4JRNA

Rop18 kinase domain in complex with amp-pnp and sucrose
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
362
structure length
349
Chain Sequence
SELVFEKADSGCVIGKRILAHMQELENSERLDRILTVAAWPPDVPKRFVSVTTGETRTLVRGAPLGSGGFATVYEATDVETNEELAVKVFMSEKEPTDETMLDLQRESSCYRNFSLAKTAKDAQESCRFMVPSDVVMLEGQPASTEVVIGLTTRWVPNYFLLMMRAEADMSKVISWVFGDASVNKSEFGLVVRMYLSSQAIKLVANVQAQGIVHTDIKPANFLLLKDGRLFLGDFGTYRINNSVGRGTPGYEPPERPGITYTFPTDAWQLGITLYCIWCKERPTPADGIWDYLHFADCPSTPELVQDLIRSLLNRDPQKRMLPLQALETAAFKEMDSVVKGAAQNFEQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhoptry kinase family protein
publication title Structure of the Toxoplasma gondii ROP18 kinase domain reveals a second ligand binding pocket required for acute virulence.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Transferase
total genus 101
structure length 349
sequence length 362
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14531 Kinase-like Kinase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jrnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jrnA02
1SVEA 3QRUA 2PVRA 3DB6A 3I4BA 4P4CA 4ZIMA 2X7OA 2W99B 2H96A 3PLSA 3LCKA 4L3JA 3ATTA 1PMEA 1GIJA 2NPQA 3EHAA 4F7NA 1GIIA 3PVUA 2OXDA 2XNOA 3I1AA 5A4TA 3L8SA 5D41A 4R77A 4X3FA 2O64A 4O7WA 3LCDA 3U51A 1TQIA 3ZM9A 3HV7A 2CGUA 2QOHA 1M2PA 2YFXA 3K2LA 3C4EA 4FSQA 4UXQA 3ZRKA 2J6MA 3HMIA 2P4IA 3ID6C 3O50A 1YXVA 5CEPA 2CMWA 2QCSA 3FZPA 4JIAA 4QO9A 5K3YA 4QMUA 5BVDA 1MUOA 2H8HA 3NNXA 3PLAE 4DEHA 1H8FA 2E9UA 1E1VA 4HNIA 4DINA 4HVGA 5LQFA 4HZRA 3TV4A 1H08A 5ANIA 3IKAA 2PTKA 4QYFA 5IEYA 4KUJA 1OGUA 3R8PA 3MN3A 3RM6A 2JFMA 5BUJA 3N51A 5ACBC 4EHVA 2BMCA 3GCPA 3MH1A 3NS9A 3IW7A 4LUDA 4YZBA 1R1WA 1KOAA 4IDVA 1FVVA 4K18A 3DBDA 4BR3A 4O86A 3L1SA 3VUKA 1OMWA 1CTPE 2O3PA 4I6QA 5AR5A 4G5PA 2BAJA 2PMIA 3EN6A 4GYGA 4TT7A 1CM8A 3P7CA 3ROCA 3DXQA 4FK6A 1OUYA 3LXKA 4W4VA 3QD0A 4QMOA 4F6SA 4XOZA 2KULA 4KABA 4CFWA 3VS6A 2OJGA 5DBXA 3KMUA 4ACGA 2NO3A 5CSVA 2C6DA 5HG5A 4QMQA 2YAAA 5CSWA 3QX2A 4IZ5A 4S31A 4YZMA 1H25A 4CQGA 4TNBA 2JIUA 5D7VA 1PKDA 3F2RA 1WZYA 3GEQA 4PP7A 3WZEA 4XX9A 4FOCA 1UU7A 2QOOA 4BKZA 5E4HA 1KV1A 3R8MA 2X9EA 3W2SA 2YM7A 5KKRC 3FMHA 4TYJA 3NLBA 3P4KA 3IONA 4IAAA 4XBRA 3UGCA 3O2MA 1BL6A 3U4WA 5B7VA 4YJSA 4GEOA 2GQGA 4U8ZA 5CQUA 2YCFA 3ZONA 4FMQA 3C9WA 3VQHA 4R78A 2QC6A 2ITXA 2WQBA 3RZFA 5M08A 5CYIA 2W9ZB 4ORKA 2W9FB 5AP1A 2VAGA 3BBTB 4RPVA 3QC9A 1P4FA 2C0OA 3VUTA 3VRYA 3ZO3A 5FD2A 1FMKA 3ENMA 3D83A 4EJ7A 5CVFA 4OT5A 4F7LA 3OROA 4J1RA 4FTMA 4BDCA 5CWZA 5IA0A 1QL6A 4H1JA 5GZ9A 3TTJA 5IQFA 2JKKA 2GS2A 5LMBA 2RF9A 3QWKA 5K0XA 2WIHA 2C68A 2R64A 5CU4A 3VIDA 4X2FA 4E1ZA 3UG2A 2ITWA 4HGEA 3MVJA 1PYXA 2ONLA 4X3FC 4FSTA 4GK2A 2WXVA 2XBJA 3LFNA 4I5CA 5M51A 4KBAA 4ZSAA 2VTNA 2QONA 5D7AA 3Q4TA 3ZC6A 4UMQA 4RC3A 5K4JA 4FIFA 4QRCA 2ITOA 3D9VA 3HKOA 2VZ6A 4S34A 5HO6A 4QT1A 3BV2A 4EI4A 3PY1A 3KF4A 5HO7A 2PWLA 2QLQA 3R1NA 3UZTA 4XOYA 3GC7A 3GU6A 3ZUTA 4O96A 2FSTX 3VUGA 3OCGA 3P86A 3GT8A 4FSUA 2XKFA 4KIKB 4QQTA 3VS4A 2JEDA 5B2MA 4K9YA 4OTFA 4U5JA 1PXKA 4BDKA 5CAQA 4DH1A 2PL0A 5CALA 3BKBA 2J0IA 3E8EA 1BI8A 1BI7A 3G2FA 2I0HA 3NW7A 3QHRA 3I5ZA 3I6UA 3E3BX 3F82A 1MRVA 4D5HA 5KMJA 4NJ3A 3P1AA 4LGHA 3SDJA 3LJ0A 3KEXA 3V6RA 4IH8A 4FNZA 2BZIB 4QYEA 4BDEA 3OEZA 4RWJA 4CZYB 2X7GA 3PA3A 4F1OA 5KHWA 2O0UA 4DF3A 3H9OA 2CLQA 4M67A 1JBPE 1STCE 3V8WA 1OIQA 2UZUE 2V55A 2YJSA 3EYGA 2CSNA 1JSTA 5HVYA 3VO3A 4AN3A 4EC8A 4BTMA 5IISA 1U4DA 3MIAA 4UXLA 5CU2A 2YIXA 5CENA 3ZFMA 1RW8A 5FDXA 2OJJA 2Y8OA 3I60A 3ORXA 3D14A 4I6FA 3PYYA 2LGCA 3U4UA 3GOPA 4DFUA 3QF9A 2PUUA 4ZK5A 3NSZA 3CPBA 2CNUA 3JUHA 4FL2A 5IF1A 2BZKB 4YGAA 5D12A 3PFQA 4IADA 3KXMA 5A6NA 4AZFA 3PVGA 2F9GA 1URCA 1ZAOA 2B4SB 2VNYA 3EQCA 4KRCA 4MXOA 4OGRA 4RFYA 2VNWA 4I0TA 3WIKA 4BL1A 4ZTHA 3QX4A 4IWDA 1KE5A 4QQ5A 5JFVA 4L46A 5EQPA 4YNEA 4FVRA 1OPLA 3KRWA 3B2TA 3O8UA 3RPSA 4CTBA 4OR5A 2VTPA 3TUDA 1Z9XA 2W5AA 5CAVA 4QMYA 3UTOA 3UP2A 4BBEA 1JKKA 1B6CB 3BE2A 3NCGA 4RIWA 1YXTA 2J9MA 4L00A 4CV9A 3LLAA 3NUYA 4G3DA 2JDRA 4JG7A 3ZEPA 3QLFA 3PVBA 3Q9ZA 3RK5A 4W9WA 5EW3A 5E8ZA 3ZZEA 4R1VA 1OPJA 3QZIA 1Q99A 4YR8A 4DH3A 5HEZA 2OIQA 5AUZA 1Q8WA 3TNPC 4GKIA 3R21A 3PG3A 4ZSJA 4FT5A 3ORPA 4BWXA 3TTIA 4U79A 3SXFA 2ONLC 4JR7A 3VN9A 1MQ4A 4LFIA 3KA0A 4FZFB 4IJPA 3ZSIA 3ORLA 2NRUA 3BHTA 1YWVA 2XKEA 2QOFA 3MVHA 3OC1A 2Z8CA 4NM7A 3BU5A 3VBTA 2C3JA 2O63A 3DKFA 3N4TA 3TJCA 3V5LA 5FXSA 2WTWA 3QCXA 3WZJA 4IB1A 3EL8A 1QPEA 4C57A 2UW3A 3ORTA 4FV3A 2ZV9A 3VUIA 3MPAA 4AOIA 5LMKA 4TTHB 1IR3A 2JBPA 4GS6A 1OL7A 3PPJA 4R3RA 3LFFA 4C59A 3QTXA 2F2CB 5F20A 4EEVA 5EHYA 2R3QA 4BI0A 4EQUA 3D0EA 5HIDA 3GCUA 2X2MA 2J7TA 5BVWA 5IQBA 4F9BA 2J50A 3O8TA 3V5QA 3I79A 4FTNA 5EYDA 4N6YA 3BX5A 3ZHPC 3E63A 4BCJA 5EQYA 4EH2A 4QP6A 4EOLA 2CCHA 2X8DA 3C7QA 5J9YA 3QD2B 3CTHA 4J99A 4DHFA 5CNOA 2R3MA 1PRYA 4LOOA 4IB3A 3C0HA 3IOKA 2XK4A 4D58A 3BU6A 3KMMA 3P23A 3PUPA 4XP0A 5IMEA 3RWPA 3RHXA 4V04A 4PMPA 1JAMA 5EM7A 3UQGA 4ITIA 5CZIA 4F0GA 2PUIA 2XYUA 2WD1A 4MF1A 4YUQA 4MWHA 4NU1A 5AV3A 2CGXA 3KMWA 3R22A 4FTIA 2VU3A 3TZMA 2ETMA 1P5EA 1URWA 2R0IA 4YJUA 3RVGA 4RJ4A 1U54A 4EOMA 3MFRA 3BZ3A 4FV1A 4DEBA 2AUHA 4ENYA 2GNFA 3C51A 