2QOOA

Human epha3 kinase and juxtamembrane region, y596f:y602f:y742f triple mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
273
Chain Sequence
TFVDPVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGFVHRDLAARNILINSNLVCKVSDFPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 273
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qooA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qooA01
4JQEA 4JG7A 4JIKA 4JS8A 2YZLA 4M84A 2J0IA 2VGPA 2PE0A 5CTPA 3VULA 3U6IA 3PVGA 4LG4A 4RZVA 4YUQA 1B39A 1OKVA 1WBWA 3CJFA 3NW6A 4ITIA 3UOHA 4Z9LA 2QLUA 2Y6OA 3CXWA 5EYDA 4IWPA 2FSOX 4U3YA 5EYMA 5J79A 1V0PA 4AZWA 4YJVA 4H58A 1M52A 4D2WA 1WZYA 3AC8A 4O7LA 3Q2MA 3F5XA 5IA0A 3NIEA 2BALA 1UU7A 1YW2A 3HV5A 3ZHPC 2FSMX 1UU8A 1B38A 2WTVA 3OOGA 4FOBA 5ETFA 3TEIA 4AOJA 5J9LA 4WRSA 5EI6A 3R7YA 4BZNA 4U5JA 1SZMA 2Z7LA 4GJ3A 4QTEA 4YURA 3LQ3A 3ZM9A 3MI9A 3QRIA 4I5CA 4HJOA 5HZNA 3PUPA 3MVHA 3POOA 4E4NA 1LR4A 1YVJA 3BHVA 1PYEA 5AMNA 2Y4PA 4C33A 3B2WA 4CD0A 4MXAA 4CTBA 4I6BA 1YDTE 4J1RA 3VIDA 3UZRA 3RI1A 2JGZA 3Q4UA 2C6IA 2R3GA 2C5OA 3TG1A 3COKA 4FKLA 4BBFA 1IA9A 3PZHA 4X3FA 5D7AA 4GMYA 4WRGA 3LFEA 2R9SA 3V5JA 5CEQA 2PVJA 3WARA 2GTMA 3AXWA 4RWKA 3I4BA 3ZO1A 2X2LA 2XIZA 1U54A 3GGFA 3NWWA 5JFSA 4YHJA 2PVRA 3NUAA 2Z2WA 1KOBA 1OIYA 3C4EA 4QNYA 4ACHA 4JX7A 4C3RA 2QO2A 4QP7A 4XYFA 3TT0A 2C3IB 2XKEA 4DCEA 4XEYA 3QCQA 4NM0A 3E7OA 4MK0A 2F9GA 2HY81 5JRSA 3RNYA 4UMUA 1W8CA 1STCE 3KRJA 1S9JA 2E9PA 4C2WA 2HCKA 3F2NA 4G9CA 4NFNA 4LGGA 2W99B 4FI1A 4X21A 3ENMA 5CVFA 1O9UA 4FSUA 4YJNA 2C0IA 1H08A 2H8HA 2WGJA 3FXZA 3V51A 3PPZA 1NA7A 5IEYA 5CAUA 4QQTA 3KVXA 3EMGA 2R0IA 4D2RA 2RFEA 2Z60A 5KO1A 1LEWA 3UIXA 2ITPA 2IG7A 3KMUA 4RFMA 1OIUA 2OI4X 3OW4A 3JY9A 2WQOA 2X2MA 1W98A 3FLSA 3L8XA 5DLSA 4U8ZA 4F1OA 4ITJA 5BYLA 3MSSA 5DN3A 2W1DA 5CXHA 4XUFA 4WUNA 5AV0A 2I0YA 2J0KA 3OT8A 4TYJA 5GIOE 3BZ3A 2WTJA 4IFCA 2DQ7X 4IE9A 3VBQA 3NYVA 4RWIA 4MNEB 1XKKA 5DI1A 3ERKA 3QCSA 5F20A 2PZ5A 3H9FA 4ZS0A 5H2UA 4RPVA 4BWKA 3OHTA 1DI8A 2YZAA 4FK3A 4DN5A 4DT8A 4ANLA 3UNZA 2H34A 4G3EA 4RFZA 5DT0A 3ZDUA 3LFDA 4DGLC 3R7GA 3V5WA 4BTKA 3H3CA 4O82A 4AS0A 1PW2A 1PMUA 3BX5A 5HVKA 3UIBA 2ITYA 3FZRA 3KXNA 4R3PA 4OTGA 2GU8A 4S2ZA 4U6RA 4EK5A 3WF6A 4RJ3A 4ZTHA 3AC2A 4L7FA 4FEWA 3NAYA 4FKUA 4K18A 4Y46A 5K9IA 1G8AA 3ZSGA 2CLXA 3A4OX 3LQ8A 5K3YA 2OFUA 5HIEA 5FBOA 4CZYB 5HI2A 2C3JA 1GY3A 2UZBA 4FTIA 3BHUA 3A7IA 3NR9A 4MNFA 4OTHA 5KMOA 4DBXA 3MBLA 3DFCB 4YLLA 4MXZA 4PP9A 3RAHA 2XZSA 1CDKA 1PY5A 5FM3A 3SC1A 2NNWB 3NPCA 3OWLA 4IX5A 5HLNA 3NW7A 4NFMA 4WNMA 3BQRA 3EHAA 5CT0A 2CKQA 3OCSA 4BB4A 4KUJA 4EJ7A 3HMMA 4FKTA 5IU2A 5FGKA 5HKMA 5FP5A 5BUEA 2X9EA 3D2KA 1GIHA 4XJ0A 4FL1A 4YZ9A 2PMOX 3OD6X 5KMJA 4FL2A 3E92A 5IQHA 2ITWA 4RMZA 2PZRA 3NUSA 3FKNA 3G51A 3Q9XA 5HESA 4I6QA 3VJNA 4NW6A 3IONA 4O2PA 4IVCA 4UB7A 4DEIA 3EQCA 4EH7A 4O0VA 1YXUA 2YIXA 2OIBA 1Q8YA 2R3KA 2ZMCA 3VW6A 3BWFA 3PJCA 4XBUA 5CEPA 4EH3A 1ZARA 3EFLA 2F57A 3RINA 4ANBA 2ERKA 3QLGA 4FTCA 3MVJA 1H01A 5HIDA 4FSYA 1H24A 5JSMA 1R0EA 3UOJA 3QX2A 4ACMA 2GS2A 5CVGA 5AUXA 3R1SA 2VD5A 2I7QA 4C4IA 5I9ZA 3BV3A 1PXPA 4YZBA 5M08A 1A9UA 3DKCA 3HLLA 3R28A 4YBKA 3ZO2A 4DH5A 5D41A 3AMBA 4NCTA 5LWNA 2Y4IB 2PMNX 4K77A 1GZOA 2ESMA 3QCXA 3PG3A 4RIXA 5C8KA 4O0YA 1U59A 2ITOA 4I0SA 3RAIA 4KBKA 5LQFA 3U6JA 3PG1A 4DGNA 2NRYA 5IEXA 3NEWA 4QNAA 1L8TA 1YI3A 4BCGA 2B7AA 4BWXA 4J98A 3NUUA 4YJQA 1JKKA 4HVDA 4XV2A 2BRBA 3PPKA 2J0MB 2IWIA 4C36A 3O7LD 4QP9A 2JKOA 4O86A 4IJPA 5DPVA 4L9IA 4HCTA 1OKZA 3DY7A 1BX6A 4EKKA 1GZ8A 4G5PA 5K5XA 2W0JA 3IG7A 3QQKA 4WNOA 2EB2A 3R7IA 3QD2B 4YZNA 4IB0A 2I6LA 3V8SA 1OKYA 5FD2A 1CM8A 5BX0A 3V8TA 2G2IA 4BY9E 5AJQA 1VJYA 1WBNA 4J99A 4TL0A 3AC1A 3BIZA 3A60A 3OXZA 3W32A 3QA8A 3W2SA 2ERZE 3NUPA 4RVMA 5GJFA 3UZTA 3FMLA 5BVDA 2HENA 3PJ1A 2UZVA 4FT5A 2GDOA 2ITVA 3W2CA 1FMKA 5BPYA 4GV1A 3PRIA 1F5QA 3BRBA 4Y5QA 