4JRNA

Rop18 kinase domain in complex with amp-pnp and sucrose
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
362
structure length
349
Chain Sequence
SELVFEKADSGCVIGKRILAHMQELENSERLDRILTVAAWPPDVPKRFVSVTTGETRTLVRGAPLGSGGFATVYEATDVETNEELAVKVFMSEKEPTDETMLDLQRESSCYRNFSLAKTAKDAQESCRFMVPSDVVMLEGQPASTEVVIGLTTRWVPNYFLLMMRAEADMSKVISWVFGDASVNKSEFGLVVRMYLSSQAIKLVANVQAQGIVHTDIKPANFLLLKDGRLFLGDFGTYRINNSVGRGTPGYEPPERPGITYTFPTDAWQLGITLYCIWCKERPTPADGIWDYLHFADCPSTPELVQDLIRSLLNRDPQKRMLPLQALETAAFKEMDSVVKGAAQNFEQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rhoptry kinase family protein
publication title Structure of the Toxoplasma gondii ROP18 kinase domain reveals a second ligand binding pocket required for acute virulence.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 101
structure length 349
sequence length 362
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14531 Kinase-like Kinase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jrnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jrnA02
1M2PA 3GCVA 3S95A 4YPSA 5L6PA 3LQ3A 4G17A 3QXOA 3PG1A 4OW8A 2X8EA 5AAFA 5E1SA 5HNGA 3PRIA 3IS5A 2FSTX 3U9NA 4GCJA 4M8TA 1K9AA 5DNRA 3HA6A 5JEBA 2Y8OA 4EHZA 2V62A 3VQUA 4CFXA 4E73A 1ZYDA 3TACA 3KXNA 1YXSA 2FO0A 1JOWB 4EZ7A 2VTNA 2FGIA 3E8DA 5JGAA 3EN4A 1GJOA 3LPBA 3NUUA 1XJDA 4L3JA 4LOPA 4PPAA 3FV8A 4YC8A 4FV2A 3DTWA 5LMKA 4C38A 2XRWA 5IISA 5HESA 2A0CX 2XK8A 1BYGA 2RSVA 3QCXA 4UZDA 1ND4A 5M55A 2J0IA 3UODA 2RF9A 4I24A 5HGIA 5BMMA 3CBLA 5LQFA 4IM3A 2G2FA 5AUUA 5KHWA 3C4FA 5E8TA 4ZTMA 4IJPA 3PP1A 4YHJA 4AA5A 5FBNC 3CR0A 5CAPA 4IIRA 4O27B 1Q5KA 3F3VA 4FVQA 4BC6A 2QG7A 3FKNA 3GQLA 3LXPA 4FUYA 5HU9A 2BR1A 3LCTA 4D28A 2ZOQA 4R7HA 1GOLA 3UNZA 5B2KA 3CSVA 3OF0A 5EHOA 4NM0A 4BFMA 3AMAA 4F9BA 4IEBA 3FSFA 5J8IA 2F7ZE 3QCSA 2I7QA 3COIA 3GCPA 4AE9A 3FC2A 4ZSLA 2W4KA 1MRUA 4FV4A 2YCSA 4I22A 4M0YA 3VBVA 3D7TB 3L9LA 4JQ7A 4ANMA 4HGEA 5IEXA 3VUKA 2HELA 1ERKA 3OD6X 3LE6A 3ZFXA 2GHLA 1XH7A 5CNOA 2XNNA 5DT0A 4FKOA 4O7YA 4EBVA 2YWVA 3TEIA 2ITXA 3QX2A 4XYFA 4HW7A 2OSCA 4RIXA 3TUDA 4NM3A 2YM7A 4MD8E 3F61A 3SD0A 4HCVA 4XLIA 3FZSA 1W84A 5CT0A 1JKLA 1Q8ZA 3VNTA 4QMZA 2V7OA 3RHKA 3DB8A 3SW7A 4I4EA 4YC3A 1XH9A 4QYFA 2WHBA 3DBEA 4OTHA 1QL6A 3TZMA 3UPXA 3SLSA 3TUCA 2HENA 3K54A 4XG4A 3FXWA 2YJSA 5ETAA 3QKLA 3NUXA 2JD5A 3HP2A 4G6OA 1ZMUA 5DI1A 3WE8A 5IQIA 3VHEA 1YXVA 5KMIA 4D9TA 4KRCA 2V22A 4R8QA 3H9FA 5A4TA 3S00A 4JBPA 4JAJA 5AP4A 5EOLA 4BCMA 3E92A 4Y83A 3DBFA 4FV6A 5ANGA 4HCTA 3QQFA 3H3CA 5C4LA 3EN6A 3Q60A 3PA5A 4JRNA 4LUEA 4BDFA 5AEPA 5KUPA 1CM8A 3GU6A 4BBEA 3MTFA 4LOOA 2OH4A 1IG1A 2WQEA 5KCVA 4FMQA 5FTGA 4UMUA 1VJYA 3AD5A 3FKLA 3NCGA 4RX7A 2XKDA 2WXVA 4MXZA 4HVDA 3F2NA 2GU8A 4IFGA 2BIKB 2R3MA 3ZC6A 4U40A 4AFEA 2NRYA 4IWDA 5FDPA 3D5VA 4FV1A 1OL5A 3KRJA 4IWOA 5DRDA 3QQUA 1U46A 1ZZ2A 5DA3A 5BYYA 3CD8A 4UMTA 1SYKA 3AMYA 4FV8A 1QPCA 4U9AA 4D2PA 4BGQA 2JKMA 1E9HA 3W2RA 2GTNA 2WMSA 2XKCA 3UVRA 3T3UA 3N9XA 2VV9A 4HPTE 2O63A 4NKAA 2VO3A 3R71A 3GEQA 3F66A 3W2QA 4AWIA 2C3KA 3UPZA 2BZHB 2YISA 4XLVA 1KUTA 4I93A 4CMTA 4Y85A 2UV2A 5M4CA 4AW5A 4O82A 4IX5A 4B8MA 5C26A 3Q5IA 3LFNA 3DAKA 3FE3A 4FSWA 5HU3A 2XMYA 3QTWA 4NCTA 2XIKA 3FPMA 3NRMA 5E1EA 4EHVA 2PUNA 5E4HA 3HV4A 3G33A 4DH3A 2OH0E 2QODA 4YBJA 4U44A 1G5SA 3UYTA 3MY1A 5LOHA 3EL8A 3R7EA 4ANSA 3MB6A 4FTNA 2CHLA 5I9YA 4KBKA 4BDJA 3NX8A 4DA5A 4F0GA 3VS0A 3KK8A 5GZ9A 4ALUA 2JITA 1WBNA 4GT3A 5G1XA 2BAKA 1GZOA 1H1RA 1WBOA 5B0XA 4ANBA 1UVRA 4JBQA 2BFXA 2RG6A 2C6LA 3DXQA 5FEDA 5C4KA 3II5A 4OTRA 3JPVA 4FZ7A 4IVAA 4RBLA 4EYMA 3BLRA 3CIKA 5EQYA 4LMUA 4TYJA 4CFNA 3FLNC 3MPTA 4C59A 2BTRA 2YM8A 2EWAA 3PA3A 1AGWA 4LGHA 3BU6A 4YO6A 3UOLA 4YTIA 4QP3A 3W32A 1ZARA 4USFA 2XK9A 1Q8UA 4HNIA 3UC4A 3MA3A 3TKUA 4FTTA 4X2FA 4RWLA 4L00A 4J7BA 3JVRA 2GQRA 3U9CA 3RHXA 4AAAA 3D0EA 2WTKB 3BE2A 3SOCA 3RMFA 1YXTA 5FP6A 4FTQA 3VO3A 4F6UA 2BKZA 3C4CA 2B4SB 1PXLA 1Q24A 3FXXA 4EZ5A 3F7WA 4CKIA 2CGUA 4FSRA 1ZYCA 2E9VA 1PRYA 1OECA 4FZ6A 4M0ZA 3A7JA 3BEGA 2GS7A 4QMUA 4E5BA 5J9YA 4LM5A 1Q3DA 1SNUA 5HX6A 3NAYA 4I5PA 2XNMA 2ACXA 3O7LD 4O21A 5EW8A 4D5KA 5J9LA 4WO5A 2UW3A 5ETIA 3P0MA 4CTCA 5A4CA 4CEGA 2ZYBA 4QMVA 3E8EA 5AAGA 1PMEA 2W5BA 2G2IA 4ACMA 4YTCA 2ZM4A 2BRMA 3ORPA 2VWIA 1J7LA 4DEGA 1JAMA 3H10A 3DT1A 4C8BA 1TKIA 5AV1A 4Z16A 2ITTA 3L9PA 5IA1A 3PE1A 4E5WA 5CSPA 4JRVA 4C4GA 4V04A 4BCPA 3NUSA 3G9LX 3QD2B 4RLKA 4BY9E 3MIAA 3ORNA 3CQUA 3F7ZA 2BRGA 2R3LA 4H1JA 2B7AA 3CTHA 3NW5A 4X2NA 5CT7A 3RJCA 4DH8A 2W1GA 4LRJA 3L9NA 3B8RA 5JFWA 5L2QA 3WYYA 4I92A 4YNEA 3ORXA 4ACHA 2UZLA 2PHKA 2ZM3A 5A46A 4MWHA 4EOOA 2R3FA 4FKJA 4PDSA 4R3PA 3NNXA 4F0FA 5FLFA 4N57A 2W1IA 4JDHA 4ZLYA 4PQNA 4XH6A 1WBVA 2YACA 3ODYX 2EXCX 3R9HA 4Z7GA 2REIA 4IMYA 2YLEA 4H1MA 3NZ0A 1V0PA 4I4FA 3OMVA 4EUUA 4O0VA 1URWA 4YO4A 1ZMWA 2OJFE 2OU7A 4ASEA 3OT3A 4CCUA 4TKSA 4L43A 4DEEA 4I5CA 4O91A 4PL3A 4EQUA 4X0MA 4FGRA 4YP8A 4DBNA 1BMKA 3JY9A 5FD2A 4CT1A 4O1OA 1CDKA 3BCEA 3A99A 4P90A 4CRSA 4PP7A 5CALA 2B9JA 3EQBA 3BWJA 1F0QA 4XV2A 4ZSJA 5KKRB 3HL7A 2VTJA 4RC4A 4F9AA 5HD4A 2ZDUA 3DQXA 4WHZA 4QYEA 5FTOA 4EH8A 5CAQA 2BALA 1OBGA 5GIOE 5G6VA 2X7GA 2RFSA 4I0TA 4A9SA 4AW0A 