3RKBA 1ZXEA 4YBJA 4ANMA 1VR2A 2C6LA 4C7TA 2GTMA 2XIZA 4LYNA 2WQMA 3EYHA 3N9XA 3UOKA 4JIKA 3S4QA 5C27A 3COMA 1PXOA 2R7BA 4FKTA 4FL3A 3SW4A 5FRIA 2YHVA 4RBLA 2QOQA 2QKWB 3FL5A 4ZAUA 4FV7A 2SRCA 1L3RE 5TF9A 4OUCA 2XJ0A 4ZJVA 2VO6A 2YIYA 1XH8A 2RFDA 4XEYA 1ZYCA 3EFWA 4CFNA 3UJGA 5A4QA 5T6KA 4TRLA 1W84A 2QLUA 1GIHA 2GFSA 1OPKA 3A99A 3DTCA 1BMKA 4MQ1A 4DC2A 3NX8A 1WBTA 3BLRA 3GXLA 4YJVA 3JY0A 4NH1A 3E7VA 4BI1A 4JS8A 4ANNA 1NVQA 4QTEA 4NZWB 1PXLA 3MY0A 4O38A 2BALA 4JAIA 4I5PA 1XWSA 4UWYA 3R7YA 5DNRA 1U59A 3ZEWA 3QKMA 1QCFA 3P7BA 1WFCA 2H6DA 3CD8A 1F3MC 4BICA 3QALE 4H39A 4JOAA 3Q4CA 4CFMA 3GU8A 3FBVA 5HBEA 3ACKA 2IG7A 4HCTA 4XG2A 3V01A 3QQJA 4UMRA 5K9IA 5IQDA 5AV0A 3UODA 3LQ8A 3TWJA 4NM3A 5FBNC 5AV1A 5AR8A 4R7IA 4GG7A 3TZ9A 2XF0A 3ODZX 4DEEA 1IAJA 4IACA 3QHWA 3BEGA 2OXYA 4TWOA 1M52A 3AC5A 4K33A 4RIXB 4U45A 3SHEA 2C30A 5IUIA 5LMKC 5IQCA 2OJFE 5BVOA 2R3KA 2H34A 1M7NA 4AE6A 2DYLA 3AT4A 3QRTA 4RWLA 3IDPA 2WMXA 3HVCA 5DH3A 5EOLA 3RNYA 3CPCA 3R8UA 3BRBA 4RG0A 3SW7A 4UYNA 4BBFA 1QPCA 3VC4A 4CKJA 2W4JA 1ZYSA 4EK5A 4FVPA 1IA8A 3F3TA 1GZNA 4QMXA 2DWBA 3WIGA 4AT5A 3IOPA 2XCKA 3OEFX 4BCIA 4CYIA 2YN8A 3QWJA 1M7QA 4JQ7A 3TN8A 1R39A 3ZBXA 4ZTMA 2WOUA 3UO4A 1WVYA 4I5MA 4PNKA 4XJ0A 5EDQA 5GNKA 4OAVB 4XG3A 4L8MA 2B53A 4XV1A 1DM2A 1XKKA 4GMYA 5CX9A 5JFXA 1O6KA 2UZLA 4U41A 4F09A 2R3OA 4PPBA 5M56A 2E9OA 4I92A 4J95A 4ZOGA 5HBJA 3PXKA 3L8XA 4D1XA 4JXFA 5FP6A 3MPMA 5AIKA 4GUEA 3R1QA 4X3JA 3A7GA 5GIOE 4G34A 2BHHA 4PP9A 1WVXA 4TYGA 4L3PA 4X6QC 4WBOA 1R3CA 3CQWA 5C01A 4TZRA 3KXXA 2BFYA 1YDTE 2P0CA 3KXHA 3QGWA 2IPXA 1SM2A 3ORMA 4RLLA 1O9UA 2BUJA 3MY1A 5DOSA 4EH8A 3FI3A 1UU3A 3BYMA 3KN5A 4CZUA 4H3BA 4LGDA 4A4XA 2AYPA 3BPRA 3R9RA 3LM5A 2GPHA 3VUMA 4B7TA 3EOCA 4B0GA 5BVFA 3HAVA 5CI7A 4DA5A 3P0MA 5HIBA 3WF7A 5IA1A 5HQ0A 1J7UA 4NIFB 3R8LA 3FXZA 5L8KA 2VV9A 5IH6A 3FLZA 3TNHA 2HOGA 4XUFA 1Q3WA 2DS1A 3TNIA 4DAWA 5JGBA 2IWIA 3TDVA 4E93A 3ET7A 2QO9A 3W2CA 1H26A 4FV0A 4F1MA 3NR9A 1PMUA 3ENHA 4JRNA 4YO6A 3ZRMA 4FNXA 2C3KA 3GC9A 1E9HA 3GC8A 4CTCA 3I0OA 4BF2A 2J0MB 2W1EA 2WTKB 3DB8A 4LOQA 3QQHA 4FKSA 3FHIA 4KSPA 2RFNA 1H07A 4YJNA 2OF4A 3UIUA 2J2IB 3GU4A 4UY9A 1M17A 1Q97A 5HZNA 4AA5A 3NVMB 4CV8A 3HMNA 2QVSE 2XP2A 5DT3A 3RALA 4AXAA 4A07A 4CSVA 5DT0A 3ZOSA 3D2KA 1YKRA 4L52A 4NL0A 4AZEA 2YAKA 5HTBA 3LFDA 4O6EA 4RVKA 4Y46A 3POZA 4CMTA 4XV3A 1CSNA 4M12A 5HU3A 3CQUA 4CD0A 2BRNA 4JDIA 2Y4IC 2XK7A 4CG9A 2YITA 3F5XA 1T45A 4GVJA 4MWIA 5DWRA 3RMFA 5M4CA 3OBJA 3E5AA 4F9YA 3EL7A 3G51A 3LFCA 3W2RA 4D4YA 5L4QA 5EK7A 4FIHA 3OWPA 3DGKA 2BPMA 4BCQA 4EH4A 4LUEA 2YA9A 1NW1A 4C0TA 5JK3A 3FKOA 3IGGA 4YJRA 2XJ1A 3LVPA 2PK9A 5A14A 2HY0A 4QP7A 4CRSA 3DJ5A 4M0ZA 5KUPA 4RFMA 4AE9A 4D4SA 2WMAA 2BILB 4E20A 2Y9QA 2WMUA 4FVQA 4EUUA 4I6BA 5AUXA 5KCVA 2PVKA 4QMTA 3COIA 5HICA 2UZVA 2ZM3A 3CJFA 4O0SA 3BE9A 3LAUA 4O22A 2P3GX 3Q96A 5EKNA 4CMOA 2P33A 2WNTA 2ZDTA 2HZ0A 3V6SA 4ZY6A 3OW4A 4FTAA 4ANQA 4DCEA 4GVAA 2W05A 4J53A 2R3JA 4FR4A 3D94A 2GQRA 4XHKB 4QQJA 2PMLX 2FB8A 4A4LA 5ICPA 4BDFA 4AFJA 3C4FA 4BCMA 4TN6A 4DTKA 2JKQA 4I6HA 4U97A 3FKLA 5JRQA 5LOHA 4RWKA 4GJ3A 4XG8A 4FTTA 3D5XA 4RA4A 4BDAA 2ZDUA 3F66A 3UG1A 3DBFA 3CD3A 3ERKA 3R2BA 2R7IA 4P5QA 1Q41A 4X2JA 4X6RA 4WSYA 4BZNA 5HG8A 1YI3A 3LFQA 4MX9A 5BNJA 4CFFA 4KBKA 2YLFA 4L7FA 3MGYA 2PZIA 3QA0A 4G3CA 5EW9A 4C4JA 2VRXA 4EQMA 2PVJA 5CAUA 2DUVA 3LMGA 4PDPA 4EKLA 2RGPA 1WCCA 2BKZA 2WQEA 4L53A 4LV5A 4CXAA 3KN6A 2XEYA 4Q5HA 4PPCA 2YM5A 1HCLA 2GHMA 3OD6X 3E88A 2PE0A 4BKYA 5HE3A 3UQCA 3DDPA 3ZC5A 3TUBA 4CRLA 4YJOA 4WOVA 4MK0A 4BIBA 3EQRA 1UNGA 1H00A 4YHJA 3Q5IA 2UVXA 4FI1A 3K3JA 4HJOA 5M07A 3FZOA 3G5DA 3PDTA 5IA4A 2VX1A 5GIPE 3FQEA 2W1IA 3A7JA 1KSWA 3ZMMA 4AT3A 1QMZA 4CCUA 3HMPA 4H1MA 4FV9A 4RQVA 3RAWA 5BYLA 3OP5A 4IANA 5EOBA 3EH9A 2CDZA 3FLQA 3GU5A 4C3RA 5BUEA 5HD4A 3AC8A 3NIEA 4FBXA 4QMZA 4GT5A 3Q9XA 4G9RA 3LFAA 4AW1A 5IU2A 2CHLA 4R3CA 3CBLA 4QYYA 3R9HA 3EIDA 1JKTA 4KSQA 1LPUA 3UOLA 3ZRLA 5GJFA 1OIRA 4Z9LA 5E1SA 2G2IA 3HV3A 5ANEA 2NNWB 2CNVA 4G9CA 4KS8A 4KIKA 2WMVA 5AUWA 1H27A 3IW6A 3WZUA 2CN8A 4NFMA 4F6UA 4ZLYA 3TCPA 3M11A 2YDIA 5C26A 5KZIA 3BCEA 3MIYA 4UB7A 2XK9A 2R3PA 1ZOGA 4LMNA 3PXZA 1H1PA 2OI4X 3PIXA 2W1GA 3FE3A 3QLGA 1O6YA 5BX0A 4IBMA 4BWPA 3CQEA 3OZ6A 1A9UA 2C4GA 4E5AX 5KZ0A 5CU6A 5TR6A 5JT2A 1YHWA 3QUPA 3UVQA 2C6TA 3NZ0A 3PSBA 3QGYA 3MH3A 1FOTA 3MWUA 4FKWA 3ZUUA 2PSQA 5JFSA 5KMMA 3Q53A 5FUTA 2PULA 5I9UA 2R3IA 4O7ZA 1XH4A 3MA3A 2WMWA 2WMRA 4AQCA 4O0RA 4I20A 1YDSE 2GCDA 3PWDA 2C5YA 4L42A 1Q3DA 2OG8A 5HU9A 5TO8A 2BZHB 4GUBA 4HOKA 3EZRA 4RLKA 4IAFA 4YSMA 3RM7A 2W06A 2UZTA 4YNOA 1UVRA 5C8KA 5FGKA 3V5WA 4IX6A 2PZYA 2QOIA 3HYHA 3O8PA 2ZAZA 4Q9SA 4EK6A 2GTNA 1P14A 2BTSA 2F57A 1RE8A 3RNIA 2QOBA 1EH4A 4E4XA 2OICA 5HCYA 4IB5A 2BHEA 3IW8A 4DYMA 4IAYA 2BCJA 2WGJA 4HW7A 3SQQA 2OFVA 3KFAA 5EW8A 3PXQA 3OBGA 4EOJA 3E8CA 3MA6A 4JX7A 1KOBA 4JT3A 4BZOA 4ANBA 1UU9A 1FPUA 3G0FA 3IPHA 3C0IA 4L44A 4NCTA 4QPAA 4YJPA 3RJCA 4BKJA 3QUEA 4FTOA 3I81A 3KVXA 4DGLC 4I24A 5EI2A 4PNIA 5K5XA 4GT4A 3Q6WA 3UOHA 4EOPA 4GFGA 3RAIA 1TKIA 2UZWE 2P2IA 3DAEA 5AUVA 2Y4PA 2CNQA 3EFLA 4Q9ZA 4CCBA 2PUPA 1JVPP 3KXNA 1IRKA 4S32A 2UW9A 4FTQA 4FUYA 3M42A 5DEWA 5LVMA 4MAOA 