4RIYB 1URWA 1PXNA 4HVSA 4QMNA 1PXJA 2CCIA 4MX9A 3MESA 3SG9A 3ULIA 1FINA 3FZ1A 3VAPA 4FKRA 5CQWA 2Z02A 4F7NA 4AW0A 4U0IA 5H9BA 1Q8WA 3TN8A 3VQUA 3ZFMA 4ACDA 5J9YA 3CSVA 1AD5A 4QP3A 3O8TA 3OZ6A 2YIYA 3JVSA 4XP0A 5DGZA 4C62A 4D2TA 3MB7A 3CY3A 1PMNA 3HMNA 4D2PA 2J51A 5C4KA 1QPCA 3RCJA 4QMLA 2P4IA 3QQFA 4AZTA 2VNYA 4DBNA 4HCVA 3TNPC 4R7IA 2WAJA 4C3PA 4DEDA 1ZYLA 3CLYA 4LQMA 3OEFX 4J95A 4EORA 3RBWA 5BVKA 4I41A 4L00A 5A4TA 4YTHA 4O7WA 3TTIA 4BHZA 1W84A 3G15A 2J5EA 2VV9A 4KSPA 2ZM4A 4BVUA 3RWPA 4OT5A 3RWQA 3VHEA 2PU8A 1H0VA 3GU4A 1IAJA 3L9LA 4QQCA 3OUNB 1FPUA 3TNWA 4G6NA 5D10A 5JQ5A 1APME 2YDIA 5JGAA 4M13A 2A19B 3UJGA 2XK9A 2FSLX 1XBCA 1JKSA 1R0PA 3CD8A 2GFSA 4FL3A 2XCKA 4WA9A 1IRKA 2BIKB 4JL9A 1XQZA 2WTKB 4BKZA 5D7VA 3E64A 3C4XA 4EHEA 5HG5A 3D7TB 3NIZA 5FDPA 4X3JA 5M55A 4RX5A 4FEUA 3T9IA 2IW9A 5CSVA 4CV9A 1M2PA 3UOLA 4LL0A 1HCKA 2W1CA 3I5ZA 3VNTA 4I6HA 5EFQA 4DH7A 1IEPA 3MTLA 2CKPA 3QXPA 4CCUA 5F95A 3H0YA 5EG3A 3OBJA 5J95A 5F1ZA 4WNPA 4M0YA 4FKQA 3UNJA 4YJUA 1XH7A 2OZAB 2BRMA 4RIWB 4P5QA 3HA6A 3WZUA 4DEAA 5AP7A 3EQIA 4BCPA 3VUHA 5EHLA 1LP4A 4PUZA 4PNIA 5EDQA 3W2QA 3UP2A 4AXAA 2OJFE 4ARKA 5AAEA 3PTGA 4R5SA 1YHWA 3HYHA 3NZ0A 4IVDA 5HEZA 3QQLA 3T3VA 3LFQA 3BBTB 3VC4A 4FEQA 3RM6A 2C6MA 3R1NA 3OVVA 4CFMA 3EZVA 3ZRMA 5C03A 4OTWA 3CR0A 2XCHA 5HOAA 4A9SA 4JG6A 3HVCA 3TV4A 2XUUA 3D5WA 3ORKA 5KMIA 1J7UA 4JI9A 3F6XA 1OB3A 3DU8A 5EYKA 5EHOA 3BKBA 1OIRA 1MQ4A 2QO9A 4C2VA 4U42A 3R8MA 5LCJA 3F82A 3E8EA 4C8BA 1UKHA 2YFXA 4RLKA 1U5RA 3UVRA 1H25A 1H4LA 2Z8CA 1QCFA 3II5A 4C34A 2BTSA 5JFWA 2XVDA 3I6UA 4CFUA 2E9UA 4QMTA 2CN5A 5E7RA 3R04A 1OM1A 5JGDA 5AUTA 2QCSA 5IDPA 2OG8A 4I5HA 4ZJIA 2XNPA 3FZSA 1F3MC 3CE3A 3F7WA 4NKAA 5I9UA 3MVMA 3BGZA 4LV5A 3M11A 3O2MA 3GXLA 4C7TA 3QQJA 4H3PA 3JS2A 4BKJA 4CRLA 2XIXA 4MH7A 1EH4A 4UZDA 4E6AA 4LYNA 3U9NA 4NYEA 4I21A 5HBJA 1PMVA 4L01A 4BDBA 2ZV2A 3ATSA 3RAKA 2IO6A 2YDKA 1YOMA 4P4CA 4G3CA 5HNBA 1BI7A 5T68A 4ENXA 2YM6A 3D4QA 3ANRA 5IQBA 3RPSA 2F7XE 1URCA 3FEGA 3F7ZA 4IACA 4D5HA 2C30A 4JQ8A 4F0GA 4JBQA 4YU2A 3GP0A 4IFGA 4N6YA 5KBQA 4WIHA 3O23A 5AR2A 5M57A 4X7QA 3TZ7A 3CGFA 2C47A 4KIOA 3Q5IA 4MWIA 1NVSA 3IGGA 4R3RA 1LPUA 1OL5A 4G9RA 1G5SA 2BRHA 5BMSA 5J8IA 3S95A 3V5PA 4NH1A 4QMWA 2PUPA 2B9IA 4D5KA 3DAEA 1MRUA 1YI4A 2C1AA 2PZIA 2VWBA 4O2ZA 2I0VA 2X4FA 5EKOA 2XIKA 5GINE 4A06A 3TUDA 3I60A 2H6DA 3QGWA 4PMTA 3RTPA 1H28A 3QKLA 4YSJA 4JAJA 3BWJA 4EH2A 4AFEA 4FE2A 2NPQA 3Q6UA 4AGCA 4B8MA 3FKOA 3P08A 2HWPA 4GU6A 4XOYA 4EOJA 5HTCA 3D14A 3DS6A 3LHJA 4GT5A 4XMOA 3OUKA 4JQ7A 2V7OA 4UXLA 2XK6A 4X3FB 4ZTRA 4DFXE 5J7HA 2XNNA 3C5UA 4KIQA 5HE3A 3TNQB 4O7SA 4OT6A 4YLKA 1O6YA 1BI8A 5LMBA 4F6SA 4ANNA 2J4ZA 5E8WA 5CXZA 4DC2A 2VUWA 4LOQA 5EKNA 2ZDUA 4ZSGA 3QRTA 4DGMA 3PP1A 3QZGA 3DZOA 3MN3A 3DOGA 3O8UA 2IZSA 3PJ8A 4LL5A 5C26A 5L3AA 4UZHA 1H8FA 3G33A 3AD6A 3GU5A 3MWUA 4RA5A 5C1QB 2UW3A 3WF5A 3EL8A 4IDVA 5AP3A 5B2KA 3PRFA 3TTJA 4PL4A 4DFNA 3NVKI 2YA9A 2P3GX 3ZBXA 4EOPA 1E1VA 3ZCLA 4BGQA 2V0DA 2WMAA 3OEZA 3GC8A 4CVAA 2F49A 4JX3A 4Q5EA 4WG3A 4I4EA 1SVEA 3FC1X 3KEXA 3WF8A 4ERWA 2JLDA 4LGHA 4ZIMA 5C01A 4L45A 1WBVA 3GT8A 2GS6A 5KBRA 1IAHA 3QUEA 5EM8A 2NRUA 2Z7SA 2VTIA 3GOPA 4IX6A 2V5QA 5H8EA 4FEXA 1SNUA 3WYXA 4TYIA 4USFA 4N4SA 4AZVA 3AQVA 2X8EA 2R3JA 2XYNA 4E1ZA 4JBVA 4M66A 5KHXA 2A27A 1Q41A 5EK7A 2YITA 5I3RA 2CGUA 4JRVA 4NTSA 2UUEA 5DE2A 2Y8OA 3VN9A 4FNYA 4BI2A 3FSKA 4IVBA 3R21A 3QUDA 1FBNA 1P5EA 4KIPA 3R2BA 4E73A 3OTUA 5KE0A 2ONLA 4EOSA 1OPKA 3TKHA 3QHRA 3NYXA 4O0TA 1ERKA 3W8LA 2GPHA 2IW8A 5KMKA 4BGHA 4FTKA 4CXAA 5BYYA 2JEDA 4B7TA 2Q0BA 1XO2B 4HGTA 5D12A 3DJ5A 3KB7A 4D2VA 3WZDA 3EB0A 3TIYA 1PRYA 4EK8A 2QURA 2ETKA 4RC2A 1HCLA 2ONLC 3ANQA 4OGRA 4XV9A 3FYKX 2B1PA 4O7VA 4UMTA 5DVRA 4I20A 1ZOGA 3KXXA 3OTVA 4DYMA 5JKGA 2ITZA 3BCEA 4YO4A 4FT7A 4J53A 5TE0A 5AAGA 2X1NA 4F9CA 3JYAA 4TXCA 2IVTA 3W18A 1KV2A 2VTPA 