2QOOA

Human epha3 kinase and juxtamembrane region, y596f:y602f:y742f triple mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
273
Chain Sequence
TFVDPVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGFVHRDLAARNILINSNLVCKVSDFPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 273
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qooA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qooA01
4PTCA 2V62A 4NW5A 4X3FA 5FEEA 3IKAA 3I7CA 2X1NA 5IMXA 5A14A 3TEIA 4HGSA 4AZEA 3TKIA 5BUEA 3AT4A 3GU4A 3IDCA 2B52A 2ITQA 4G9RA 2V7AA 3QRJA 3LJ1A 4JS8A 2C3JA 2WMBA 4AOJA 1VYWA 3BKBA 1G5SA 4RG0A 4BKZA 5CSPA 1R3CA 4USEA 3U6IA 3V5JA 4X7QA 3LJ0A 1ZY5A 4O7ZA 4DH8A 4Q2AA 4FK3A 3VUMA 2ETRA 3R1NA 3NAYA 2BRMA 3EZVA 4W4VA 4F1MA 5KKRB 3PIZA 1ZWSA 2JFLA 3QZGA 2C6DA 4U3YA 4BDHA 3PIYA 2Y6MA 3VWAA 3R8MA 4DBXA 5DRBA 3EL7A 3R2BA 2ZJWA 2WOUA 5E9EA 4J8MA 2XA4A 4BCNA 4FEXA 3NUNA 3UVPA 2HWPA 3A7GA 3E87A 3QUPA 2OIDA 5EW8A 4DTBA 1Z57A 2XIRA 3MH2A 2FO0A 5CNNA 3RGFA 5CNOA 4ACHA 1JWHA 1WVYA 2WFYA 5JQ8A 4FZFB 2W1HA 5DHJA 1I09A 3VRYA 3C7QA 1PXJA 4BRXA 1ZMWA 4HVIA 2XS0A 2WMSA 3D0EA 4RWJA 4AA5A 1G3NA 2WTKC 5DN3A 3EFJA 4RJ4A 3UC4A 2WXVA 3ORNA 4EYJA 2PULA 5BVWA 4ASEA 1MRUA 3EB0A 4JOAA 4C8BA 4IQ6A 4CZYB 4EOMA 3DQWA 2JKOA 4FSZA 5AV1A 3AC3A 2BZIB 2GDOA 4QTDA 3MA6A 4LYNA 5IDPA 4UB7A 3VS1A 3IQ7A 3NS9A 4FK6A 2HENA 5CTPA 5CSHA 2X2MA 3QTZA 5L6PA 2FSLX 5EYDA 2QOIA 5HLWA 4IVDA 4O0SA 4DT8A 3D94A 1HCKA 3GXLA 4FKWA 4D5HA 2PUUA 2XK9A 3PFQA 4E3CA 5EQPA 2C6MA 3AC8A 2JAVA 3OBJA 2GTNA 3T9IA 3KY2A 4AZFA 3ALOA 2VTHA 3VUTA 5IDNA 3UZPA 4HYHA 3FHIA 3SXSA 2YITA 3ZHPC 4L45A 4ANMA 3BPRA 4RX7A 5BMSA 3G0EA 3TNQB 3U51A 4FZDB 4EQMA 3RCJA 4IVAA 4KIPA 1BUHA 1CSNA 4OTIA 4FUYA 2PVNA 2WOTA 4EOQA 3ZO1A 1UU7A 3CS9A 3D83A 3MIYA 4M69B 4RIYA 4C38A 4AZWA 4FMQA 3HV3A 5IQDA 2W5BA 3HZTA 3DDQA 3JPVA 3PSDA 2CKPA 2R7IA 4FI1A 4FL1A 5JFSA 4NTTA 4R3RA 4BDIA 2QR8A 3V3VA 5FBNC 5AUTA 3G6GA 4C3RA 1FGIA 4O2PA 1ERKA 3GU6A 3MDYA 3QGWA 2XIXA 4CZUA 3GQIA 5T3QA 4D28A 2PPQA 3E8NA 3P4KA 4L53A 5E91A 3WZJA 2JGZA 3QTQA 4FUXA 2DS1A 3D5XA 3DJ7A 4BB4A 4D4VA 3C4FA 5C01A 4C4IA 4E4XA 2VTAA 1S9JA 4G5PA 5AIRA 5A4QA 1H1SA 1SMHA 1Q61A 4PPBA 2CKQA 3R83A 1OIUA 1OL1A 4FV7A 1OIYA 5HIBA 5B2LA 2OLCA 2CHLA 3ERKA 3U6HA 2YCRA 3ZONA 3Q04A 3Q5IA 3VUKA 3G6HA 4KA3A 4IM0A 4YNOA 1DAYA 2UW7A 5CF5A 4YURA 3MJ1A 3FI4A 3HRBA 4A9UA 3GGFA 3HV5A 3VBQA 4TYIA 4EK4A 2QOBA 2CPKE 3SW7A 5AA9A 4EH5A 4DAWA 3B8QA 4RLLA 3QXOA 3DJ6A 3EQHA 4HJOA 1STCE 3A7JA 4U6RA 5H8GA 3TL8A 4I0RA 3Q96A 5M55A 4NW6A 4EK6A 4JIAA 4O7LA 3EMGA 3HDNA 2WZJA 4QP4A 3WE4A 5AEPA 3NUAA 2JDVA 4HVHA 3QZIA 2C3IB 4WOVA 1U5RA 3RPOA 2YZAA 1OKWA 3TV4A 3ZEPA 2X4ZA 4RVKA 3O71A 4FOBA 3FZPA 3LFQA 3I1AA 2UZVA 4OLIA 2F9GA 5L6OA 1O6LA 4IAKA 2E2BA 1BL7A 3D2IA 4NT4A 2WTCA 3DTCA 1H00A 1K9AA 1UA2A 1O6KA 3JVSA 4N70A 3VNTA 3TG1A 3LAUA 3NIZA 4RC2A 3LMHA 4F9BA 5JGAA 4O7WA 5HLPA 2P55A 3ITZA 3BV3A 1YXTA 3AC5A 4OBQA 3V8TA 2F7EE 4ARKA 2XJ2A 3HRFA 1WBOA 4ZZNA 5A4EA 5HX8A 3P78A 4M68A 2QI8A 3GU8A 3KGAA 4I5PA 2WMVA 2HW6A 4U3ZA 1IG1A 1XH4A 4MTAA 5FRIA 4FV2A 2ZMCA 4YBJA 2JLDA 4B6LA 1W83A 2PVYA 4ZTQA 5G1XA 1CKIA 2HZIA 3GVUA 3UYTA 4PP7A 4KABA 3O8TA 4F1OA 5KMLA 5TT7A 3UVRA 4EJ7A 3FHRA 4X2GA 4BIBA 2C6TA 2WMTA 5HU9A 4QNYA 2YM5A 3RAHA 4R77A 4ID7A 3C0HA 3PJ3A 3L9LA 4IB1A 4K11A 4HYUA 4LGGA 1XBBA 3QD4A 1BI7A 3FUPA 4M7IA 5DH3A 5GNKA 4A4XA 5HTIA 4HGTA 4PDPA 4AGWA 2OO8X 2VGOA 4BTMA 1G8AA 2Q83A 3R21A 5FUTA 3AD6A 3MPTA 4UMUA 4Z9LA 5AP5A 4DCAA 4OR5A 3RZFA 4JX7A 4F65A 1PYXA 4PL3A 5I9UA 3ZH8A 3S1HA 1ZZLA 4JG8A 2WTKB 3COIA 4WHZA 5CASA 3QQGA 3GCQA 2EU9A 5AMNA 5DYJA 4UMQA 3QGYA 4EC9A 3SAYA 5T6KA 5IA2A 5T68A 2QO9A 2PVMA 4CNHA 3FQEA 4II5A 2J51A 4I24A 3NEWA 4MNEB 4Y8DA 4ACGA 2VU3A 3FMLA 4IH8A 3FYKX 4TY1A 1PYEA 3QCYA 4PNKA 2IZUA 3I5ZA 3RHXA 4U8ZA 1OB3A 2JDSA 3RJCA 5HO8A 4DFNA 4ZLZA 2PZRA 2UW9A 4F7SA 1Y8YA 2WD1A 4BWXA 5CEIA 1W7HA 4I41A 3UOKA 4NZWB 4Y46A 5AJQA 4CYIA 2XM8A 3EKKA 1H1WA 1WFCA 3LCTA 4IJPA 4TZRA 1KOBA 5CVGA 2B55A 4FICA 4CMTA 5LWMA 4U5JA 3I81A 4LUEA 3V6RA 2V55A 3KRLA 3C13A 1VEBA 5HZNA 2BDWA 4S31A 5HE2A 3F88A 4JIKA 2XCHA 3C50A 2HCKA 2WEVA 3EL8A 2W1EA 5E8VA 5CT7A 5EHYA 4GJ2A 4N6YA 5L2WA 4ASDA 3NW6A 3SRVA 2ZMDA 3D7TA 3GENA 4BN1A 3MVMA 3TV7A 3ZRLA 2B9IA 1H25A 5BVKA 4ALWA 2B9JA 3ZCLA 3DFAA 2W1GA 3R71A 3BQRA 5EQYA 4C36A 3K3IA 4MEDA 1Q62A 3PVWA 3SDJA 4DEBA 2YM6A 2RL5A 2XNOA 4JJRA 3VUDA 4A9TA 3DKFA 1S9IA 1H1QA 2W4OA 4ERKA 4C3FA 5BUIA 3DJ5A 4H58A 4LOOA 4O1OA 4R7HA 3ROCA 3ATSA 4ZJVA 3OEZA 4ALUA 4DGLC 4F0FA 5CU6A 4M14A 3R9DA 3QTIA 3ZXTA 5JMSA 3DXNA 4D5KA 4QMZA 3OXZA 2OJGA 5AIKA 4YO4A 2YDIA 4GRBA 3EFWA 3LMGA 4R1VA 4GKIA 2C30A 3DGKA 3EN6A 3I60A 4E1ZA 4QP8A 2VN9A 2BDFA 5BPYA 4FTJA 4XHKB 3VUGA 3VN9A 4X21A 3E93A 4MQ1A 5M07A 4IC8A 3GOKA 3H4JA 3Q9WA 3DBFA 2YM4A 4PRJA 4EHEA 4OTDA 1BLXA 1BX6A 3ZSGA 3Q2MA 2NRYA 4AFJA 4CCBA 5I9YA 4JG7A 2H34A 4QRCA 3RBWA 4F6WA 5IUGA 4LRKA 4IM2A 2GMXA 4FKUA 3HA8A 2IZRA 5A4LA 3RM6A 4YZBA 3DB8A 4CFFA 2ESMA 4O0VA 4WUNA 4DEEA 2XKEA 3C5UA 3S4QA 3VUIA 5L8LA 2XYNA 2VNYA 4M67A 5A3XA 4ITJA 2VO3A 1OUKA 2YIWA 2YISA 4YU2A 2CGXA 2WTIA 