2FSLX 1FQ1B 1MRYA 2UW6A 3E93A 5AR4A 3NYOA 2VX3A 3TT0A 4C35A 4EOOA 3IDCA 3FZ1A 3BU3A 3Q5ZA 3NUNA 4JBPA 2WPAA 4IM3A 3RK9A 5I9WA 2PVHA 4ZS4A 3FLYA 5H9BA 5BMSA 3VVHA 3U55A 3BGQA 2VTHA 3P7AA 4TPTA 3VF9A 4PWNA 1JQHA 5M06A 4YTCA 3OT8A 4FK3A 3U9NA 5E9EA 4UZDA 1ZY5A 2B9FA 2EUFB 2RFEA 4GH2A 3DLZA 4CFUA 2PVYA 4QTDA 1Q8ZA 4M3QA 2BR1A 5JN2A 4FV5A 3P9JA 1V0OA 3LQ5A 4KS7A 5KMOA 3F7ZA 1UU8A 4DBNA 3AD5A 4AW5A 3MJ1A 2IW6A 4IVBA 5A3XA 3SOAA 2XIXA 3VWAA 1NY3A 4M14A 2QOKA 3JVSA 1RJBA 3QTIA 4IMYA 5FTQA 4EOKA 2A2AA 4G16A 4RIYA 3ZLSA 4HYSA 3CY3A 2B7AA 2WTCA 3V5PA 2BAKA 4A4OA 4WO5A 5C1QB 5LMAA 1LR4A 4M69B 4RIOA 3BHUA 4G31A 5AR7A 2H9VA 3CGOA 5EYCA 3W1FA 2BRMA 1NA7A 4D9TA 1W8CA 2VN9A 1PXIA 5AWMA 1Q8UA 2QI8A 2ZJWA 3EZVA 3QTSA 4MBIA 2JKMA 2RSVA 2YCRA 4MHAA 4Z55A 3F3ZA 2VO0A 1LP4A 4HZSA 5AMNA 1RQQA 4A9RA 4Y8DA 2XNPA 4YLJA 1APME 3LCSA 1BUHA 4ZS0A 4E6QA 5AV4A 5F9EA 5M4FA 3CE3A 3F88A 4G3GA 3Q9WA 4JJRA 3TL8A 4RZVA 2G2HA 1XH6A 3ALNA 3TV7A 3OUNB 2R2PA 5HE0A 5D1JA 4AN9A 5CLPA 3VW8A 3DXNA 4L3LA 4L45A 2AC5A 2IZRA 2WB8A 4WRGA 4BTKA 5L3AA 5M4IA 5IQIA 3WOWA 3FZSA 5C4KA 1OI9A 4CT2A 2C5OA 2OIDA 4ANLA 4PL4A 3D7TB 3WBLA 2PMNX 3OTUA 3C4CA 4D28A 1KE7A 3NUSA 5M55A 4DEDA 3KVWA 1VJYA 2HW7A 4JI9A 4JR3A 4BCKA 5HBHA 4OTQA 5FQDC 2YCSA 3NWWA 3IDBA 4NCTC 2QR7A 2Z7LA 5M09A 3KGAA 3QCSA 4NTSA 3S2PA 3KXGA 4IC7A 5DMZA 2PUNA 4FEWA 2IZTA 3LCTA 5A4CA 1ERKA 2ZYBA 4IIRA 5CT0A 5J7BA 3V3VA 3VS5A 4QQCA 4J97A 5J7HA 4FG8A 2FVDA 3EN9A 1AGWA 2C1BA 2W1DA 1KWPA 1MQBA 3U87A 3RGFA 1OL5A 3AGLA 4LG4A 3V8TA 4MNEB 3I6WA 4ZLZA 3FL4A 2HXLA 1OUKA 3COKA 4NKAA 5DEYA 3F5PA 4BDJA 3L8VA 2HW6A 4PL5A 2GNGA 3PP0A 3R83A 4G6LA 4YC8A 4F0IA 4Q2AA 3EKNA 3GI3A 3IO7A 4OLIA 1IA9A 1S9IA 1YXUA 4R5YA 5CEKA 1ZWSA 3CIKA 4BCFA 1QPDA 4RC2A 4AGWA 3NW5A 2QKRA 4C3PA 4U42A 1Q4LA 2AC3A 4DN5A 2CKEA 3MVLA 1Q8TA 4BN1A 4BGQA 4PMTA 1J7LA 3ALOA 3HZTA 5AA8A 4PF4A 4RIXA 5HI2A 3PXRA 4D5KA 2JAMA 2PU8A 1Y91A 3DV3A 4XG9A 3ZYAA 4TWCA 1J7IA 3G0EA 2ZM4A 3ULZA 1ND4A 3N4UA 1REJA 4PDOA 4R7BA 4N4SA 3DBEA 3WE8A 3OTVA 3T9TA 3MTLA 3DJ6A 4O7SA 3R7EA 5AAGA 3OMVA 2VX0A 1UKHA 4M13A 4L6QA 1PXNA 4PV0A 4RJ3A 3DA6A 3C4XA 5HG7A 3FMNA 4NW5A 4XG4A 1B38A 3WYYA 3PXFA 3ELJA 5AP6A 4ZJIA 5GJGA 3R7OA 5DA3A 1WMKA 4E26A 4FEUA 3UVRA 4AOJA 5KX8A 3EN5A 4OTWA 3H4JA 4X3FB 1J3HA 4DEIA 3IG7A 4BGGA 5HKMA 1CKPA 3ACJA 4N6ZA 3OOGA 4YURA 5JGDA 3RAKA 5IZFA 1BKXA 1LEWA 4MCVA 4QP9A 5DT4A 4BCGA 5CEQA 1ZZ2A 3UBDA 2VTLA 4ZTRA 4C2WA 3D4QA 4PUZA 3FDNA 4YZCA 4TYEA 2J0LA 1WBVA 2WOTA 5AUTA 2I40A 3CS9A 4MXCA 5DHJA 1BLXA 4QMPA 4WBBB 4YC6A 3GQIA 3BQCA 4IAZA 4PY1A 1XJDA 3HNGA 3SOCA 2OZAA 3NGAA 2C69A 4O2ZA 2YEXA 3S0OA 1YWRA 3OCTA 4TXCA 4CQEA 1KV2A 3FEGA 4WKQA 3CC6A 4O0UA 4FKGA 5EM5A 2Y0AA 3HP5A 4FA2A 5H2UA 3DNEA 4WG5A 1XH9A 4DFNA 2X7FA 3AXWA 5J5TA 4AT4A 4MQ2A 4ONAA 2GMXA 2PZRA 3TNWA 2KTYA 4QP1A 4CLJA 5I9VA 4HCUA 3EQBA 4FKOA 2E2BA 5DLSA 4IXPA 4IVDA 1DS5A 4IVCA 3R01A 2UUEA 3Q2MA 2UW8A 4NJDA 2QURA 3SRVB 5EH0A 4L9IA 3O51A 4NM5A 2VTAA 4LL0A 1S9JA 4FOBA 3FYKX 4V05A 5AR3A 3GBZA 2EVAA 3R2YA 2PVNA 4WRSA 2GFCA 3A60A 3C1XA 3COHA 4O0XA 3GUBA 4ITHA 4MYGA 4QD6A 1V1KA 4AGUA 4YTFA 3MFUA 5A54A 2I0YA 2EB2A 3ZM4A 1OB3A 1X8BA 3CKWA 4QP4A 2Q83A 4G3EA 3BLQA 4UV0A 4WHZA 3CJGA 5L8JA 3SXRA 5I9XA 1G8SA 2XIYA 4QTBA 4EH3A 4RWIA 2CCIA 2GDOA 3QD4A 5J95A 2W1CA 5JZJA 4DTAA 2NP8A 1OVEA 3S3IA 4UEUA 4WD5A 4G6NA 4O2PA 3DKGA 2EB3A 5IH5A 3LJ2A 2CKOA 1BX6A 4LMUA 2ZB0A 4FV6A 3L9LA 4TYHA 3HRCA 1QPJA 1H1WA 4G2FA 4ID7A 3V8SA 2R3RA 3FWQA 4XRJA 4FEQA 5FG8A 2UZNA 3O71A 4QNYA 4HYHA 2OU7A 3VS7A 3HV5A 3P5KA 4A06A 4O0WA 5IH4A 4Q5EA 2HWOA 4MD9E 4FV2A 4WUAA 5IDPA 2XS0A 4W8DA 4AGDA 5IUGA 4YU2A 5L2WA 1UNLA 5A4EA 3DDQA 5A46A 5GINE 3ZBFA 3R7UA 4O7VA 2W4KA 3K5VA 5ACKA 5ANKA 3WYXA 4BDDA 1Y57A 4IE9A 5TE0A 5I4NA 3FI8A 4I93A 4IWQA 1V0BA 3SXSA 2IW8A 3A7HA 3Q4ZA 1BYGA 4DFBA 4AA4A 5A4LA 5AP7A 5E90A 3GU7A 3ZUVA 3PRIA 1Y6BA 4UMPA 4I0SA 3TKHA 1H1QA 1REKA 4EH6A 4C61A 4G5JA 4USDA 3FMDA 5DFPA 3VS3A 4DG3E 4RSSA 3AMAA 5C4LA 2W7XA 2QQ7A 4BC6A 3IK3A 4JL9A 5EFQA 2YIQA 3L9NA 1PW2A 4KRDA 4RRVA 3LXPA 1U46A 4JNWA 3EJ1A 3DBQA 5DR2A 4ZJJA 2UVYA 5HVKA 4AF3A 2EXMA 1UKIA 2HAKA 2YIRA 3HUCA 4D0WA 5IQGA 2RG5A 4FSWA 4CG8A 2WQNA 4FTCA 2QODA 4LQMA 5CF4A 4IAKA 2A0CX 3TIZA 4FSMA 3UO5A 3E62A 3LCOA 4FV4A 5DR9A 3O7LD 2JC6A 2ZMDA 4XS2A 4CNHA 3UNKA 2YLEA 3QTRA 3SVVA 3BYVA 3P79A 3UDBA 4RX8A 2C6EA 4J96A 2R3NA 4U9AA 4X0MA 5HLPA 4RJ7A 4EWHA 4C62A 4U6RA 2QHMA 2WMSA 1OIUA 2GU8A 4D4RA 3KRJA 3W55A 4IW0A 4AS0A 4K6ZA 5DYJA 4FSNA 1W98A 4YHTA 3PPKA 2CPKE 4G1WA 2BTRA 2RG6A 4KINA 5CS6A 2HYYA 3RPVA 4EOQA 1TQMA 4FTLA 4ZLOA 4CVAA 3AT3A 4YZDA 5BVNA 2WTKC 3OS3A 4H3PA 4S2ZA 3NYNA 4NTTA 2IZSA 5FBOA 3KRLA 5AFVA 4FT3A 1NT2A 2VTSA 2WKMA 5I3RA 2B52A 3C4WA 3H9RA 5HE2A 4LI5A 4CFVA 2CJMA 4A9TA 2C6IA 4R5SA 1Y6AA 2PVLA 3ANRA 4HGLA 2BIYA 3UYTA 2JLDA 5HE1A 2C5VA 3DOGA 4O27B 3ETAA 5AX9A 3AD6A 3LZBA 3ZO2A 4FKRA 2E9VA 2UZDA 3RCJA 3W2PA 3QYWA 4UMTA 4N70A 3BHYA 1FGIA 5ANDA 4I23A 4RX5A 1XR1A 4H36A 2RKUA 1H24A 2DQ7X 3H0YA 1SVGA 5ITAA 4XNEA 5I3OA 4O7NA 4FKUA 4YTIA 3UO6A 4KKEA 3OHTA 5DVRA 3PJ2A 3UIMA 3WARA 1DI9A 4O1OA 2IN6A 4U3ZA 3JVRA 3OY3A 5ETFA 4ZMEA 4DG2E 5FTOA 2BROA 2IJMA 1GAGA 3S00A 2YISA 3ZS5A 4FG9A 