3I6UA 3C5UA 3CGFA 3NAXA 4RC3A 3RNIA 3ZXZA 5M4UA 4U97A 3PFQA 3Q4ZA 3BKBA 4F9YA 2PL0A 4YJTA 3SXRA 2VX1A 4J99A 1YDRE 5ETCA 1ZY5A 2WTJA 2HY0A 3SOAA 2C0TA 4G3CA 2UZUE 3DDPA 4FIFA 4O6EA 5CVHA 5CS6A 1PKDA 2ITYA 2VO7A 3A62A 4WRGA 2PMOX 4C02A 3OCBA 4RIYA 5HICA 4RMZA 5AUWA 2PVYA 3BRBA 3EQRA 3NMUF 3AGLA 5HO8A 4TY1A 5A3XA 5AIRA 4R3CA 2X4ZA 3UG2A 4ACGA 5EKNA 2R64A 3HRCA 3DLZA 3VC4A 5DWRA 3ANQA 2J51A 3ZDIA 4K18A 4R5YA 3V6SA 5AFVA 5A54A 1I09A 4CLIA 4D4SA 4WNMA 4LFIA 2HW7A 5FRIA 1REKA 2IVUA 3QYWA 5CEMA 3BHHA 1OVEA 5AP2A 1REJA 4CYJA 2BPMA 4YZBA 3LCOA 4W4WA 4BI1A 4DLJA 1W82A 5CSHA 5HNBA 3UQGA 4FSYA 4LUDA 2IO6A 3R1QA 3DXNA 3NS9A 2R2PA 5TO8A 4R5SA 5IKWA 1Q4LA 2W0JA 5CF6A 2WGJA 2CN8A 4O7SA 4FSNA 1OKYA 2QOQA 5DLSA 3E8CA 4UALA 1DI8A 2BROA 4FE2A 4IVDA 1UU3A 4U41A 4R3RA 5T3QA 5L8KA 1ZMVA 1H25A 2J5EA 5EHLA 4DEDA 5K4JA 5DG5A 3BBWA 5AWMA 5F20A 4TYIA 1M17A 3ZBXA 4A4OA 1H1SA 1YXXA 3GOPA 2QOLA 4YHTA 3VUHA 2UZWE 3UYSA 2PUPA 4E93A 5CU4A 3P7AA 4MTAA 5K3YA 4HGSA 3EZVA 5EDQA 3R1NA 3FLYA 4FK6A 3EN9A 4EH5A 3WF5A 3KXHA 4IX3A 4MXOA 3G2FA 3GI3A 3QC9A 4TYHA 4YJQA 4OTFA 5FXSA 4RQVA 4YZ9A 4ZTSA 4N6ZA 3GENA 2EXMA 3K2LA 3RK7A 4EJ7A 2QURA 3F2AA 3WZUA 4J53A 1H1PA 4GRBA 3B8QA 2RG5A 1FMKA 3D4QA 1U5QA 3PG3A 2C3IB 3QRJA 2ITWA 2J0MB 2VWUA 1KV2A 3UZPA 3PJ1A 4D2SA 4I3ZA 2O5KA 2CSNA 4PMMA 4BHZA 3R7GA 1V0BA 3TDWA 3DB6A 4FI1A 4NK9A 1P5EA 4E26A 3HZTA 5DIAA 2IZSA 2G1TA 4S34A 3JXWA 2YABA 4S33A 3E63A 3CS9A 3A4OX 3DOGA 2R3JA 3L1SA 4AA4A 3HMOA 4OGRA 2UW6A 4OT6A 2PE1A 4FKVA 4D2VA 1XKKA 4KBAA 5DR9A 2WZJA 2JKQA 3COKA 1LEZA 3AOXA 4H39A 4MNFA 4C0TA 1JNKA 3DK7A 2WMRA 3OZ6A 5KMJA 5IUHA 3DY7A 1DAYA 4QD6A 3QCQA 4MHAA 4YU2A 4FKLA 4XRJA 4FV5A 5IG1A 1PJKA 3A8XA 4YSMA 4TYEA 5EK7A 3UIBA 3R9OA 4P5QA 5HG5A 5IH4A 4JOAA 1PXNA 3H9OA 2GNGA 2WTKC 2WELA 3EWHA 4KS7A 4UY9A 5E8YA 4WIHA 4KS8A 4RIOA 2JDTA 3UP7A 3FL5A 2EUFB 2X8IA 5BYZA 2HZ4A 3FC1X 3N51A 3O51A 4D1SA 4E8AA 5I9XA 3QWKA 4I20A 4O7WA 2C47A 3CY2A 2YM3A 2BZIB 5K0XA 4TNBA 3RCJA 4QMWA 3PIYA 2NPQA 4QP7A 3BE9A 5ICPA 3G5DA 3P7CA 3ZO2A 3ZSGA 4L01A 4S31A 3G0FA 3RKBA 5HO7A 2QOIA 1Y57A 3F3ZA 3QRTA 4RFMA 5TKDA 2ZV2A 4F70A 5CAOA 4QMNA 3NNWA 3MS9A 3POOA 2YFXA 3MVLA 3D7TA 3MJ2A 4J8MA 5TE0A 3JR1A 1R0EA 5JGBA 4DH7A 1W0XC 3K3IA 2BHEA 4FT9A 2PULA 2PVKA 4B7TA 3FJQE 2QOCA 5HE1A 2QR7A 2J50A 4DGGA 5K9IA 3PRFA 3QA8A 4UXQA 4QMQA 3MB7A 3U51A 3AGMA 4A06A 3U55A 5H9BA 3QZIA 5EYDA 4EC9A 2OXXA 1YI6A 2OK1A 3UG1A 4XOZA 4GT4A 4AUAA 1YI4A 3R28A 4ANOA 1M2RA 2Y6MA 3LKMA 5JGDA 3HX4A 3WZJA 4PNIA 3WZKA 4AX8A 5AAEA 1QMZA 5TR6A 4ZSAA 3K5UA 4GG7A 5E8XA 4EWHA 3KRXA 4FKQA 4LV5A 4A7CA 3O17A 3U6HA 2BCJA 3ORIA 3BQRA 4XG8A 3U4UA 1T46A 4WSQA 4C33A 2RIOA 4FBXA 4MX9A 1O9UA 4FSQA 5EHYA 5DGZA 2WMWA 4OTPA 5EH0A 5HLWA 1GIHA 2YDJA 4RZVA 4WNPA 1W8CA 4ID7A 2BAQA 5DT4A 3D94A 4S32A 3EFKA 2IPXA 4Y5QA 2VWWA 2C69A 4QMTA 5JK3A 5CSXA 2RL5A 3NUNA 4FIJA 4FIHA 4U80A 5FXQA 3V8SA 3VHKA 3ORLA 4APCA 4H3BA 3FMEA 2CJMA 5DFPA 4RJ8A 4ZZNA 1Z5MA 1UV5A 2ONLC 3EQGA 3LMGA 3VRYA 5KKRC 3O23A 4RIYB 3A7FA 3PY1A 3ENMA 4J8NA 4IZ5A 3AMBA 2W9ZB 3ULZA 2JBOA 3ELJA 4P2KA 4NTTA 4FIGA 4AT4A 4AZTA 1NW1A 4K0YA 3PTGA 4M84A 2CNUA 4JLCA 2XBAA 2IVTA 3D9VA 4HVHA 4O7NA 4IX6A 3DGKA 2VO6A 3P5KA 4BCQA 4WUAA 2WU7A 2VTRA 4YJPA 4ZS4A 5IQFA 2WMBA 3GVUA 4GL9A 1H1WA 2R3KA 4A9RA 4HVIA 2GQSA 1B39A 5H8EA 4DFBA 4DTBA 1Z57A 1VR2A 2PMNX 4EOIA 2XJ2A 2Y0AA 4OTWA 2G01A 1PMNA 2W5AA 3DKGA 3PWYA 4HZRA 4C3PA 4MH7A 4NFMA 3T9IA 3NW7A 5IMXA 5C8MA 2JDRA 3HAMA 1MRYA 2W1EA 4JDIA 4CQGA 4EUTA 4FTMA 5LVLA 4NWMA 2ITUA 3ULIA 4IM0A 3F69A 3O8TA 3UTOA 5A6NA 2EB3A 2X4FA 3KMMA 4FG7A 4QMPA 5IPJA 4EONA 1R1WA 4USEA 3W33A 1FVRA 4UEUA 2VO0A 2YIQA 4KIOA 4DT9A 2WMUA 5ETFA 3S3IA 1T45A 3OEFX 4PTCA 4ACCA 4PL4A 4AU8A 5L3AA 4E20A 2A19B 3Q2JA 4L52A 2F7XE 3R7VA 1OGUA 4K8AA 3TM0A 3UVQA 4DGNA 2C1AA 3ZO4A 5AIKA 4M67A 2BRBA 2GQGA 4RJ5A 4JT3A 5EI8A 4YJNA 3UMXA 5K4IA 4FL3A 1YDTE 3GP0A 1L8TA 3Q52A 2OF4A 3HVCA 3FDNA 4DGLC 4XV3A 5T6KA 3Q6WA 4IX4A 3FI3A 4EK5A 4FF8A 3UMWA 3W1FA 2AUHA 2F49A 2J4ZA 3RZFA 3KMUA 4C3RA 4FSMA 3MFRA 2ZDTA 2PE0A 5AUVA 2W1FA 4U45A 3RPSA 1JKSA 2I0YA 1OIQA 2CKEA 3NDMA 1OL6A 5IDPA 4GVJA 2XK7A 2R7BA 3BLHA 5CXHA 3NNUA 4EOMA 4FV3A 4J95A 4ITHA 4DH5A 4C36A 3DQWA 4XV9A 3T9TA 3GCUA 4AA0A 5M07A 2VTLA 3EKNA 3NYXA 5GHVA 2A1AB 2ITOA 2YERA 4O0XA 5B2LA 4NZWB 2E9NA 4JBVA 5BVEA 3V5TA 4PX6A 4RIWB 5M09A 3RI1A 4E4NA 2F2CB 3ZFYA 2XJ1A 4IB3A 2VWVA 2YIWA 5HBHA 2X2LA 3ZRKA 5HCXA 1YQJA 1OL2A 4B6LA 3SA0A 3MYGA 2XF0A 1NA7A 2HWOA 2A2AA 1KOBA 4IANA 4YHFA 5AADA 4PPCA 4NIFA 5CI7A 2EXEA 4DEBA 2Z2WA 4XEYA 4F64A 4QRCA 2WTIA 3TIYA 3ZONA 3TZ9A 4A4LA 4DFLA 4KB8A 3ALNA 4BZOA 4CGAA 4Y5HA 5H8GA 4Y95A 3CPCA 3MGYA 3NYOA 2XK4A 1BI8A 3MVMA 2ETRA 2ZAZA 4RVTA 2X9EA 4V01A 3EZRA 4FTKA 3HA8A 4FV9A 4HYSA 5DHJA 2XYUA 5H2UA 5AR7A 4DBXA 4PUZA 2NO3A 3IOPA 4ONAA 2R3HA 3GCSA 3IW5A 3BU5A 3OWLA 3QKMA 2W17A 4AS0A 3EKKA 4E5AX 4ARKA 4BDDA 3PJ8A 1OUKA 2HIWA 1JWHA 3C0IA 5HIDA 5IUGA 3DNEA 4FIIA 4D2RA 2WQOA 3ZEPA 2UW9A 2JKKA 4J71A 2PVHA 1RE8A 3P78A 1XWSA 3FUPA 4TW9A 3A2CA 1CSNA 1SNXA 4C7TA 4EK3A 4DCEA 4ANLA 3RWPA 5HIEA 2ZJWA 3VW8A 5HOAA 4Q9ZA 3P7BA 3FLSA 2GNLA 3QGYA 5EYMA 1LEWA 4D1ZA 5J1WA 3Q4TA 2JDSA 4GT5A 3OXTA 5LARA 