3I4BA 5J87A 4FIHA 4FVPA 3WI6A 4FKQA 3WE8A 4IXPA 1QCFA 3A7HA 4LI5A 1W0XC 1ZYDA 5LVPA 2BDJA 2WQOA 2H9VA 3CTQA 4A4LA 4E5AX 3HNGA 5J1WA 3L8XA 5D7AA 2PMOX 5M57A 4IWQA 3RCDA 3CEKA 3CY2A 4A9RA 5DNRA 4AAAA 3GOPA 3RPYA 2XNGA 1YWRA 3L9PA 3BHHA 5HTCA 2YFXA 4B7TA 4QMWA 1ZMUA 4EHVA 3E3PA 3R8ZA 3WF9A 2XK3A 5ACBC 2OH0E 4AE9A 3QTWA 3KXHA 5EDRA 5HG8A 4C59A 5I5ZA 2HOGA 4YC6A 4F08A 3TACA 3OW4A 3E8CA 4QYYA 4BKJA 3SVVA 3F5UA 3L9MA 2UZEA 2DUVA 1OM1A 5C27A 4ITIA 4UZHA 5CY3A 4GUBA 2Y0AA 1ZOEA 5LXMA 4IM3A 1E9HA 3D4QA 3ZS5A 3FLZA 3BHUA 4L42A 3KQ7A 3E92A 3JUHA 1IRKA 2WO6A 4AW1A 5DA3A 1H01A 5J5TA 2UV2A 1WBSA 4YBKA 5AP6A 3PLSA 4X2NA 5FG8A 3AD4A 5LVNA 4DE4A 2QKWB 1H26A 4Y95A 1PHKA 4YSJA 3POZA 2R3LA 4JQ7A 4MF1A 5IF1A 4AZSA 3RTPA 2JBOA 4PF4A 4S2ZA 2EB3A 4U80A 3BX5A 5ANGA 3FMJA 4PMPA 4QP3A 3ZBXA 5FXRA 3FQSA 4W9WA 4NCTC 1GAGA 2JIIA 4DN5A 3LXNA 4EKLA 4FR4A 4PY1A 3I79A 3BBWA 3WZDA 3PLAE 2OK1A 5EHOA 4MXZA 3ODYX 5FTOA 2BUJA 4FKPA 3HV7A 5IA1A 2CCIA 2EXEA 3CTJA 4FNZA 2BZKB 3LFFA 1F5QA 5TR6A 1OECA 4EZ7A 3H10A 3OCGA 1YWNA 3OTVA 3LCOA 5GINE 4I3ZA 3FSKA 3PXYA 4MYGA 3VULA 4ZLOA 2ZOQA 2JC6A 2X0GA 1OVEA 2EVAA 1U5QA 2GNLA 1CDKA 2I1MA 4MXCA 4CRSA 1OL7A 4ERWA 5LMKC 2C5YA 3RPRA 3F2AA 4X6QC 4FBXA 3FXXA 4LRJA 3HA6A 1REJA 5DMZA 1JAMA 4L00A 3F66A 2QOKA 4EL9A 2WQBA 2QVSE 3EQCA 1AQ1A 3LW0A 1OL5A 4CSVA 2QKRA 4TRLA 3MPAA 1J91A 4FSNA 4XH6A 2OKRA 5AP3A 5HI2A 4FTKA 3LXPA 3IOKA 3RI1A 2R3MA 5CSXA 4BYJA 2YM3A 5IUIA 2OWBA 5DR6A 4WUAA 1YXXA 3L1SA 5FLFA 4B4LA 5LMBA 4MXAA 2GNGA 3OROA 1J1BA 3PPKA 1M2PA 3CQEA 2FSMX 4DGMA 4XG8A 3PA3A 3BHTA 2RFSA 2UW6A 3DAJA 3IW7A 2WMQA 3LLTA 4BZNA 5EM6A 2Y4PA 5EM8A 1OBDA 5AV2A 3K3JA 5HQ0A 3A4PA 3CD3A 2WMXA 3FKNA 3H0ZA 2C3LA 4FV6A 3IONA 4O7SA 3CXWA 4P5ZA 3OEFX 5HCXA 3AQVA 5M44A 2NO3A 4LOPA 4A07A 4UXQA 3SV0A 1PXPA 2C1AA 4XOYA 5EI2A 3W8QA 4XG7A 3MI9A 1ZOGA 4EZ3A 5GJFA 3TZ9A 2X6DA 3OF0A 4NUSA 3BZ3A 4JBVA 4FL3A 4KBKA 3TNPC 1P2AA 2IPXA 2YJSA 3FKOA 3QF9A 3EFKA 4CT2A 1FVRA 2W96B 2UZNA 4IANA 4MNFA 4BTFA 4D1ZA 2OG8A 3PXRA 4DFYA 3ORIA 1Q8YA 4CKRA 2YCQA 2VTTA 5HIDA 2QOQA 4BICA 3FYJX 1VYZA 2BKZA 1PXMA 5KHXA 5DR9A 4L44A 2IO6A 5IUHA 4JBPA 5KKRC 3FI3A 4FOCA 4BCQA 2R3PA 5EHLA 1XR1A 5CI7A 3TNWA 4UMRA 2W1IA 4NU1A 4UMPA 5BX0A 2I7QA 3PXFA 2UZBA 1H1PA 1Q41A 3QQUA 2X4FA 4CG8A 4MK0A 3NUXA 4YLLA 3F3ZA 5H3QA 4ANLA 4FKLA 1KE9A 4X6RA 5HOAA 4RC4A 4OTGA 3FY0A 3QFVA 3VUHA 4Z7GA 4R78A 3F7WA 5EYMA 1PKGA 3NRMA 4D2TA 4L46A 4MBIA 2XUUA 4F4PA 1NT2A 4APPA 2RFEA 4U79A 3COMA 2CSNA 4CXAA 1GIIA 4QMOA 4WG5A 5FXSA 3DOGA 1F3MC 4JRVA 2J2IB 2HZNA 5GZ9A 4EOKA 5I9XA 1ZXEA 5HHWA 4OAVB 1OMWA 4FV5A 2YM8A 3KFAA 4H3QA 4KRDA 3IW8A 4DEDA 5DIAA 2UZWE 3AGLA 1ZOHA 4FX3A 3I0OA 1JPAA 4O38A 5J95A 1H08A 2BHHA 4BCJA 4CT1A 4EOOA 4ZS0A 3IPHA 2VTQA 2E9NA 5HESA 4BBMA 4O83A 4M8TA 5KUPA 4Y72A 3C4XA 5J9YA 1ZYJA 3FBVA 1TQPA 2C6KA 1M14A 4G9CA 3UIXA 5CANA 3LFBA 5BUJA 4WSYA 4I5HA 4W4WA 4L3JA 5JFVA 3SD0A 4E6QA 2QHNA 1B6CB 5DR2A 2PZ5A 1UNHA 2GHMA 2FSOX 4KIKB 3MFTA 4PTGA 4QMUA 4F0IA 4ASXA 2QCSA 3EQFA 2XB7A 3CE3A 3NIEA 3R7IA 3BE2A 4FVRA 3GB2A 4FSUA 4MH7A 3LIJA 2QLQA 3SC1A 3Q52A 3UG1A 4XMOA 1NVSA 3FMEA 4EI4A 5GZAA 5AAGA 5AUVA 2X8DA 3NYVA 5I4NA 4ITHA 3ZSIA 4EZ5A 3BYOA 5CYIA 4RA4A 3LFAA 3CGOA 2GPHA 4ZSJA 3AD5A 3TTJA 1PMNA 2QU5A 1J3HA 2XIZA 4FL2A 4O0WA 2R0UA 3HMNA 5HO7A 3RPVA 3I6WA 4EUTA 3RNYA 4FKIA 2PE0A 3FC1X 3KKVA 3M42A 3MVHA 4HVSA 4R5YA 1Z5MA 4IHPA 3DTWA 1NA7A 4RX9A 2ITWA 4WNOA 5BVEA 1JKKA 5IQHA 4I93A 2YABA 2A19B 3UNKA 5CT0A 1MP8A 3FAAA 4F9CA 2CMWA 1PW2A 3HYHA 4CYJA 1OL6A 4QP9A 4FTTA 4JAJA 4HCTA 3F69A 1PMEA 4C3PA 2F2CB 2OJJA 5I3RA 3HEGA 4GK3A 5HE0A 5HE1A 3DNEA 2O63A 1P5EA 3OCSA 4AS0A 3ORPA 3W2OA 5E8XA 4MXOA 4EH9A 2QD9A 5EI6A 4MXXA 2F7ZE 3KXMA 4A7CA 3TZMA 3CIKA 3Q2JA 4LGHA 3VS5A 1M7QA 1X8BA 1IAHA 3BU5A 3Q4ZA 4MWHA 3QC9A 1RW8A 3MFRA 3VRZA 4FTMA 4DFUA 2J0KA 3P7CA 3VC4A 3A7IA 2R5TA 3AG9A 3BE9A 3F6XA 1QPEA 4Q5EA 3OOGA 4QMVA 5CZHA 4C4HA 2XBJA 3M1SA 3U4WA 3FEGA 5EM7A 1Y6BA 5KMKA 2VTLA 2PHKA 4HGEA 5ETAA 3HMOA 2C5OA 2XH5A 3G2FA 3NNVA 4WKQA 2X6EA 1Q8ZA 4O81A 3AC4A 1H27A 2XK7A 4Z16A 3HVCA 4AQCA 5CLPA 3QCQA 4R1YA 3F82A 4JT3A 5KMJA 4USDA 5HE3A 5IA4A 3ET7A 3HV4A 4FTOA 4YJTA 3SGCA 4YZ9A 1GZKA 3R8VA 4OBOA 5JEBA 3P08A 4LL0A 3HMMA 3TN8A 2HYYA 3I5NA 4YJSA 2ITOA 2CNUA 2V7OA 3TV6A 5D9HA 2Q0BA 3BI6A 4NJ3A 3L8SA 4CCUA 5A6OA 4YTIA 3MIAA 5DEWA 5FDXA 4QPSA 4IAYA 3ZDIA 5IG1A 3UNJA 2JIUA 5L4QA 4QT1A 4GV1A 4BFMA 4M12A 2PK9A 5FXQA 5LVMA 3NSZA 4KSQA 2IVUA 2J50A 2BALA 4WNMA 3UYSA 3SOAA 4MD7E 1H07A 3GU5A 5ICPA 5JRQA 3DV3A 2QQ7A 2DYLA 3SA0A 4LV5A 4FKJA 3PZHA 3R9OA 2OZAA 2W9FB 2JDRA 3MFSA 4FIGA 4TYHB 3V5PA 2ONLA 3G90X 5K5NA 4MHAA 3RMFA 1OIQA 4BGQA 2KTYA 4G31A 5HNBA 3CP9A 1APME 3DKCA 1V1KA 3R0TA 2B54A 4RJ6A 3BQCA 1PXNA 1BMKA 5L2IA 3NCGA 3HRCA 3A2CA 5E8TA 2Z2WA 3GC0A 2CKEA 4PUZA 4QTEA 3QQFA 2G01A 3E64A 2VUWA 2E9PA 3R02A 3TJDA 3NNUA 4QQCA 4YUQA 4GG7A 4U7ZA 1ZAOA 5H8BA 3F5XA 4MD8E 4YHTA 3LHJA 4MX9A 4U45A 2VWUA 1VR2A 2GTMA 5I9VA 2J6MA 5EK7A 3W2PA 4QTBA 4KKGA 4G34A 4N6ZA 3OT3A 4FKOA 4AUAA 4KB8A 5E8UA 3FLQA 4Y83A 3H9OA 2VV9A 4R8QA 3QX2A 1ZARA 5E92A 4YC8A 2OH4A 3IW5A 5AFVA 