2X39A 2HZ4A 4S33A 2XIKA 3ULIA 3EQIA 4E4NA 1ZMUA 2JGZA 4NSTA 2F7ZE 3NUAA 4JRVA 3T9IA 4J71A 1JOWB 2IZUA 3IECA 1ZOHA 3QC4A 4XLVA 4DCAA 5HCXA 5FXRA 4CKIA 4YLLA 4XH6A 3BELA 5KNJA 3QTQA 1IG1A 3R1SA 4USFA 3U6IA 2F4JA 3II5A 4MNFA 1A06A 4EJNA 3HAMA 4D2PA 2XKCA 5EG3A 4D2SA 3FXXA 4K8AA 4BIEA 2YWPA 3S1HA 3KF7A 2YJRA 4KD1A 2OKRA 1ZRZA 4GV1A 4OW8A 5E8VA 3OWLA 4CGAA 3WF5A 4BY9E 3FMJA 2XM9A 3V5JA 4FODA 5CNNA 4EBWA 3A8WA 2B54A 4IM0A 4RJ8A 3QRIA 4V0GA 3FLWA 4AW2A 3MVMA 4XMOA 4GCJA 1XQZA 4ACHA 3Q2JA 3ZLXA 3FMMA 3POOA 3ZSGA 3GP0A 4IQ6A 2R3FA 3IQ7A 3Q52A 2OJIA 4E73A 1OBDA 3FZRA 3QCYA 2P55A 2WU6A 4K1BA 5L2TA 2ESMA 4O0TA 3FI2A 3TUCA 4M97A 2XCHA 4II5A 5AAFA 3RCDA 5CEMA 5IMXA 1Z5MA 4AA0A 1VZOA 3GENA 4UX9A 2VWIA 1YOJA 2X8EA 4HVHA 2Z60A 4LM5A 3LQ3A 2I7QA 1W7HA 1VEBA 3PJCA 4KA3A 4R7HA 5BQ0A 5DN3A 4DLIA 3QQKA 3C5IA 2HWPA 4ZTQA 3TKUA 3D7ZA 2VWBA 2QOCA 5AP3A 5AP2A 4CT1A 2WELA 2WTJA 5HTIA 1OKYA 1U54B 2UZEA 2X6DA 5CF6A 2JBOA 3KY2A 3QTZA 3F61A 4ASEA 3H3CA 2OH4A 1PJKA 4RVLA 5GZ8A 2J0JA 4FZ6A 3DNDA 3O23A 3A4OX 5FXQA 3BGPA 4GKHA 1UWHA 4D2VA 4XV9A 3NYXA 2CN5A 4EUTA 5BYYA 5I9YA 3DKCA 4FTRA 3W18A 3NCZA 4ASZA 4TW9A 3FMKA 3KB7A 5BVKA 3T3VA 3NIZA 2W1HA 3FV8A 1JNKA 3PG1A 3UC4A 1PF8A 3O96A 2J4ZA 4ALUA 2OZOA 3AG9A 4FG7A 2WTIA 4RGJA 4RX9A 4ARKA 5J1WA 4L43A 4DLJA 4FTJA 4XLIA 1Z57A 5AM7A 5BYZA 3DPKA 4TY1A 4BHZA 1ZARA 2WIPA 3NNWA 5A6OA 4HVIA 2VO3A 5LJJA 4E4LA 3DKOA 3A7IA 3F5UA 4UYAA 5AP5A 3LW0A 4UWCA 4YZ9A 3UMXA 2J90A 3FLNC 3Q60A 2F2UA 2XBAA 4QP2A 2I0VA 4RC4A 4IFGA 4PTGA 4BTFA 4QMMA 3K3IA 3VW6A 4ALVA 4NYEA 3R30A 4FZ7A 3JR1A 3G6GA 3BIZA 5HNGA 3RAHA 2E9PA 2ZV7A 3GOKA 3SG9A 1OITA 4MBJA 3KC3A 2XH5A 1H0VA 4I0RA 3VJOA 4V01A 4WT6A 4EH5A 2PY3A 1GZ8A 4YPSA 3HA6A 3OWJA 3KULB 2YWVA 4Z7GA 3VBWA 4DEGA 1ZYDA 5CSHA 4AUAA 4U0IA 4E4MA 4F0FA 4EQCA 4WUNA 4EH9A 5JKGA 4W9XA 5AV2A 4B4LA 5K5NA 4DGMA 3OVVA 4D4VA 3HP2A 3UZRA 3EFKA 4JVGA 5EQEA 4K0YA 2QG7A 4M69A 4LRJA 1CKIA 5I5ZA 4JQEA 4EZ5A 5J87A 2YM6A 5IKWA 2WAJA 4XBUA 2XUUA 4KAOA 5AX3A 3WZDA 4I21A 5IPJA 5C8NA 1P2AA 3OY1A 1GNGA 3TV6A 2C6KA 2VWYA 5JH6A 5KO1A 4BYIA 2FA2A 4E6AA 4FE2A 5D10A 3LPBA 1OL2A 3PWYA 2Z7SA 2XK3A 3Q32A 2BZJA 2G01A 3PY3A 5IA2A 4W4XA 3KL8A 3KU2A 3I5NA 4F1TA 4CKRA 4RJ5A 4J8NA 3DTWA 2ZOQA 3IS5A 4GIIA 4Y95A 3AC1A 3I7CA 3F7WA 3UP7A 3WE4A 3MESA 4FIGA 4IDTA 5C03A 3ZH8A 3WZKA 3SG8A 3B8QA 4BVUA 4IB0A 4FKLA 1FINA 3DXPA 4DGOA 4PMSA 4UALA 4XG7A 4TWNA 2ITYA 3NEWA 1WBSA 4MD8E 3D7TA 4FT9A 2JITA 3VS2A 2J5FA 3OUKA 2GS7A 3KRXA 2A1AB 3UNZA 5AUYA 1WAKA 2B0QA 3G33A 3K54A 2ITPA 3FHRA 4D1ZA 4AN2A 4ZY4A 2B9IA 3D5VA 1PY5A 1I09A 3PTGA 4JBOA 4MH7A 3HLLA 4BIDA 4A9SA 3L9MA 3O17A 4OTGA 3HDNA 1CKJA 4O91A 2EXEA 3D2IA 5DI1A 3GVUA 4FKPA 3FZTA 4IM2A 4RX7A 4UZHA 4RFZA 3SV0A 4QYGA 3EN7A 5CAPA 2OIBA 3I0QA 1T46A 3A2CA 4QP3A 1SNXA 4EOSA 3PA4A 5FWKK 2XB7A 5EDPA 3H10A 2JKOA 3JXWA 1L8TA 3E7OA 1DI8A 1P4OA 3L9PA 3UIXA 4I94A 5ETCA 1OZ1A 2A4LA 5LWNA 5HVJA 5JQ8A 3VULA 4D0XA 3CEKA 2YDJA 3LHJA 3PIYA 3DK7A 2PE1A 3OXIA 2G15A 4IWPA 3QTWA 4IWOA 3GC0A 5CU3A 3R7IA 3OXZA 5FEQA 3MYGA 4A9YA 3VHKA 5DG5A 3KREA 2OJ9A 4M0YA 3QXPA 1GZOA 4NK9A 4ZZNA 1Q24A 3B2WA 3AC2A 5FP5A 2V7OA 2VWZA 3UC3A 4QMWA 3RINA 1OECA 3FSFA 3MS9A 3ORNA 4I4FA 3QBNA 5CANA 5HHWA 3UOJA 1ZOEA 2C6MA 2XM8A 4HGSA 3ZLYA 4X2GA 1BL7A 1KE6A 4MKCA 2B55A 4PL3A 5TT7A 3RK7A 3NDMA 4J7BA 1OL1A 4ZZMA 4QOXA 3MY5A 3TEIA 4FNYA 3WILA 3W10A 5J1VA 4R8QA 4FSRA 5J79A 2WEIA 5GJDA 5EKOA 1R0PA 2X4FA 4RJ6A 3W16A 3R63A 2WEVA 2X8IA 2VWUA 3TZ8A 3E64A 5E8TA 3NVKI 4FIEA 3DFCB 2BVAA 2WFYA 4QPMA 2V62A 3R0TA 3DFAA 4G3FA 3R8ZA 2W5HA 3PY0A 1F5QA 5CSPA 2ITVA 2ITTA 4BWKA 3QA8A 2GNJA 5C9CA 3GCQA 4C33A 3D5UA 4I22A 4JAJA 4ANOA 4C34A 1YRPA 2ITZA 2WMTA 4FICA 4FX3A 4TL0A 1SMHA 3AC4A 3MFTA 5LXMA 3DZQA 2JIVA 4RVTA 3LKMA 3FQHA 2VTOA 1XO2B 4AP7A 5AADA 1WVWA 3E92A 1H0WA 3W8LA 1YI6A 2O8YA 2PE2A 3CP9A 4F63A 4ZTSA 4I4EA 3NUXA 3W2QA 3QUDA 4FYOA 4F65A 3DK6A 2J5EA 2V0DA 4UBAA 4B99A 3DAJA 3NRMA 5DRBA 2PPQA 5C8MA 4ZSGA 3ZFXA 3NYVA 4KB8A 4EZ7A 4MXAA 4FIJA 4L01A 4AZWA 3MPTA 4DFZE 3DY7A 3THBA 3WF8A 4PMMA 1YWNA 4AACA 3FPMA 3FQSA 3CKXA 5EI8A 4FEXA 4GU9A 1Y8YA 3BGZA 3TZ7A 4FSYA 3U6HA 3ZDUA 3TM0A 1K2PA 4FKIA 3SRVA 1G5SA 4IZYA 4W4YA 1NVSA 2XRWA 3MTFA 1IASA 3F2AA 4C3FA 1ZYLA 2R5TA 2UW7A 4ZSLA 5ETAA 2HZNA 3DT1A 1H28A 3PIZA 3QZGA 4GYIA 5D11A 5KMIA 4EWQA 5B0XA 2XVDA 3RWQA 1CMKE 4ACCA 4D2TA 3ZU7A 4EYJA 2RFSA 4MD7E 2ZV8A 5LWMA 4JDKA 5G6VA 5D9HA 5L6OA 2X6EA 3R7GA 1FBNA 4FF8A 3ANQA 4FC0A 5CASA 3MV5A 2BDJA 3QRKA 4M15A 4B8LA 3ATSA 3R9NA 4O81A 2YDKA 2PHKA 4MF0A 2VTTA 2VGPA 5H8EA 2G2FA 3DJ7A 4NUSA 3HV4A 3PJ8A 4DT8A 4H58A 3NNUA 3LIJA 3FLSA 4DGNA 3NNVA 4NFNA 1FMOE 3PP1A 4R1YA 1R78A 3FYJX 3FAAA 5EM6A 4F6WA 3DQWA 2R9SA 4I3ZA 4GK4A 3TACA 4NEUA 5CU0A 2XYNA 4FIIA 3NUPA 2QOLA 3AQVA 3SGCA 2QG5A 4DE4A 5IQHA 4FYNA 4ERKA 3G9LX 2BRHA 5ANOA 2CKPA 4K77A 1VYZA 1XH7A 2WU7A 3BBWA 3A8XA 4L67A 2LAVA 2FGIA 4C38A 4F9WA 5HORA 5KMLA 4F7SA 4GG5A 3VQUA 3QAME 2CGVA 3K5UA 5IG1A 4HPTE 1OKWA 5JFWA 3TIYA 3L8PA 1E1XA 3VS1A 2W1FA 3R28A 3NUUA 2I0EA 4C4IA 2YCQA 5H3QA 4ZEGA 2C0IA 4ACMA 5HIEA 4HCVA 5E1EA 4PQNA 4DEAA 5KE0A 3GB2A 3KRRA 4HPUE 2OWBA 2EU9A 2VTRA 2UVZA 4AX8A 2WMQA 3LLTA 5CTPA 4EORA 3UIBA 