4PY1A 3MESA 3AT2A 3ZO3A 4O86A 4AOIA 4IDTA 4NW6A 3QYZA 4GIHA 4QTDA 4MWIA 4EOJA 4D2TA 2CCIA 3R83A 1UNLA 4ZY6A 4QMLA 4NEUA 4DT8A 3GU7A 3WE4A 4II5A 4DGOA 5H8BA 1RQQA 1V1KA 3PSDA 4IM2A 4XX9A 3OCGA 5M57A 3MH2A 3HDMA 3BYUA 4YTFA 4ZIMA 4RRVA 3C0HA 4R6VA 1SMHA 2ITVA 3SW4A 4CZUA 1XBCA 1GY3A 4WA9A 2CCHA 3C4WA 5AP3A 2PVLA 1U4DA 2XNEA 2R4BA 3TKHA 3VUIA 4RFYA 4KKHA 3ET7A 3R1YA 2DYLA 3LCDA 4U3ZA 5DPVA 3EHAA 4M68A 5I9UA 2JAVA 4X2JA 2ETKA 3EH9A 4UMPA 2ONLA 3GFWA 3ALOA 3RWQA 4ALVA 5CANA 4J97A 4S2ZA 3PLAE 4LV8A 4WBOA 2OKRA 4S30A 1P2AA 3KRRA 3IQ7A 3T8OA 1K2PA 2UZEA 2IW9A 3VS3A 2BDWA 4YR8A 5E8SA 3LFDA 3PXRA 5DYJA 3P86A 2BRHA 3LFEA 4XHKB 2NNWB 2F57A 5BYLA 2UUEA 3EQCA 2JBPA 3HV7A 3W8LA 3LLAA 3E88A 1PXIA 2XJ0A 3FBVA 3RM7A 3DAEA 5DOSA 4F6WA 3ZM9A 4FEXA 1L3RE 3AQVA 4BR3A 4FEVA 3F5UA 4V0GA 5AV4A 4BDIA 2GFCA 4D4RA 3VS5A 4LGDA 2W5HA 4F1OA 5HBEA 3ZYAA 3KXXA 3SX9A 3F5GA 5EM8A 4EKLA 5A9UA 4O7ZA 2WMAA 1NVSA 4NSTA 2QD9A 4WNKA 4NKSA 2W9FB 4GU6A 5CYIA 5L2SA 4MQ1A 2VAGA 2Y7JA 2PZYA 2OJJA 5CLPA 3W8QA 4FV7A 3R8ZA 4JJRA 4AG8A 4DEHA 2VTHA 3R7UA 3GQIA 5JFVA 5M08A 3UNKA 4EQCA 3A7GA 5KX8A 3LOKA 2RFEA 1KE7A 2BZKB 5A4QA 4ZS0A 1OI9A 3VBQA 2WMQA 2WOTA 2VTTA 5FM2A 1YHSA 5BVFA 4WKQA 3PPJA 3ORMA 1VZOA 2GFSA 4NM7A 1XBBA 3QUEA 4RX8A 3H4JA 4FA2A 4D55A 4AOTA 5L4QA 4CV8A 1OKVA 2A27A 5JFSA 3WF9A 3PYYA 2NP8A 5A6OA 3PXYA 5D9HA 4XG7A 2R3OA 4FV0A 3KF7A 5CU6A 4KSQA 1ZAOA 4NJDA 3UP2A 2JGZA 3V5JA 3CGOA 1GZNA 2HCKA 3DZOA 5AV3A 3RAIA 3VUGA 1SM2A 1KV1A 3C50A 2FUMA 3MWUA 3GC7A 4DN5A 1M14A 2P2HA 3C1XA 3QQHA 2VTSA 1R3CA 4L68A 3SAYA 2XM8A 4GV1A 4UYNA 3VBTA 4UMQA 1MUOA 4TT7A 1XH5A 2OO8X 4E1ZA 3N4TA 2OIDA 4BB4A 3TTIA 3ZFMA 4DGMA 2WEVA 4RJ6A 4QTCA 5EW9A 4HYHA 3RBWA 3H9RA 5GZAA 4QMMA 4CRLA 5TF9A 5KMNA 2Y4IB 3BLQA 4O38A 2Q0NA 2VTQA 3U8WA 4BGHA 4CFUA 2QLUA 2WMTA 3PJ2A 3OBJA 3O0GA 4PDOA 4BI0A 1Q61A 2H34A 3TV7A 3BYMA 2WPAA 5AUZA 4ZJIA 4FEQA 4MEDA 3AC4A 2PMLX 3GU5A 4ZMEA 3BBTB 4QPSA 3PVUA 2F7EE 5BX0A 3HUCA 1H26A 2Z7SA 5ANDA 3QX4A 4C61A 3QBNA 2BDFA 3PJ3A 3W2SA 4RJ3A 2QOHA 3FYJX 2QU6A 1PXJA 5KNJA 1OPKA 2ESMA 4QYGA 5EYKA 3HKOA 2F9GA 1ZYJA 2GTMA 3MN3A 4UX9A 4DEAA 1U5RA 3KXZA 3NCZA 3LVPA 4RZWA 4TYGA 4D5HA 2IG7A 2OBJA 2WU6A 3QRIA 3OFMA 3GCQA 4CCBA 1Q62A 2QCSA 4O1PA 2BVAA 1HCKA 4QMOA 4GU9A 3PE2A 4RA4A 1J1CA 1M52A 5ANEA 4FKWA 4ZTLA 4F1TA 4NIFB 5IA4A 1M2QA 4R78A 1WBWA 4GUBA 1BL7A 2UW7A 2G15A 2Z7LA 4HJOA 2ZB1A 2I1MA 3QU0A 4FTCA 4LL0A 2XRUA 1B6CB 4MXCA 3RALA 3RM6A 3OT8A 3PVBA 3VUDA 5HLPA 1JQHA 2OIQA 2C6MA 4QQCA 4F7NA 3IK3A 4FG8A 3VIDA 4Q5HA 3AT3A 3MFSA 4BF2A 2XCHA 4IAYA 4U0IA 1H8FA 4CZTA 2ETMA 1ZOHA 4FYNA 5ANJA 2JIVA 4A9YA 5CXZA 2C5VA 4XG3A 3COHA 3DFAA 3VAPA 3ZHPC 3R04A 3POZA 3P1AA 5H3QA 5HORA 3JY0A 5EYCA 3IONA 4FSTA 4PL5A 3P08A 5JFXA 3R2YA 4O0SA 4IZ7A 4ASDA 5GJDA 1OM1A 5HCYA 4GKHA 3GOKA 3F82A 3RK9A 5D12A 3V3VA 4MK0A 2CKPA 1ZRZA 2FYSA 3KRWA 2JDOA 3LLTA 1P14A 2WTVA 4AW2A 5F9EA 5GJFA 1P4FA 3ZCLA 4BTJA 4FX3A 4XS2A 4FVPA 5JQ5A 4GK3A 3DPKA 4HGLA 4IAKA 3DBCA 4IWQA 4BHNA 5LVOA 5D7AA 5EI2A 3SG8A 2I6LA 4C2WA 2IVSA 3TCPA 3NUAA 4FL2A 3IO7A 1FGKA 3FAAA 3LW0A 3PXQA 2JFMA 3OUKA 2H96A 3E7OA 3IPHA 3M11A 3QTZA 4I21A 4AE6A 1H0WA 4RA5A 4LI5A 3CEKA 4NW5A 3EFWA 4BWPA 2ZV8A 1YRPA 5CWZA 5DRBA 5J87A 4BWKA 2QONA 4APPA 5J95A 3ZEWA 4AT3A 2W1HA 2OJ9A 5J1VA 1QCFA 3NSZA 4GFMA 5D1JA 3UC3A 4BCFA 4EWQA 1OIYA 4JAIA 4TRLA 2OZAA 2PSQA 4XNEA 2UW5A 3FMLA 3KVWA 5AP7A 4QPMA 1G8AA 4FSZA 2J5FA 3M1SA 3FKOA 3S0OA 2C6IA 3IOKA 4ZSEA 3KK9A 2XCKA 3P79A 1KE5A 4D9UA 2P3GX 4IH8A 5HO6A 4BKZA 4OT5A 3UNJA 5HVKA 5IH5A 3A60A 5EDRA 3O50A 3OS3A 3G6GA 3FMNA 4HPUE 4V0GB 5A4LA 2B52A 3KMWA 2GCDA 4O0WA 2YIRA 3LFCA 4W4YA 4PMSA 1PMUA 4HZSA 2BKKA 3NWWA 5I4NA 5LWMA 3KXGA 5HKMA 3NGAA 3ZC5A 1URCA 3WI6A 3MH3A 1IA9A 4FZAB 1PW2A 4M15A 3NLBA 4FT3A 4J96A 4F7JA 1WAKA 1H24A 2C5NA 4I6HA 1YOJA 3CPBA 3OBGA 4BIBA 4IAAA 3EOCA 4JR3A 4W4XA 3FY0A 3NNVA 5M4IA 3EYGA 3TZ8A 4DFYA 4X3FB 5TT7A 5BUIA 4X3JA 3VJNA 2XH5A 4KIKB 3IW7A 3ZLYA 2XA4A 5ITAA 4DITA 1DS5A 4UYAA 5I5ZA 3Q2MA 4ALWA 4RLLA 1AQ1A 1Y8GA 2WTWA 3DJ5A 3Q6UA 5K0KA 3QA0A 3TJDA 4G31A 3KU2A 3BHYA 3R0TA 3R8UA 3I6WA 2PVRA 4P4CA 3ANRA 1MQ4A 4UWBA 4C58A 3HEGA 2O0UA 3QQGA 1R39A 4LG4A 2PY3A 4BBMA 5KMOA 2XIRA 3ZZWA 5AA9A 2PK9A 3MY0A 1ATPE 2VX3A 5ACBC 4L67A 4XJ0A 1WCCA 4K77A 3VBYA 2YA9A 3UVPA 3CD3A 1LP4A 4G1WA 4JL9A 4O6LA 3I81A 2CMWA 4HGTA 3PY0A 1H07A 2FSLX 5HVYA 4DG2E 3DBQA 4JG7A 2HZ0A 4U8ZA 3BGQA 1PXMA 3LJ0A 3L8VA 3FXZA 2UZBA 2W1DA 3VF8A 4FTJA 3WZEA 3ZRLA 3KN6A 5KBQA 2OGVA 2CN5A 4GYGA 5L6WL 5CX9A 3U87A 2CGWA 4L44A 2QQ7A 3NYVA 2XUUA 2XKFA 2B0QA 1J91A 3OCSA 5CEKA 3D7ZA 3MI9A 3QXPA 4YUQA 3V01A 1BX6A 1JKTA 2UZNA 3QLGA 4PPBA 4U6RA 3F3WA 4TPTA 2C3JA 1YHWA 3GFEA 3VUMA 3KREA 2YM4A 4L9IA 4DE4A 5GINE 4QYYA 1DI9A 5J5TA 2JAMA 1F5QA 1KOAA 1LPUA 4BCGA 2GDOA 1WVWA 3PPZA 1Q8WA 3DJ7A 4RIWA 3OW3A 4H3QA 4YZDA 5DBXA 5FBOA 3TI1A 2GHMA 3TN8A 1JSTA 2ZVAA 4CMUA 4CKRA 2X2MA 4BYJA 3R8VA 2RFDA 4LMNA 4EH4A 3N4VA 2Q0BA 2DWBA 2Y4IC 4H36A 5J9ZA 4GK4A 5L2TA 3PZHA 1H1QA 5EM5A 5L2WA 5ACKA 2BTSA 4ZTHA 1Q3WA 4M13A 2J2IB 3E62A 4UN0C 1YWNA 3JVSA 3UQFA 1YOMA 2JEDA 3UDBA 5HG8A 5J7BA 3EFJA 2YEXA 5IQCA 3CKXA 1ZOGA 2I0EA 2X9FA 4W8EA 4DFZE 5HQ0A 4QP8A 3UOKA 