4GEOA 5AP1A 3T9IA 2J90A 3NNUA 5F9EA 2E9NA 1P5EA 3QU0A 3QUDA 4J8NA 4U42A 5KMIA 1W2CA 3U6IA 2YLFA 4EOMA 4M0YA 3ZUTA 2XUUA 3VW6A 3BIZA 3E92A 3BYOA 3CP9A 4MX9A 3LFQA 1ZAOA 1ZYLA 4ZSAA 5EHOA 4GL9A 4Q5HA 5FEQA 4BBFA 3TEIA 4QMMA 4DAWA 1AGWA 2WU7A 3NIZA 4AF3A 2X81A 2ITYA 2YM7A 3QXOA 4FKUA 3GCQA 2WEIA 4QMOA 4OTPA 4NSTA 4YUQA 2CKPA 5IQAA 3LZBA 3NLBA 2P2IA 3V5WA 1W7HA 4BCKA 2XNPA 2OF2A 4L52A 5EM8A 3LFFA 4IVDA 5LQFA 5A14A 3JR1A 2GQGA 2WQNA 3E3PA 2OGVA 4NCTA 5CASA 4O1OA 3N4TA 4UXLA 2GS2A 2VTRA 3UIBA 2AUHA 4OTWA 4BVUA 2WQEA 3C9WA 3BLAA 3U6JA 4UZDA 3A7JA 3FL5A 4HCVA 2WQBA 2XK3A 5ANIA 5M44A 3HA8A 4E5AX 4AQCA 5IA1A 4S30A 5E7RA 3ZS5A 4YO4A 4NIFB 3D15A 2C30A 2RFSA 4FV8A 4JS8A 4S31A 4YJOA 3CJFA 3QQUA 5TE0A 3DPKA 2F4JA 2RL5A 5CXHA 1XHAA 1XQZA 4E6DA 5KO1A 2OG8A 2X4FA 4DHJA 4R5SA 2BRMA 1FGIA 4FSYA 2QG5A 4ZY4A 1QPJA 1MRVA 2VTMA 3A2CA 4FKIA 2R3OA 4L00A 1JVPP 4DGNA 4ZAUA 4LG4A 1KV2A 2R3PA 2SRCA 5J9LA 4WA9A 3R9OA 2XVDA 1PF8A 3Q5ZA 4E6AA 4PL4A 5KKRB 4II5A 4F1MA 4BCPA 4U44A 3VS6A 4Q5EA 5AP4A 4BZOA 4QPSA 5KMOA 1XH8A 1ST4A 2XKEA 3ZH8A 5J79A 1FPUA 4DEHA 5HE1A 1FQ1B 3C1XA 2PE1A 4UWCA 4MD9E 5H8EA 4OT6A 4ASEA 5CU0A 5L6OA 3PG1A 3QRTA 3C4CA 2X7OA 4L7FA 4ACDA 3GU5A 4I22A 4O0UA 2XMYA 3IW7A 5AV0A 3ZZEA 2HZ0A 5E8VA 4FC0A 4BCIA 2PVMA 3ULIA 3D5XA 4BDAA 4CQEA 4N4SA 5DG5A 1H00A 4QOXA 5B0XA 5DR9A 3PVBA 2CNVA 4U43A 2GFCA 5JRSA 2G2IA 3KK9A 4ZTSA 3PSCA 2BZIB 2JIVA 4PPBA 3OCGA 3EQBA 3HL7A 1MP8A 2W99B 3WZJA 4E1ZA 3UODA 4Y5HA 3KB7A 3R8MA 3CBLA 3GCUA 4IEBA 3RPVA 5CZIA 2XRWA 4ZP5A 3RPSA 4QDVA 2JC6A 4NJDA 2VX0A 3NFFB 5IH6A 1FGKA 4X6QC 5AIKA 1Q5KA 3E93A 5AUTA 2ZV2A 3SAYA 3MIAA 4CYJA 5KKRC 5CF6A 2G9XA 1P4FA 2X8EA 2BZKB 4FX3A 4Y8DA 4WT6A 4YLKA 1PW2A 2W4JA 4I3ZA 