4TNDA 1O9UA 3TUCA 4P7EA 2OU7A 3V51A 1KSWA 3VBVA 2WQEA 2YCFA 3MA3A 4RWIA 4KAOA 2WU6A 5CAOA 1M2RA 4FIJA 3UIBA 1WBNA 2PVHA 3AMBA 4YZCA 3ZLWA 4QYFA 2GCDA 2ITTA 4AOTA 2GFCA 3B8RA 3FJQE 3KULB 3PPJA 3W2RA 3WYYA 4CD0A 2IVSA 4XRLA 2I0HA 5G6VA 2HY81 4I20A 4HGLA 4ANOA 4F63A 1GJOA 4PL4A 4AG8A 4M84A 1FMKA 4JG6A 3HUCA 3Q53A 4DG0E 2BRHA 5DOSA 2GHGA 2WTDA 4JDIA 5AUXA 2HELA 5D12A 3TIYA 4TT7A 3FC2A 2BIKB 4PDOA 4OTWA 2R4BA 3QUDA 4FT7A 4WIHA 2PY3A 1WBTA 3JVRA 4GL9A 5AWMA 3TM0A 4QQTA 1PXOA 1Q24A 1U54B 2AUHA 3W1FA 4G5JA 4BTKA 2GNJA 4I6BA 1SM2A 1Q8TA 1YKRA 3QYWA 3RNIA 3N4VA 5J7BA 5BYYA 3LXLA 3Q9YA 5JH6A 3D9VA 1ATPE 1SYKA 2ZV9A 4YC3A 2GQRA 3QKKA 2WMAA 3Q32A 4G16A 4TN6A 2PYWA 4DF3A 3FZ1A 2VTSA 4IFCA 3WBLA 5KZ0A 4ZSAA 5IEVA 2WHBA 2F57A 2VX3A 4YJRA 1WBVA 2O65A 4FT3A 4KINA 4LFIA 3R73A 5EDPA 3NX8A 3OCTA 5ANIA 1P4OA 3OY3A 1RJBA 1WBPA 4X3FB 5BVDA 1NVRA 3P9JA 4G6LA 4RRVA 4BZOA 3OW3A 3U4UA 3ZUUA 4OT5A 3ENMA 4D4RA 3QQLA 3KREA 1J7IA 4JDJA 3LQ8A 4MAOA 5DGZA 2OIBA 3RAKA 4D0WA 4F9AA 4PTEA 4K18A 4BKYA 4JBOA 4BCPA 2XNPA 4NTSA 4R7IA 3ORTA 2VO7A 1MRYA 4D2WA 4IFGA 5HLNA 3PY1A 5AV3A 3CSVA 1YHWA 4J97A 5KO1A 3MGYA 1DAWA 4KRCA 4E6CA 4ZLYA 3N4TA 3PWYA 3JS2A 1JSVA 3FY2A 4FVQA 4IAAA 4OTQA 4FGBA 5CVFA 2QO7A 2HXQA 4BBFA 2O5KA 4K6ZA 3RAIA 3VBYA 1CMKE 3FMMA 3HL7A 4QPAA 1F0QA 4BCHA 2ZM4A 4HCVA 2RFDA 2WIPA 1HCLA 3CKXA 3UQGA 3VAPA 3PA4A 4RQKA 5KHWA 4RWLA 5K0XA 3VBXA 3ZZEA 4DC2A 3NNXA 4HW7A 4QMYA 4FIFA 3O2MA 5EKOA 3P7BA 4J71A 4XLIA 2BTRA 4KBCA 5AR8A 4JXFA 4YP8A 3VS6A 5GHVA 3R9NA 3LM5A 3GFEA 4U44A 3R01A 2IWIA 4V0GA 4Y85A 5ETIA 2PUPA 5IEYA 4NSTA 4EHZA 3UNZA 4IX5A 4IZ5A 3UBDA 4C62A 4YSMA 3LCDA 3EJ1A 3WZUA 4WO5A 3KVXA 4TTHB 3P7AA 3V5LA 3VS3A 4BHZA 3OZ6A 5CSWA 5CI6A 3CY3A 4ZTMA 2VTMA 4N4SA 3E3BX 2GS2A 3UMXA 4G3FA 5K3YA 4YPSA 1CKJA 3DY7A 4FV9A 2OJ9A 3B2TA 2UZTA 2CGUA 4C02A 4F7JA 2FA2A 2XK4A 2QC6A 2ZB0A 3GFWA 3ORMA 3QRIA 4TYGA 3D2KA 5HG9A 4PL5A 2UVZA 4DLJA 1AGWA 3FI8A 2WAJA 5M09A 3DBCA 3ZFYA 5HX6A 3U87A 3EZRA 3R7GA 3PIXA 1XHAA 3PTGA 4EKKA 4JL9A 2X7GA 4L9IA 3CPBA 4C37A 1QPCA 3TZ7A 3MV5A 4RIYB 4ANBA 4FE2A 2UW5A 5AX3A 3TNHA 3A99A 3DPKA 2XJ1A 3GP0A 3MSSA 4PMMA 5K4IA 3C51A 4FZAB 4YMJA 3FI2A 2RF9A 4LOQA 5D10A 1R78A 3R04A 4RFYA 1NVQA 2UW8A 3QC4A 4BDEA 3SG8A 5KMOA 1K3AA 3QTRA 5TKDA 3HAVA 4GK4A 4OUCA 2BPMA 1URCA 4CMUA 2JBPA 3QTUA 2ITNA 3LFNA 2HWOA 3GCSA 4AT3A 2OF2A 2R3KA 3R9HA 4ORKA 3KN5A 4E73A 4CKJA 2CLQA 2J5EA 3BIZA 4P4CA 5C4LA 4ZJJA 3NMUF 4F99A 5AUZA 4E4MA 1ZLTA 3QA0A 5KZIA 2VWVA 2XKCA 5AUWA 3EYHA 5AV0A 4BWKA 2X2KA 3KC3A 3QZFA 3LM0A 3KEXA 4E93A 2CNQA 4BGHA 1JKSA 2CDZA 3WF5A 3OBGA 1KE5A 4QTAA 1OPLA 4Z55A 4GU6A 1R39A 2I0YA 2GFSA 3QQJA 5B2MA 2P2HA 5ANKA 2VTPA 3MS9A 4P5QA 2A4LA 4GW8A 3F2RA 4EH3A 3WZKA 4DH3A 1AD5A 3LVPA 4FYNA 5A9UA 4G2FA 4G6OA 3EQRA 4Z7HA 4EH7A 2XK8A 2R3IA 1P4FA 1Z9XA 3ZLYA 4BCIA 4PPCA 4D9TA 1RE8A 2NPQA 3E7VA 3TDWA 4MBJA 2BAJA 2BFYA 4FA2A 4TPTA 2PVJA 2VTIA 4UXLA 1CM8A 2A0CX 3BEGA 3WYXA 5C26A 4FKSA 4AN9A 4W4XA 1MQBA 2XF0A 2VO0A 5IH6A 3PRIA 1FMOE 4FNWA 5AR5A 3A62A 4AU8A 3DDPA 4P2KA 5E8SA 1XH5A 2FYSA 3MFUA 1GIHA 4KIQA 1Q8WA 4ANQA 1OKYA 5AUYA 4BDAA 4U97A 4F7NA 2QODA 3AT3A 4V01A 3V8SA 1NW1A 3PJ1A 2OGVA 1Q3WA 4YJOA 3U6JA 4YPDA 3PJ8A 3DLSA 2YJRA 3NYNA 5HBEA 3LFCA 3KRXA 4O0TA 3ZU7A 3ODZX 5IQCA 3O50A 4W8EA 1UNGA 3NVKI 3AMAA 3FMDA 4U42A 3GBZA 3PXQA 4QP7A 5DG5A 4GFMA 1IASA 3VS4A 4BC6A 4G6NA 2XBAA 2YN8A 1WCCA 3FLYA 3KA0A 3QA8A 4W4YA 2VAGA 4BI2A 4E8AA 3ZFXA 4CFNA 2VTNA 3BYSA 4I6QA 4IB3A 4U81A 4IWOA 5HVYA 1DI9A 2I0VA 4C4GA 5LOHA 2EB2A 3PXZA 4RIXA 4RQVA 3A8WA 3QRTA 5IA0A 2WB8A 5EYKA 3NUSA 1UVRA 4IVBA 4JDKA 4RWKA 4C33A 4JR7A 3NW7A 4O7VA 2YIXA 4FSYA 3E7OA 1OZ1A 5D1JA 2YACA 5ANJA 3ZFMA 1Q8UA 2E9UA 3SXRA 3DT1A 3WILA 4R6VA 4E5BA 5EDQA 4CGAA 4TKSA 1OKZA 2YIYA 2HW7A 1ZZ2A 2I6LA 4H39A 4DITA 5K9IA 2R2PA 4WG4A 1GY3A 2UZLA 4F64A 3WZEA 5AM6A 4M3QA 2Y8OA 4O2ZA 3EQIA 1OUYA 5L8KA 3DZOA 4FKTA 5M4CA 3ULZA 3IDBA 4USFA 4RJ8A 4F7LA 3S3IA 3ZOSA 4O0UA 4O82A 2W1ZA 4E4NA 4XS2A 4CQGA 4LMUA 4DEAA 3R7UA 5C8MA 3EFLA 2J0JA 4A06A 4L8MA 4E26A 4QMTA 2Y9QA 3EQBA 3KRJA 2B4SB 4IWDA 2QO2A 5L3AA 1YI3A 2A2AA 5IQAA 3ZMMA 3DK3A 3AXWA 4NH1A 4RIWA 5C4KA 4XLVA 4XX9A 2PVLA 1J7LA 4CQEA 4FT0A 4NIFA 2E9VA 2Z60A 2XCKA 5EFQA 3KMWA 5J1VA 4PP9A 1U4DA 2SRCA 4EC8A 5BVOA 3DKOA 3QKLA 4GYIA 3M11A 4QTCA 5FTQA 5CXZA 3H9RA 4OTPA 4TXCA 4FEQA 3DAKA 4LG4A 1PXKA 2OI4X 3A8XA 2GNIA 3ZC6A 4WT6A 5FWKK 4XG2A 1Y91A 2YWVA 4RFMA 4PDYA 3RP9A 3COKA 2YAAA 2C4GA 3R1SA 4E6AA 4UWCA 1SNUA 4F9YA 3CC6A 3QZHA 5CU0A 5CAUA 3ZLXA 3OUKA 3FZTA 3SRVB 2X7OA 3VF9A 2WGJA 4F1TA 3ZO2A 2WMRA 3D7TB 3T9TA 4C2VA 3D7ZA 4R7BA 3HP5A 4XNEA 4D55A 3OWPA 3QX4A 2H96A 3LFEA 4J53A 1OITA 3OOMA 4I92A 4BL1A 4D2PA 4O0RA 4I1ZA 5HG7A 3OD6X 5CF8A 4FSTA 3KN6A 5AA8A 3B2WA 5DE2A 4AA4A 2CN8A 4NK9A 3ACKA 3UGCA 4MKCA 4EH4A 4YTFA 4FGRA 4I23A 4RSSA 2ERZE 4IEBA 4IX3A 4NM5A 4WBOA 4G3DA 3EIDA 1R1WA 4TNBA 5E8WA 4ZIMA 3RPSA 1KE6A 5DWRA 2FH9A 3EQDA 4GEOA 5JFXA 3ZEWA 5IQIA 4XCUA 4XBRA 2XJ0A 3ZSHA 3C4EA 4FSRA 4I21A 3EN4A 3QRUA 4AWIA 5EKNA 4HNIA 3EN5A 3ORXA 3CBLA 2UW4A 4D2RA 3PVGA 5BNJA 4BBEA 3S95A 4E7WA 4TL0A 2PVFA 4U9AA 