5F94A 4YLJA 3W2OA 2YM5A 5FEEA 5E7RA 3F5XA 3SXSA 4RVMA 3LJ1A 5AMNA 3UJGA 4ITJA 4XV1A 1MRVA 4AT5A 3UIMA 4F1MA 5BMSA 4EKKA 3TNPC 3R7IA 3W18A 3CKWA 4N6YA 1Y6BA 4EZ3A 4HVSA 4YJOA 5HVJA 1OBDA 2GMXA 2J0KA 2JKOA 4KBCA 3CCNA 2XEYA 3ZU7A 4DHFA 3PP0A 1ZZLA 2WNTA 3RINA 4BTKA 3IDPA 4IZAA 2E9PA 4QP6A 4QP1A 5F1ZA 5BVNA 2QU5A 3NIZA 5IUIA 3MSSA 1M7NA 3D2KA 4CZYB 4GH2A 4TZRA 2QO7A 3C4ZA 4ORKA 1SZMA 5M44A 3TL8A 4LRMA 3QKKA 2WB8A 4G34A 4ERKA 4Z7HA 1UU7A 1NXKA 4EK6A 3ZS5A 2V7AA 2PWLA 1OUYA 2P2IA 4MAOA 3E7VA 4JQ8A 5HI2A 2GPHA 1IR3A 2J90A 3L8XA 2QVSE 4O2PA 3FLQA 5CVFA 2UZVA 3Q53A 4GW8A 2VWYA 4X6QC 3F2RA 2XYNA 5D10A 5E8WA 4GUEA 2PPQA 4H58A 4IHPA 1JPAA 3NYNA 3P9JA 4F08A 3QAME 3QTSA 4B99A 1AD5A 4EL9A 3ROCA 3THBA 2VWBA 4QOXA 5LVMA 3HMPA 2GSFA 3G51A 1XH4A 2BDJA 4GMYA 3ENHA 4GYIA 4IJ9A 2B9IA 4YURA 3I5ZA 4U81A 3BPRA 1WFCA 3TG1A 2ERKA 3AXWA 4DF3A 3MTLA 4FKTA 5BVWA 3NVKI 3OHTA 3Q5ZA 2ITPA 3F9NA 3A4PA 4FNWA 4BIEA 5M4FA 2O2UA 4FEUA 4FR4A 2HOGA 3UQCA 3C0GA 1WZYA 3MV5A 5C01A 4QP9A 3KCFA 3FQHA 3MFTA 2IVVA 4EEVA 2OZAB 4TN6A 4RX9A 1SVEA 4C2VA 3PXKA 3R63A 3GT8A 3FI8A 1EH4A 2VRXA 3AD4A 4FTAA 3EQIA 2J0LA 4X6RA 2B53A 4PF4A 3JUHA 5ANKA 1ZLTA 2GNHA 4I1ZA 4FODA 3FQSA 3TNIA 3VN9A 5M56A 1J7UA 4BTMA 1YOLA 4RC2A 2EB2A 4E6AA 4ZAUA 4ZJVA 5E8VA 1XH8A 4YGAA 3PJCA 3RZBA 4JG8A 2BMCA 5AUTA 3SVVA 2WMXA 5FM3A 4UB7A 5HEZA 2IW6A 1Q97A 4AW1A 2B9FA 1IAJA 4FT7A 2AC5A 1WVXA 3E5AA 3SKCA 3ZLXA 2IWIA 3ZOSA 5K5NA 3A7HA 5EFQA 5E9EA 4G16A 3VVHA 5AR8A 4EH6A 2C30A 3CJFA 4FK3A 3QF9A 4FNZA 3V6RA 4GJ2A 3VBXA 1XO2B 4Y8DA 3RPYA 2R3NA 3TUBA 3V8WA 2RFNA 3FPQA 3BYOA 3B2WA 3ZO1A 4OAUC 3IW6A 3R01A 4RGJA 5J5SA 3VW6A 2YDKA 4NU1A 3BHVA 2Y9QA 2R3IA 3BGPA 5HG7A 2OF2A 3OP5A 5BQ0A 4E4MA 3JS2A 5EOBA 4OBOA 2RKUA 5JZJA 4QQJA 4XG9A 3DV3A 1UKIA 4E3CA 4I6BA 1QPEA 1VYZA 4FTLA 4G3EA 5HE3A 1NY3A 1OKWA 4ZSGA 2OXDA 3RAKA 3V5QA 4AQCA 3BYVA 4ZTRA 5CASA 4DYMA 5HD7A 4RFZA 4PMTA 2X1NA 3EQFA 3ZSIA 4U5JA 4F65A 4EH9A 4LYNA 5GIPE 5CF8A 1YXUA 2LAVA 1FBNA 4D2WA 5JQ8A 4M14A 2WIPA 3AG9A 4E4XA 2HY81 3A8WA 3MA6A 5C8KA 4WD5A 3FSKA 3GC0A 2ZB0A 2XBJA 5KE0A 4D0XA 4TWCA 2V0DA 5JMSA 4WOVA 2WAJA 3P23A 4IWPA 3R21A 1OIUA 5IU2A 4IB0A 4X3FC 5HIBA 3UZTA 1FINA 3IDBA 5BPYA 3SG9A 3EN5A 5CAVA 2IZUA 3T3VA 4ENXA 1MP8A 4ZJJA 1Q8YA 3WIGA 3ZXTA 1UWJA 3EIDA 4U42A 2Y4PA 3QHRA 4B9DA 1PF8A 1R0PA 5IEVA 4J1RA 4O7TA 4GJ3A 4M7IA 3PWDA 3KRLA 5AP5A 3HV5A 4J98A 4O7RA 3F3UA 2O8YA 1CKIA 2VWZA 3OOMA 2QOFA 3ACJA 4G3DA 4YJVA 4ENYA 3QHWA 1O6YA 3Q04A 2BRNA 4HYIA 1G8SA 4R77A 3DDQA 4BDHA 3BI6A 4AGCA 3BQCA 2VUWA 4JIAA 4TNDA 3E87A 4FOBA 2XEZA 5FP5A 4D4VA 3BGZA 5BVDA 3OY1A 5E8ZA 4AF3A 1SVGA 5B7VA 4QO9A 5EKOA 3KULA 4BN1A 2QKWB 4BKYA 2EU9A 3DKFA 2CNVA 2FSOX 3R73A 3PSCA 4G2FA 3KVXA 3V04A 4MXXA 5D7VA 2YJRA 4FKSA 1OL1A 2JFLA 4EHEA 2PVNA 2J7TA 5C03A 3BWFA 3DS6A 4BI2A 3ZRMA 1Y91A 4O0TA 3FY2A 5I9VA 5JKGA 4PWNA 4I41A 5HX8A 3ETAA 2VX0A 5LMBA 4F6SA 2WFYA 4ZTQA 1OPLA 4IVBA 1WBPA 4IW0A 1A9UA 2ZV7A 3NUPA 4ASXA 4AACA 4OLIA 5HG9A 4GIIA 3GU4A 4EQMA 3HDNA 5HHWA 5CEPA 4CLJA 5IA5A 3RPVA 1S9JA 2P33A 2BZJA 3H0YA 4YC6A 5CZIA 4N0SA 2XNGA 2F2UA 3BIZA 3FI4A 4GK2A 1B38A 5IQAA 1YDSE 2WQNA 1U54B 2VTIA 5J7HA 1GNGA 4JIKA 4NUSA 5AA8A 3QLFA 5LVPA 2HYYA 3E3PA 4QYHA 3EJ1A 3I0OA 1VYWA 5HTBA 4NYEA 4CSVA 3EN7A 3E93A 4PTEA 4YNOA 3R8PA 2YLFA 4PDYA 3UZRA 1Z9XA 3VS6A 2J0JA 5D11A 4C62A 1IRKA 4P7EA 1XR1A 4AZWA 4LL5A 5LXMA 1BUHA 4EOKA 5IQHA 4C4IA 2HK5A 3DK6A 2OG8A 4DC2A 4CG8A 2C0OA 4RJ7A 2GS6A 2VTPA 5I3RA 4IAZA 4FKGA 4W8DA 2WTCA 2HW6A 3PPKA 2Z8CA 2BUJA 2HXQA 2YAAA 3DU8A 4QMXA 4L42A 3C51A 5A14A 2QHNA 3MH1A 3SHEA 3UIXA 1GIJA 2UW4A 1YW2A 3WIKA 1E1VA 4O7VA 3C9WA 2YAKA 4EOQA 4XUFA 3FLWA 2WD1A 3D14A 3R7OA 4O84A 3QD3A 3DAJA 5KZIA 1R78A 3IGOA 1WBSA 4K2RA 4K9YA 3QALE 3CTQA 1SVHA 3R22A 4RX5A 4QP4A 4D58A 3I7CA 4QMSA 4UBAA 4XBUA 3C5IA 2H9VA 3LIJA 4RWKA 3VWAA 3QUPA 4X21A 4PNKA 2OFVA 4EI4A 3G90X 2PTKA 3ZMMA 4H3PA 2VGPA 5DE2A 4YZCA 5LWNA 2XP2A 4MNEA 3WYXA 3MW1A 3KKVA 2VTAA 5AP1A 3SDJA 3BEAA 3RAHA 2PUUA 3NPCA 3TT0A 4NTSA 1H27A 2FA2A 4Z9LA 5F95A 3RAWA 3FMMA 5CF4A 5M06A 2W99B 4FZDB 4GS6A 3D15A 3DKOA 1Q41A 5AUXA 1XH6A 4Y46A 5BVKA 1DAWA 5EW3A 4EH2A 3I7BA 1IA8A 3HMNA 2XIYA 3IECA 1YI3A 5AX9A 3TV6A 5I0BA 2GHGA 2C3LA 4YLKA 2AYPA 3D83A 5D41A 3EB0A 3Q4CA 2PVMA 3PXZA 4KINA 4R7IA 3ZDUA 1X8BA 2UVYA 3SQQA 3LFSA 3SXFA 3Q96A 2B55A 3C4XA 4I0RA 1O6LA 4IQ6A 3U6IA 2DS1A 2WQMA 1OMWA 3UOJA 2X7OA 2X6EA 1PKGA 4FOCA 5C1QB 4BDBA 4K1BA 3BHTA 2QNJA 4UXLA 4C34A 1HOWA 4BZNA 3VUTA 2C68A 3R9NA 2P4IA 1FVTA 2QG5A 4QPAA 4MCVA 4QT1A 4QTBA 1JKKA 4RVKA 3PUPA 3CLYA 4Y73A 2JIUA 2XM9A 5JRQA 2YCRA 4WSYA 4XMOA 3Q9WA 4XP3A 4YSJA 4L45A 4GFGA 2Y6OA 3DZQA 5DEYA 4MF0A 1RW8A 5KMLA 2E9UA 4X3FA 4KABA 4CFFA 4NFNA 4R7BA 2R3QA 4BCNA 4C4EA 3FMKA 4KIKA 4FIEA 1OPJA 4HOKA 2W96B 4EH7A 5HZNA 4IFCA 1JLUE 3TV4A 4CFMA 5CAUA 4OUCA 5FXRA 4I94A 3IKAA 4QTEA 3QTIA 3ZBFA 5M51A 1E1XA 3MVJA 4AOJA 4X2GA 3A7IA 1KE9A 3SC1A 4YBKA 5IA0A 1FOTA 4ZEGA 1RDQE 4ERWA 2YHVA 4DLIA 3RTPA 1Q8TA 3WF6A 3ATSA 5AP0A 4YZNA 4CV9A 2W7XA 3TZ7A 2HZNA 5GZ8A 2OWBA 4MBJA 3SRVB 4L7SA 3QC4A 5FUTA 2B1PA 4HYUA 5IDNA 2C5XA 3I0QA 4CFVA 2XS0A 2A4LA 4WG3A 2VTOA 2GNIA 3QQJA 4AP7A 4BGGA 1GIIA 4ITIA 3PDTA 