3KK9A 3RPRA 3OW3A 2X4ZA 1DAWA 2BFXA 2B1PA 2YIWA 3MI9A 2QO2A 4FNWA 4U44A 5AJQA 3ZXZA 1A48A 4QTCA 4DTBA 5KKRB 3NPCA 4RZWA 2EXCX 2Y7JA 4D9UA 4BYJA 4O84A 4QMNA 2VWVA 4MXXA 4YHFA 4RVMA 4KIOA 2Q0BA 5CF8A 3LMIA 4TKSA 1JKLA 3ZO1A 2ACXA 5CT7A 1PXJA 4C4GA 4DFXE 4FEVA 1JSVA 4IFCA 1ZMWA 1M2QA 2BRGA 3HRBA 3MDYA 2XIRA 4H3QA 2JFLA 4PTEA 4E8AA 3EB0A 3LOKA 5E8XA 5LVLA 3ZO4A 3NMUF 2F49A 2UW0A 3RPOA 4Z7HA 1TQPA 5HNIX 1FVTA 4DH7A 5TKDA 1KUTA 2VUWA 2VTIA 5HNBA 4GFOA 3U9CA 4XP2A 3QYZA 1K9AA 2I1MA 3EMGA 5DIAA 3RI1A 4APCA 2I6LA 4F7JA 4KIPA 5K4IA 4O7TA 2XNMA 1PMNA 3FMLA 3C0GA 3QZFA 4FV8A 3GCVA 1UNHA 2WTVA 2YM3A 3MB6A 4APPA 4X2KA 4YP8A 5CEIA 4AWIA 3UE4A 5EYMA 5FEEA 1AQ1A 2VTQA 2XA4A 3CTJA 5GZAA 4XV2A 1W82A 3HRFA 3TNQB 2FYSA 2XJ2A 4LRMA 3AGMA 5CVHA 1OBGA 1NXKA 3Q6UA 4G6OA 4K2RA 3KK8A 4WNMA 4FKQA 1PYEA 3A61A 4J8MA 2E9NA 5IUHA 4KBCA 5DPVA 4YMJA 1U5RA 3BWFA 2J51A 3F6XA 4M7IA 4S30A 3W8QA 3ZDIA 3WF6A 5E92A 4LGGA 2OO8X 4B8MA 1YXXA 3P78A 3JY9A 4BCPA 1LEZA 2W4OA 2UV2A 3QTUA 4BRXA 2P2HA 2JIIA 3EN4A 4KNBA 3W32A 4Y73A 4A7CA 2HXQA 3UPZA 2Z2WA 3O7LB 2XEZA 3WF9A 4ERWA 2OW3A 4AOTA 4DH8A 3BHVA 4F4PA 3GFWA 4FUXA 2IVUA 4WNKA 3ROYA 5AEPA 4DITA 4AFEA 1OL6A 2BDWA 3ORIA 4MVFA 4O0YA 5JGAA 4FKJA 3DU8A 3QQGA 4NIFA 3C4ZA 4ZTLA 2C3IB 2R3LA 1YW2A 5AP4A 2RIOA 2VWXA 4BBMA 3HMMA 3NAYA 2ERZE 3IGOA 3UMWA 4CFXA 4YZNA 4IX5A 3TDWA 3TKIA 4QPSA 4PTCA 4ZP5A 4QP8A 4F64A 3HUBA 4WG3A 4BB4A 3U6JA 5CVGA 2ERKA 1RDQE 4AAAA 2OK1A 1I44A 3O0GA 4N57A 2QO7A 2IO6A 3CCNA 2F7XE 2YM4A 4KWPA 3KQ7A 2O65A 3A62A 3EWHA 4I41A 2V7AA 5JQ5A 1TVOA 4NWMA 2YERA 5HO8A 2IW9A 1MRUA 4AW0A 5HCZA 3VRZA 3FC2A 5KHXA 4HGTA 4JG8A 3HEGA 3PVWA 2QNJA 4AGCA 3QD3A 5T68A 4CEGA 3F3UA 2CLXA 3PZHA 4DGGA 4USEA 1O6LA 3PE2A 3C50A 4W4WA 4WSQA 5FM3A 4AG8A 3E3PA 4RIYB 4ALWA 1ZYJA 3R00A 4E6DA 3QKKA 3BI6A 4RQKA 2WMBA 3SLSA 4LV8A 1J1CA 2ETKA 2X2KA 1YQJA 3CLYA 3FPQA 3F2NA 3FKNA 4OBQA 2V22A 4QNAA 4ZMFA 4KKGA 2FO0A 4ZY5A 2R3GA 4HYIA 4IX3A 1ZY4A 2X81A 2PYWA 4FTKA 3VBQA 3R6XA 3PA5A 3OCSA 2B9HA 4IEBA 2UW5A 2EWAA 4X21A 4Y5QA 2YM8A 2JDVA 2XZSA 4FTUA 3A4PA 4EC9A 3MSSA 3C13A 4TYIA 2BIKB 3OOMA 2IVTA 4DFYA 2C3LA 4DBXA 3R9OA 3LFBA 4UN0C 2X2LA 2BRBA 5LARA 5CEOA 2XK8A 5BMMA 3TJDA 2VGOA 3DK3A 4BI2A 2B9JA 3E8DA 4HYUA 4C2VA 4CYJA 2IVVA 3W33A 3ODYX 4D55A 3F9NA 4BZDA 4JG6A 2XK6A 3QU0A 4AU8A 2WHBA 4R3PA 3M2WA 3RBWA 2HENA 1UWJA 2PMOX 3FJQE 4XG6A 5J9LA 3DZOA 1GY3A 4O83A 1WBOA 4TNDA 2IVSA 4FT0A 1PKGA 4I1ZA 1JPAA 2VD5A 4YJQA 4M66A 2NRYA 3QQFA 4LOPA 1UV5A 4M8TA 5M4UA 3EKKA 2PZPA 4O21A 5BUIA 2FSMX 4MXZA 2OBJA 3LFEA 3R8VA 3CTQA 3QQUA 2ITNA 2PZ5A 3G90X 3RTPA 3GFEA 4C02A 3C5UA 4GFMA 4F70A 2HCKA 4FGBA 4RMZA 4MXYA 4GIHA 4DFLA 4IAIA 4Z3VA 3LXNA 2GS6A 4EOIA 5E8YA 3UZPA 2RL5A 4H05A 4K11A 3HL7A 5JRSA 2OXXA 2V5QA 3MFSA 2GSFA 1FGKA 4EK4A 3SC1A 5TOZA 3E8NA 3F3WA 4P7EA 4YLKA 1ZMVA 2R3HA 4CZTA 5JZNA 4L7SA 5DE2A 3UPXA 2C47A 2WO6A 3Q04A 4YJTA 3D15A 4P90A 1HOWA 3KXZA 5L8LA 3ORKA 2HK5A 2OSCA 1JWHA 3FMEA 5E91A 5HX6A 1OIYA 2PVMA 2QHNA 1GOLA 4FT7A 3DLSA 3Q4UA 3KULA 4EHZA 3BLHA 4EYMA 4O0VA 2GNLA 5L6WL 4FZDB 4IJ9A 3G6HA 2GNHA 3TG1A 4EH7A 2G9XA 4P5ZA 4U43A 3PPZA 2J0KA 4JDHA 5EDRA 4O7RA 3LJ1A 5LCJA 3FSKA 2GQSA 2XNEA 3FY2A 4NM0A 2C0TA 1XBCA 4AZTA 4O1PA 3FY0A 4U3YA 3PRFA 1SZMA 4FL1A 3ZTXA 4YO4A 2O2UA 4M68A 2PVFA 3CY2A 4RIWB 5M57A 3AOXA 5AA9A 2C5NA 4OTHA 3EQPA 4R6VA 3VUDA 2REIA 1GZKA 4EL9A 4E5BA 4DG0E 4G17A 4BDBA 4I5HA 4AZSA 4FSZA 2O5KA 3BHHA 2R0UA 2XKDA 2Z7QA 4XCUA 4BGHA 4Y85A 4BCOA 5HOAA 4YSJA 3A7FA 3G9NA 5KBRA 3BWJA 3NW6A 1OKVA 1J91A 4X2NA 4X7QA 3NAXA 5CI6A 2C1AA 3VBVA 3F5GA 5ANGA 4AZVA 3OFMA 2FH9A 1VYWA 3AD4A 2JDTA 5BPYA 2ITQA 4ASXA 4CMUA 2OFUA 3VS0A 4OBOA 1XHAA 1SVHA 3BQRA 4OT6A 3QRJA 4Y72A 2HY81 2A19B 2GNIA 4PX6A 4N0SA 3RHKA 3RP9A 3QXOA 2OZAB 3ZFYA 2ZM1A 4J98A 5LCKA 1Y8GA 2GHLA 5M44A 1G3NA 3R04A 5L2SA 2YACA 3R9DA 5T3QA 1Q5KA 3TI1A 3VBXA 4B6LA 4M84A 3PJ3A 3BYUA 3R02A 5L6PA 1M2RA 2W17A 3AMBA 1ZZLA 4ASDA 5JSMA 3AT2A 3CGFA 3PZEA 3D5WA 4ZSEA 5AR2A 4QMVA 3QL8A 5CZHA 4IZ7A 4OTPA 4U7ZA 5B2KA 5F1ZA 5AAEA 5JMSA 1IAHA 2YZLA 4O7LA 3H9FA 1AD5A 2OGVA 4JDJA 2ZV2A 3B8RA 3GQLA 3ORZA 3IW4A 3PXYA 4E3CA 3LMHA 5CAOA 4ACDA 1YHSA 3OG7A 1B39A 1HCKA 2QU6A 3WI6A 2C6OA 3OF0A 5CQWA 2OH0E 3VUHA 4IVAA 3ZXTA 5HLWA 3Q9YA 5IQEA 4TWPA 4CLIA 5BVEA 1PMVA 4HVDA 1YOLA 4QTAA 1W83A 4IX4A 5M53A 4U81A 3SX9A 2QR8A 2GHGA 1FVRA 4RT7A 2VWWA 3HGKA 5H8GA 5ETIA 2W0JA 3CXWA 4IHPA 5IA5A 4D1SA 4ITJA 2A27A 3H0ZA 5F4NA 4MBLA 5E8WA 3PSDA 3FI4A 4KIQA 4C8BA 4JBVA 2CKQA 2OLCA 1PXPA 3PJ1A 2ETRA 1H01A 5IDNA 3OT3A 2Q0NA 1H1RA 2YABA 3UYSA 5A9UA 4U80A 3HX4A 3F3VA 3CR0A 4NKSA 1R0EA 4D2RA 4E6CA 2ITUA 2X0GA 4NT4A 4TYHB 3V51A 5I9ZA 3E87A 3VNTA 3AMYA 1PHKA 1Q8YA 1YI4A 4EBVA 4FZAB 4BDHA 3SA0A 4WNOA 3GNIB 3G15A 1YHVA 4LRKA 1UA2A 4XP3A 4YPDA 5CXZA 4OAUC 3MW1A 4JQ8A 1IEPA 5EYKA 1U5QA 2JAVA 2BDFA 1YXSA 3FXWA 3HA8A 3JS2A 2WTDA 4Y5HA 4GU6A 1SYKA 4OTIA 1K3AA 5IQAA 1YVJA 3QKLA 4L68A 2XMYA 5FEDA 2G1TA 4GW8A 1DAYA 4DH5A 1ATPE 3R71A 5E7RA 3SAYA 1M14A 2Y6MA 2BKKA 2W1ZA 4EHEA 1XBBA 4C58A 2Z7RA 3MH2A 5CF5A 2R4BA 4XYFA 5H8BA 3ZCLA 5EHOA 2UZOA 5HLNA 3U8WA 1F0QA 3MBLA 5DR6A 5ANJA 4BDIA 3CSVA 3SKCA 5I0BA 1CDKA 4J52A 4HVSA 1JKSA 5AP0A 4IZAA 