3ZZEA 3FDNA 1GJOA 4FSZA 3UGCA 2O8YA 3FLZA 4ALUA 2Y0AA 2YCQA 3GQIA 4ACCA 4NM3A 4NW5A 1PJKA 5CQUA 3TWJA 5DNRA 2BFXA 4EUTA 1KE5A 1U5QA 4QOXA 2J5FA 1YXSA 4BDDA 4LUDA 4MBLA 3UO5A 5JK3A 2VX1A 4PTGA 2PE1A 4RBLA 1J7IA 3AT3A 2P55A 5I5ZA 4U41A 5IMXA 4LV8A 2IVVA 3MV5A 3E3PA 3KXHA 3PE1A 3MY1A 3G5DA 4FV0A 4Z16A 4ZSAA 1Q8ZA 3QUPA 4IBMA 3EIDA 4K1BA 5HCYA 5FTQA 1GIJA 5M56A 1CMKE 5C8MA 3RHKA 3HRFA 3RAWA 4GKHA 4ZSJA 2UW7A 4ANOA 4Y85A 1Q8TA 2XM8A 3P4KA 3FMHA 3DKOA 4IXPA 4ALWA 4I22A 3MA3A 2WKMA 2R64A 5CAVA 3NUXA 4CFXA 3B2TA 4TWNA 5TOZA 4YNOA 2JFMA 2O3PA 1PF8A 2WMSA 3QWKA 3KK9A 4FYNA 4M0ZA 2ZVAA 5I3OA 3UBDA 4BIDA 2G1TA 2BDWA 5K5NA 5A46A 4AG8A 4CNHA 3HUBA 4CQGA 4RIXB 3UIUA 4EYMA 3QRJA 4RIWA 5GZ8A 1W0XC 2X7FA 3QLFA 4L68A 5CU6A 4ZP5A 3Q3BA 4TYHA 3AC4A 2GNLA 3PJ2A 3GC0A 3A62A 5HHWA 5TO8A 2XBJA 2VTQA 3AT2A 3IW4A 2UW4A 2VTSA 4DG3E 5L2TA 3JUHA 3BELA 3DB8A 2W5HA 3SAYA 4CQEA 4JXFA 1SVHA 2W17A 2GSFA 4EH8A 2WMUA 4F64A 4EQCA 3WIKA 5DOSA 3FKLA 2HOGA 3DGKA 5HBHA 4GSBA 3MFSA 3ZBFA 5HG9A 2ACXA 4TYGA 4D1XA 3P7AA 1FMOE 3LOKA 4FTJA 3VUGA 1YWRA 2FA2A 2GFCA 3R1YA 4KABA 4N70A 4AT3A 3W2PA 5IKWA 4DEGA 3A4PA 5ICPA 5KMMA 4BI1A 3DFAA 1YQJA 3IK3A 5E8VA 2PPQA 3EJ1A 5AP2A 3A99A 4GVJA 5FDXA 3QTXA 2X7OA 4NK9A 4NU1A 2UVYA 3TACA 2VX0A 3BU3A 1KWPA 1BKXA 5LXMA 1QPDA 4MD8E 3T8OA 4O83A 3WBLA 3PA3A 4XH6A 2YCFA 2QHMA 4FNZA 1RDQE 4XG7A 5CAPA 5FM2A 1WAKA 2V22A 2VNWA 4JT3A 2OJJA 3DBCA 5CEKA 4H1MA 4YJPA 3OOMA 2HY0A 4D2SA 4USEA 4FV1A 2PK9A 5L8JA 3OFMA 1Y6BA 3HRCA 4LMUA 4OBPA 1Q61A 4BL1A 1JOWB 1JNKA 1PXOA 3PY0A 2BHHA 4IC7A 4AP7A 1H1SA 1H0WA 3ZSIA 2FUMA 2PUUA 4FKGA 3VJOA 3ZLSA 1R1WA 1BL7A 2BR1A 4OTQA 4FSQA 4BDCA 3JR1A 3VBTA 1L3RE 5F9EA 5BVNA 3TZ8A 3QD3A 2JBOA 4U80A 1QL6A 4E5BA 3ROCA 3QF9A 3PA4A 4LUEA 3RJCA 5B2LA 1JSUA 2B52A 4IAYA 4QMQA 2C6EA 4E7WA 5M4UA 2WHBA 4YTFA 2OF2A 3LMHA 2XK4A 3EKKA 1YRPA 4U3ZA 5E1SA 5IMEA 4G16A 2YWVA 4NKSA 2GTNA 3LFNA 5AV1A 2YAKA 4Z3VA 4CFVA 3MJ1A 3CQWA 2PVHA 1WCCA 1OUKA 4GIIA 4AACA 3QKMA 4DITA 3LCOA 3IS5A 1SYKA 5FWKK 5B2MA 4IB1A 3SW7A 5ACBC 4U43A 4G3DA 4QT1A 5DIAA 4GFGA 2B55A 5JN2A 5CEIA 4GVAA 3HX4A 3TV6A 3EWHA 3FE3A 1Z57A 3POZA 2ITXA 4P7EA 3ZSHA 3NAXA 4BTMA 2XK7A 2EXCX 4U79A 4ONAA 3TDWA 2XH5A 3ET7A 4O6EA 3FWQA 5IUGA 3LLAA 4JBOA 2C5VA 3VUDA 4GG7A 4CT1A 3R83A 2VX3A 3QQHA 3F3VA 2VTRA 5CI6A 2VTTA 2WQEA 3AT4A 3FUPA 4KKHA 4AQCA 4HYUA 3HUCA 5HNGA 4F6UA 2R3LA 2VWZA 5HG7A 4AN2A 2OKRA 3BLQA 4CRSA 2W1FA 4IAFA 2WTCA 2O0UA 3HECA 4GH2A 2WEVA 4ZSLA 3R8LA 2G2FA 4CFNA 1OECA 1JAMA 2GNIA 1GOLA 3V6SA 3HAMA 4FODA 1UNHA 4F7JA 4GIHA 5EM7A 1ZXEA 3Q60A 4AZFA 2FSTX 5K0XA 3PXRA 2ZMDA 4KNBA 1P4OA 3D2IA 3GCSA 5IDNA 4QP1A 2Q83A 5EQPA 4FTMA 4L52A 2BTRA 4NEUA 2Z7RA 3TXOA 2G2HA 1XH6A 1KE6A 1DM2A 2X2KA 4S30A 5KX8A 3Q9YA 4ID7A 2J6MA 4FIEA 3FI8A 3CC6A 4O96A 2CN8A 5L4QA 3KVWA 3P0MA 3R6XA 2KULA 5BMMA 4R1VA 3VUIA 2YJSA 3UTOA 2W05A 3I7CA 4EK6A 2OGVA 5C9CA 3QXOA 4BR3A 3MY5A 4AN3A 2BRGA 4UN0C 5FEQA 4WBOA 2RG5A 4RSSA 5K0KA 3H10A 2PYWA 3TV7A 3CQUA 3PSCA 1WBTA 4Z7GA 3R9OA 4F9AA 5DR2A 2DUVA 3DDPA 4I5PA 4M14A 3ACKA 3PLSA 3D9VA 3P5KA 5FTOA 3T9TA 4CFWA 4QRCA 5ANOA 3PFQA 4EC8A 3OXIA 4QMPA 5BNJA 1PYXA 5HQ0A 5JRQA 5E4HA 4F0IA 4IAZA 2WIPA 2X4ZA 3FMMA 3ORMA 3UVQA 2X8DA 5JH6A 3G9NA 2WQMA 3BPRA 4C3FA 3LM0A 5IH4A 4BDIA 4M67A 4ZTQA 4C4GA 3MH3A 4DTAA 3TUCA 2I40A 3RPOA 1UKIA 4Q2AA 4BCQA 5G6VA 4C59A 4HW7A 3ZH8A 5A54A 3PPJA 2OBJA 5AAFA 4N0SA 1T46A 3A2CA 5CS6A 5ETCA 3BEGA 2ZM1A 3FJQE 3V5QA 4F09A 5CASA 2C6TA 5AIRA 5IF1A 5DEYA 1ZY5A 4ANMA 3NYOA 3B8QA 2F4JA 3F2AA 5HORA 3GB2A 1OGUA 4AOTA 5CSHA 4YP8A 5HE2A 3UDBA 3QTQA 3TZ9A 3UE4A 4FSRA 3DJ7A 3LMGA 4XRLA 2OK1A 4K0YA 3C50A 3HV3A 2CGWA 3UMWA 3LFAA 4L53A 1UU3A 3H9RA 1Q8UA 3F3UA 2ZM3A 4O22A 2OFVA 4C4EA 2EXMA 3BEAA 2QQ7A 4RC4A 4MEDA 4K8AA 3KA0A 3ZOSA 1H07A 2GCDA 3OWKA 5IG1A 2G01A 3T3UA 2JKQA 4NTTA 3HV6A 4C4HA 4EZ7A 3M2WA 2QOOA 4RGJA 4FKOA 2BUJA 