4FKIA 5L2IA 3LM0A 4FSUA 3KL8A 1YVJA 3GXLA 2WIHA 1S9IA 2W4JA 3MVHA 4MD7E 4QQ5A 4RWJA 3DK3A 3Q9ZA 2GS2A 3RPRA 2O65A 3MIYA 3WF7A 1UKHA 2VN9A 3QTQA 5CVGA 1Y8YA 4FKPA 1YKRA 5ANIA 3L8SA 4ZTNA 5EM7A 1GZKA 2VTMA 2B54A 2BFYA 4ACDA 3LHJA 2C6EA 3OROA 4WNOA 2IW8A 4A9UA 4G5PA 1FQ1B 3VQHA 3AC5A 5GJGA 4O22A 5DH3A 1PY5A 2CLQA 2XIZA 2OZOA 3FL4A 3VULA 4BL1A 5HE0A 5E90A 3AC3A 4TWPA 2YDIA 3OTVA 4ZOGA 5EG3A 2Z60A 3E8NA 3OWKA 4WRSA 5AR3A 4WT6A 3WZDA 3LCKA 3MJ1A 4HVGA 5DEWA 3QZHA 4JS8A 4XOYA 4HCUA 4O81A 3PVWA 4BCHA 4C35A 3U54A 3KULB 3V51A 4B8LA 3R8MA 1QPJA 1KE6A 4D1XA 5C8NA 4M69B 3VS7A 3VS1A 4CQEA 3LFQA 3ZLWA 3Q32A 2I0HA 4F09A 4NJ3A 3QCYA 1I44A 2JC6A 4NT4A 4KUJA 3HP5A 4BDCA 4BYIA 4MD9E 5I9WA 4RQKA 4QP2A 3GB2A 3R9RA 3F5PA 5L8LA 5IQBA 3D2IA 2R5TA 5JH6A 5CSVA 3S4QA 4K33A 1WMKA 5CSWA 3UO4A 3OWPA 3WILA 3DTCA 3H0ZA 1OIRA 2R0UA 5IA2A 2DUVA 4I6FA 1IEPA 3PLSA 4KWPA 4AGUA 4BCIA 4ZY5A 3KY2A 1FPUA 3Q9YA 5GNKA 1H4LA 3L8PA 3ZZEA 4IADA 4BWXA 4MF1A 4IZYA 5CQWA 4XBRA 3REPA 2C5OA 3FMHA 4IB5A 3IW4A 3QUDA 4USDA 4X2KA 3VBWA 1CMKE 4QNAA 4CXAA 5IA3A 5IQEA 4ZZOA 4C3FA 1A48A 1J1BA 2HXLA 2W06A 4FEWA 1UWHA 4EOSA 2YM6A 5E91A 3HGKA 4QTAA 4LGGA 5CY3A 4F9WA 3PZEA 3AC8A 3RP9A 5BUEA 5EQPA 3R8LA 4AZVA 4D0WA 3RGFA 4EOPA 2YWPA 2ZMDA 1H08A 3UGCA 2FSMX 4BDAA 5FEQA 5ANOA 2YZLA 2X2KA 3OTUA 3I5NA 2E9OA 3KEXA 3QZGA 5KMKA 3NR9A 2KTYA 3CE3A 4OTIA 4AGDA 3DNDA 3D5XA 4MVFA 5C27A 3QD4A 3E64A 3CY3A 3HYHA 4K6ZA 4WG5A 3ID6C 2C5YA 2PZPA 3FZRA 1JVPP 4OBQA 5IZFA 1YWRA 1XBAA 3CXWA 2WO6A 3OEZA 2FVDA 3QTXA 3QD0A 4TXCA 2O64A 4FICA 4TWOA 3IGGA 4OTDA 4QNYA 3W10A 5EDPA 1Y6AA 4R1YA 1MQBA 3O71A 3KQ7A 2H8HA 4I0SA 1FGIA 4MNEB 4DG0E 3FHIA 1H28A 4DCAA 3LMIA 2QOOA 2B9HA 2W4OA 2X0GA 4IBMA 3HNGA 2LGCA 3A61A 1JSUA 4G9CA 5JZNA 2C4GA 4AN3A 3TWJA 4ZY4A 2OJIA 4MXYA 5C9CA 4KSPA 3NW6A 4V05A 2CKQA 4EC8A 4DEIA 1OITA 4U43A 4RSSA 4CVAA 3FMJA 5IQDA 4AN2A 3FHRA 3BV2A 3S1HA 2J6MA 4G6LA 4G9RA 4UWCA 1LR4A 4X7QA 2OW3A 3WOWA 4AZEA 4RIXB 2XB7A 3OVVA 2QO2A 1W83A 3KC3A 3NVMB 3QL8A 3FMDA 4U7ZA 4D4YA 5FDXA 4JDKA 4KKGA 3U6JA 3FZTA 1J7IA 3MFUA 1APME 4XP0A 4E6CA 4KRDA 3LM5A 5L6OA 2HAKA 3QTRA 1BKXA 5E92A 3F6XA 2Z02A 4NL0A 4ZK5A 2C6OA 3HAVA 2WTDA 1GAGA 2YCQA 4IC7A 4C57A 5HTCA 1ZWSA 5BVOA 4EJNA 2R3RA 4C4FA 4YJSA 5AR2A 4CD0A 1VEBA 3S2PA 3UIUA 5KBRA 5KZ0A 4OBPA 5CU3A 3B2TA 4DTAA 3QRKA 2XK6A 4FVRA 2JIIA 4U3YA 4C37A 2QI8A 5LVNA 2Z7RA 4JQEA 3NIEA 2RGPA 2HZIA 3W2PA 5HLNA 1OB3A 2C0IA 3ZM4A 4CMOA 3Q3BA 4KA3A 4CKJA 5BNJA 1UU9A 5FG8A 1ZYLA 3GC9A 2XNBA 3FEGA 3JYAA 4GG5A 5CEOA 4LOQA 1NT2A 3ZUTA 3KF4A 3U4WA 5EM6A 1UNGA 3QZFA 3GUBA 3ODZX 3IW8A 2V5QA 3OUNB 1LUFA 3QWJA 4DTKA 3PSBA 4JX7A 5FQDC 3SGCA 1PXKA 3OXZA 3W2CA 1GZ8A 3OC1A 4CT2A 1KE8A 3HV3A 4O0UA 4OAVB 2WQBA 2HWPA 5LMAA 3W55A 3Q4UA 2W1ZA 2BAJA 1PXPA 3EFLA 3KFAA 4M12A 2I40A 4PV0A 3TKIA 2QC6A 1RJBA 3MH0A 3RVGA 4BTFA 4TL0A 4O83A 3EL7A 4YJRA 3MDYA 1OKZA 1ZYSA 2ZM1A 4N4SA 3G9NA 3OXIA 3FWQA 3LQ8A 4IB1A 4UV0A 5CTPA 3LAUA 4IVCA 4RG0A 4B0GA 4Q5EA 3R6XA 2OICA 3KCKA 3HMMA 3BHUA 2C6TA 3PVGA 3OOGA 1XQZA 1G3NA 5IH6A 3E3BX 3VS4A 2P0CA 4A4XA 4LQMA 2ITNA 3FZ1A 2H6DA 2WEIA 3ZH8A 3BYSA 1PYEA 2BILB 2QO9A 2UW0A 2VWXA 4M97A 2W1CA 3HECA 3HMIA 4DFNA 2ZV9A 2VNYA 1CKPA 4JVGA 3ACKA 3ATTA 1TQIA 3C13A 4G6NA 1UNHA 3BX5A 4HNFA 4RT7A 4I23A 5EI6A 3O96A 3TIZA 4BDGA 5CEQA 1FMOE 4PDPA 4YPDA 4AZSA 4B4LA 4BZDA 5IQGA 4MKCA 1PMVA 2R3GA 4DG3E 3K5VA 3ZSHA 3UO6A 3AC2A 3R1SA 4ANNA 2IZRA 2WKMA 3GNIB 4FC0A 1BI7A 2QKRA 3LXLA 5J79A 4GVAA 3HLLA 3KN5A 3ROYA 3PXFA 4CFWA 2FH9A 3DLSA 3R02A 1WVYA 3AT4A 3LZBA 4FKUA 4BIDA 4Z55A 3DXPA 1V0OA 5CENA 5K5XA 3QGWA 2WMVA 4L7FA 4WUNA 2YCFA 2G9XA 2J9MA 3TDVA 2IJMA 3PY3A 3I60A 4YZMA 1BL6A 4ASZA 1U59A 2ITQA 2XNPA 3LXKA 4L8MA 4C4JA 2BHHA 2E2BA 3VF9A 2X7FA 2UVXA 3WF8A 3LFFA 4AZFA 4EHGA 3L9MA 3R2BA 4DAWA 4O0YA 4FT5A 3WARA 3DFCB 1PXOA 4F4PA 3F88A 4Q9SA 1J3HA 3F3TA 1U54A 4M3QA 3CP9A 4GSBA 5KO1A 1PHKA 3QTUA 1DM2A 1JBPE 5AP6A 2UZTA 3LFBA 4ZXTA 4UWYA 2SRCA 2OXYA 2F4JA 3TJCA 4EK4A 4OTQA 4G3GA 3DCVA 2C1BA 4LRKA 3G6HA 4RWIA 4BCJA 1JSVA 5AJQA 3OCTA 4KD1A 4FTOA 5IMEA 4EH3A 2QR8A 4R1VA 4C4HA 4IAFA 4IAIA 4TWNA 5FGKA 2JLDA 2QHMA 2XK3A 3AD6A 3ORKA 3HRBA 4FG9A 4L53A 1UU8A 3KGAA 2PYWA 2R9SA 2IN6A 3VJOA 2YIYA 4JXFA 1W7HA 4E4LA 5CQUA 4ZP5A 4BBFA 3O8UA 3M42A 4KIPA 1IASA 4Y72A 3R00A 4PP9A 2V55A 1XHAA 1TQMA 4JDJA 2YN8A 4IC8A 4QMYA 4CG9A 3I1AA 3VRZA 2X6DA 2NRUA 2IZTA 3OY3A 5AX3A 2PVFA 4OTGA 4IXPA 3UBDA 4FZFB 4AXAA 5AM7A 2WOUA 2PE2A 4KAOA 4YLLA 4W9WA 2VU3A 4O96A 3RCDA 3CQWA 4MXAA 4YJUA 4DH1A 4KNBA 5HCZA 1BLXA 5A4EA 3GU8A 4RJ4A 5AV0A 3ZLSA 2PU8A 3OW4A 1P4OA 4FGBA 4FTRA 2PUIA 3V8TA 5DN3A 4JBOA 4JR7A 2OLCA 4GFOA 4O7LA 3QQKA 3ZUUA 3TTJA 2BIYA 3KA0A 3I79A 5F4NA 5LMKC 2PZ5A 1ZOEA 4O0RA 2UZDA 3Q9XA 3SV0A 4F63A 1K3AA 2PVJA 4DFUA 1ZXEA 4ZLOA 3V5LA 2R0IA 4XP2A 3BV3A 2VNWA 3CC6A 3C4EA 4O2ZA 4JI9A 4GKIA 3UOHA 4UZHA 3EQDA 3FZPA 2XVDA 3FLZA 3D5UA 3GGFA 1OZ1A 4F9CA 3KB7A 5JN2A 4MBIA 3EQHA 3MBLA 4A07A 3BELA 4XG6A 2QOBA 1TVOA 3OG7A 2XKEA 4U79A 4BRXA 1YHVA 2O3PA 3LMHA 4FNYA 4I5MA 5CNNA 1WBTA 2I0VA 3O7LB 3OWJA 4FTUA 4BDKA 3QFVA 3RNYA 3ZUVA 4Z3VA 4W9XA 4J52A 3HV6A 3TNQB 5IF1A 4JNWA 4EORA 4N70A 4BCKA 3KXMA 5LJJA 3HRFA 4EOLA 5I3OA 