1Q62A 5G1XA 5E8UA 4PRJA 2UZBA 3MH0A 1OKZA 3DAKA 4JBQA 3OWKA 2XNGA 1H1SA 1V0PA 1J1BA 3P08A 4NW6A 3LM0A 3MB7A 4BDGA 5DRDA 4BHNA 2VTJA 3ZZWA 3UQFA 2FSOX 2JD5A 2HIWA 1GJOA 2F7EE 3FUPA 4ZTNA 1G8AA 5J8IA 3T3UA 2X1NA 2Z02A 4ENXA 3BV3A 4W8EA 3PE1A 3TXOA 4JX3A 5FM2A 2UW4A 3HMOA 5FTGA 3EFJA 2C5XA 2WZJA 4EZ3A 5E8SA 4FGRA 5IEXA 2XRUA 4IC8A 4EK3A 1NVRA 2XNBA 4GL9A 4F9CA 4C36A 4F08A 4WNPA 3BYOA 3KKVA 3Q3BA 3R73A 4C37A 3DCVA 3GCSA 4YTHA 2ZMCA 4F9AA 3OXTA 4QMSA 2FUMA 3EQFA 5AM6A 3QCQA 3VAPA 4WIHA 3UNJA 3VHEA 2CGWA 2W96B 3VBYA 2X9FA 2Y4IB 5F95A 4EHGA 2QD9A 2W5BA 1KE9A 2YZAA 5CXHA 3EQGA 2OF2A 1PXMA 2WQOA 3T8OA 5EM8A 3I7BA 5HTCA 3BYSA 4YBKA 4C4EA 3QFVA 2BAQA 3ZSHA 4DT9A 4UWBA 2XNNA 3FC1X 1WBNA 2JDSA 4LL5A 5KBQA 1W0XC 1YDRE 2VTMA 5AUUA 5DGZA 4GK3A 5IEVA 5L2QA 3DS6A 5F94A 4BTJA 3VJNA 5CY3A 5HG9A 3LE6A 1YOMA 3GGFA 1LUFA 2ZVAA 3MJ2A 3ZLWA 4GSBA 3QQLA 1WBWA 4WA9A 5KMKA 4Y83A 4E7WA 3KCKA 3W2OA 3HDMA 2JDOA 3EQDA 1JSUA 2HZIA 4YC3A 4B9DA 4KKHA 4QMLA 5LVPA 4QYHA 4JLCA 5K0KA 3REPA 3EQHA 3RZBA 3OCBA 4PDYA 1MP8A 4FKVA 5CSXA 4OTDA 4BFMA 5IA3A 1ZLTA 2Y6OA 4E5WA 1XH5A 4PPAA 4O82A 4P2KA 4GRBA 3VF8A 5L2IA 5J9ZA 4MNEA 3BEAA 1WBPA 4UMUA 5J5SA 4D2WA 3QZHA 5AIRA 3IW5A 5KMNA 5LVNA 3R1YA 4MTAA 4GT3A 2VO7A 4A9UA 4EKKA 3U54A 3DBCA 4RA5A 5HD7A 1KE8A 3AC3A 4OBPA 5GHVA 4XRLA 1XBAA 5FLFA 5HGIA 5EHLA 4F99A 4EONA 4BCNA 5HX8A 4C4HA 3LFSA 3N4VA 5EI6A 2QU5A 4C4FA 3SD0A 3LXLA 4Z16A 4BCHA 1JLUE 3DQXA 3HECA 3UVPA 4ANSA 3V5TA 4U40A 5LVOA 3V04A 4MEDA 3KCFA 4HNFA 4EK8A 4WG4A 1H4LA 5HESA 3PSCA 3RPYA 2HELA 4GJ2A 3M1SA 4OTRA 4V0GB 1Q61A 3JYAA 3ITZA 4O7YA 4O6LA 5FDPA 5JEBA 4ZXTA 3JPVA 4PDSA 3S95A 5B2LA 3R7VA 4ZZOA 3HV6A 1SNUA 3F69A 3H30A 1OM1A 2ZB1A
chains in the Genus database with same CATH superfamily
1SVEA 3QRUA 2PVRA 3DB6A 3I4BA 4P4CA 4ZIMA 2X7OA 2W99B 2H96A 3PLSA 3LCKA 4L3JA 3ATTA 4JMQA 1PMEA 1GIJA 2NPQA 3EHAA 4F7NA 1GIIA 3PVUA 2OXDA 2XNOA 3I1AA 5A4TA 3L8SA 5D41A 4R77A 4X3FA 2O64A 4O7WA 3LCDA 3U51A 1TQIA 3ZM9A 3HV7A 2CGUA 2QOHA 1M2PA 2YFXA 3K2LA 3C4EA 4FSQA 4UXQA 3ZRKA 2J6MA 3HMIA 2P4IA 3ID6C 3O50A 1YXVA 5CEPA 2CMWA 2QCSA 3FZPA 4JIAA 4QO9A 5K3YA 4QMUA 5BVDA 1MUOA 2H8HA 3NNXA 3PLAE 4DEHA 1H8FA 2E9UA 1E1VA 4HNIA 4DINA 4HVGA 5LQFA 4HZRA 3TV4A 1H08A 5ANIA 3W0RA 3IKAA 2PTKA 4QYFA 5IEYA 4KUJA 1OGUA 3R8PA 3MN3A 3RM6A 2JFMA 5BUJA 3N51A 5ACBC 4EHVA 2BMCA 3GCPA 3MH1A 3NS9A 3IW7A 4LUDA 4YZBA 1R1WA 1KOAA 4IDVA 1FVVA 4K18A 3DBDA 4BR3A 4O86A 3L1SA 3VUKA 1OMWA 1CTPE 2O3PA 4I6QA 5AR5A 4G5PA 2BAJA 2PMIA 3EN6A 4GYGA 4TT7A 1CM8A 3P7CA 3ROCA 3DXQA 4FK6A 3BL7A 1OUYA 3LXKA 4W4VA 3QD0A 4QMOA 4F6SA 4XOZA 2KULA 4KABA 4CFWA 3VS6A 2OJGA 5DBXA 3KMUA 4ACGA 2NO3A 5CSVA 2C6DA 5HG5A 4QMQA 2YAAA 5CSWA 3QX2A 4IZ5A 4S31A 4YZMA 1H25A 4CQGA 4TNBA 2JIUA 5D7VA 1PKDA 3F2RA 1WZYA 3GEQA 4PP7A 3WZEA 4XX9A 4FOCA 1UU7A 2QOOA 4BKZA 5E4HA 1KV1A 3R8MA 2X9EA 3W2SA 2YM7A 5KKRC 3FMHA 4TYJA 3NLBA 3P4KA 3IONA 4IAAA 4XBRA 3UGCA 3O2MA 1BL6A 3U4WA 5B7VA 4YJSA 4GEOA 2GQGA 4U8ZA 5CQUA 2YCFA 3ZONA 4FMQA 3C9WA 3VQHA 4R78A 2QC6A 2ITXA 2WQBA 3RZFA 5M08A 5CYIA 2W9ZB 4ORKA 2W9FB 5AP1A 2VAGA 3BBTB 4RPVA 3QC9A 1P4FA 2C0OA 3VUTA 3VRYA 3ZO3A 5FD2A 1FMKA 3ENMA 3D83A 4EJ7A 5CVFA 4OT5A 4F7LA 3OROA 4J1RA 4FTMA 4BDCA 5CWZA 5IA0A 1QL6A 4H1JA 5GZ9A 3TTJA 5IQFA 2JKKA 2IF8A 2GS2A 5LMBA 2RF9A 3QWKA 5K0XA 2WIHA 2C68A 2R64A 5CU4A 3VIDA 4X2FA 4E1ZA 3UG2A 2ITWA 4HGEA 3MVJA 1PYXA 2ONLA 4X3FC 4FSTA 4GK2A 4DHIB 2WXVA 2XBJA 3LFNA 4I5CA 5M51A 4KBAA 4ZSAA 2VTNA 2QONA 5D7AA 1ST0A 3Q4TA 3ZC6A 4UMQA 4RC3A 5K4JA 4FIFA 4QRCA 2ITOA 3D9VA 3HKOA 2VZ6A 4S34A 5HO6A 4QT1A 3BV2A 4EI4A 3PY1A 3KF4A 5HO7A 2PWLA 2QLQA 3R1NA 3UZTA 4XOYA 3GC7A 3GU6A 3ZUTA 4O96A 2FSTX 3VUGA 3OCGA 3P86A 3GT8A 4FSUA 2XKFA 4KIKB 4QQTA 3VS4A 2JEDA 5B2MA 4K9YA 4OTFA 4U5JA 1PXKA 4BDKA 5CAQA 4DH1A 2PL0A 5CALA 3BKBA 2J0IA 3E8EA 1BI8A 1BI7A 3G2FA 2I0HA 3NW7A 3QHRA 3I5ZA 3I6UA 3E3BX 3F82A 1MRVA 4D5HA 5KMJA 4NJ3A 3P1AA 4LGHA 3SDJA 3LJ0A 3KEXA 3V6RA 4IH8A 4FNZA 2BZIB 4QYEA 4BDEA 3OEZA 4RWJA 4CZYB 2X7GA 3PA3A 4F1OA 5KHWA 2O0UA 4DF3A 3H9OA 2CLQA 4M67A 1JBPE 1STCE 3V8WA 1OIQA 2UZUE 2V55A 2YJSA 3EYGA 2CSNA 1JSTA 5HVYA 3VO3A 4AN3A 4EC8A 4BTMA 5IISA 1U4DA 3MIAA 4UXLA 5CU2A 2YIXA 5CENA 3ZFMA 1RW8A 5FDXA 2OJJA 2Y8OA 3I60A 3ORXA 3D14A 4I6FA 3PYYA 2LGCA 3U4UA 3GOPA 4DFUA 3QF9A 2PUUA 4ZK5A 3NSZA 3CPBA 2CNUA 3JUHA 4FL2A 5IF1A 2BZKB 4YGAA 5D12A 3PFQA 4IADA 3KXMA 5A6NA 4AZFA 3PVGA 2F9GA 1URCA 1ZAOA 2B4SB 2VNYA 3EQCA 4KRCA 4MXOA 4OGRA 4RFYA 2VNWA 4I0TA 3WIKA 4BL1A 4ZTHA 4DDGA 3QX4A 4IWDA 1KE5A 4QQ5A 5JFVA 4L46A 5EQPA 4YNEA 4FVRA 1OPLA 3KRWA 3B2TA 3O8UA 3RPSA 4CTBA 4OR5A 2VTPA 3TUDA 1Z9XA 2W5AA 5CAVA 4QMYA 3UTOA 3UP2A 4BBEA 1JKKA 1B6CB 3BE2A 3NCGA 4RIWA 1YXTA 2J9MA 4L00A 4CV9A 3LLAA 4AXDA 3NUYA 4G3DA 2JDRA 4JG7A 3ZEPA 3QLFA 3PVBA 3Q9ZA 3RK5A 4AXEA 4W9WA 5EW3A 5E8ZA 3ZZEA 4R1VA 1OPJA 3QZIA 1Q99A 4YR8A 4DH3A 5HEZA 2OIQA 5AUZA 1Q8WA 3TNPC 4GKIA 3R21A 3PG3A 4ZSJA 4FT5A 3ORPA 4BWXA 3TTIA 4U79A 3SXFA 2ONLC 4JR7A 3VN9A 1MQ4A 4LFIA 3KA0A 4FZFB 4IJPA 3ZSIA 3ORLA 2NRUA 2X0PA 1YWVA 2XKEA 2QOFA 3BHTA 3MVHA 3OC1A 2Z8CA 4NM7A 3BU5A 3VBTA 2C3JA 2O63A 3DKFA 3N4TA 3TJCA 3V5LA 5FXSA 2WTWA 3QCXA 3WZJA 4IB1A 3EL8A 