3E8CA 3QHWA 5M07A 2P0CA 5HO6A 3RPVA 2HIWA 5IZFA 4D4YA 5M53A 4X6QC 3I7BA 4ZTLA 2ZOQA 2ZV9A 3ZZWA 2QD9A 5AR5A 5LARA 4QMUA 4EWQA 3ZO3A 2W1IA 2ZV7A 4B6LA 3K3JA 1VYZA 3UMXA 4YR8A 2WMQA 2CPKE 5HO8A 3TUBA 1PXLA 2WNTA 2YM8A 5IQIA 3LFSA 2BILB 4R6VA 5GJGA 2JDOA 4WO5A 3MB6A 3EQPA 3UP7A 1DAYA 4ORKA 3QC4A 4PPCA 4ZS4A 2VWVA 3UQGA 2E9NA 4BKYA 3GFEA 3UPZA 1IA8A 4A4XA 2R3RA 4CT2A 3AC3A 4OTPA 4YO6A 2J0LA 4ASEA 4D0XA 1JKLA 4A9TA 3S4QA 4RC3A 1NXKA 4EK4A 4A9UA 2ZYBA 5FTGA 3EN6A 5LMAA 4R3CA 4F99A 4ZMFA 4FSTA 3IDCA 2BZKB 1Q97A 4L44A 3GVUA 4OUCA 4ZTNA 2YAAA 3OF0A 5I9VA 3ODYX 3SOAA 5HX8A 4GS6A 1ZWSA 4I6FA 2I1MA 3G6HA 5T3QA 4U9AA 2BKZA 5AIKA 4ZJJA 5J7BA 4MQ2A 3DBEA 4I1ZA 4XNEA 2HWOA 4ZAUA 5EM5A 1H1RA 4G2FA 3UVPA 3LXKA 3O7LB 3LCTA 3VUMA 4I94A 2EUFB 4K9YA 5ETAA 2YLFA 2A1AB 2UZOA 4L3JA 1Z9XA 3MY0A 1UVRA 3QALE 5L2IA 3AG9A 5AR8A 4DHFA 1TQIA 1Y57A 2XB7A 5HIBA 3U4WA 1G3NA 3QQUA 4KINA 3GCUA 3FBVA 3D94A 3PIZA 4LOPA 2XA4A 5FUTA 1M7QA 4CGAA 4C02A 1QPEA 2VWWA 4FKWA 2R3FA 3BQCA 2QR7A 2QONA 4O0XA 5CU3A 3JVRA 2G9XA 2SRCA 3BU5A 3P1AA 4FG7A 3HA8A 4NUSA 1ZY4A 3VQHA 4APCA 4CEGA 3PXQA 4E6QA 4FK6A 3DAJA 3DT1A 1GNGA 3VS6A 4AT4A 4CTCA 1R3CA 2AC3A 5FBNC 4V05A 2R0UA 1FVVA 4OAUC 2PVLA 3BV2A 3GUBA 4TYEA 4G17A 1F0QA 5J5SA 4IWDA 1JBPE 1MQBA 3C7QA 3ORXA 4GCJA 4KS7A 4CMUA 5AM7A 5LVNA 2H9VA 2R5TA 2YISA 3HAVA 3SXSA 2I0HA 4TTHB 4V0GB 5F4NA 3S3IA 3LW0A 4DEHA 4RLLA 4QD6A 4AW2A 3LCSA 3KCFA 3GI3A 5K4IA 3Q4TA 4Q5HA 4APPA 2XEYA 3O71A 5DG5A 3P7CA 4AZEA 3S1HA 5IA5A 3L8PA 3PWYA 2VTNA 3N4VA 4O27B 2OZOA 2R3IA 2R7BA 4LRJA 4CMTA 4IZYA 4XRJA 3OY3A 4E4LA 3VS0A 3D0EA 5CEMA 2JKKA 5IA1A 5CT7A 1M7NA 5D9HA 3MW1A 2F2UA 3E93A 5CYIA 3ZC5A 5J1WA 4I23A 4U44A 3D5XA 4JAIA 2YERA 3PY1A 3MPMA 3KN6A 1GIIA 3TJDA 3ZO4A 4I0RA 3ZS5A 3DK7A 3DXPA 3KRWA 4KB8A 4M8TA 3SRVA 2HZNA 4DFYA 4UMPA 3QD4A 2EU9A 4IZ5A 5I4NA 4RX9A 5HCXA 3BLHA 4TZRA 3DNEA 3NYNA 3CQEA 1NW1A 3ZFYA 4WUAA 4YJSA 1K9AA 4D28A 4N6ZA 3UO6A 4CCBA 2VN9A 2XEZA 4FVQA 4FTQA 4MHAA 2IJMA 5CWZA 2VO7A 1BMKA 3FPQA 5FXRA 2UW8A 4H3QA 3SVVA 3PVBA 2HW6A 3U55A 4G3GA 3KMWA 1IASA 4D1ZA 3UG2A 2O2UA 3EFWA 3NGAA 4IB3A 2UZDA 3SQQA 4UMRA 3FQHA 2CGVA 4QMMA 3Q4CA 1GAGA 2NO3A 2XIRA 3FY2A 4TYHB 3OG7A 2V55A 4YLJA 4L3PA 2OIDA 3SX9A 4R7HA 4WNKA 4RWJA 3WOWA 4JDKA 2HZ4A 1RW8A 4J52A 4TRLA 4E4MA 1K2PA 1IR3A 3R01A 3H9OA 2JFLA 1M17A 2OSCA 1OZ1A 4HPTE 3C1XA 3VRZA 4ZMEA 4PTCA 1OMWA 3KULB 2HK5A 3MPTA 3TJCA 1V0BA 3PSDA 3P9JA 3QCYA 3ZTXA 4QMYA 2X6DA 3FMJA 4KA3A 5I9WA 4OTIA 1YWVA 1W83A 4AE6A 5JFVA 2PZPA 3CPBA 3P86A 2WTIA 4NIFB 4OR5A 1TVOA 3C0HA 2BAQA 2JDSA 4JRNA 3R9NA 4M7IA 4TN6A 3TL8A 2X6EA 3MDYA 2J0JA 4CFFA 4M97A 4WSYA 5CAQA 4JOAA 3C5IA 4YC3A 3RMFA 4PY1A 2ZAZA 1OPLA 3QC9A 4X2GA 3G0EA 3MH0A 2B9HA 3ZEWA 4AFJA 5CF5A 4XG6A 4OTRA 4NT4A 4R1YA 2E9VA 3ZLXA 1M14A 3OWJA 4FYOA 3FC2A 4K2RA 4OTFA 4P90A 5CANA 3RALA 5LMKC 3ULZA 4XOZA 3FAAA 3TNIA 5BUIA 1J7LA 3M1SA 2YWPA 3HMIA 4RJ7A 2OXYA 3WF9A 5DRDA 5BVWA 4MVFA 5L6PA 5CALA 3SA0A 5TF9A 2ZB0A 4EUUA 3P78A 4QMZA 3KMMA 5LJJA 4F4PA 3HDNA 2GNJA 4GYGA 1KUTA 4RJ5A 5E8UA 3R22A 5H8GA 3VRYA 1PHKA 2QLQA 3BBWA 3OP5A 5AWMA 4F9WA 4PMPA 2OW3A 4FGRA 2WEIA 5IQGA 4FV2A 4MXXA 2W4KA 4KBAA 4K6ZA 4DH3A 2W5AA 2VWYA 4M3QA 3Q2JA 5IA4A 5DRBA 5HE0A 3MYGA 3FXWA 2WMXA 3SKCA 4EOQA 3QTUA 3SD0A 5HU9A 5KKRC 4J71A 2OXXA 3K2LA 3NCGA 2JAMA 3ZXZA 2B53A 4E5AX 1OL7A 4FKVA 3FY0A 3RKBA 4PNKA 2PTKA 4JJRA 4G6OA 5CU2A 4C0TA 3W2OA 3RK7A 5M4CA 3U51A 3S0OA 4UX9A 5GJDA 2FH9A 3FQSA 4HGLA 1S9IA 1Y6AA 2JITA 3DXNA 2GS7A 4J8MA 5CSXA 4A4LA 5IH6A 2CKOA 3G6GA 3BHTA 3L9PA 4FZAB 4FIGA 5GZAA 1AGWA 4I5MA 1ZYCA 4EBWA 2IVSA 5IQDA 3KRLA 1YOJA 3NNWA 3NNVA 4EHGA 3W55A 2WPAA 3HMOA 5JEBA 2QOCA 2C3KA 4QMSA 3EN4A 4XG9A 1P14A 3L1SA 1PXKA 2GNHA 2IN6A 5JMSA 5DR9A 1ZYJA 1KSWA 3F61A 4FF8A 4UYNA 3O96A 5J87A 5EOBA 3R7EA 4DGGA 4FG8A 5EQYA 2I0EA 5B0XA 2B9JA 4X2KA 4TNDA 4F63A 4XS2A 3LCDA 4YSMA 