4AE6A 2IZTA 2ITVA 3AC2A 2R64A 3PRFA 3DU8A 4GG5A 4QMPA 3R00A 3V8WA 2NRUA 4FTQA 1P14A 4C34A 2X81A 1DS5A 5A4CA 2OXXA 3NUPA 4CTBA 4GT3A 3CGFA 3BU3A 4WA9A 3NUUA 2R3RA 3ANRA 4LUDA 5BYLA 1OIRA 4C57A 5HICA 3MESA 2WKMA 5AR7A 3VS0A 4A9YA 3NGAA 2JEDA 3GUBA 3H9FA 3ATTA 1XJDA 3DQXA 4X2JA 2ZDTA 3DCVA 1DI8A 4FT9A 5B0XA 3QL8A 1O6YA 3RALA 1G8SA 2J0MB 1IEPA 3TJCA 2W7XA 4JDHA 3IW4A 4JR3A 4Q9ZA 1LPUA 4ACMA 3BYMA 4CFMA 5IH5A 3MPMA 3QAME 2C0OA 3AOXA 2H8HA 3UDBA 3MTLA 3F7ZA 4CFVA 4EH2A 4CV9A 4FEVA 2X8EA 4HZSA 5AAEA 3W33A 2XNEA 3MH3A 4FG8A 5DRDA 3F5PA 4NM0A 4RA5A 4FC0A 3G9NA 5JZJA 4J96A 5AP1A 4NKAA 1JSUA 3KXGA 4RPVA 1GZNA 2OXYA 1CTPE 2EUFB 4RIOA 3VS7A 2GNFA 4HZRA 3C4ZA 2B9FA 1ZY4A 2IW9A 3CPCA 3KK9A 4OGRA 3C5IA 4IC7A 1ZYLA 1V0BA 2WQNA 3O51A 3BCEA 4MXYA 4QMMA 3OVVA 2VGPA 3TNIA 1Q5KA 4UX9A 3FSFA 3TKUA 4ANNA 3OUNB 2YLFA 2O3PA 4IADA 4XP2A 2PZPA 4PNIA 3R8PA 1XQZA 2Y4IB 5H9BA 2CGWA 4KKEA 2UW3A 3IK3A 1BL6A 4KWPA 4TWCA 3ZZWA 1B39A 4KD1A 3UOLA 3IO7A 3KXNA 1J1CA 2B53A 4LQMA 4DH1A 3KMUA 5DBXA 4BF2A 3IW6A 3PJCA 4ZS4A 4NM3A 2JKQA 5CSVA 5IEXA 3H0YA 4C4FA 2OXDA 4HOKA 1ZYSA 4L52A 3BEAA 4ZEGA 2YHVA 1H8FA 2C3KA 2BMCA 5E8YA 1YQJA 4B9DA 5KMMA 1W82A 1Q99A 3E8DA 4J7BA 4ZY6A 1NY3A 2F4JA 4AGCA 5LVLA 4OT6A 2W4JA 1UWJA 2BILB 2OIQA 4GMYA 1XWSA 4QQ5A 4ALVA 4H3BA 1OBGA 4D0XA 4ZSGA 3Q9ZA 2UW0A 3NDMA 4M13A 5DFPA 3KB7A 5M08A 3NYOA 5DPVA 5M06A 4S34A 3F9NA 5CU4A 5CALA 5FDPA 3EN7A 4BYIA 1OI9A 5F1ZA 4FF8A 4I94A 2JIVA 4OBPA 3BGQA 5CF6A 3O96A 4UYAA 4FKRA 2F49A 3OY1A 5E7RA 5DLSA 5BVFA 5FEQA 4OTRA 2P2IA 1RDQE 5ACKA 3BWFA 3OHTA 4ENYA 4F6UA 1PMVA 3NR9A 4QP2A 3V5WA 3SKCA 4MVFA 4NM7A 4RC3A 5HCYA 5TOZA 1UU9A 2ZB1A 4ACCA 4E20A 4BY9E 1OPKA 3CTHA 4DFZE 4YZMA 2YA9A 5FD2A 4AP7A 1PXLA 2XNBA 4YLJA 2BKKA 2X7FA 4JNWA 1WMKA 3CD8A 3KXXA 3PSBA 5JGBA 3EQGA 4EEVA 2Z7SA 4EK3A 2PU8A 4F70A 3R8UA 3CJFA 1SVGA 3ORZA 5A6NA 2YDJA 3JYAA 3ID6C 1LEZA 2IN6A 2P33A 3UQFA 5JN2A 1UU3A 2EWAA 3FZOA 3SX9A 2OF4A 3ENHA 4FTUA 4MQ2A 3EQPA 5HNGA 4QOXA 3DBQA 3UO5A 5ANEA 2X2LA 3HECA 3TT0A 2ZV2A 4C61A 4C4EA 3UZRA 3DFCB 4JI9A 4LRMA 4YO6A 3A60A 1WVXA 2QOFA 3N9XA 3M2WA 1YVJA 4GVJA 1A06A 2BR1A 2A27A 4KSPA 3NWWA 3EHAA 4X3FC 4ZTSA 4NKSA 1SVEA 5CEPA 3U9CA 1XO2B 2VNWA 3AMYA 2RG5A 3OMVA 3G5DA 5F4NA 1U59A 3Q6UA 3FXWA 2YDKA 3ZTXA 4FV4A 2Z02A 3AC1A 4RX5A 1WVWA 3KRWA 1W98A 5IQGA 1YW2A 2AC3A 1ZRZA 2G2FA 3LFSA 3KMMA 3P5KA 2BROA 4G17A 4HPUE 4O27B 4DFLA 3PP1A 1B38A 2R0IA 4ZXTA 4UALA 5F20A 4PMTA 2P3GX 5FTGA 1XH9A 5I0BA 1GZ8A 1VJYA 2G15A 2RFNA 1GZOA 4QYHA 2C5VA 2YERA 3COHA 4FKGA 4D9UA 1YOMA 1OL2A 2QR7A 2RG6A 3LE6A 3QQKA 4ZZMA 4YJPA 3TI1A 5AP7A 3UP2A 3W16A 4OTFA 3PY0A 3SW4A 3QLFA 3DXQA 4PDSA 2VTJA 4IB5A 2O2UA 5CQUA 4MWIA 4S30A 4WRSA 4HPTE 1I44A 4M69A 2J9MA 3W2SA 2GQSA 3R9RA 4BWPA 2VX1A 3MY0A 1IR3A 2CLXA 2IJMA 4O1PA 2QU6A 5AV4A 5I9WA 2HIWA 5DVRA 4J98A 3VF8A 4BCOA 4PWNA 3E8EA 3FZRA 2HZ4A 4FV8A 1R0PA 5JT2A 2IG7A 4XP3A 3QWKA 4TWNA 3PY3A 2FGIA 2VTOA 4XRJA 3MYGA 4BHNA 3RK7A 2HK5A 5L2QA 4I0SA 1REKA 1URWA 2PTKA 3QXPA 3SXFA 2ACXA 4LV8A 3ZO4A 4O91A 4DH5A 3ZM9A 5GZ8A 2IZSA 5JKGA 4H1MA 3S00A 2W4KA 3NW5A 2Y6OA 3R6XA 2JITA 2C69A 2XK6A 1MRVA 3P86A 2Z8CA 4GK2A 3QD3A 4ACDA 1PY5A 3GU7A 2VWBA 4O86A 4I6FA 1V0OA 5K0KA 5C1QB 5L8JA 3K54A 1Y57A 1JKLA 2VWIA 4WD5A 4CMOA 5KMIA 5EI8A 1YDTE 3Q4UA 3QBNA 5CF4A 4DYMA 3BGPA 3E5AA 2RGPA 4C7TA 4I0TA 2C6IA 4IDVA 1YHVA 4U40A 2VWYA 3C4WA 4CEGA 4IE9A 3CQWA 2I0EA 4H1JA 4RJ5A 4BI0A 3UIMA 2CN5A 2QLUA 5AR2A 2Q0NA 2Z7QA 4FTIA 2F2UA 1R0EA 5HBHA 2GHLA 2XYUA 5B2KA 1YXUA 3W2CA 1IA8A 4LMNA 5JFWA 3KCKA 3KF7A 3RK9A 4G1WA 3MH1A 2P0CA 1HOWA 2UUEA 3N51A 4S33A 4YGAA 3BLHA 3R63A 2O0UA 4M0YA 4ZSLA 1OPJA 4IZAA 4O22A 5E8ZA 4HYSA 2R9SA 2BIYA 3OXIA 5KE0A 5CXHA 3UPXA 2XP2A 4FV0A 2G9XA 4BDCA 4DFXE 3P79A 4I4FA 2PMNX 3R28A 3QKMA 5CENA 5HU3A 4YTHA 2H6DA 1XH8A 3ZDUA 4CV8A 4D2SA 3SG9A 2JKKA 2ZM1A 3HP2A 5JK3A 4I5MA 4I6HA 4IX6A 3ZUTA 4EOLA 2R7BA 3O17A 4DA5A 5H8EA 4ZP5A 4F0GA 4RGJA 4FZ7A 3MBLA 5FM3A 5AP0A 4CTCA 1IAJA 2R3GA 2BRNA 3CR0A 3HMPA 1E1XA 3IGOA 3Q60A 4TYJA 4BR3A 4MCVA 3UE4A 4BIEA 4RBLA 2XIYA 3ZRMA 5AM7A 3V5TA 1YXVA 4JVGA 4O84A 3FQHA 1RQQA 4PQNA 5HNIX 3VW6A 4DG3E 4U41A 3Q6WA 5M53A 1MUOA 2UVYA 3VBTA 4UWYA 4RFZA 3G15A 4BGGA 3F2NA 4JAIA 4EQUA 4AFEA 3CJGA 4AOIA 2O64A 1BKXA 3NVMB 5IPJA 2R3NA 3OCBA 3RK5A 4EH6A 1YI6A 4EOJA 2VD5A 3C4CA 2XRUA 4O0XA 1H1RA 5LMAA 2B9HA 3RM7A 1JLUE 4BCMA 4UN0C 3RKBA 3I6UA 4S32A 4D58A 1PRYA 3KXZA 5D41A 5CZIA 2X39A 3RINA 3KK8A 5FQDC 2ZV8A 4EBVA 4K77A 4NFMA 5GIPE 1DM2A 2YM7A 1JVPP 3SQQA 4MD9E 4NWMA 3R7OA 3QCXA 3DB6A 3Q9XA 3REPA 5E4HA 2LGCA 4IJ9A 3ZYAA 3WF8A 1ND4A 4MNEA 4K9YA 4R5SA 4C35A 4L7FA 4D4SA 4OTHA 5M4FA 4TW9A 4XJ0A 5IH4A 1IA9A 4XEYA 3U8WA 5GIOE 2ITZA 3ALNA 2V0DA 5HVJA 3VJOA 2GU8A 3FL5A 4BCGA 2AC5A 3Q3BA 4PX6A 2OZAB 4ANSA 4DTKA 2B0QA 3UIUA 1YOLA 3MB7A 4Q9SA 4FV1A 3E62A 3MJ2A 1H0WA 4Y5QA 2O8YA 4KNBA 3QTXA 2JDTA 5AR4A 5J79A 3S2PA 5KBQA 1SZMA 1QL6A 3JY9A 4ONAA 2YIRA 4PPAA 4EJNA 5LCJA 4GIHA 1WBWA 2C68A 3F5GA 4KKHA 3VQHA 5L6WL 4DHFA 3FE3A 3QRKA 1Y6AA 4FG9A 3IECA 4ZJIA 4HVDA 5JGDA 3TZ8A 2XRWA 2FSTX 4KS7A 5M4IA 4J95A 4ZY4A 3CLYA 5GJGA 4UY9A 