4YMJA 4WBBB 2YITA 5B2MA 5I9ZA 4AFJA 5T68A 3FI2A 3DKCA 3H30A 4RPVA 1NVRA 3CJGA 1KWPA 4QQTA 4FYOA 3P4KA 4A9TA 4DFXE 2OIBA 3UO5A 1CKJA 1CTPE 4K11A 3ERKA 3D5WA 3EMGA 5BUJA 3I4BA 3O8PA 5EQEA 2PZRA 2VD5A 4KKEA 4I5HA 5L8JA 4CTBA 5HNIX 2XNOA 1O6KA 3GBZA 4XCUA 3DA6A 5HTIA 5JSMA 3ITZA 5KMMA 3G15A 1A06A 1UA2A 5TOZA 1QPDA 5DVRA 5DMZA 3QQLA 3HUBA 3NUYA 4Q2AA 5IEYA 5DR6A 5KHXA 4AN9A 5CF5A 2XIXA 4FL1A 4GEOA 3PA4A 5JT2A 4JX3A 4H05A 4FTIA 5LCKA 1PYXA 5JRSA 3LJ2A 4ZZMA 2C6DA 1W98A 4L46A 5FTQA 3CQEA 3BZ3A 4PRJA 3SRVA 5AR4A 4CYIA 4E6DA 2PMIA 3MY5A 4L3LA 4G5JA 4MYGA 4NM5A 2Q83A 2VZ6A 4BCOA 2CDZA 4BVUA 4MQ2A 2OI4X 3FQEA 3DBDA 5E8UA 3DJ6A 5CU0A 4WG4A 5HE2A 5CEIA 4G3FA 3R7YA 4ZLZA 3O2MA 1H0VA 4BKJA 4EBWA 3COMA 4E7WA 3G0EA 3VS2A 1F3MC 2QLQA 2UVZA 3UE4A 5LCJA 2UW8A 2CGVA 3R9DA 4XRLA 4BDEA 3ORTA 4BICA 4F99A 2EVAA 5FWKK 3M2WA 2R3PA 5CZHA 3TNHA 2Z7QA 3LQ5A 3QRUA 3TNWA 5AM6A 3V5WA 4AGWA 1TQPA 3RPOA 2OJGA 2CLXA 3TXOA 1STCE 3NEWA 3BU3A 4P5ZA 5DR2A 2G2HA 4IDVA 1M7QA 5AUYA 4F0IA 2XZSA 5AV2A 4UMRA 4EK8A 2ERZE 1KSWA 3V5PA 2CKOA 3AC1A 3IDCA 2YZAA 3K3JA 5M53A 2CNQA 1H00A 3CTJA 3ZTXA 2FB8A 2C6KA 4OR5A 2DQ7X 4I6QA 5HBJA 2ZMCA 4KIQA 3LCSA 2GNJA 4ZMFA 2X39A 3FYKX 4PTGA 3C7QA 1FVVA 2R7IA 2X8DA 2GNFA 2X81A 3EYHA 4TYHB 1Q99A 2CPKE 4NH1A 3RK5A 3ORZA 4FT0A 3MPAA 1IAHA 3R30A 2OFUA 3PIZA 4JG6A 4NCTC 2KULA 2P55A 3FZOA 3LFAA 4L3PA 2ITZA 4L6QA 1ZY4A 4M69A 4XG2A 1H01A 4YTHA 4DINA 4E6QA 4F7LA 4F7SA 4FKRA 5CI6A 5DT3A 2QOKA 3EQPA 2W05A 3N4UA 3WBLA 4EYJA 2CGXA 3PIXA 4W4VA 1YWVA 3IG7A 2UZOA 4FNXA 4CNHA 4IE9A 1NVQA 4TTHB 3GC8A 2YIXA 4ANQA 2PZIA 2AC3A 4IACA 4RVLA 1OL7A 5CU2A 4MBLA 4PMPA 4M66A 1HCLA 2JDVA 2VGOA 3LXNA 3MPMA 5AR5A 4FUXA 3W16A
chains in the Genus database with same CATH superfamily
1M2PA 3GCVA 3S95A 4YPSA 5L6PA 3LQ3A 4G17A 3QXOA 3PG1A 4OW8A 2X8EA 5AAFA 5E1SA 5HNGA 3PRIA 3IS5A 2FSTX 3U9NA 4GCJA 4M8TA 1K9AA 5DNRA 3HA6A 5JEBA 2Y8OA 4EHZA 2V62A 3VQUA 4CFXA 4E73A 1ZYDA 3TACA 3KXNA 1YXSA 2FO0A 1JOWB 4EZ7A 2VTNA 2FGIA 3E8DA 5JGAA 3EN4A 1GJOA 3LPBA 3NUUA 1XJDA 4L3JA 4LOPA 4PPAA 3FV8A 4YC8A 4FV2A 3DTWA 5LMKA 4C38A 2XRWA 5IISA 5HESA 2A0CX 2XK8A 1BYGA 2RSVA 3QCXA 4UZDA 1ND4A 5M55A 2J0IA 3UODA 2RF9A 4I24A 5HGIA 5BMMA 3O5AA 3CBLA 5LQFA 4IM3A 2G2FA 5AUUA 5KHWA 3BLAA 3C4FA 5E8TA 4ZTMA 4IJPA 3PP1A 4YHJA 4AA5A 5FBNC 3CR0A 5CAPA 4IIRA 4O27B 1Q5KA 3F3VA 4FVQA 4BC6A 2QG7A 3FKNA 3GQLA 3LXPA 4FUYA 5HU9A 2BR1A 3LCTA 4D28A 2ZOQA 4R7HA 1GOLA 3UNZA 5B2KA 3CSVA 3OF0A 5EHOA 4NM0A 4BFMA 3AMAA 4F9BA 4IEBA 3FSFA 5J8IA 2F7ZE 3QCSA 2I7QA 3COIA 3GCPA 4AE9A 3FC2A 4ZSLA 2W4KA 1MRUA 4FV4A 2YCSA 4I22A 4M0YA 3VBVA 3D7TB 3L9LA 4JQ7A 4ANMA 4HGEA 5IEXA 3VUKA 2HELA 1ERKA 3OD6X 3LE6A 2XALA 3ZFXA 2GHLA 1XH7A 5CNOA 2XNNA 5DT0A 4FKOA 4O7YA 4EBVA 2YWVA 3TEIA 2ITXA 3QX2A 4XYFA 4HW7A 2OSCA 4RIXA 3TUDA 4NM3A 2YM7A 4MD8E 3F61A 3SD0A 4HCVA 4XLIA 3FZSA 1W84A 5CT0A 1JKLA 1Q8ZA 3VNTA 4QMZA 2V7OA 3RHKA 3DB8A 3SW7A 4I4EA 4YC3A 1XH9A 4QYFA 2WHBA 3DBEA 4OTHA 1QL6A 3TZMA 3UPXA 3SLSA 3TUCA 2HENA 3K54A 4XG4A 3FXWA 2YJSA 5ETAA 3QKLA 3NUXA 2JD5A 3HP2A 4G6OA 1ZMUA 5DI1A 3WE8A 5IQIA 3VHEA 1YXVA 5KMIA 4D9TA 4KRCA 2V22A 4R8QA 3H9FA 5A4TA 3S00A 4JBPA 4JAJA 5AP4A 5EOLA 4BCMA 3E92A 3ML1A 4Y83A 3DBFA 4FV6A 5ANGA 4HCTA 3QQFA 3H3CA 5C4LA 3EN6A 3Q60A 3PA5A 4JRNA 4LUEA 4BDFA 5AEPA 5KUPA 1CM8A 3GU6A 4BBEA 3MTFA 4LOOA 2OH4A 1IG1A 2WQEA 5KCVA 4FMQA 5FTGA 4UMUA 1VJYA 3AD5A 3FKLA 3NCGA 4RX7A 2XKDA 2WXVA 4MXZA 4HVDA 3F2NA 2GU8A 4IFGA 2BIKB 2R3MA 3ZC6A 4U40A 4AFEA 2NRYA 4IWDA 5FDPA 3D5VA 4FV1A 1OL5A 3KRJA 4IWOA 5DRDA 3QQUA 1U46A 1ZZ2A 5DA3A 5BYYA 3CD8A 4UMTA 1SYKA 3AMYA 4FV8A 1QPCA 4U9AA 4D2PA 4BGQA 2JKMA 4AAYA 1E9HA 3W2RA 2GTNA 2WMSA 2XKCA 3UVRA 3T3UA 3N9XA 2VV9A 4HPTE 2O63A 4NKAA 2VO3A 3R71A 3GEQA 3F66A 3W2QA 4AWIA 2C3KA 3UPZA 2BZHB 2YISA 4XLVA 1KUTA 4I93A 4CMTA 4Y85A 2UV2A 5M4CA 4AW5A 4O82A 4IX5A 4B8MA 5C26A 3Q5IA 3LFNA 3P5JC 3DAKA 3FE3A 4FSWA 5HU3A 2XMYA 3QTWA 4NCTA 2XIKA 3FPMA 3NRMA 5E1EA 4EHVA 2PUNA 5E4HA 3HV4A 3G33A 4DH3A 2OH0E 2QODA 4YBJA 4U44A 1G5SA 3UYTA 3MY1A 5LOHA 3EL8A 3R7EA 4ANSA 3MB6A 4FTNA 2CHLA 5I9YA 4KBKA 4BDJA 3NX8A 4DA5A 4F0GA 3VS0A 3W0QA 3KK8A 5GZ9A 4ALUA 2JITA 1WBNA 4GT3A 5G1XA 2BAKA 1GZOA 1H1RA 1WBOA 5B0XA 4ANBA 1UVRA 4JBQA 2BFXA 2RG6A 2C6LA 3DXQA 5FEDA 5C4KA 3II5A 4OTRA 3JPVA 4FZ7A 4IVAA 4RBLA 4EYMA 3BLRA 3CIKA 5EQYA 4LMUA 4TYJA 4CFNA 3FLNC 3MPTA 4C59A 2BTRA 2YM8A 2EWAA 3PA3A 1AGWA 4LGHA 3BU6A 4YO6A 3UOLA 4YTIA 4QP3A 3W32A 1ZARA 4USFA 2XK9A 1Q8UA 4HNIA 3UC4A 3MA3A 3TKUA 4FTTA 4X2FA 4RWLA 4L00A 4J7BA 3JVRA 2GQRA 3U9CA 3RHXA 4AAAA 3D0EA 2WTKB 3BE2A 3SOCA 3RMFA 1YXTA 5FP6A 4FTQA 3VO3A 4F6UA 2BKZA 3C4CA 2B4SB 1PXLA 1Q24A 3FXXA 4EZ5A 3F7WA 4CKIA 2CGUA 4FSRA 1ZYCA 2E9VA 1PRYA 1OECA 4FZ6A 4M0ZA 3A7JA 3BEGA 2GS7A 4QMUA 4E5BA 5J9YA 4LM5A 1Q3DA 1SNUA 5HX6A 3NAYA 4I5PA 2XNMA 2ACXA 3O7LD 4O21A 5EW8A 4D5KA 5J9LA 4WO5A 2UW3A 5ETIA 3P0MA 4CTCA 5A4CA 4CEGA 2ZYBA 4QMVA 3E8EA 5AAGA 1PMEA 2W5BA 2G2IA 4DHJA 4ACMA 4YTCA 2ZM4A 2BRMA 3ORPA 2VWIA 1J7LA 4DEGA 1JAMA 3H10A 3DT1A 4C8BA 1TKIA 5AV1A 4Z16A 2ITTA 3L9PA 5IA1A 3PE1A 4E5WA 5CSPA 4JRVA 4C4GA 4V04A 4BCPA 3NUSA 3G9LX 3QD2B 4RLKA 4BY9E 3MIAA 3ORNA 3CQUA 3F7ZA 