2AC5A 4RX8A 4EOOA 5JQ8A 4TWCA 4O81A 5JZJA 5DBXA 4MXOA 4FT3A 4GK4A 1KE9A 1WVWA 1UV5A 3WE4A 4FKIA 2XNMA 5HE1A 3FHRA 3HNGA 1PMEA 2QG7A 3RCDA 2W1EA 1YDRE 2IZRA 5ITAA 1XJDA 3KN5A 4D9TA 2O5KA 3N4TA 3GCVA 2CKEA 2XRUA 3F66A 2YCRA 4WOVA 4DFBA 4HGSA 5KCVA 4C58A 3H30A 4PV0A 3VO3A 4ASDA 2AUHA 2R3HA 3U87A 4O0SA 2UW6A 3C0GA 5BQ0A 3TKIA 3A7HA 4BTFA 3DBFA 4F65A 4AN9A 2C6KA 3V5TA 2CJMA 2ZB1A 3PJ3A 4NJ3A 4MKCA 3AGLA 2BVAA 3RPYA 3SOCA 4M15A 2BIYA 2LGCA 4BIEA 4PTEA 4HNFA 4LI5A 2JDRA 3LM5A 5EDRA 1A06A 5HD7A 4O7TA 4E6CA 4ASZA 1H26A 3AMYA 3BYOA 4DTBA 3NDMA 2XKDA 2XNGA 4W4XA 3VWAA 4E26A 4O91A 4G34A 2WD1A 3QTSA 4AW1A 4U45A 5HVYA 1Q3WA 2EXEA 2XNOA 2GHMA 4UY9A 4YZDA 5A4EA 3FHIA 2ETMA 3UO4A 1MRYA 1VR2A 2X8IA 3K54A 3KXZA 3QTZA 2GQSA 2B54A 4FTOA 3MVLA 4GK3A 2PE2A 2LAVA 1WMKA 3Q5ZA 5TT7A 4FVPA 2QODA 4BDKA 2VU3A 3GC9A 3LJ0A 4MF0A 4AX8A 4A07A 5BVOA 5JGBA 1FOTA 5HG8A 3HGKA 3WILA 4QO9A 4RFYA 4PMMA 4XG3A 2BAJA 4MCVA 4AZSA 1CSNA 5CI7A 4KRDA 3E8DA 3PWDA 2EWAA 4JBPA 2JBPA 3UYTA 4JLCA 3RZBA 3E5AA 4FTLA 3V01A 3EFKA 4AWIA 1KOAA 4EQUA 2C68A 4U81A 4ZSEA 1E1XA 4UWBA 1K3AA 1YOLA 4V0GA 3RP9A 4TWOA 4AOIA 3LKMA 2VWIA 4WG4A 3PLAE 5FRIA 3C0IA 2HW7A 4E93A 4IJ9A 5A14A 4J96A 2QI8A 4BCKA 5GHVA 1UU9A 3VBYA 4CZUA 4CV8A 3D7ZA 1OL2A 2XF0A 3FPMA 3QU0A 3DCVA 4NSTA 3R8PA 3V3VA 4P2KA 3SHEA 3MIAA 3OS3A 2WO6A 3WZEA 4OBQA 2UZLA 5AR3A 2YABA 2PVYA 3O17A 4ZK5A 3SXRA 4EOMA 3NVMB 1E9HA 5AR7A 3TZMA 1JKTA 3EKNA 1KV1A 5LWMA 2XJ0A 4W8DA 4AU8A 4FV3A 5LCKA 4BICA 2YM5A 3KK8A 1U4DA 3R00A 4G5JA 4TPTA 4YHTA 4MYGA 4E4XA 2VTLA 1HOWA 4IM2A 2HYYA 2BDJA 3ZRKA 3F88A 3EZRA 4W4YA 4L6QA 4AAAA 3DXQA 5EYCA 5BYZA 1W7HA 2C6OA 2PMIA 3DK6A 3KC3A 3ZM4A 3DPKA 5DFPA 5EOLA 4L7SA 4FT0A 3UYSA 4DFLA 3ENHA 2OJGA 4FT9A 4E5WA 4R7BA 4BCIA 3OCGA 4YBJA 1JLUE 1YI6A 1V1KA 2O64A 2IZTA 3IW5A 2QOKA 2H96A 4O21A 3Q52A 5GNKA 1OL6A 1WVYA 3LJ1A 5E8TA 3HV4A 2R3NA 4BGGA 2WOUA 5AX3A 5HBEA 1J3HA 2E2BA 5DWRA 3NS9A 2JIIA 5AADA 1CKIA 5CAOA 4WHZA 2CHLA 3CTHA 5ANEA 3SXFA 3ACJA 2XMYA 4KS8A 3KF4A 3CKWA 2WTKC 2QOFA 3UG1A 3KULA 2DYLA 4L8MA 4RA4A 2BZJA 4RJ8A 4OAVB 3I81A 2B9FA 3DK3A 2JIUA 3QAME 3EQRA 4IWOA 4NIFA 1W82A 2X39A 3DLZA 3VBWA 4RJ6A 4BYIA 4EHVA 3C4FA 4CKJA 3FL5A 3VUTA 4KKGA 2ETRA 4JVGA 4M69A 5DR6A 5IISA 2HXQA 2JD5A 4BDAA 2CMWA 2FB8A 5HTIA 2XBAA 4BCFA 1P4FA 4X0MA 2PUNA 2AYPA 1ATPE 2EB3A 3R2YA 2YDJA 3WZJA 4FA2A 3PA5A 4QTDA 1GZKA 3LVPA 3MS9A 4FC0A 4FX3A 1RE8A 4LMNA 4ZOGA 4RVLA 3LIJA 3M42A 3ID6C 3MPAA 2VTJA 3DLSA 5J9ZA 4BDJA 4QMOA 4YPDA 1XBBA 3EQFA 4XLVA 4FTTA 1ZLTA 2OF4A 4TNBA 3R8ZA 3UODA 1WBSA 4H36A 4HZRA 1Q62A 1TQMA 1NVRA 4AT5A 3KFAA 1QMZA 2XNEA 5AV4A 4PF4A 2W1HA 4ZXTA 3OXTA 5AUUA 4KIKB 2JDTA 4KSQA 2GQGA 2VTAA 4XV3A 1VZOA 4QMVA 5D11A 4MF1A 2C69A 4RX7A 1OITA 3DTCA 4D1SA 3W10A 2CLQA 2X7GA 4J97A 4RQVA 3FV8A 2GNFA 4AGUA 2J2IB 4HOKA 4FIFA 5AP0A 3VF9A 5AM6A 5EQEA 4C4JA 3DBDA 4BZDA 3NSZA 4IZ7A 3C4ZA 3K5UA 4FMQA 4PP7A 2R7IA 1ZOHA 3FLWA 1J1CA 2PSQA 4JDJA 4K33A 3SDJA 2CGXA 3BYUA 3FLYA 3FSFA 3VS3A 4PRJA 4N57A 4MD7E 2BKKA 4IAIA 2ITQA 5GIPE 1G8SA 4WKQA 4CKRA 1UWHA 3C13A 4FV5A 5CF8A 3HZTA 2PVMA 5IH5A 5E1EA 1SVGA 4O7ZA 4GT4A 4X2NA 3REPA 3HV7A 4EQMA 2CNQA 3FI2A 5M06A 3MH1A 4S31A 1CKJA 4M68A 2ITTA 3A7FA 3QD0A 4IMYA 2WU7A 4O7YA 4L42A 3SRVB 3A8WA 4UALA 2CCHA 4YC6A 4W9XA 5E91A 2WU6A 1NVQA 3UQFA 1NT2A 1ZYDA 4UMQA 1WBOA 2W96B 3AGMA 4O0UA 4ANQA 4RWLA 5CNNA 5CLPA 4RZWA 4IH8A 1UWJA 3R9RA 2V7AA 3G9LX 4KD1A 3KREA 2PL0A 4FGBA 1XH4A 4R5YA 4JG8A 5L6OA 4RIOA 4WD5A 2FGIA 4YPSA 3U6HA 4IADA 3DDQA 4JNWA 4BN1A 2REIA 3CD3A 1XHAA 4G31A 1Y91A 4BDEA 2BAKA 2C0TA 3ZLYA 4GU9A 4FV7A 2YIQA 3R71A 3GOKA 1ZZLA 5AA8A 3BGQA 5CY3A 4ASXA 4RVTA 3DB6A 4RVKA 1O6KA 2GMXA 1YWNA 4IW0A 4FV6A 3R8VA 4ZLYA 3COMA 4FNWA 3RM7A 2WMVA 3U54A 4YHFA 5LVOA 3AC5A 4BWPA 3R73A 4EBVA 4MTAA 4FVRA 3CY2A 5L2WA 3LXPA 3VS7A 2PHKA 2ZJWA 4QPMA 3SLSA 5I0BA 2O65A 4IWQA 1Q5KA 4X3FC 5HICA 