4C3PA 3KXZA 3BQRA 4ITIA 1ERKA 3P23A 4O2ZA 4MXCA 4EUUA 3QLFA 1UKIA 2PVYA 4O7LA 2F2UA 3DY7A 4CKRA 3R8UA 3VUDA 2J5FA 4EK8A 2E9UA 2PVFA 1B39A 3U55A 3R2YA 1FOTA 3TV7A 4FJVA 1I44A 2NNWB 1M52A 2YDJA 2H9VA 2PMIA 5J5SA 3HV7A 3I7CA 5EM5A 3GEQA 4XP3A 2QO9A 3NYNA 3QX2A 3DZOA 1H8FA 1CKPA 4TYGA 2X8DA 3FEGA 5EQPA 1W8CA 2CCHA 4HVGA 3GNIB 3FXWA 4D2PA 4F6SA 3ZO1A 4MXXA 4X3FA 3ZZWA 5KX8A 3FMDA 2IG7A 4LFIA 4C58A 4YJVA 4E4NA 4U97A 3VS5A 5F94A 4DBNA 2H96A 4QT1A 4KKGA 1NXKA 3CD8A 2W1CA 3SQQA 4X2GA 4JG8A 2C5VA 3HV6A 1ZOGA 4PTCA 3MW1A 3AG9A 3PY0A 3MV5A 4JT3A 2P4IA 1KE5A 4IIRA 2UZBA 4IB3A 1YXUA 3E5AA 1NY3A 4TYHB 2BIYA 2W1EA 4O83A 3WF7A 3RNYA 4AE6A 2PSQA 4AZSA 5M08A 3RAWA 4EOIA 4PUZA 1H1RA 2ITWA 1OKZA 2BUJA 4AXEA 5KMNA 4EH6A 4ANSA 4NM7A 3W10A 3LCDA 5HTCA 4FI1A 2IEWA 2WTWA 4UEUA 4HVSA 2R3GA 3I79A 4NM0A 1BI7A 2W9FB 4XV1A 3N9XA 4RWIA 2J5EA 1WVWA 4WSQA 3UVRA 4QMQA 4OLIA 4FICA 2CCIA 5CQUA 2XJ2A 3E88A 3IGGA 1EH4A 5AWMA 5J7BA 3ORXA 1YXSA 3LMIA 4QDEA 5E91A 3QRUA 1Y91A 1MRUA 4E6QA 5EHLA 3SRVA 4AW0A 5FGKA 1G8AA 4Z16A 2XNEA 3TKHA 1KE8A 3IPHA 3D9VA 4M13A 4NTTA 3ZLWA 3E64A 3KA0A 4K9YA 5DT3A 4D1ZA 5IQDA 4XMOA 3F2NA 5HG5A 4BCMA 3PFYA 2P55A 4DLIA 2CDZA 5L2IA 1GZKA 2B9HA 2V5QA 3QCQA 4CQGA 5IA4A 1Q4LA 2JITA 2J50A 4BDCA 4DE4A 4KNBA 2VRXA 3PIYA 1YOLA 2IW8A 4TWPA 5BVWA 3QCXA 5CQWA 5D41A 5FQDC 5GZ8A 2XS0A 1U5QA 1UVRA 2GSFA 4C35A 2NRYA 5AV2A 3CQUA 3G33A 3UGCA 3HRFA 2XEYA 3UTOA 3EKNA 3QTUA 1O6LA 3CQEA 3O96A 4A06A 2GTNA 3NW5A 4R3RA 3F82A 4Y73A 2YIQA 2BZJA 3FXZA 3ML1A 3HKOA 4CFNA 3HRBA 4BIBA 2ZV7A 3P0MA 4HVIA 2ZFYA 2JDVA 5T6KA 3FC1X 3UNZA 4ANOA 4FNWA 3GUBA 5J95A 3W0NA 4XV3A 4IAYA 2YIWA 3OT3A 1JKLA 2CN8A 2QOQA 3MFTA 5FBNC 4ZY5A 4EHEA 2BZHB 3DFAA 5AUUA 3UOJA 2OF