3MB6A 3QUEA 4L43A 2GSFA 4YLKA 4BDJA 5A4TA 4CFWA 2G1TA 1YDSE 1QPJA 4KS8A 2QG7A 4F9WA 1LEWA 4IX4A 2ZDUA 3BYVA 3DK6A 3VW8A 3FLSA 4O0YA 4XOZA 3LFDA 4GYGA 4FSQA 3TXOA 5JZNA 1MQ4A 3JXWA 3NZ0A 4RVLA 4XG4A 4QMSA 3GCPA 3IGGA 4QMQA 2G2HA 3L8PA 5AP4A 2C6OA 5HG5A 5A54A 4U0IA 2KULA 3PP0A 3PJ2A 4UEUA 5CAQA 2PVKA 5KMNA 4NFNA 2PWLA 3TCPA 2PMLX 5HIEA 4APCA 1M17A 3DLZA 3R1QA 4IZ7A 3TUBA 1UV5A 5A46A 4ZTRA 3UOJA 4GKHA 4XV1A 3BRBA 2R3OA 3KRRA 4ZTLA 3UG2A 4O7YA 1PF8A 4EYMA 4G3CA 2C1BA 4RJ7A 3V04A 5L2TA 3QD0A 5EW3A 3QALE 4YJUA 1FPUA 2OW3A 3EKNA 3GEQA 4M0ZA 4XYFA 1L8TA 2OZOA 5EG3A 2ZVAA 4QYGA 2VO6A 2VZ6A 4FIIA 5HO6A 3O8PA 1SNXA 4IMYA 2GS6A 3R30A 3RVGA 4XP0A 4CLJA 2CJMA 2QNJA 5HORA 3MVLA 4FIEA 4C58A 2OFUA 4LL5A 2BAKA 1FINA 2W1CA 5E90A 5ETCA 3KCFA 3K2LA 3NNWA 1FQ1B 3E88A 3BU6A 5IA5A 5M51A 3OP5A 5DT0A 3DAEA 5FM2A 3MY1A 4BDBA 3DS6A 4G3EA 4FTLA 1M2QA 3FV8A 4DG2E 3ELJA 2J4ZA 2XNMA 3FMHA 2W0JA 3C0GA 3D14A 4OW8A 4YHFA 3RHKA 2ZV7A 3NUYA 3ORKA 4GT5A 4L3PA 5EM5A 5IISA 3WOWA 4B8LA 4QO9A 4W9XA 2QOCA 3DNDA 2QURA 2VWWA 4L01A 3R7VA 3BBTB 4B99A 5HTBA 3V6SA 3UQCA 4KUJA 2XKDA 4KIOA 3HX4A 3LJ2A 3TKHA 2J90A 5CAPA 2V5QA 5DEYA 2CNVA 2PUNA 3DK7A 1Q3DA 2C6LA 5BYZA 5EQEA 4YR8A 1H0VA 2PL0A 1UKIA 4DGOA 3PZEA 2JDOA 4ZY5A 5JSMA 3R7EA 5LVOA 2YCSA 3HUBA 3U54A 2W5AA 3GC8A 4BCFA 3LLAA 2X8IA 2OICA 3PUPA 4YJQA 5TE0A 1SVHA 3W32A 4AT5A 4ZAUA 3HLLA 2DWBA 4H3PA 3F3VA 4YJNA 1JQHA 3FZSA 4HNFA 2YWPA 4AN2A 4BCKA 4BTJA 5M4UA 4I4EA 5LCKA 4OAUC 2NNWB 2J7TA 4FTCA 4QYEA 1PKDA 2HZ0A 4P90A 4DINA 3D5UA 3GQLA 4GIIA 2R3JA 5C9CA 3F3TA 4U43A 3PPZA 5K5XA 5HVKA 2C5XA 4K33A 3ETAA 2C47A 2QG5A 3BLQA 1XBCA 3L9NA 3OWJA 3VHKA 4FV3A 3AGMA 4AW0A 4BVUA 3BHVA 1A48A 3ZRKA 4O6EA 4DGGA 3R8LA 3V5QA 2VX0A 3PVUA 4V0GB 5ANDA 1WZYA 1JKTA 3UODA 2FB8A 4BDGA 2FUMA 3PE2A 5C03A 4DGNA 3DBDA 1PXIA 1TKIA 3EWHA 4TYEA 3VIDA 4DT9A 4DTAA 4QMXA 4Y73A 4X3JA 3BGZA 4X2KA 3R2YA 3VS2A 3OT8A 3ZLSA 4AT4A 3I0QA 4I22A 4IAZA 3OTUA 2XEYA 4EK8A 3DA6A 1JSTA 3PSCA 4CLIA 3QYZA 3O7LB 4FSMA 4EWHA 4AZVA 2RKUA 2YAKA 2W5HA 4ZMFA 4NJDA 3KU2A 3ZBFA 3D5VA 3QU0A 3UO6A 4EBWA 5J9LA 2QHMA 4WG3A 4WNPA 3IDPA 1GIJA 2PZIA 3QD2B 2Y4IC 2PSQA 4TWPA 4AX8A 2NP8A 2Y7JA 4NEUA 3LCKA 5DT4A 3PVBA 5IMEA 3C1XA 2PE2A 4ZMEA 4UMTA 3GNIB 4E5WA 5IZFA 2GQGA 1EH4A 4FNYA 5F94A 4RX8A 4AZTA 4Z3VA 4CRLA 2XEZA 3GI3A 3MTFA 4FKVA 2VTRA 3ROYA 5CAVA 1FOTA 4W8DA 3A61A 2W1FA 3GT8A 4JX3A 5LJJA 5IQBA 1K2PA 2PVRA 3QQHA 4GU9A 4EWQA 5B7VA 3FWQA 1GOLA 2BAQA 3MW1A 1KE7A 4UWBA 2ZYBA 1TQIA 2XIKA 4J52A 1E1VA 2WEIA 2CKOA 3PE1A 2FVDA 2R3HA 4JLCA 3WIKA 4FYOA 1Q4LA 3SHEA 2W17A 2XKFA 2XNNA 3IS5A 1KWPA 2WMUA 4UBAA 4J1RA 5I3OA 2WIHA 3QTSA 5CU2A 2ERKA 5IU2A 4FT5A 3VVHA 3UPZA 2WU7A 4DH7A 4IAIA 2VWXA 3F61A 4PV0A 2WTVA 3U9NA 5KNJA 3O0GA 1W8CA 5GJDA 4MBLA 4A4OA 5JQ5A 3R1YA 3DZQA 4O7TA 4ZSEA 4GVAA 3FMKA 4AN3A 1CKPA 1H24A 3RZBA 4O7RA 4BZDA 2OBJA 1YRPA 3NLBA 5CEOA 4FG7A 4F6SA 4JBQA 5D11A 4D1SA 1A9UA 1OKVA 4GFGA 1T45A 2RSVA 3NCZA 4UV0A 4IIRA 5J9ZA 5CEMA 4KBAA 3BLRA 5EW9A 3LPBA 3VO3A 4FODA 4GT4A 3K5UA 4BI1A 4UYNA 4CZTA 2C5NA 1LR4A 2X9FA 4WRGA 5AAFA 3HV6A 4EOPA 3A7FA 5EH0A 3EN9A 2C6EA 2XZSA 2B7AA 2WQMA 5J8IA 3W18A 3K5VA 2JAMA 5E1EA 5KX8A 1JOWB 4EUUA 3PXKA 3LQ5A 3G9LX 1H4LA 4WBBB 2WTWA 4K8AA 3UTOA 5FP6A 3UOHA 3F3WA 3OC1A 4XV9A 2ITXA 5KBRA 4AXAA 4XG9A 4RLKA 5BVNA 4FZ6A 3ZXZA 3FMNA 2J0IA 3LXKA 3LCSA 4J8NA 3UC3A 3ZM4A 2VWZA 3BELA 3PG3A 4DEIA 4IWPA 4RMZA 2DQ7X 3C9WA 2UZUE 3PA5A 4I5CA 3UZTA 2UZDA 4DEHA 2AYPA 3Q5ZA 4ASZA 3MWUA 1WAKA 4ZTHA 4QMNA 3G51A 4K0YA 4L3LA 3O23A 4V04A 1Y8GA 5AR3A 4K2RA 3RAWA 4M97A 5C8KA 4ZOGA 4WSQA 4HVGA 3ZC5A 2EXCX 4NYEA 4IDTA 1BI8A 4XG6A 3WF6A 1YXSA 2CGVA 4FTRA 4KIKA 4RIXB 4FEUA 2YIQA 5IQFA 4GS6A 4C2WA 2PE1A 1UU8A 3OFMA 2Z7LA 2WPAA 3UO4A 4CFUA 5AADA 5K4JA 2YLEA 4XG3A 1LUFA 4EOSA 5CS6A 3OWLA 1YWVA 3ANQA 2LAVA 4NCTA 4CG9A 2GS7A 3FKLA 2CCHA 1YI4A 2UZOA 3SOCA 2ITUA 5L2SA 4JRNA 1XH6A 4H05A 1PMUA 4CKIA 3TWJA 5J7HA 2A1AB 4L6QA 4AGUA 1QPDA 3KF4A 4QMLA 3ZO3A 3BHYA 2W9ZB 1FVTA 4MF0A 3BYUA 2XM9A 3II5A 4JQ8A 3TDVA 3F3UA 4XV3A 3A4OX 2W1DA 4K1BA 4R3PA 4FSWA 3MH0A 3WF7A 4O7NA 3TIZA 1T46A 4DLIA 3L8VA 5ITAA 3T3VA 4EONA 2JFMA 2RIOA 3FPQA 1KOAA 3R22A 4FTAA 2XVDA 3PDTA 4V05A 4LM5A 4AACA 1TVOA 2YEXA 4RIWB 4B8MA 4Q5HA 5LMKA 4E6DA 5LQFA 4O6LA 3EH9A 2XMYA 3WARA 4NIFB 2ZM3A 2OSCA 1M52A 4X0MA 3O7LD 3D5WA 4YJVA 1YDRE 1U46A 3H3CA 4O21A 1XBAA 3LOKA 2E9OA 3RWPA 1UKHA 5IA3A 3Q4TA 2QOOA 4WNKA 2JD5A 2W99B 3Q4CA 3W8LA 3VBWA 4HCUA 4AF3A 4BIDA 3KL8A 4EOIA 4ENXA 4NL0A 5AP2A 2Z7RA 3FLNC 3P0MA 5IQEA 2PZYA 1LP4A 1W84A 2J5FA 4DEGA 4EK5A 2C0TA 5FBOA 3HAMA 2ITYA 3PYYA 5EYCA 3EOCA 4FTNA 4G3GA 1BYGA 3NYXA 3ACJA 5HEZA 3C0IA 5HD7A 1M7NA 4HYIA 2JKMA 3O8UA 4XV2A 4H36A 3ULIA 3UP7A 3UJGA 4EHGA 3S0OA 3LQ3A 4J99A 2REIA 3CKWA 4IVCA 4B0GA 4L67A 2V22A 1XH7A 3BV2A 2WMWA 3E63A 2IW8A 5F95A 2C0IA 4GSBA 2QOLA 4FEWA 1Q97A 1H28A 5HCZA 3LKMA 2HAKA 3PWDA 5CVHA 4UZDA 3BWJA 4QP1A 5DT3A 5JRSA 3R7YA 4AGDA 4EQCA 1V0PA 4L68A 5I9ZA 4RZWA 1KUTA 5TO8A 3V01A 3W10A 4FNXA 3OXTA 4QP6A 1TQMA 1FVVA 5EOLA 5FEDA 5HBJA 2YZLA 2BCJA 2J0LA 4QQJA 1FGKA 2BRBA 1UNLA 4E4LA 3QHWA 4ZTNA 2OJIA 