3ETAA 2BRNA 5AP1A 5G1XA 3I0OA 3NRMA 4YGAA 2PWLA 4D4SA 4BDFA 1I44A 4IM0A 3RPRA 5IQAA 4QPSA 5I9XA 3RNIA 3HP5A 1JSVA 3Q9ZA 3QL8A 2C5YA 4HZSA 5EDPA 4BF2A 2C5XA 1YHVA 5ANGA 1OI9A 3OY1A 3THBA 3WIGA 4YZCA 4IX3A 1OUYA 3ORZA 1JVPP 4BBMA 4CYJA 4Y83A 4FZ6A 5M4IA 1A48A 4IM3A 4EHZA 3FZPA 2WB8A 2YLEA 2YM7A 2ZDTA 3DNDA 3QZHA 5CX9A 3TCPA 4IEBA 4EJNA 5CZIA 4DFUA 4HYHA 3KCKA 5AV3A 4KWPA 2W4OA 3R7OA 3ZMMA 5A4CA 2WFYA 3CGOA 3KY2A 2YHVA 3WI6A 4F1TA 3E88A 5ANIA 2BROA 5KMLA 4EC9A 4PL3A 5AV2A 3VHKA 5KKRB 2VTMA 4EI4A 3GFWA 1MUOA 3HL7A 3IDBA 2A2AA 4GFMA 3UC3A 4YJRA 4EH5A 3ZU7A 3R0TA 5EW3A 3ALOA 5AUWA 3ZUVA 1JQHA 2W9FB 5KMNA 3TM0A 2A4LA 1YXXA 1YKRA 3CS9A 2HXLA 3NUNA 3FYJX 3ITZA 4X2JA 3DBQA 5LOHA 4IANA 3E7VA 5AFVA 4AF3A 5J1VA 2GHGA 5L6WL 1LEZA 2YJRA 5CENA 5JT2A 1PXIA 3LE6A 4GJ2A 2BCJA 3DV3A 3UNKA 2WQNA 1ZMUA 2XJ2A 4HYSA 4B8LA 3EN9A 3MGYA 4FKPA 5CNOA 4H39A 4Y95A 4C4FA 5E8SA 3UOKA 3O0GA 3MTFA 4U7ZA 4AW5A 5LVMA 3CTJA 4LRMA 3OBGA 4BFMA 3R1QA 4FSWA 4IC8A 3V5LA 4GYIA 4RG0A 5EW9A 2NP8A 3LXNA 4CKIA 2WMRA 3SGCA 4D58A 4DGOA 2R3OA 3HP2A 3PP0A 4CLJA 4JDIA 2VZ6A 3AD4A 4O6LA 3U8WA 4W8EA 2IW6A 3ORIA 1ZAOA 2QO7A 2YM3A 3R9DA 2C3LA 4LRKA 4FTAA 5F94A 3W16A 4XHKB 3ZUUA 3IW7A 3O51A 2XP2A 4XG4A 1OKWA 1BL6A 2QR8A 4M12A 1UA2A 5M4FA 5TR6A 2F2CB 3H4JA 4IDTA 3ZUTA 3AMAA 4DH1A 4FG9A 2XYUA 2Y7JA 4D4RA 2VTHA 4PDYA 4QP8A 5J5TA 4JIAA 3COHA 2RGPA 5BVFA 2C6LA 5EH0A 1ZRZA 2OLCA 2YEXA 4KRCA 2JAVA 5HVJA 2PVKA 2YIWA 2J9MA 3LZBA 4II5A 4UBAA 4FIJA 3CJGA 4QYFA 4RJ4A 5I9YA 4DLJA 3I5NA 3L8SA 2Y9QA 4C61A 5EW8A 5A9UA 4YJTA 3P79A 3DKGA 5HLWA 4O7NA 5AP6A 2QOLA 4CLIA 3KGAA 2JIVA 3BGPA 5H8BA 4FUXA 1VYWA 1J1BA 5DMZA 4NM5A 3MFRA 4UV0A 4UYAA 5IA2A 4PWNA 4I0TA 2RKUA 3EN7A 4R77A 2W4JA 3EOCA 1ZZ2A 5CVHA 3Q04A 4ERKA 4B0GA 3F5PA 3W33A 3PYYA 1QPJA 5AUVA 2E9OA 3H0ZA 1Q3DA 1T45A 3AOXA 4NCTC 5HNIX 4QYYA 4XX9A 1FGKA 3PY3A 5JFXA 3L9MA 2C1BA 1B6CB 4DLIA 4GG5A 1M2RA 4ZY6A 3ZFXA 3R63A 3I0QA 3MFUA 4CZTA 2OJIA 5L8LA 2OXDA 3V8WA 1SMHA 2Q0NA 2Y6MA 4GUBA 4JR7A 4ZTSA 3RK5A 4DF3A 4S33A 5E8ZA 5L2SA 1ZYSA 3EQDA 4R78A 2PMLX 3DQXA 4BCMA 2R3MA 3IPHA 3JXWA 2C6DA 4L3LA 3R7VA 4BC6A 5KNJA 2GQRA 4O1OA 2PZYA 4FZ7A 4Q9ZA 1YHSA 2W1GA 2XRWA 2YM4A 3FI3A 4GT3A 4XP3A 5KUPA 2PULA 3GCPA 4PPAA 4DA5A 1UNGA 2J7TA 4XCUA 4KBCA 4XP2A 3CTQA 3HMPA 4Q9SA 2B0QA 5E8YA 4KIKA 1M2QA 1OVEA 3G2FA 4OW8A 2WELA 4FTNA 4IIRA 4F7LA 4FEVA 2RL5A 2J90A 3GBZA 3ORNA 5M09A 3EYHA 4NL0A 3EQBA 4G6LA 3GU6A 1XR1A 2JC6A 4PDSA 4Z7HA 1V0OA 2X9FA 4Z55A 4WT6A 3E8NA 5FLFA 4FR4A 4GRBA 1ZMVA 2QC6A 4UWYA 1FQ1B 3Q4ZA 4DFZE 4EONA 3PVWA 3VVHA 4DG0E 4B9DA 1O6LA 1JWHA 4YNEA 4BYJA 4NJDA 2WOTA 3QWJA 4FUYA 1H1PA 4D4VA 4MAOA 3R8UA 4XBRA 3PZEA 5FEEA 3KL8A 4HGEA 5C27A 1OPJA 3ZONA 5AEPA 3O8PA 2FO0A 3Q32A 2UW9A 4QP4A 4EYJA 3TDVA 2O63A 1Q24A 5CEOA 3NNUA 2OU7A 5TKDA 3WF7A 4AUAA 3NNXA 5AA9A 5T6KA 4E8AA 1KE7A 2RIOA 5HCZA 4CG9A 4F6WA 2B4SB 4DAWA 4PL5A 3A8XA 2CSNA 5EHYA 4FZDB 2C4GA 4WBBB 4DCAA 1OL1A 4IQ6A 4O84A 5EM6A 3MJ2A 3EN5A 4TW9A 4KKEA 1XBAA 3ROYA 2OWBA 3W1FA 4ACGA 4YZMA 2RFDA 4BI0A 3ZC6A 3ORTA 3U4UA 5K4JA 2XK8A 2RG6A 2BZHB 2ZV8A 2X0GA 3OW3A 4L43A 5AP5A 4D55A 4DG2E 4I24A 1RJBA 5DT3A 3I6WA 4FSMA 4YJOA 4FV8A 4Y73A 3V04A 2VAGA 2PUIA 1MRVA 3FMNA 1JPAA 1WBPA 3VBVA 1TKIA 3A61A 4P5ZA 3WZKA 4FZFB 2VO6A 3KXGA 4RRVA 2HELA 5AP4A 4BDGA 5B7VA 3FZOA 3A7GA 5LVPA 3F2RA 5ANKA 4J8NA 2OH0E 3F5GA 3QYZA 5FP6A 4CMOA 3I79A 2UZNA 4FIIA 4QPAA 3VW8A 5FXQA 3ZYAA 3IDPA 4FOCA 3CP9A 4WSQA 3O50A 3PXZA 4L67A 4X6RA 5IQCA 4CSVA 4BRXA 5LMKA 4EH6A 2UVZA 4BDHA 4XG2A 5AUZA 4RT7A 1KE8A 4IZAA 3Q53A 4M69B 2OH4A 2WTDA 3R9HA 2P2IA 4LM5A 4EK3A 5BVEA 4YTCA 3R30A 3F69A 2CNVA 3BLRA 4QQJA 4BCOA 4FTRA 3FMKA 5DYJA 2PVFA 2GNGA 4EKLA 4RQKA 5CSPA 1Q99A 4D0WA 2WMTA 3CEKA 3COIA 1GZNA 3RHXA 4IVAA 5IQEA 3SV0A 2XK3A 3NW5A 4C35A 4MBJA 3IW8A 2VTOA 4QP6A 1I09A 4S34A 3KXMA 2HZ0A 5ACKA 3HEGA 3IECA 2IVUA 4IX4A 