1QPEA 4O4DA 2UW3A 3ORTA 4FV3A 4C57A 2ZV9A 3VUIA 3MPAA 4AOIA 5LMKA 4TTHB 1IR3A 2JBPA 4GS6A 1OL7A 3PPJA 4R3RA 3LFFA 4C59A 3QTXA 2F2CB 5F20A 4EEVA 5EHYA 2R3QA 4BI0A 4EQUA 3D0EA 5HIDA 3GCUA 2X2MA 2J7TA 5BVWA 5IQBA 4F9BA 2J50A 3O8TA 3V5QA 3I79A 4FTNA 5EYDA 4N6YA 3BX5A 3ZHPC 3E63A 4BCJA 5EQYA 4EH2A 4QP6A 4EOLA 2CCHA 2X8DA 3C7QA 5J9YA 3QD2B 3CTHA 4MUQA 4J99A 4DHFA 5CNOA 2R3MA 1PRYA 4LOOA 4IB3A 3C0HA 3IOKA 2XK4A 3UDTA 4D58A 3BU6A 3KMMA 3P23A 3PUPA 4XP0A 1TFFA 5IMEA 3RWPA 3RHXA 4V04A 4PMPA 1JAMA 5EM7A 3UQGA 4ITIA 5CZIA 4F0GA 2PUIA 2XYUA 2WD1A 4MF1A 4YUQA 4MWHA 4NU1A 5AV3A 2CGXA 3KMWA 3R22A 4FTIA 2VU3A 3TZMA 2ETMA 1P5EA 1URWA 2R0IA 4YJUA 3RVGA 4RJ4A 1U54A 4EOMA 3MFRA 3BZ3A 4FV1A 4DEBA 2AUHA 4ENYA 2GNFA 3C51A 3RKBA 1ZXEA 4YBJA 4ANMA 1VR2A 2C6LA 4C7TA 2GTMA 2XIZA 4LYNA 2WQMA 3EYHA 3N9XA 3UOKA 4JIKA 3S4QA 5C27A 3COMA 1PXOA 2R7BA 4FKTA 4FL3A 3SW4A 5FRIA 2YHVA 4RBLA 2QOQA 2QKWB 3FL5A 4ZAUA 4FV7A 2SRCA 1L3RE 5TF9A 3P5JC 4OUCA 2XJ0A 4ZJVA 2VO6A 2YIYA 1XH8A 2RFDA 4XEYA 1ZYCA 3EFWA 4CFNA 3UJGA 5A4QA 5T6KA 4TRLA 1W84A 2QLUA 1GIHA 2GFSA 1OPKA 3A99A 3DTCA 1BMKA 4MQ1A 4DC2A 3NX8A 1WBTA 3BLRA 3GXLA 4YJVA 3JY0A 4NH1A 3E7VA 4BI1A 4JS8A 4ANNA 1NVQA 4QTEA 4NZWB 1PXLA 3MY0A 4O38A 2BALA 4JAIA 4I5PA 1XWSA 4UWYA 3R7YA 5DNRA 1U59A 3ZEWA 3QKMA 1QCFA 3P7BA 1WFCA 2H6DA 3CD8A 1F3MC 4BICA 3QALE 4H39A 4JOAA 3Q4CA 4CFMA 3GU8A 3FBVA 5HBEA 3ACKA 2IG7A 4HCTA 4XG2A 3V01A 3QQJA 4UMRA 5K9IA 5IQDA 5AV0A 3UODA 3LQ8A 3TWJA 4NM3A 5FBNC 5AV1A 5AR8A 4R7IA 4GG7A 3TZ9A 2XF0A 3ODZX 4DEEA 1IAJA 4IACA 3QHWA 3BEGA 2OXYA 4TWOA 1M52A 3AC5A 4K33A 4RIXB 4U45A 3SHEA 2C30A 5IUIA 5LMKC 5IQCA 2OJFE 5BVOA 2R3KA 2H34A 1M7NA 4AE6A 2DYLA 3AT4A 3QRTA 4RWLA 3IDPA 2WMXA 3HVCA 5DH3A 5EOLA 3RNYA 3CPCA 3R8UA 3BRBA 4RG0A 3SW7A 4UYNA 4BBFA 1QPCA 3VC4A 4CKJA 2W4JA 1ZYSA 4EK5A 4FVPA 1IA8A 3F3TA 1GZNA 4QMXA 2DWBA 3WIGA 4AT5A 1W2FA 3TYKA 3IOPA 2XCKA 3OEFX 4BCIA 4CYIA 2YN8A 3QWJA 1M7QA 4JQ7A 3TN8A 1R39A 3ZBXA 4ZTMA 2WOUA 3UO4A 1WVYA 4I5MA 4PNKA 4XJ0A 5EDQA 5GNKA 4OAVB 4XG3A 4L8MA 2B53A 4XV1A 1DM2A 1XKKA 4GMYA 5CX9A 5JFXA 1O6KA 2UZLA 4U41A 4F09A 2R3OA 4PPBA 5M56A 2E9OA 4I92A 4J95A 4ZOGA 5HBJA 3PXKA 3L8XA 4D1XA 4JXFA 5FP6A 3MPMA 5AIKA 4GUEA 3R1QA 4X3JA 3A7GA 5GIOE 4G34A 2BHHA 4O4CA 4PP9A 1WVXA 4TYGA 4L3PA 4X6QC 4WBOA 1R3CA 3CQWA 5C01A 4TZRA 3KXXA 2BFYA 1YDTE 2P0CA 1VLRA 3KXHA 3QGWA 2IPXA 1SM2A 2IEWA 3ORMA 1O9UA 2BUJA 3MY1A 4RLLA 5DOSA 4EH8A 3FI3A 1UU3A 3BYMA 3KN5A 4CZUA 4H3BA 4LGDA 4A4XA 2AYPA 3BPRA 3R9RA 4FJVA 3LM5A 2GPHA 3VUMA 4B7TA 3EOCA 4B0GA 5BVFA 3HAVA 5CI7A 4DA5A 3P0MA 5HIBA 3WF7A 5IA1A 5HQ0A 1J7UA 4NIFB 3R8LA 3FXZA 5L8KA 2VV9A 5IH6A 3FLZA 3TNHA 2HOGA 4XUFA 1Q3WA 2DS1A 3TNIA 4DAWA 5JGBA 2IWIA 3TDVA 4E93A 3ET7A 2QO9A 3W2CA 1H26A 4FV0A 4F1MA 3NR9A 1PMUA 3ENHA 4JRNA 4YO6A 3ZRMA 4FNXA 2C3KA 3GC9A 1E9HA 3GC8A 4CTCA 3AKLA 3I0OA 4BF2A 2J0MB 2W1EA 2WTKB 3DB8A 4LOQA 3QQHA 4FKSA 3FHIA 4KSPA 2RFNA 1H07A 4YJNA 2OF4A 3UIUA 2J2IB 3GU4A 4UY9A 4QDVA 1M17A 1Q97A 5HZNA 4AA5A 3NVMB 4CV8A 3HMNA 2QVSE 2XP2A 5DT3A 3RALA 4AXAA 4A07A 4CSVA 5DT0A 3ZOSA 3D2KA 1YKRA 4L52A 4NL0A 4AZEA 2YAKA 5HTBA 3LFDA 4O6EA 4RVKA 4Y46A 3POZA 4CMTA 4XV3A 1CSNA 4M12A 5HU3A 3CQUA 4CD0A 2BRNA 4JDIA 2Y4IC 2XK7A 4CG9A 2YITA 3F5XA 1T45A 4GVJA 4MWIA 5DWRA 3RMFA 5M4CA 3OBJA 3E5AA 4F9YA 3EL7A 3G51A 3LFCA 3W2RA 4D4YA 5L4QA 5EK7A 4FIHA 3OWPA 3DGKA 2BPMA 4BCQA 4EH4A 4LUEA 2YA9A 1NW1A 4C0TA 5JK3A 3FKOA 3IGGA 4YJRA 2XJ1A 3LVPA 2PK9A 5A14A 2HY0A 4QP7A 4CRSA 3DJ5A 4M0ZA 5KUPA 4RFMA 4AE9A 4D4SA 2WMAA 2BILB 4E20A 2Y9QA 2WMUA 4FVQA 4EUUA 4I6BA 5AUXA 5KCVA 2PVKA 4QMTA 3COIA 5HICA 2UZVA 2ZM3A 3CJFA 4O0SA 3BE9A 3LAUA 4O22A 2P3GX 3Q96A 5EKNA 4CMOA 2P33A 2WNTA 2ZDTA 2HZ0A 3V6SA 4ZY6A 3OW4A 4FTAA 4ANQA 4DCEA 4GVAA 2W05A 4J53A 2R3JA 4FR4A 3D94A 2GQRA 5BV3A 4XHKB 4QQJA 2PMLX 2FB8A 4A4LA 5ICPA 4BDFA 4AFJA 3C4FA 4BCMA 4TN6A 4DTKA 2JKQA 4I6HA 4U97A 3FKLA 5JRQA 5LOHA 4RWKA 4GJ3A 4XG8A 4FTTA 2ZFYA 3D5XA 4RA4A 4BDAA 2ZDUA 3F66A 3UG1A 3DBFA 3CD3A 3ERKA 3R2BA 2R7IA 4P5QA 1Q41A 4X2JA 4X6RA 4I6LA 4WSYA 4BZNA 5HG8A 1YI3A 3LFQA 4MX9A 5BNJA 4CFFA 4KBKA 2YLFA 4L7FA 3MGYA 2PZIA 3QA0A 4G3CA 5EW9A 4C4JA 2VRXA 4EQMA 2PVJA 5CAUA 2DUVA 3LMGA 4PDPA 4EKLA 2RGPA 1WCCA 2BKZA 2WQEA 4L53A 4LV5A 4CXAA 3KN6A 2XEYA 4Q5HA 4PPCA 2YM5A 1HCLA 2GHMA 3OD6X 3E88A 2PE0A 4BKYA 5HE3A 3UQCA 3DDPA 3ZC5A 3TUBA 4CRLA 4YJOA 4WOVA 4MK0A 4BIBA 3EQRA 1UNGA 1H00A 4YHJA 3Q5IA 1OGYA 2UVXA 4FI1A 3BL9A 3K3JA 4HJOA 5M07A 3FZOA 3G5DA 3PDTA 5IA4A 2VX1A 5GIPE 3FQEA 2W1IA 3A7JA 1KSWA 3ZMMA 4AT3A 1QMZA 4CCUA 3HMPA 4H1MA 4FV9A 4RQVA 3RAWA 5BYLA 3OP5A 4IANA 5EOBA 3EH9A 2CDZA 3FLQA 3GU5A 4C3RA 5BUEA 5HD4A 3AC8A 3NIEA 4FBXA 4QMZA 4GT5A 3Q9XA 4G9RA 3LFAA 4AW1A 5IU2A 2CHLA 4R3CA 3CBLA 4QYYA 3R9HA 3EIDA 1JKTA 4KSQA 1LPUA 3UOLA 3ZRLA 5GJFA 1OIRA 4Z9LA 5E1SA 2G2IA 3HV3A 5ANEA 2NNWB 2CNVA 4G9CA 4KS8A 4KIKA 2WMVA 5AUWA 1H27A 3IW6A 3WZUA 2CN8A 4NFMA 4F6UA 4ZLYA 3TCPA 3M11A 2YDIA 5C26A 5KZIA 3BCEA 3MIYA 4UB7A 2XK9A 2R3PA 1ZOGA 4LMNA 3PXZA 1H1PA 2OI4X 3PIXA 2W1GA 3FE3A 3QLGA 1O6YA 5BX0A 4IBMA 4BWPA 3CQEA 3OZ6A 1A9UA 2C4GA 4E5AX 5KZ0A 5CU6A 5TR6A 5JT2A 1YHWA 1XMLA 4BJJA 3QUPA 3UVQA 2C6TA 3NZ0A 3PSBA 3QGYA 