3AT2A 4AW2A 3HKOA 2P4IA 3NAXA 2BZJA 4IW0A 4N0SA 2R3FA 2OJFE 5TF9A 3WIGA 4C4JA 1J7UA 4BDDA 2ETMA 3PG1A 1XKKA 4DBNA 3TUDA 2BRGA 2W05A 3HDMA 5AUUA 3SLSA 4ZZOA 5LARA 2UVXA 4R3CA 4YHJA 4RVMA 2OFVA 3ZUVA 4TYHA 4EORA 3THBA 3P1AA 4GH2A 3VJNA 2HY0A 1JBPE 5DI1A 4JQEA 3VHEA 3MVJA 3MY5A 4RT7A 3G0FA 5M56A 3NPCA 4IZYA 5IKWA 2QONA 4DFBA 5E1SA 2I40A 4IB0A 4GUEA 3UMWA 3T3UA 2BFXA 3D15A 5CQWA 5CWZA 2HXLA 3RWQA 5LWNA 3UVQA 2PMIA 3CCNA 4BDFA 3H30A 2IVTA 3HGKA 2GNHA 3W2QA 3OWKA 3GCUA 1L3RE 2G2IA 5HKMA 4QNAA 4XBUA 2WELA 1FBNA 1UWHA 3JR1A 3EYGA 4RZVA 1KV2A 2BZHB 2WTJA 4M66A 4IAFA 4QPMA 5KCVA 3FPMA 3IG7A 3CQUA 3JY0A 5AX9A 4ZK5A 5CU3A 5ANOA 5F9EA 4IBMA 4M15A 3QCSA 1KE8A 2IW6A 3G33A 1JNKA 4YTCA 3GC7A 3ORLA 5ETFA 3HMIA 3DBEA 4D2VA 4X2FA 4XUFA 2BVAA 4AW5A 2BHEA 4AA0A 1VZOA 3KVWA 2EXMA 5CEKA 3TTIA 3LMIA 4CFXA 3FDNA 4F09A 4O96A 3U55A 4DCEA 4D1XA 4TWOA 5CX9A 5HD4A 3KULA 2B1PA 4QD6A 3OS3A 2PUIA 1PJKA 2ONLC 3P23A 1OGUA 3GCVA 1YOJA 2VRXA 4GJ3A 3I7BA 3QLGA 5BMMA 4LGDA 5C8NA 4RJ3A 1KV1A 3DKGA 1ZMVA 5H2UA 5CEQA 2F7XE 4RVTA 5J5SA 3LZBA 1GNGA 3POOA 5D7VA 3MN3A 4YZDA 2ITPA 4Y5HA 3DXPA 3VQUA 1YHSA 4L7SA 5HGIA 2R3QA 4YZNA 2W06A 1NXKA 4IACA 3QHRA 4CVAA 3FLWA 2WNTA 2BTSA 1U54A 2QOHA 4GFOA 5EOBA 3FXZA 4EH8A 3IOPA 4A9SA 2X9EA 4YNEA 3N4UA 5FP5A 3GC9A 4D4YA 3FL4A 3OG7A 2IVVA 3T8OA 1ZYCA 4C0TA 4N57A 2ETKA 5BQ0A 3W55A 4GCJA 3QWJA 5FGKA 4PMSA 4BDKA 1QMZA 2ZAZA
chains in the Genus database with same CATH superfamily
4PTCA 2V62A 4NW5A 4X3FA 5FEEA 3IKAA 3I7CA 2X1NA 5IMXA 5A14A 3TEIA 4HGSA 4AZEA 3TKIA 5BUEA 3AT4A 3GU4A 3IDCA 2B52A 2ITQA 4G9RA 2V7AA 3QRJA 3LJ1A 4JS8A 2C3JA 2WMBA 4AOJA 1VYWA 3BKBA 1G5SA 4RG0A 4BKZA 5CSPA 1R3CA 4USEA 3U6IA 3V5JA 4X7QA 3LJ0A 1ZY5A 4O7ZA 4DH8A 4Q2AA 4FK3A 3VUMA 2ETRA 3R1NA 3NAYA 2BRMA 3EZVA 4W4VA 4F1MA 5KKRB 3PIZA 1ZWSA 2JFLA 3QZGA 2C6DA 4U3YA 4BDHA 3PIYA 2Y6MA 3VWAA 3R8MA 4DBXA 5DRBA 3EL7A 3R2BA 2ZJWA 2WOUA 5E9EA 4J8MA 2XA4A 4LV7A 4BCNA 4FEXA 3NUNA 3UVPA 2HWPA 3A7GA 3E87A 3QUPA 2OIDA 5EW8A 4DTBA 1Z57A 2XIRA 3MH2A 2FO0A 5CNNA 3RGFA 5CNOA 4ACHA 1JWHA 1WVYA 2WFYA 5JQ8A 4FZFB 2W1HA 5DHJA 1XMMA 1I09A 1W2CA 3VRYA 3C7QA 1PXJA 4BRXA 1ZMWA 4HVIA 2XS0A 2WMSA 3D0EA 4RWJA 4AA5A 1G3NA 2WTKC 5DN3A 3EFJA 4RJ4A 3UC4A 2WXVA 3ORNA 4EYJA 2PULA 5BVWA 4ASEA 1MRUA 3EB0A 4JOAA 4C8BA 4IQ6A 4CZYB 4EOMA 3DQWA 2JKOA 4FSZA 5AV1A 3AC3A 2BZIB 2GDOA 4QTDA 3MA6A 4LYNA 5IDPA 4UB7A 3VS1A 4QDVA 3IQ7A 3NS9A 4FK6A 2HENA 5CTPA 5CSHA 2X2MA 3QTZA 5L6PA 2FSLX 5EYDA 2QOIA 5HLWA 4IVDA 4O0SA 4DT8A 3D94A 1HCKA 3GXLA 4FKWA 4D5HA 2PUUA 2XK9A 3PFQA 4E3CA 5EQPA 2C6MA 3AC8A 2JAVA 3OBJA 2GTNA 3T9IA 3KY2A 4AZFA 3ALOA 2VTHA 3VUTA 5IDNA 3UZPA 4HYHA 3FHIA 3SXSA 2YITA 3ZHPC 4L45A 4ANMA 3BPRA 4RX7A 5BMSA 3G0EA 3TNQB 3U51A 4FZDB 4EQMA 3RCJA 4IVAA 4KIPA 1BUHA 1CSNA 4OTIA 4FUYA 2PVNA 2WOTA 4EOQA 3ZO1A 2IEWA 1UU7A 3CS9A 3D83A 3MIYA 4M69B 4RIYA 4C38A 4AZWA 4FMQA 3HV3A 5IQDA 2W5BA 3HZTA 3DDQA 3JPVA 3PSDA 2CKPA 2R7IA 4FI1A 4FL1A 5JFSA 4NTTA 4R3RA 4BDIA 2QR8A 3V3VA 5FBNC 5AUTA 3G6GA 4C3RA 1FGIA 4O2PA 1ERKA 3GU6A 3MDYA 3QGWA 2XIXA 4CZUA 3GQIA 5T3QA 4D28A 2PPQA 3E8NA 3P4KA 4L53A 5E91A 3WZJA 2JGZA 3QTQA 4FUXA 2DS1A 3D5XA 3DJ7A 4BB4A 2X0PA 4D4VA 3C4FA 5C01A 4C4IA 4E4XA 3NFFB 2VTAA 1S9JA 4G5PA 5AIRA 5A4QA 1H1SA 1SMHA 1Q61A 4PPBA 2CKQA 3R83A 1OIUA 1OL1A 4FV7A 1OIYA 5HIBA 5B2LA 2OLCA 2CHLA 3ERKA 3U6HA 2YCRA 3ZONA 3Q04A 3Q5IA 3VUKA 3G6HA 4KA3A 4IM0A 4YNOA 1DAYA 2UW7A 5CF5A 4YURA 3MJ1A 3FI4A 3HRBA 4A9UA 3GGFA 3HV5A 3VBQA 4TYIA 4EK4A 2QOBA 2CPKE 3SW7A 5AA9A 4EH5A 4DAWA 3B8QA 4RLLA 3QXOA 3DJ6A 3EQHA 4HJOA 1STCE 3A7JA 4U6RA 5H8GA 3TL8A 4I0RA 3Q96A 5M55A 4NW6A 4EK6A 4JIAA 4O7LA 3EMGA 3HDNA 2WZJA 4QP4A 3WE4A 5AEPA 3NUAA 2JDVA 4HVHA 3AKLA 3QZIA 2C3IB 4WOVA 1U5RA 3RPOA 2YZAA 1OKWA 3TV4A 3ZEPA 2X4ZA 4RVKA 3O71A 4FOBA 3FZPA 3LFQA 3I1AA 2UZVA 4OLIA 2F9GA 5L6OA 1O6LA 4IAKA 2E2BA 1BL7A 3D2IA 4NT4A 2WTCA 3DTCA 1H00A 1K9AA 1UA2A 1O6KA 3JVSA 4N70A 3VNTA 3TG1A 3LAUA 3NIZA 4RC2A 3LMHA 4F9BA 5JGAA 4O7WA 5HLPA 2P55A 3ITZA 3BV3A 1YXTA 3UDTA 3AC5A 4OBQA 3V8TA 2F7EE 4ARKA 2XJ2A 3HRFA 1WBOA 4ZZNA 5A4EA 5HX8A 3P78A 4M68A 2QI8A 3GU8A 3KGAA 4I5PA 2WMVA 2HW6A 4U3ZA 3P5JC 1IG1A 1XH4A 4MTAA 5FRIA 4FV2A 2ZMCA 4YBJA 2JLDA 4B6LA 1W83A 2PVYA 4ZTQA 5G1XA 1CKIA 2HZIA 3GVUA 3UYTA 4PP7A 4KABA 3O8TA 4F1OA 5KMLA 2X0QA 5TT7A 3UVRA 4EJ7A 3FHRA 4X2GA 4BIBA 2C6TA 2WMTA 5HU9A 4QNYA 2YM5A 3RAHA 4R77A 4ID7A 3C0HA 3PJ3A 3L9LA 4IB1A 4K11A 4HYUA 4LGGA 1XBBA 3QD4A 1BI7A 3FUPA 4M7IA 5DH3A 5GNKA 4A4XA 5HTIA 4HGTA 4PDPA 4AGWA 2OO8X 2VGOA 4BTMA 1G8AA 2Q83A 3R21A 5FUTA 3AD6A 3MPTA 4UMUA 4Z9LA 5AP5A 4DCAA 4OR5A 3RZFA 4JX7A 4F65A 1PYXA 4PL3A 5I9UA 3ZH8A 3S1HA 1ZZLA 4JG8A 2WTKB 3COIA 4WHZA 5CASA 3QQGA 3GCQA 2EU9A 5AMNA 5DYJA 4UMQA 3QGYA 4EC9A 3SAYA 5T6KA 5IA2A 5T68A 2QO9A 2PVMA 4CNHA 3FQEA 4II5A 2J51A 4I24A 3NEWA 4MNEB 4Y8DA 4ACGA 2VU3A 3FMLA 4IH8A 3FYKX 4TY1A 1PYEA 3QCYA 4PNKA 2IZUA 3I5ZA 3RHXA 4U8ZA 1OB3A 2JDSA 3RJCA 5HO8A 4DFNA 4ZLZA 2PZRA 2UW9A 4F7SA 1Y8YA 2WD1A 4BWXA 5CEIA 1W7HA 4I41A 3UOKA 4NZWB 4Y46A 5AJQA 4CYIA 2XM8A 3EKKA 1H1WA 1WFCA 3LCTA 4IJPA 4TZRA 1KOBA 5CVGA 