3FL4A 4GL9A 3CPCA 4MNEA 4UWCA 2J50A 3ZLWA 3C51A 3EQGA 5HLPA 4QYHA 5A4LA 5C8NA 4U97A 3DAKA 5HD4A 1CKPA 1WFCA 3FLQA 3NUYA 4ITHA 4B99A 3QFVA 4EH9A 5A6OA 4KAOA 5KZIA 3HKOA 1J91A 4L46A 2YIRA 5CU4A 2QKWB 3L9NA 1H1QA 3VS5A 3F5UA 5IUIA 3GC7A 3IQ7A 3ZXTA 1OBGA 2XKFA 5LVLA 3LCKA 3LJ2A 4E20A 3AD5A 4HCUA 4YMJA 2WQBA 4C37A 3DKFA 2BMCA 5A3XA 3QZIA 5HTBA 4CG8A 5IA3A 4D9UA 2QU6A 3IOKA 5EI8A 4ZLOA 5BUJA 3F9NA 5ANJA 3RGFA 3CKXA 3OT3A 2BZIB 1SNXA 4GEOA 2ITNA 1BLXA 3OROA 1Y8GA 3S00A 2IPXA 2BFYA 2QOHA 2JDVA 4DEEA 4MXCA 2R3PA 4I92A 5AX9A 1UNLA 3QRUA 5HX6A 2WIHA 3GCQA 4V04A 3TKUA 1ND4A 4OLIA 5FEDA 4HVIA 4H05A 3P23A 2OIQA 3OMVA 3D5UA 4QP2A 3OWPA 5GZ9A 1BYGA 1Y8YA 2WTWA 3PVUA 1PXMA 2W1ZA 4PDOA 1REJA 4BBEA 4EOLA 4E6DA 3Q6WA 2DS1A 2UZUE 3PXKA 5ANDA 5L2QA 3QYWA 4O7RA 3FMDA 3LFCA 4GW8A 5CSWA 3KF7A 1H1WA 2WZJA 3B8RA 2JKMA 3PXFA 3GQLA 5HGIA 2Z7QA 3OCBA 2QHNA 1Q4LA 3QBNA 4WG5A 5DEWA 5E8XA 4BCJA 2WMWA 4FSNA 4FKJA 2F7EE 2UW5A 4EOIA 2V62A 2KTYA 2IZUA 1U46A 3CIKA 3VS1A 3KKVA 5DA3A 3U9CA 4PX6A 1U54B 5IQFA 3CCNA 3OCTA 4QMXA 2BHEA 3DZQA 4AA0A 3NMUF 4Y72A 1SM2A 1DAWA 4A9RA 4EZ3A 5E90A 4I3ZA 2VWUA 4CYIA 4NWMA 4AGDA 4AE9A 4B4LA 4HNIA 3GENA 4ZJVA 5IPJA 2OICA 3EH9A 3V6RA 3S2PA 4F9YA 3LFBA 2XM9A 4C57A 2UZTA 4X2FA 3DJ6A 1IG1A 3LQ5A 5M51A 4F9BA 5A4QA 2F7ZE 5M44A 2RFSA 4ZEGA 5IUHA 4XG8A 5FQDC 3UQCA 3ELJA 3OC1A 3HRBA 5E9EA 2Y4IC 4FBXA 3EFJA 1R39A 3WYYA 4V01A 1AQ1A 4QQ5A 2R3QA 4W9WA 3PE2A 2QKRA 3MA6A 4H1JA 2CDZA 4BTJA 4ZZNA 3QGYA 3IOPA 2UVXA 3FXXA 4GFOA 4HPUE 3VBXA 3BE9A 3QTIA 1H00A 3VS2A 2QOQA 3BYSA 4ZZOA 4BHNA 3ORLA 3BU6A 2RSVA 4F1MA 3PIXA 4O0WA 4OTDA 3EL7A 4ZZMA 4U40A 3DA6A 5CZHA 3TIZA 1DI9A 4FV4A 4YC8A 4PQNA 2P33A 4ALVA 1WVXA 2QNJA 4JDHA 4QTBA 3NX8A 4C38A 1ZOEA 4EZ5A 4GUEA 1ZMWA 4G3FA 4AA5A 3ZDIA 2VO3A 3N9XA 3Q96A 4RIYA 3G90X 2UV2A 3UIMA 4MBIA 3QTRA 5HU3A 3BYVA 4XV1A 3F3WA 3DQWA 3KRXA 3RVGA 1YXTA 3K3IA 3W8QA 2W9ZB 2RFNA 4J7BA 2EVAA 4S32A 1PKDA 3VS4A 5HO7A 3C9WA 2OO8X 2GHLA 4UXQA 3R02A 4DE4A 2XNBA 3P7BA 4Y5HA 2XKCA 3F3ZA 3NCZA 1X8BA 2QOBA 5E92A 4FICA 4Y8DA 3G0FA 3QA0A 4G1WA 4TKSA 4GK2A 4BCNA 3N51A 1YXVA 4EEVA 1FGIA 3ORPA 3E63A 5AR4A 3LFFA 4I93A 2C0OA 3SG8A 4ZY4A 3Q9WA 4BZOA 3D5VA 2VRXA 3LXLA 2ITUA 5CU0A 4TWPA 5DT4A 4ZTMA 3ATTA 1CTPE 2W06A 2XIYA 2DWBA 3ALNA 4IB5A 1H27A 2UZWE 3R7UA 4EOKA 3UPXA 2UZEA 3N4UA 2BDFA 4EL9A 1BUHA 2FYSA 3LMIA 4R8QA 5C4LA 3VF8A 3FZTA 4QYEA 4AA4A 4O38A 3PIYA 4TY1A 3GU8A 3NLBA 1REKA 4F08A 1OIQA 3WE8A 5FXSA 4MD9E 3E87A 4OBOA 2WXVA 2CNUA 4IHPA 4ZLZA 3JPVA 2VWXA 4W4WA 2XS0A 5IEVA 2G15A 3C4CA 4K11A 4DEBA 2PY3A 4ENYA 5A6NA 4BCHA 5JZNA 3PDTA 1VEBA 1Z5MA 4PMSA 3GEQA 5H3QA 3JY0A 4O0RA 3UZPA 5FG8A 1XH5A 3IO7A 3D7TA 4USDA 2R2PA 3QX4A 4HVHA 3ZRLA 4W4VA 3IGOA 3ODZX 4GKIA 1XH9A 3QQGA 2OJ9A 4I4FA 2C5NA 4NZWB 4DT9A 5D1JA 2W7XA 4FTUA 3FI4A 4YTIA 5AUYA 4O1PA 3VUKA 5ETIA 2YCSA 3L8VA 3A7JA 3MIYA 4EWHA 4E3CA 1JSTA 2A0CX 3UC4A 5L8KA 3QRKA 2HZIA 2VO0A 3BHYA 4MQ1A 2OZAA 3QKKA 4QYGA 4UEUA 2P2HA 3KRRA 3ZEPA 3I1AA 3QTWA 4A7CA 4LOOA 4PPBA 2R4BA 4FIHA 3RK9A 1FVTA 2XJ1A 1RQQA 4BIBA 4F70A 2WMBA 4A4OA 4FNXA 2X81A 3PXYA 3BE2A 2YN8A 3LPBA 3IKAA 3CBLA 4MXYA 4DINA 3F3TA 2W5BA 3FMEA 1DS5A 4TT7A 3LLTA 4HVGA 5DHJA 1PKGA 2HAKA 1XWSA 4ZY5A 3BI6A 3D15A 3DTWA 3C4WA 2FVDA 3BHHA 3KU2A 3TI1A 4HYIA 3EYGA 3HDMA 3E3BX 2BPMA 3MFTA 5CF4A 3MH2A 3BYMA 1XH8A 4IAKA 5KHWA 3W2RA 5DH3A 3LAUA 4XLIA 3SW4A 4FV9A 1YDSE 2QVSE 3IW6A 4PDPA 3E62A 2QG5A 2QU5A 3FQEA 5EI2A 2PVNA 4NM7A 3EQHA 4ANSA 4QTAA 4DTKA 4IAAA 4F7SA 4A9YA 3RZFA 4MWHA 4LGDA 5CF6A 3FLNC 3KQ7A 4F0FA 3GU7A 1OBDA 3TNHA 2YACA 4DH8A 4EH4A 1R78A 2VGOA 3GNIB 3K5VA 2UW0A 1LUFA 3QZFA 5KZ0A 1MP8A 1TQPA 4AGWA 1FVRA 3D83A 4FKSA 4H3BA 4QTCA 3PSBA 1P2AA 1NY3A 4JR3A 2QOIA 4LFIA 2RF9A
chains in the Genus database with same CATH superfamily