3MH3A 1FOTA 3MWUA 4FKWA 3ZUUA 2PSQA 5JFSA 5KMMA 3Q53A 5FUTA 2PULA 5I9UA 2R3IA 4O7ZA 1XH4A 3MA3A 2WMWA 2WMRA 4AQCA 4O0RA 4I20A 1YDSE 2GCDA 3PWDA 2C5YA 4L42A 1G8JA 1Q3DA 2OG8A 5HU9A 5TO8A 2BZHB 4GUBA 4HOKA 3EZRA 4RLKA 4IAFA 4YSMA 3RM7A 2W06A 2UZTA 4YNOA 1UVRA 5C8KA 5FGKA 3V5WA 4IX6A 2PZYA 2QOIA 3HYHA 3O8PA 2ZAZA 4Q9SA 4EK6A 2GTNA 1P14A 2BTSA 2F57A 1RE8A 3RNIA 2QOBA 1EH4A 4E4XA 2OICA 5HCYA 4IB5A 2BHEA 3IW8A 4DYMA 4IAYA 2BCJA 2WGJA 4HW7A 3SQQA 2OFVA 3KFAA 5EW8A 3PXQA 3OBGA 4EOJA 3E8CA 3MA6A 4JX7A 1KOBA 4JT3A 4BZOA 4ANBA 1UU9A 1FPUA 3G0FA 3IPHA 3C0IA 4L44A 4NCTA 4QPAA 4YJPA 3RJCA 4BKJA 3QUEA 4FTOA 3I81A 3KVXA 4DGLC 4I24A 5EI2A 4PNIA 5K5XA 4GT4A 3Q6WA 3UOHA 4EOPA 4GFGA 3RAIA 1TKIA 2UZWE 2P2IA 3DAEA 5AUVA 2Y4PA 2CNQA 3EFLA 4Q9ZA 4CCBA 2PUPA 1JVPP 3KXNA 1IRKA 4S32A 2UW9A 4FTQA 4FUYA 3M42A 5DEWA 5LVMA 4MAOA 2FSLX 1FQ1B 1MRYA 2UW6A 3E93A 5AR4A 3NYOA 2VX3A 3TT0A 4C35A 4EOOA 3IDCA 3FZ1A 3BU3A 3Q5ZA 3NUNA 4JBPA 2WPAA 4IM3A 3RK9A 5I9WA 2PVHA 4ZS4A 3FLYA 5H9BA 5BMSA 3VVHA 3U55A 3BGQA 2VTHA 3P7AA 4TPTA 3VF9A 4PWNA 1JQHA 5M06A 4YTCA 3OT8A 4FK3A 3U9NA 5E9EA 4UZDA 1ZY5A 2B9FA 2EUFB 2RFEA 4GH2A 1TZDA 3DLZA 4CFUA 2PVYA 4QTDA 1Q8ZA 4M3QA 2BR1A 5JN2A 4FV5A 3P9JA 1V0OA 3LQ5A 4KS7A 5KMOA 3F7ZA 3W0SA 1UU8A 4DBNA 3AD5A 4AW5A 3MJ1A 2IW6A 4IVBA 5A3XA 3SOAA 2XIXA 3VWAA 1NY3A 4M14A 2QOKA 3JVSA 1RJBA 3QTIA 4IMYA 5FTQA 4EOKA 2A2AA 4G16A 4RIYA 3ZLSA 4HYSA 3CY3A 2B7AA 2WTCA 3V5PA 2BAKA 4A4OA 4WO5A 5C1QB 5LMAA 1LR4A 4M69B 4RIOA 3BHUA 4G31A 5AR7A 2H9VA 3CGOA 5EYCA 3W1FA 2BRMA 1NA7A 4D9TA 1W8CA 2VN9A 1PXIA 5AWMA 1Q8UA 2QI8A 2ZJWA 3EZVA 3QTSA 4MBIA 2JKMA 2RSVA 2YCRA 4MHAA 4Z55A 3F3ZA 2VO0A 1LP4A 4HZSA 5AMNA 1RQQA 4A9RA 4Y8DA 2XNPA 4YLJA 1APME 3LCSA 1BUHA 4ZS0A 4E6QA 5AV4A 5F9EA 3UDZA 5M4FA 3CE3A 3F88A 4G3GA 3Q9WA 4JJRA 3TL8A 4RZVA 2G2HA 1XH6A 3ALNA 3TV7A 3OUNB 2XARA 2R2PA 5HE0A 5D1JA 4AN9A 5CLPA 3VW8A 3DXNA 4L3LA 4L45A 2AC5A 2IZRA 2WB8A 4WRGA 4BTKA 5L3AA 5M4IA 5IQIA 3WOWA 3FZSA 5C4KA 1OI9A 4CT2A 2C5OA 2OIDA 4ANLA 4PL4A 3D7TB 3WBLA 2PMNX 3OTUA 3C4CA 4D28A 1KE7A 3NUSA 5M55A 4DEDA 3KVWA 1VJYA 2HW7A 4JI9A 4JR3A 4BCKA 5HBHA 4OTQA 5FQDC 2YCSA 3NWWA 3IDBA 4NCTC 2QR7A 2Z7LA 5M09A 3KGAA 3QCSA 4NTSA 3S2PA 3KXGA 4IC7A 5DMZA 2PUNA 4FEWA 2IZTA 3LCTA 5A4CA 1ERKA 2ZYBA 4IIRA 5CT0A 5J7BA 3V3VA 3VS5A 4QQCA 4J97A 5J7HA 4FG8A 2FVDA 3EN9A 1AGWA 2C1BA 2W1DA 1KWPA 1MQBA 3U87A 3RGFA 1OL5A 3AGLA 4LG4A 3V8TA 4MNEB 3I6WA 4ZLZA 3FL4A 2HXLA 1OUKA 3COKA 4NKAA 5DEYA 3F5PA 4BDJA 4AQKA 3L8VA 2HW6A 4PL5A 2GNGA 3PP0A 3R83A 4G6LA 4YC8A 4F0IA 4Q2AA 3EKNA 3GI3A 3IO7A 4OLIA 1IA9A 1S9IA 1YXUA 4R5YA 5CEKA 1ZWSA 3CIKA 4BCFA 1QPDA 4RC2A 4AGWA 3NW5A 2QKRA 4C3PA 4U42A 1Q4LA 2AC3A 4DN5A 2CKEA 3MVLA 1Q8TA 4BN1A 4BGQA 4PMTA 1J7LA 3ALOA 3HZTA 5AA8A 4PF4A 4RIXA 5HI2A 3PXRA 4D5KA 2JAMA 2PU8A 1Y91A 3DV3A 4XG9A 3ZYAA 4TWCA 1J7IA 3G0EA 2ZM4A 3ULZA 1ND4A 3N4UA 1REJA 4PDOA 4R7BA 4N4SA 3DBEA 3WE8A 3OTVA 3T9TA 3MTLA 3DJ6A 4O7SA 3R7EA 5AAGA 3OMVA 2VX0A 1UKHA 4M13A 4L6QA 1PXNA 4PV0A 4RJ3A 3DA6A 3C4XA 5HG7A 1ST4A 3FMNA 4NW5A 4XG4A 1B38A 3WYYA 3PXFA 3ELJA 5AP6A 4ZJIA 5GJGA 3R7OA 5DA3A 1WMKA 4E26A 4FEUA 3UVRA 4AOJA 5KX8A 3EN5A 4OTWA 3H4JA 4X3FB 1J3HA 4DEIA 3IG7A 4BGGA 5HKMA 1CKPA 3ACJA 4N6ZA 3OOGA 4YURA 5JGDA 3RAKA 5IZFA 1BKXA 1LEWA 4MCVA 4QP9A 5DT4A 4BCGA 5CEQA 1ZZ2A 3UBDA 2VTLA 4ZTRA 4C2WA 3D4QA 4PUZA 3FDNA 4YZCA 4TYEA 2J0LA 1WBVA 2WOTA 5AUTA 2I40A 3CS9A 4MXCA 5DHJA 1BLXA 4QMPA 4WBBB 4YC6A 3GQIA 3BQCA 4IAZA 4PY1A 1XJDA 3HNGA 3SOCA 2OZAA 3NGAA 2C69A 4O2ZA 2YEXA 3S0OA 1YWRA 3OCTA 4TXCA 4CQEA 1KV2A 3FEGA 4WKQA 3CC6A 4O0UA 4FKGA 5EM5A 2Y0AA 4LDTA 3HP5A 4FA2A 5H2UA 3DNEA 4WG5A 1XH9A 4DFNA 2X7FA 3AXWA 5J5TA 4AT4A 4MQ2A 4ONAA 2GMXA 2PZRA 3TNWA 2KTYA 4QP1A 4CLJA 5I9VA 4HCUA 3EQBA 4FKOA 2E2BA 5DLSA 4IXPA 4IVDA 1DS5A 4IVCA 3R01A 2UUEA 3Q2MA 2UW8A 4NJDA 2QURA 3SRVB 5EH0A 4L9IA 3O51A 4NM5A 2VTAA 4LL0A 1S9JA 4FOBA 3FYKX 4V05A 5AR3A 3GBZA 2EVAA 3R2YA 2PVNA 4WRSA 2GFCA 3A60A 3C1XA 3COHA 4O0XA 3GUBA 4ITHA 4MYGA 4QD6A 1V1KA 4AGUA 2A98A 3MFUA 4YTFA 5A54A 2I0YA 2EB2A 3ZM4A 1OB3A 1X8BA 3CKWA 4QP4A 2Q83A 4G3EA 3BLQA 4UV0A 4WHZA 3CJGA 5L8JA 3SXRA 5I9XA 1G8SA 2XIYA 4QTBA 4EH3A 4RWIA 2CCIA 2GDOA 3QD4A 5J95A 2W1CA 5JZJA 4DTAA 2NP8A 1OVEA 3S3IA 4UEUA 4WD5A 4G6NA 4O2PA 3DKGA 2EB3A 5IH5A 3LJ2A 2CKOA 1BX6A 4LMUA 2ZB0A 4FV6A 3L9LA 4TYHA 3HRCA 1QPJA 1H1WA 4G2FA 4ID7A 3V8SA 2R3RA 3FWQA 4XRJA 4FEQA 5FG8A 2UZNA 3O71A 4QNYA 4HYHA 2OU7A 3VS7A 3HV5A 3P5KA 4A06A 4O0WA 5IH4A 4Q5EA 2HWOA 4MD9E 4FV2A 4WUAA 5IDPA 2XS0A 4W8DA 4AGDA 5IUGA 4YU2A 5L2WA 1UNLA 5A4EA 3DDQA 5A46A 5GINE 3ZBFA 3R7UA 4O7VA 2W4KA 3K5VA 5ACKA 5ANKA 3WYXA 4BDDA 1Y57A 4IE9A 5TE0A 5I4NA 3FI8A 2XAOA 4I93A 4IWQA 1V0BA 3SXSA 2IW8A 3A7HA 3Q4ZA 1BYGA 4DFBA 4AA4A 5A4LA 5AP7A 5E90A 3GU7A 3ZUVA 3PRIA 1Y6BA 4UMPA 4I0SA 3TKHA 1H1QA 1REKA 4EH6A 4C61A 4G5JA 4USDA 3FMDA 5DFPA 3VS3A 4DG3E 1G8KA 4RSSA 3AMAA 5C4LA 2W7XA 2QQ7A 4BC6A 3IK3A 4JL9A 5EFQA 3W0QA 2YIQA 3L9NA 1PW2A 4KRDA 4RRVA 3LXPA 1U46A 4JNWA 3EJ1A 3DBQA 5DR2A 4ZJJA 2UVYA 5HVKA 4AF3A 2EXMA 1UKIA 2HAKA 2YIRA 3HUCA 4D0WA 5IQGA 2RG5A 4FSWA 4CG8A 2WQNA 4FTCA 2QODA 4LQMA 5CF4A 4IAKA 2A0CX 3TIZA 4FSMA 3UO5A 3E62A 3LCOA