2B55A 4FICA 4CMTA 5LWMA 4QEBA 4U5JA 3I81A 4LUEA 3V6RA 2V55A 3KRLA 3C13A 1VEBA 5HZNA 2BDWA 4S31A 5HE2A 3F88A 4JIKA 2XCHA 3C50A 2HCKA 2WEVA 3EL8A 2W1EA 5E8VA 5CT7A 5EHYA 4GJ2A 4N6YA 5L2WA 4ASDA 3NW6A 3SRVA 2ZMDA 3D7TA 3GENA 4BN1A 3MVMA 3TV7A 3ZRLA 4BJJA 2B9IA 1H25A 5BVKA 4ALWA 2B9JA 3ZCLA 3DFAA 2W1GA 3R71A 3BQRA 5EQYA 4C36A 3K3IA 4MEDA 1Q62A 3PVWA 3SDJA 4DEBA 2YM6A 2RL5A 2XNOA 4JJRA 3VUDA 4A9TA 3DKFA 1S9IA 1H1QA 2W4OA 4ERKA 4C3FA 5BUIA 3DJ5A 4H58A 4LOOA 4O1OA 4R7HA 3ROCA 3ATSA 4ZJVA 3OEZA 4ALUA 4DGLC 4F0FA 5CU6A 4M14A 3R9DA 3QTIA 3ZXTA 5JMSA 3DXNA 4D5KA 4QMZA 3OXZA 2OJGA 5AIKA 4YO4A 2YDIA 4GRBA 3EFWA 3LMGA 4R1VA 4GKIA 2C30A 3DGKA 3EN6A 3I60A 4E1ZA 4QP8A 2VN9A 2BDFA 5BPYA 4FTJA 4XHKB 3VUGA 3VN9A 4X21A 3E93A 4MQ1A 5M07A 4IC8A 3GOKA 3H4JA 3Q9WA 3DBFA 2YM4A 4PRJA 4EHEA 4OTDA 1BLXA 1BX6A 3ZSGA 3Q2MA 2XARA 2NRYA 4AFJA 4CCBA 5I9YA 4JG7A 2H34A 4QRCA 3RBWA 4F6WA 5IUGA 4LRKA 4IM2A 2GMXA 4FKUA 3HA8A 2IZRA 5A4LA 3RM6A 4YZBA 3DB8A 4CFFA 2ESMA 4O0VA 4WUNA 4DEEA 2XKEA 3C5UA 3S4QA 3VUIA 5L8LA 2XYNA 2VNYA 4M67A 5A3XA 4ITJA 2VO3A 1OUKA 2YIWA 2YISA 4YU2A 2CGXA 2WTIA 3I4BA 5J87A 4FIHA 4FVPA 3WI6A 4FKQA 3WE8A 4IXPA 1QCFA 3A7HA 4LI5A 1W0XC 1ZYDA 5LVPA 2BDJA 2WQOA 2H9VA 3CTQA 4A4LA 4E5AX 3HNGA 5J1WA 3L8XA 5D7AA 2PMOX 5M57A 4IWQA 3RCDA 3CEKA 3CY2A 4A9RA 5DNRA 4AAAA 3GOPA 3RPYA 2XNGA 1YWRA 3L9PA 3BHHA 5HTCA 2YFXA 4B7TA 4QMWA 1ZMUA 4EHVA 3E3PA 3R8ZA 3WF9A 2XK3A 5ACBC 2OH0E 4AE9A 3QTWA 3KXHA 5EDRA 5HG8A 4C59A 5I5ZA 2HOGA 4YC6A 4F08A 3TACA 3OW4A 3E8CA 4QYYA 4BKJA 3SVVA 3F5UA 3L9MA 2UZEA 2DUVA 1OM1A 5C27A 4ITIA 4UZHA 5CY3A 4GUBA 2Y0AA 1ZOEA 5LXMA 4IM3A 1E9HA 3D4QA 3ZS5A 3FLZA 3BHUA 4L42A 3KQ7A 3E92A 3JUHA 1IRKA 2WO6A 4AW1A 5DA3A 1H01A 5J5TA 2UV2A 1WBSA 4YBKA 5AP6A 3PLSA 4X2NA 5FG8A 3AD4A 4FRFA 5LVNA 4DE4A 2QKWB 1H26A 4Y95A 1PHKA 4YSJA 3POZA 2R3LA 4JQ7A 4MF1A 5IF1A 4AZSA 3RTPA 2JBOA 4PF4A 4S2ZA 2EB3A 4U80A 3BX5A 5ANGA 3FMJA 4PMPA 4QP3A 3ZBXA 5FXRA 3FQSA 4W9WA 4NCTC 1GAGA 2JIIA 4DN5A 3LXNA 4EKLA 4FR4A 4PY1A 3I79A 3BBWA 3WZDA 3PLAE 2OK1A 5EHOA 4MXZA 3ODYX 5FTOA 2BUJA 4FKPA 3HV7A 5IA1A 2CCIA 2EXEA 3CTJA 4FNZA 2BZKB 3LFFA 1F5QA 5TR6A 1OECA 4EZ7A 3H10A 3OCGA 1YWNA 3OTVA 3LCOA 5GINE 4I3ZA 3FSKA 3PXYA 4MYGA 3VULA 4ZLOA 2ZOQA 2JC6A 2X0GA 1OVEA 2EVAA 1U5QA 1ST0A 2GNLA 1CDKA 2I1MA 4MXCA 4CRSA 1OL7A 4ERWA 5LMKC 2C5YA 3RPRA 3F2AA 4X6QC 4FBXA 3FXXA 4LRJA 3HA6A 1REJA 5DMZA 1JAMA 4L00A 3F66A 2QOKA 4EL9A 2WQBA 2QVSE 3EQCA 1AQ1A 3LW0A 1OL5A 4CSVA 2QKRA 4TRLA 3MPAA 1J91A 4FSNA 4XH6A 2OKRA 5AP3A 5HI2A 4FTKA 3LXPA 3IOKA 3RI1A 2R3MA 5CSXA 4BYJA 2YM3A 5IUIA 2OWBA 5DR6A 4AXEA 4WUAA 1YXXA 3L1SA 5FLFA 4B4LA 5LMBA 4MXAA 2GNGA 3OROA 1J1BA 3PPKA 1M2PA 3CQEA 2FSMX 4DGMA 4XG8A 3PA3A 3BHTA 2RFSA 2UW6A 3DAJA 3IW7A 2WMQA 3LLTA 4BZNA 5EM6A 2Y4PA 5EM8A 1OBDA 5AV2A 3K3JA 5HQ0A 3A4PA 3CD3A 2WMXA 3FKNA 3H0ZA 2C3LA 4FV6A 3IONA 4O7SA 3CXWA 4P5ZA 3OEFX 5HCXA 3AQVA 5M44A 2NO3A 4LOPA 4A07A 4UXQA 3SV0A 1PXPA 2C1AA 4XOYA 5EI2A 3W8QA 4XG7A 3MI9A 1ZOGA 4EZ3A 5GJFA 3TZ9A 2X6DA 3OF0A 4NUSA 3BZ3A 4JBVA 4FL3A 4KBKA 3TNPC 1P2AA 2IPXA 2YJSA 3FKOA 3QF9A 3EFKA 4CT2A 1FVRA 2W96B 2UZNA 4IANA 4MNFA 4BTFA 4D1ZA 2OG8A 3PXRA 4DFYA 3ORIA 1Q8YA 4O4BB 4CKRA 2YCQA 2VTTA 5HIDA 2QOQA 4BICA 3FYJX 1VYZA 2BKZA 1PXMA 5KHXA 5DR9A 4L44A 2IO6A 5IUHA 4JBPA 5KKRC 3FI3A 4FOCA 4BCQA 2R3PA 5EHLA 1XR1A 5CI7A 3TNWA 4UMRA 2W1IA 4NU1A 4UMPA 5BX0A 2I7QA 3PXFA 2UZBA 1H1PA 1Q41A 3O5AA 3QQUA 4LDTA 2X4FA 4CG8A 4MK0A 3NUXA 4YLLA 3F3ZA 5H3QA 4ANLA 4FKLA 1KE9A 4X6RA 5HOAA 4RC4A 4OTGA 3FY0A 3QFVA 3VUHA 4Z7GA 4R78A 3F7WA 5EYMA 1PKGA 3NRMA 4D2TA 4L46A 4MBIA 2XUUA 4F4PA 1NT2A 4APPA 2RFEA 4U79A 3COMA 2CSNA 4CXAA 1GIIA 4QMOA 2XALA 4WG5A 5FXSA 3DOGA 1F3MC 4JRVA 2J2IB 2HZNA 5GZ9A 4EOKA 5I9XA 1ZXEA 5HHWA 4OAVB 1OMWA 4FV5A 2YM8A 3KFAA 4H3QA 4KRDA 3IW8A 4DEDA 5DIAA 2UZWE 3AGLA 1ZOHA 4FX3A 3I0OA 1JPAA 4O38A 5J95A 1H08A 2BHHA 4BCJA 4CT1A 4EOOA 4ZS0A 3IPHA 2VTQA 2E9NA 5HESA 4BBMA 4O83A 4M8TA 5KUPA 4Y72A 3C4XA 5J9YA 1ZYJA 3FBVA 1TQPA 2C6KA 1M14A 4G9CA 3UIXA 5CANA 3LFBA 5BUJA 4WSYA 4I5HA 4W4WA 4L3JA 5JFVA 3SD0A 4E6QA 2QHNA 1B6CB 5DR2A 2PZ5A 1UNHA 2GHMA 2FSOX 4KIKB 3MFTA 4PTGA 4QMUA 4F0IA 4ASXA 2QCSA 3EQFA 2XB7A 3CE3A 3NIEA 3R7IA 3BE2A 4FVRA 3GB2A 4FSUA 4MH7A 3LIJA 2QLQA 3SC1A 3Q52A 3UG1A 4XMOA 1NVSA 3FMEA 4EI4A 5GZAA 5AAGA 5AUVA 2X8DA 3NYVA 5I4NA 4ITHA 3ZSIA 4EZ5A 3BYOA 5CYIA 4RA4A 3LFAA 3CGOA 2GPHA 4ZSJA 3AD5A 3TTJA 1PMNA 2QU5A 1J3HA 2XIZA 4FL2A 4O0WA 2R0UA 3HMNA 5HO7A 3RPVA 3I6WA 4EUTA 3RNYA 4FKIA 2PE0A 3FC1X 3KKVA 3M42A 3MVHA 4HVSA 4R5YA 1Z5MA 4IHPA 3DTWA 1NA7A 4RX9A 2ITWA 4WNOA 5BVEA 1JKKA 5IQHA 4I93A 2YABA 2A19B 3UNKA 5CT0A 1MP8A 3FAAA 4F9CA 2CMWA 1PW2A 3HYHA 4CYJA 1OL6A 4QP9A 4FTTA 4JAJA 4HCTA 3F69A 1PMEA 4C3PA 2F2CB 2OJJA 5I3RA 3HEGA 4GK3A 5HE0A 5HE1A 3DNEA 2O63A 1P5EA 3OCSA 4AS0A 3ORPA 3W2OA 5E8XA 4MXOA 4EH9A 2QD9A 5EI6A 4MXXA 2F7ZE 3KXMA 1W2DA 4A7CA 3TZMA 3CIKA 3Q2JA 4LGHA 3VS5A 4AXCA 1M7QA 1X8BA 1IAHA 3BU5A 3Q4ZA 4MWHA 3QC9A 1RW8A 3MFRA 3VRZA 4FTMA 4DFUA 2J0KA 3P7CA 3VC4A 3A7IA 2R5TA 3AG9A 3BE9A 3F6XA 1QPEA 4Q5EA 3OOGA 4QMVA 5CZHA 4C4HA 2XBJA 