2BRGA 2R3LA 4H1JA 2B7AA 3CTHA 3NW5A 4X2NA 5CT7A 3RJCA 4DH8A 2W1GA 4LRJA 3L9NA 3B8RA 5JFWA 5L2QA 3WYYA 4I92A 4YNEA 3ORXA 4ACHA 2UZLA 2PHKA 2ZM3A 5A46A 4MWHA 4EOOA 2R3FA 4FKJA 4PDSA 4LDTA 4R3PA 3NNXA 4F0FA 5FLFA 4N57A 2W1IA 4JDHA 4ZLYA 4PQNA 4XH6A 1WBVA 2YACA 3ODYX 2EXCX 3R9HA 4Z7GA 2REIA 4IMYA 2YLEA 4H1MA 3NZ0A 1V0PA 4I4FA 3OMVA 4EUUA 4O0VA 1URWA 4YO4A 1ZMWA 2OJFE 2OU7A 4ASEA 3OT3A 4CCUA 4TKSA 4L43A 4DEEA 4I5CA 4O91A 4PL3A 4EQUA 4X0MA 4FGRA 4YP8A 4DBNA 1BMKA 3JY9A 5FD2A 4CT1A 4O1OA 1CDKA 3BCEA 3A99A 4P90A 4CRSA 4PP7A 5CALA 2B9JA 3EQBA 3BWJA 1F0QA 4XV2A 4ZSJA 5KKRB 3HL7A 2VTJA 4RC4A 4F9AA 5HD4A 2ZDUA 3DQXA 4WHZA 4QYEA 5FTOA 4EH8A 5CAQA 2BALA 1OBGA 5GIOE 5G6VA 2X7GA 2RFSA 4I0TA 4A9SA 4AW0A 3I6UA 3C5UA 3CGFA 3NAXA 4RC3A 3RNIA 3ZXZA 5M4UA 4U97A 3PFQA 3Q4ZA 3BKBA 4F9YA 2PL0A 4YJTA 3SXRA 2XARA 2VX1A 4J99A 1YDRE 5ETCA 1ZY5A 2WTJA 2HY0A 3SOAA 2C0TA 4G3CA 2UZUE 3DDPA 4FIFA 4O6EA 5CVHA 5CS6A 1PKDA 2ITYA 2VO7A 3A62A 4WRGA 2PMOX 4C02A 2AEGA 3OCBA 4RIYA 5HICA 4RMZA 5AUWA 2PVYA 3BRBA 3EQRA 3NMUF 3AGLA 5HO8A 4TY1A 5A3XA 5AIRA 4R3CA 2X4ZA 3UG2A 4ACGA 5EKNA 4I6LA 2R64A 3HRCA 3DLZA 3VC4A 5DWRA 3ANQA 2J51A 3ZDIA 4K18A 4R5YA 3V6SA 5AFVA 5A54A 1I09A 4CLIA 4D4SA 4WNMA 4LFIA 2HW7A 5FRIA 1REKA 2IVUA 3QYWA 5CEMA 3BHHA 1OVEA 5AP2A 1REJA 4CYJA 2BPMA 4YZBA 3LCOA 4W4WA 4BI1A 4DLJA 1W82A 5CSHA 5HNBA 3UQGA 4FSYA 4LUDA 2IO6A 3R1QA 3DXNA 3NS9A 2R2PA 5TO8A 4R5SA 5IKWA 1Q4LA 2W0JA 5CF6A 2WGJA 2CN8A 4O7SA 4FSNA 1OKYA 2QOQA 5DLSA 3E8CA 4UALA 1DI8A 2BROA 4FE2A 4IVDA 1UU3A 4U41A 4R3RA 5T3QA 5L8KA 1ZMVA 1H25A 2J5EA 5EHLA 4DEDA 5K4JA 5DG5A 3BBWA 5AWMA 5F20A 4TYIA 1M17A 3ZBXA 4A4OA 1H1SA 1YXXA 3GOPA 2QOLA 4YHTA 3VUHA 2UZWE 3UYSA 2PUPA 4E93A 5CU4A 3P7AA 4MTAA 5K3YA 4HGSA 3EZVA 5EDQA 3R1NA 3FLYA 4FK6A 3EN9A 4EH5A 3WF5A 5BV3A 3KXHA 4IX3A 4MXOA 3G2FA 3GI3A 3QC9A 4TYHA 4YJQA 4OTFA 5FXSA 4RQVA 4YZ9A 4ZTSA 4N6ZA 3GENA 2EXMA 3K2LA 3RK7A 4EJ7A 2QURA 3F2AA 3WZUA 4J53A 1H1PA 4GRBA 3B8QA 2RG5A 1FMKA 3D4QA 1U5QA 3PG3A 2C3IB 3QRJA 2ITWA 2J0MB 2VWUA 1KV2A 3UZPA 3PJ1A 4D2SA 4I3ZA 2O5KA 2CSNA 4PMMA 4BHZA 3R7GA 1V0BA 3TDWA 3DB6A 4FI1A 4NK9A 1P5EA 4E26A 3HZTA 5DIAA 2IZSA 3UDSA 2G1TA 4S34A 3JXWA 2YABA 4S33A 3E63A 3A4OX 3CS9A 2X0OA 3DOGA 2R3JA 3L1SA 4AA4A 3HMOA 4OGRA 3W0NA 2UW6A 4OT6A 2PE1A 4FKVA 4D2VA 1XKKA 4KBAA 5DR9A 2WZJA 4BJJB 2JKQA 3COKA 1LEZA 3AOXA 4H39A 4MNFA 4C0TA 1JNKA 3DK7A 2WMRA 3OZ6A 5KMJA 5IUHA 3DY7A 1DAYA 4QD6A 3QCQA 4MHAA 4YU2A 4FKLA 4XRJA 4FV5A 5IG1A 1PJKA 3A8XA 4YSMA 4TYEA 5EK7A 3UIBA 3R9OA 4P5QA 5HG5A 5IH4A 4JOAA 1PXNA 3H9OA 2GNGA 2WTKC 2WELA 3EWHA 4KS7A 4UY9A 5E8YA 4WIHA 4KS8A 4RIOA 2JDTA 3UP7A 3FL5A 2EUFB 2X8IA 5BYZA 2HZ4A 3FC1X 3N51A 3O51A 4D1SA 4E8AA 2X0QA 5I9XA 3QWKA 4I20A 4O7WA 2C47A 3CY2A 2YM3A 2BZIB 5K0XA 4TNBA 3RCJA 4QMWA 3PIYA 3PUFC 2NPQA 4QP7A 3BE9A 5ICPA 3G5DA 3P7CA 3ZO2A 3ZSGA 1OGYA 4L01A 4S31A 3G0FA 3RKBA 5HO7A 2QOIA 1Y57A 3F3ZA 3QRTA 4RFMA 5TKDA 2ZV2A 4F70A 5CAOA 4QMNA 3NNWA 3MS9A 3POOA 2YFXA 3MVLA 3D7TA 3MJ2A 4J8MA 5TE0A 3JR1A 1R0EA 5JGBA 4DH7A 1W0XC 3K3IA 2BHEA 4FT9A 2PULA 2PVKA 4B7TA 3FJQE 2QOCA 5HE1A 2QR7A 2J50A 4DGGA 5K9IA 3PRFA 3QA8A 4UXQA 4QMQA 3MB7A 3U51A 3AGMA 4A06A 4FJVA 3U55A 5H9BA 3QZIA 5EYDA 4EC9A 2OXXA 1YI6A 2OK1A 3UG1A 4XOZA 4GT4A 4AUAA 1YI4A 3R28A 4ANOA 1M2RA 2Y6MA 3LKMA 5JGDA 3HX4A 3WZJA 4PNIA 3WZKA 4AX8A 5AAEA 1QMZA 5TR6A 4ZSAA 3K5UA 4GG7A 5E8XA 4EWHA 3KRXA 4FKQA 4LV5A 4A7CA 3O17A 3U6HA 2BCJA 3ORIA 3BQRA 4XG8A 3U4UA 1T46A 4WSQA 4C33A 2RIOA 4FBXA 4MX9A 1O9UA 4FSQA 5EHYA 5DGZA 2WMWA 4OTPA 5EH0A 5HLWA 1GIHA 2YDJA 4RZVA 4WNPA 1W8CA 4ID7A 2BAQA 5DT4A 3D94A 4S32A 3EFKA 2IPXA 4Y5QA 2VWWA 2C69A 4QMTA 5JK3A 5CSXA 2RL5A 3NUNA 4FIJA 4FIHA 4U80A 5FXQA 3V8SA 3VHKA 3ORLA 4APCA 4H3BA 3FMEA 2CJMA 5DFPA 4RJ8A 4ZZNA 1Z5MA 1UV5A 2ONLC 3EQGA 3LMGA 3VRYA 5KKRC 3O23A 4RIYB 3A7FA 3PY1A 3ENMA 4J8NA 4IZ5A 3AMBA 2W9ZB 3ULZA 2JBOA 3ELJA 4P2KA 4NTTA 4FIGA 4AT4A 4AZTA 1NW1A 4K0YA 3PTGA 4M84A 2CNUA 4JLCA 2XBAA 2IVTA 3D9VA 4HVHA 4O7NA 4IX6A 3DGKA 2VO6A 3P5KA 4BCQA 4WUAA 2WU7A 2VTRA 4YJPA 4ZS4A 5IQFA 2WMBA 3GVUA 4GL9A 1H1WA 2R3KA 4A9RA 4HVIA 2GQSA 1B39A 5H8EA 4DFBA 4DTBA 1Z57A 1VR2A 2PMNX 4EOIA 2XJ2A 2Y0AA 4OTWA 2G01A 1PMNA 2W5AA 3DKGA 3PWYA 4HZRA 4C3PA 4MH7A 4NFMA 3T9IA 3NW7A 5IMXA 5C8MA 2JDRA 3HAMA 1MRYA 2W1EA 4JDIA 4CQGA 4EUTA 4FTMA 5LVLA 4NWMA 2ITUA 3ULIA 4IM0A 3F69A 3O8TA 3UTOA 5A6NA 2EB3A 2X4FA 3KMMA 4FG7A 4QMPA 5IPJA 4EONA 1R1WA 4USEA 3W33A 1FVRA 4UEUA 2VO0A 2YIQA 4KIOA 3AKKA 4DT9A 2WMUA 5ETFA 3S3IA 1T45A 3OEFX 4PTCA 4ACCA 4PL4A 4AU8A 5L3AA 4E20A 2A19B 3Q2JA 4L52A 2F7XE 3UDTA 3R7VA 1OGUA 4K8AA 2X0PA 3UVQA 4DGNA 2C1AA 3ZO4A 3TM0A 5AIKA 4M67A 2BRBA 2GQGA 4RJ5A 4JT3A 5EI8A 4YJNA 3UMXA 5K4IA 4FL3A 1YDTE 3GP0A 1L8TA 3Q52A 2OF4A 3HVCA 3FDNA 4DGLC 4XV3A 5T6KA 3Q6WA 4IX4A 3FI3A 4EK5A 4FF8A 3UMWA 3W1FA 2AUHA 2F49A 2J4ZA 3RZFA 3KMUA 4C3RA 4FSMA 3MFRA 2ZDTA 3KIOC 2PE0A 5AUVA 2W1FA 4U45A 3RPSA 1JKSA 2I0YA 1OIQA 2CKEA 3NDMA 1OL6A 5IDPA 4GVJA 2XK7A 2R7BA 3BLHA 5CXHA 3NNUA 4EOMA 4FV3A 4J95A 4ITHA 4DH5A 4C36A 3DQWA 4QDVA 4XV9A 3T9TA 3GCUA 4AA0A 5M07A 2VTLA 3EKNA 3NYXA 5GHVA 2A1AB 2ITOA 2YERA 4O0XA 5B2LA 4NZWB 4AXCA 2E9NA 4JBVA 5BVEA 3V5TA 4PX6A 4RIWB 5M09A 3RI1A 4E4NA 4AXDA 4AXFA 2F2CB 3ZFYA 2XJ1A 4IB3A 2VWVA 2YIWA 5HBHA 2X2LA 3ZRKA 5HCXA 1YQJA 1OL2A 4B6LA 3SA0A 3MYGA 2XF0A 1NA7A 2HWOA 2A2AA 1KOBA 4IANA 4YHFA 5AADA 4PPCA 4NIFA 5CI7A 2EXEA 4DEBA 2Z2WA 4XEYA 4F64A 4QRCA 2WTIA 3TIYA 3ZONA 3TZ9A 4A4LA 4DFLA 4KB8A 3ALNA 4BZOA 4CGAA 4Y5HA 5H8GA 4Y95A 3CPCA 3MGYA 3NYOA 2XK4A 1BI8A 3MVMA 2ETRA 2ZAZA 4RVTA 2X9EA 4V01A 3EZRA 4FTKA 3HA8A 4FV9A 4HYSA 5DHJA 2XYUA 5H2UA 5AR7A 4DBXA 4PUZA 2NO3A 3IOPA 4ONAA 2R3HA 3GCSA 3IW5A 3BU5A 3OWLA 3QKMA 2W17A 4AS0A 3EKKA 4E5AX 3UDZA 4FRFA 4ARKA 4BDDA 3PJ8A 1OUKA 2HIWA 1JWHA 3C0IA 5HIDA 5IUGA 3DNEA 4FIIA 4D2RA 2WQOA 3ZEPA 2UW9A 2JKKA 4J71A 2PVHA 1RE8A 3P78A 1XWSA 3FUPA 4TW9A 3A2CA 1CSNA 1SNXA 4C7TA 4EK3A 4DCEA 4ANLA 3RWPA 5HIEA 2ZJWA 3VW8A 5HOAA 4Q9ZA 3P7BA 3FLSA 2GNLA 3QGYA 5EYMA 1LEWA 4D1ZA 5J1WA 3Q4TA 2JDSA 4GT5A 3OXTA 5LARA 4PY1A 3MESA 3AT2A 3ZO3A 4O86A 4AOIA 4IDTA 4NW6A 3QYZA 4GIHA 4QTDA 4MWIA 4EOJA 4D2TA 2CCIA 3R83A 1UNLA 4ZY6A 4QMLA 4NEUA 4DT8A 3GU7A 3WE4A 4II5A 4DGOA 5H8BA 1RQQA 1V1KA 3PSDA 4IM2A 4XX9A 3OCGA 5M57A 3MH2A 3HDMA 3BYUA 4YTFA 4ZIMA 4RRVA 3C0HA 4R6VA 1SMHA 2ITVA 3SW4A 4CZUA 1XBCA 1GY3A 4WA9A 2CCHA 3C4WA 5AP3A 2PVLA 1U4DA 2XNEA 2R4BA 3TKHA 3VUIA 4RFYA 4KKHA 3ET7A 3R1YA 2DYLA 3LCDA 4U3ZA 5DPVA 3EHAA 4M68A 5I9UA 2JAVA 4X2JA 2ETKA 3EH9A 4UMPA 2ONLA 3GFWA 3ALOA 3RWQA 4ALVA 2AQXA 5CANA 1ST0A 4J97A 4S2ZA 3PLAE 4LV8A 4WBOA 2OKRA 4S30A 1P2AA 3KRRA 3IQ7A 3T8OA 1K2PA 2UZEA 2IW9A 3VS3A 1G8JA 2BDWA 4YR8A 5E8SA 3LFDA 3PXRA 5DYJA 3P86A 2BRHA 3LFEA 4XHKB 2NNWB 2F57A 5BYLA 2UUEA 3EQCA 2JBPA 3HV7A 3W8LA 3LLAA 3E88A 1PXIA 2XJ0A 3FBVA 3RM7A 3DAEA 5DOSA 4F6WA 3ZM9A 4FEXA 1L3RE 3AQVA 4BR3A 4FEVA 3F5UA 4V0GA 5AV4A 4BDIA 2GFCA 4D4RA 3VS5A 4LGDA 2W5HA 4F1OA 5HBEA 3ZYAA 3KXXA 3SX9A 3F5GA 5EM8A 4EKLA 5A9UA 4O7ZA 2WMAA 1NVSA 4NSTA 2QD9A 4WNKA 4NKSA 2W9FB 4GU6A 5CYIA 5L2SA 4MQ1A 2VAGA 2Y7JA 2PZYA 2OJJA 5CLPA 3W8QA 4FV7A 3R8ZA 4JJRA 4AG8A 4DEHA 2VTHA 3R7UA 3GQIA 5JFVA 5M08A 3UNKA 4EQCA 3A7GA 4O4EA 5KX8A 3LOKA 2RFEA 1KE7A 2BZKB 5A4QA 4ZS0A 1OI9A 3VBQA 2WMQA 2WOTA 2VTTA 5FM2A 1YHSA 5BVFA 4WKQA 3PPJA 3ORMA 1VZOA 2GFSA 4NM7A 1XBBA 3QUEA 4RX8A 3H4JA 4FA2A 4D55A 4AOTA 5L4QA 4CV8A 1OKVA 2A27A 5JFSA 3WF9A 3PYYA 2NP8A 5A6OA 3PXYA 5D9HA 4XG7A 2R3OA 4FV0A 3KF7A 5CU6A 4KSQA 1ZAOA 4NJDA 3UP2A 2JGZA 3V5JA 3AKLA 3CGOA 1GZNA 2HCKA 3DZOA 5AV3A 3RAIA 3VUGA 1SM2A 1KV1A 3C50A 2FUMA 3MWUA 3GC7A 4DN5A 1M14A 2P2HA 3C1XA 3QQHA 2VTSA 1R3CA 4L68A 3SAYA 2XM8A 4GV1A 4UYNA 3VBTA 4UMQA 1MUOA 4TT7A 1XH5A 2OO8X 4E1ZA 3N4TA 2OIDA 4BB4A 3TTIA 3ZFMA 4DGMA 2WEVA 4RJ6A 4QTCA 5EW9A 4HYHA 3RBWA 3H9RA 5GZAA 4QMMA 4CRLA 5TF9A 5KMNA 2Y4IB 3BLQA 4O38A 2Q0NA 2VTQA 3U8WA 4BGHA 4CFUA 2QLUA 2WMTA 3PJ2A 3OBJA 3O0GA 4PDOA 4BI0A 1Q61A 2H34A 3TV7A 3BYMA 2WPAA 5AUZA 4ZJIA 4FEQA 4MEDA 3AC4A 2PMLX 3GU5A 4ZMEA 3BBTB 4QPSA 3PVUA 2F7EE 5BX0A 2NYAA 3HUCA 1H26A 2Z7SA 5ANDA 3QX4A 2IEWA 4C61A 3QBNA 2BDFA 3W0PA 3PJ3A 3W2SA 4RJ3A 4O4DA 2QOHA 3FYJX 2QU6A 1PXJA 5KNJA 1OPKA 2ESMA 4QYGA 5EYKA 3HKOA 2F9GA 1ZYJA 2GTMA 3MN3A 4UX9A 3TYKA 4BJJA 4DEAA 1U5RA 3KXZA 3NCZA 3LVPA 4RZWA 4TYGA 4D5HA 2IG7A 2OBJA 2WU6A 3QRIA 3OFMA 3GCQA 4CCBA 1Q62A 2QCSA 4O1PA 2BVAA 1HCKA 4QMOA 4GU9A 3PE2A 4RA4A 1J1CA 1M52A 5ANEA 4FKWA 4ZTLA 4F1TA 4NIFB 5IA4A 1M2QA 4R78A 1WBWA 4GUBA 1BL7A 2UW7A 2G15A 2Z7LA 4HJOA 2ZB1A 2I1MA 3QU0A 4FTCA 4LL0A 2XRUA 1B6CB 4MXCA 3RALA 3RM6A 3OT8A 3PVBA 3VUDA 5HLPA 1JQHA 2OIQA 2C6MA 4QQCA 4F7NA 4DDIA 3IK3A 4FG8A 3VIDA 4Q5HA 3AT3A 3MFSA 4BF2A 2XCHA 4IAYA 4U0IA 1H8FA 4CZTA 2ETMA 1ZOHA 4FYNA 5ANJA 2JIVA 4A9YA 5CXZA 2C5VA 1TZDA 4XG3A 3COHA 3DFAA 3VAPA 3ZHPC 3R04A 3POZA 3P1AA 5H3QA 5HORA 3JY0A 5EYCA 3IONA 4FSTA 4PL5A 4DHIB 3P08A 4MUQA 5JFXA 3R2YA 4O0SA 4IZ7A 4ASDA 5GJDA 1OM1A 5HCYA 4GKHA 3GOKA 3F82A 3RK9A 5D12A 3V3VA 4MK0A 2CKPA 1ZRZA 2FYSA 3KRWA 2JDOA 3LLTA 1P14A 2WTVA 4AW2A 5F9EA 5GJFA 1P4FA 3ZCLA 1XMLA 4BTJA 4FX3A 4XS2A 4FVPA 5JQ5A 4GK3A 3DPKA 4HGLA 4IAKA 3DBCA 4IWQA 4BHNA 5LVOA 5D7AA 5EI2A 3SG8A 2I6LA 4C2WA 2IVSA 3TCPA 3NUAA 4FL2A 3IO7A 1FGKA 3FAAA 3LW0A 3PXQA 2JFMA 3OUKA 2H96A 3E7OA 3IPHA 3M11A 3QTZA 4I21A 4AE6A 1H0WA 4RA5A 4LI5A 3CEKA 4NW5A 3EFWA 4BWPA 2ZV8A 1YRPA 5CWZA 5DRBA 5J87A 4BWKA 2QONA 4APPA 5J95A 3ZEWA 4AT3A 2W1HA 2OJ9A 5J1VA 1QCFA 3NSZA 4GFMA 5D1JA 3UC3A 4BCFA 4EWQA 1OIYA 4JAIA 4TRLA 2OZAA 2PSQA 4XNEA 2UW5A 3FMLA 3KVWA 5AP7A 4QPMA 1G8AA 4FSZA 2J5FA 3M1SA 3FKOA 3S0OA 2C6IA 3IOKA 4ZSEA 3KK9A 2XCKA 3P79A 1KE5A 4D9UA 2P3GX 4IH8A 5HO6A 4BKZA 4OT5A 4QEBA 3UNJA 5HVKA 5IH5A 3A60A 5EDRA 3O50A 3OS3A 3G6GA 3FMNA 4HPUE 4V0GB 5A4LA 2B52A 3KMWA 2GCDA 4O0WA 2YIRA 3LFCA 4W4YA 4PMSA 1PMUA 4HZSA 2BKKA 3NWWA 5I4NA 5LWMA 3KXGA 5HKMA 3NGAA 3ZC5A 1URCA 3WI6A 3MH3A 1IA9A 4FZAB 1PW2A 4M15A 3NLBA 4FT3A 4J96A 4F7JA 1WAKA 1H24A 2C5NA 4I6HA 1YOJA 3CPBA 3OBGA 4BIBA 4IAAA 3EOCA 4JR3A 4W4XA 3FY0A 3NNVA 5M4IA 3EYGA 3TZ8A 4DFYA 4X3FB 5TT7A 5BUIA 4X3JA 3VJNA 2XH5A 4KIKB 3IW7A 3ZLYA 2XA4A 5ITAA 4DITA 1DS5A 4UYAA 5I5ZA 3Q2MA 4ALWA 4RLLA 1AQ1A 1Y8GA 2WTWA 3DJ5A 3Q6UA 5K0KA 3QA0A 3TJDA 4G31A 3KU2A 3BHYA 3R0TA 3R8UA 3I6WA 2PVRA 4P4CA 3ANRA 1MQ4A 4UWBA 4C58A 3HEGA 2O0UA 3QQGA 1R39A 4LG4A 2PY3A 4BBMA 5KMOA