3M1SA 3U4WA 3FEGA 5EM7A 1Y6BA 5KMKA 2VTLA 2PHKA 4HGEA 5ETAA 3HMOA 2C5OA 2XH5A 3G2FA 3NNVA 4WKQA 2X6EA 1Q8ZA 4O81A 3AC4A 1H27A 2XK7A 4QDEA 4Z16A 3HVCA 4AQCA 5CLPA 3QCQA 1TZDA 4R1YA 3F82A 4JT3A 5KMJA 4USDA 5HE3A 5IA4A 3ET7A 3HV4A 4FTOA 4YJTA 3SGCA 4YZ9A 1GZKA 3R8VA 4OBOA 5JEBA 3P08A 4LL0A 3HMMA 3TN8A 2HYYA 3I5NA 4YJSA 2ITOA 2CNUA 2V7OA 3TV6A 5D9HA 2Q0BA 3BI6A 4NJ3A 3L8SA 4CCUA 5A6OA 4YTIA 3MIAA 5DEWA 5FDXA 4QPSA 4IAYA 3ZDIA 5IG1A 3UNJA 2JIUA 5L4QA 4F78A 4QT1A 4GV1A 4BFMA 4M12A 2PK9A 5FXQA 5LVMA 3NSZA 4KSQA 2IVUA 2J50A 2BALA 4WNMA 3TYKA 3UYSA 3SOAA 4MD7E 1H07A 3GU5A 5ICPA 5JRQA 3DV3A 2QQ7A 2DYLA 3SA0A 4LV5A 4FKJA 3PZHA 3R9OA 2OZAA 2W9FB 2JDRA 3MFSA 4FIGA 4TYHB 3V5PA 2ONLA 3G90X 5K5NA 4MHAA 3RMFA 1OIQA 4BGQA 2KTYA 4G31A 5HNBA 3CP9A 1APME 3DKCA 1V1KA 3R0TA 2B54A 4RJ6A 3BQCA 1PXNA 1BMKA 5L2IA 3NCGA 3HRCA 3A2CA 5E8TA 2Z2WA 3GC0A 2CKEA 4PUZA 4QTEA 3QQFA 2G01A 3E64A 2VUWA 2E9PA 3R02A 3TJDA 3NNUA 4QQCA 4YUQA 4GG7A 4U7ZA 1ZAOA 5H8BA 3F5XA 4MD8E 4YHTA 3LHJA 4MX9A 4U45A 2VWUA 1VR2A 2GTMA 5I9VA 2J6MA 5EK7A 3W2PA 4QTBA 4KKGA 4G34A 4N6ZA 1OGYA 3OT3A 4FKOA 4AUAA 4KB8A 5E8UA 3FLQA 4Y83A 3H9OA 2VV9A 4R8QA 3QX2A 1ZARA 5E92A 4YC8A 2OH4A 3IW5A 5AFVA 4TNDA 3W0PA 4JMQA 1O9UA 3TUCA 4P7EA 2OU7A 3V51A 1KSWA 3VBVA 2WQEA 2YCFA 3MA3A 4RWIA 4KAOA 2WU6A 5CAOA 1M2RA 4FIJA 3UIBA 1WBNA 2PVHA 3AMBA 4YZCA 3ZLWA 4QYFA 2GCDA 2ITTA 4AOTA 2GFCA 3B8RA 3FJQE 3KULB 3PPJA 3W2RA 3WYYA 4CD0A 2IVSA 4XRLA 2I0HA 5G6VA 2HY81 4I20A 4HGLA 4ANOA 1W2FA 4F63A 1GJOA 4PL4A 4AG8A 4M84A 1FMKA 4JG6A 3HUCA 3Q53A 4DG0E 2BRHA 5DOSA 2GHGA 2WTDA 4JDIA 5AUXA 2HELA 5D12A 3TIYA 4TT7A 3FC2A 2BIKB 4PDOA 4OTWA 2R4BA 3QUDA 4FT7A 4WIHA 2PY3A 1WBTA 3JVRA 4GL9A 5AWMA 3TM0A 4QQTA 1PXOA 3ML1A 1Q24A 1U54B 2AUHA 3W1FA 4G5JA 4BTKA 2GNJA 4I6BA 1SM2A 1Q8TA 1YKRA 3QYWA 3RNIA 3N4VA 5J7BA 5BYYA 3LXLA 3Q9YA 3PUFC 5JH6A 3D9VA 1ATPE 1SYKA 2ZV9A 4YC3A 2GQRA 3QKKA 2WMAA 3Q32A 4G16A 4TN6A 2PYWA 4DF3A 3FZ1A 2VTSA 4IFCA 3WBLA 5KZ0A 4ZSAA 5IEVA 2WHBA 2F57A 2VX3A 4YJRA 1WBVA 2O65A 4FT3A 4KINA 4LFIA 3W0QA 3R73A 5EDPA 3NX8A 3OCTA 5ANIA 1P4OA 3OY3A 1RJBA 1WBPA 4X3FB 5BVDA 1NVRA 3P9JA 4G6LA 4RRVA 4BZOA 3OW3A 3U4UA 3ZUUA 4OT5A 3ENMA 4D4RA 3QQLA 3KREA 1J7IA 4JDJA 3LQ8A 4MAOA 5DGZA 2OIBA 3RAKA 4D0WA 4F9AA 4PTEA 4K18A 4BKYA 4JBOA 4BCPA 2XNPA 4NTSA 4R7IA 3ORTA 2VO7A 1MRYA 4D2WA 4IFGA 5HLNA 3PY1A 5AV3A 3CSVA 1YHWA 4J97A 5KO1A 3MGYA 1DAWA 4KRCA 4E6CA 4ZLYA 3N4TA 4AQKA 3PWYA 3JS2A 1JSVA 3FY2A 4FVQA 4IAAA 4OTQA 4FGBA 5CVFA 2QO7A 2HXQA 4BBFA 2O5KA 4K6ZA 3RAIA 3VBYA 1CMKE 3FMMA 3HL7A 4QPAA 1F0QA 2AQXA 4BCHA 2ZM4A 4HCVA 2RFDA 2WIPA 1HCLA 3CKXA 3UQGA 3VAPA 3PA4A 4RQKA 5KHWA 4RWLA 5K0XA 3VBXA 3ZZEA 4DC2A 3NNXA 4HW7A 4QMYA 4FIFA 3O2MA 5EKOA 3P7BA 4J71A 4XLIA 2BTRA 4KBCA 5AR8A 4JXFA 4YP8A 3VS6A 5GHVA 3R9NA 3LM5A 3GFEA 4U44A 3R01A 2IWIA 4V0GA 4Y85A 5ETIA 2PUPA 5IEYA 4NSTA 4EHZA 3UNZA 4IX5A 4IZ5A 3UBDA 4C62A 4YSMA 3LCDA 3EJ1A 3WZUA 3TMOA 4WO5A 3KVXA 4TTHB 3P7AA 3V5LA 3VS3A 4BHZA 3OZ6A 2ZFYA 5CSWA 5CI6A 3CY3A 4ZTMA 2VTMA 4N4SA 3E3BX 2GS2A 3UMXA 4G3FA 5K3YA 4YPSA 1CKJA 3DY7A 4FV9A 2OJ9A 3B2TA 2UZTA 2CGUA 4C02A 4F7JA 2FA2A 2XK4A 2QC6A 2ZB0A 3GFWA 3ORMA 3QRIA 4TYGA 3D2KA 5HG9A 4PL5A 2UVZA 4DLJA 1AGWA 3FI8A 2WAJA 5M09A 3DBCA 4FJVA 3ZFYA 5HX6A 3U87A 3EZRA 3R7GA 3PIXA 1XHAA 3PTGA 4EKKA 4JL9A 2X7GA 4L9IA 3CPBA 4C37A 1QPCA 3TZ7A 3MV5A 4RIYB 4ANBA 4FE2A 1VLRA 2UW5A 5AX3A 3TNHA 3A99A 3DPKA 2XJ1A 3GP0A 3MSSA 4PMMA 5K4IA 3C51A 4FZAB 4YMJA 3FI2A 2RF9A 4LOQA 5D10A 1R78A 3R04A 4RFYA 1NVQA 2UW8A 3QC4A 4BDEA 3SG8A 5KMOA 1K3AA 3QTRA 5TKDA 3HAVA 4GK4A 4OUCA 2BPMA 1URCA 4CMUA 2JBPA 3QTUA 2ITNA 3LFNA 2HWOA 3GCSA 4AT3A 2OF2A 2R3KA 3R9HA 1G8KA 3KN5A 4E73A 4CKJA 4ORKA 2CLQA 2J5EA 3W0SA 3BIZA 4P4CA 5C4LA 4ZJJA 3NMUF 4F99A 5AUZA 4E4MA 1ZLTA 3QA0A 5KZIA 2VWVA 2XKCA 5AUWA 3EYHA 5AV0A 4BWKA 2X2KA 3KC3A 3QZFA 3LM0A 3KEXA 4E93A 2CNQA 4BGHA 1JKSA 2CDZA 3WF5A 3OBGA 1KE5A 4QTAA 1OPLA 4Z55A 4GU6A 1R39A 2I0YA 2GFSA 3QQJA 5B2MA 2P2HA 5ANKA 2VTPA 3MS9A 4P5QA 2A4LA 4GW8A 3F2RA 4EH3A 3WZKA 4DH3A 1AD5A 3LVPA 4FYNA 5A9UA 4G2FA 4G6OA 3EQRA 4Z7HA 4EH7A 2XK8A 2R3IA 1P4FA 1Z9XA 3ZLYA 4BCIA 4PPCA 4D9TA 1RE8A 2NPQA 4O4EA 3E7VA 3TDWA 4MBJA 2BAJA 2BFYA 4FA2A 4TPTA 2PVJA 2VTIA 4UXLA 1CM8A 2A0CX 3BEGA 3WYXA 5C26A 4FKSA 4AN9A 4W4XA 1MQBA 2XF0A 2VO0A 5IH6A 3PRIA 1FMOE 4FNWA 5AR5A 3A62A 4AU8A 3DDPA 4P2KA 5E8SA 1XH5A 2FYSA 3MFUA 1GIHA 4KIQA 1Q8WA 4ANQA 1OKYA 5AUYA 4BDAA 4U97A 4F7NA 2QODA 3AT3A 4V01A 3V8SA 1NW1A 3PJ1A 2OGVA 1Q3WA 4YJOA 3U6JA 4YPDA 3PJ8A 1G8JA 3DLSA 2YJRA 3NYNA 5HBEA 3LFCA 3KRXA 4O0TA 3ZU7A 3ODZX 5IQCA 3O50A 4W8EA 1UNGA 3NVKI 3AMAA 3FMDA 4U42A 3GBZA 3PXQA 4QP7A 5DG5A 4GFMA 1IASA 3VS4A 4BC6A 4G6NA 2XBAA 2YN8A 1WCCA 3FLYA 3KA0A 3QA8A 4W4YA 2VAGA 4BI2A 4E8AA 3ZFXA 4CFNA 2VTNA 3BYSA 4I6QA 4IB3A 4U81A 4IWOA 5HVYA 1DI9A 2I0VA 4C4GA 5LOHA 2EB2A 3PXZA 4RIXA 4RQVA 3A8WA 3QRTA 5IA0A 2WB8A 5EYKA 3NUSA 1UVRA 4IVBA 4JDKA 4RWKA 4C33A 4JR7A 3NW7A 4O7VA 2YIXA 4FSYA 3E7OA 1OZ1A 5D1JA 2YACA 5ANJA 3ZFMA 1Q8UA 2E9UA 3SXRA 3DT1A 3WILA 4R6VA 4E5BA 5EDQA 4CGAA 4TKSA 1OKZA 2YIYA 2HW7A 1ZZ2A 2I6LA 4H39A