4JQEA 4JG7A 4JIKA 4JS8A 2YZLA 4M84A 2J0IA 2VGPA 2PE0A 5CTPA 3VULA 3U6IA 3PVGA 4LG4A 3W0SA 4RZVA 4YUQA 1B39A 1OKVA 1WBWA 3CJFA 3NW6A 4ITIA 3UOHA 3ML1A 4Z9LA 2QLUA 2Y6OA 3CXWA 5EYDA 4IWPA 2FSOX 4U3YA 5EYMA 5J79A 1V0PA 4AZWA 4YJVA 4H58A 1M52A 4D2WA 1WZYA 3AC8A 4O7LA 3Q2MA 3F5XA 4O4BB 5IA0A 3NIEA 2BALA 1UU7A 1YW2A 3HV5A 3ZHPC 2FSMX 1UU8A 1B38A 2WTVA 3OOGA 4FOBA 5ETFA 3TEIA 4AOJA 5J9LA 4WRSA 5EI6A 3R7YA 4BZNA 4U5JA 1SZMA 2Z7LA 4GJ3A 4QTEA 4YURA 3LQ3A 3ZM9A 3MI9A 3QRIA 4I5CA 4HJOA 5HZNA 3PUPA 3MVHA 3POOA 4E4NA 1LR4A 1YVJA 3BHVA 1PYEA 5AMNA 2Y4PA 4C33A 3B2WA 4CD0A 4MXAA 4CTBA 4I6BA 1YDTE 4J1RA 3VIDA 3UZRA 3RI1A 2JGZA 3Q4UA 2C6IA 2R3GA 2C5OA 3TG1A 3COKA 4FKLA 4BBFA 1IA9A 3PZHA 4X3FA 5D7AA 4GMYA 4WRGA 3LFEA 2R9SA 3V5JA 5CEQA 2PVJA 3WARA 2GTMA 3AXWA 4RWKA 3I4BA 3ZO1A 2X2LA 2XIZA 1U54A 3GGFA 3NWWA 5JFSA 4YHJA 2PVRA 3NUAA 2Z2WA 1KOBA 1OIYA 3C4EA 4QNYA 4ACHA 4JX7A 4C3RA 2QO2A 4QP7A 4XYFA 3TT0A 2C3IB 2XKEA 4DCEA 4XEYA 3QCQA 4NM0A 3E7OA 4MK0A 2F9GA 2HY81 5JRSA 3RNYA 4UMUA 1W8CA 1STCE 3KRJA 1S9JA 2E9PA 4C2WA 2HCKA 3F2NA 4G9CA 4NFNA 4LGGA 2XARA 2W99B 4FI1A 4X21A 3ENMA 5CVFA 1O9UA 4FSUA 4YJNA 2C0IA 1H08A 2H8HA 2WGJA 3FXZA 3V51A 3PPZA 1NA7A 5IEYA 5CAUA 1XMMA 4QQTA 3KVXA 3EMGA 2R0IA 4D2RA 2RFEA 2Z60A 5KO1A 1ST0A 1LEWA 3UIXA 2ITPA 2IG7A 3KMUA 4RFMA 1OIUA 2OI4X 3OW4A 3JY9A 2WQOA 2X2MA 1W98A 3FLSA 3L8XA 5DLSA 4U8ZA 4F1OA 4ITJA 5BYLA 3MSSA 5DN3A 2W1DA 5CXHA 4XUFA 4WUNA 5AV0A 2I0YA 2J0KA 3OT8A 4TYJA 5GIOE 3BZ3A 2WTJA 4IFCA 2DQ7X 4IE9A 3VBQA 3NYVA 4RWIA 4MNEB 1XKKA 5DI1A 3ERKA 3QCSA 5F20A 2PZ5A 3H9FA 4ZS0A 5H2UA 4RPVA 4BWKA 2XALA 3OHTA 1DI8A 2YZAA 4FK3A 4DN5A 4DT8A 4ANLA 3UNZA 2H34A 4G3EA 4RFZA 5DT0A 3ZDUA 3LFDA 4DGLC 3R7GA 3V5WA 4BTKA 3H3CA 4O82A 4AS0A 1PW2A 1PMUA 3BX5A 5HVKA 3UIBA 2ITYA 4DHJA 3FZRA 3KXNA 4R3PA 4OTGA 2GU8A 4S2ZA 4U6RA 4EK5A 3WF6A 4RJ3A 4ZTHA 3AC2A 4L7FA 4FEWA 3NAYA 4FKUA 4K18A 4Y46A 5K9IA 1G8AA 3ZSGA 2CLXA 3A4OX 3LQ8A 5K3YA 2OFUA 5HIEA 5FBOA 4CZYB 5HI2A 2C3JA 1GY3A 2UZBA 4FTIA 3BHUA 3A7IA 3NR9A 4MNFA 4OTHA 5KMOA 4DBXA 3MBLA 3DFCB 4YLLA 4MXZA 4PP9A 3RAHA 2XZSA 1CDKA 1PY5A 5FM3A 3SC1A 2NNWB 3NPCA 3OWLA 4IX5A 5HLNA 3NW7A 4NFMA 4WNMA 3BQRA 3EHAA 5CT0A 2CKQA 3OCSA 4BB4A 4KUJA 4EJ7A 3HMMA 4FKTA 5IU2A 5FGKA 5HKMA 5FP5A 3VONA 5BUEA 2X9EA 3D2KA 1GIHA 4XJ0A 4FL1A 4YZ9A 2PMOX 3OD6X 5KMJA 4FL2A 3E92A 5IQHA 2ITWA 4RMZA 2PZRA 3NUSA 3FKNA 3G51A 3Q9XA 5HESA 4I6QA 3VJNA 4NW6A 3IONA 4O2PA 4IVCA 4UB7A 4DEIA 3EQCA 4EH7A 4O0VA 1YXUA 2YIXA 2OIBA 1Q8YA 2R3KA 2ZMCA 3VW6A 3BWFA 4QEBA 3PJCA 4XBUA 5CEPA 4EH3A 1ZARA 3EFLA 2F57A 3RINA 4ANBA 2ERKA 3QLGA 4FTCA 3MVJA 1H01A 5HIDA 4FSYA 1H24A 5JSMA 1R0EA 3UOJA 3QX2A 4ACMA 2GS2A 5CVGA 2XAMA 5AUXA 3R1SA 2VD5A 2I7QA 4C4IA 5I9ZA 3BV3A 1PXPA 4YZBA 5M08A 1A9UA 3DKCA 3HLLA 3R28A 4YBKA 4AXDA 3ZO2A 4DH5A 5D41A 3AMBA 4NCTA 5LWNA 2Y4IB 2PMNX 4K77A 1GZOA 2ESMA 3QCXA 3PG3A 4RIXA 5C8KA 4O0YA 1U59A 2ITOA 4I0SA 3RAIA 4KBKA 5LQFA 3U6JA 3PG1A 4DGNA 2NRYA 5IEXA 3NEWA 4QNAA 1L8TA 1YI3A 4BCGA 2B7AA 4BWXA 4J98A 3NUUA 4YJQA 1JKKA 4HVDA 4XV2A 2BRBA 3PPKA 2J0MB 2IWIA 4C36A 3O7LD 4QP9A 2JKOA 4O86A 4IJPA 5DPVA 4L9IA 4HCTA 1OKZA 3DY7A 1BX6A 4EKKA 1GZ8A 4G5PA 5K5XA 2W0JA 3IG7A 3QQKA 4WNOA 2EB2A 3R7IA 3QD2B 4YZNA 4IB0A 2I6LA 3V8SA 1OKYA 5FD2A 1CM8A 5BX0A 3V8TA 2G2IA 4BY9E 5AJQA 1VJYA 1WBNA 4J99A 4TL0A 3AC1A 3BIZA 3A60A 3OXZA 3W32A 3QA8A 3W2SA 2ERZE 3NUPA 4RVMA 5GJFA 3UZTA 3FMLA 5BVDA 2HENA 3PJ1A 2UZVA 4FT5A 2GDOA 2ITVA 3W2CA 1FMKA 5BPYA 4GV1A 3PRIA 1F5QA 3BRBA 4Y5QA 4RIYB 1URWA 1PXNA 4HVSA 4QMNA 2AEGA 1PXJA 2CCIA 4MX9A 3MESA 3SG9A 3ULIA 1FINA 3FZ1A 3VAPA 4FKRA 5CQWA 2Z02A 4F7NA 4AW0A 4U0IA 5H9BA 1Q8WA 3TN8A 3VQUA 3ZFMA 4ACDA 5J9YA 3CSVA 1AD5A 4QP3A 3O8TA 3OZ6A 2YIYA 3JVSA 4XP0A 5DGZA 4C62A 4D2TA 3MB7A 3CY3A 1PMNA 3HMNA 4D2PA 2J51A 5C4KA 1QPCA 3RCJA 4QMLA 2P4IA 3QQFA 4AZTA 2VNYA 4DBNA 4HCVA 3TNPC 4R7IA 2WAJA 4C3PA 4DEDA 1ZYLA 3CLYA 4LQMA 3OEFX 4J95A 4EORA 3RBWA 5BVKA 4I41A 4L00A 5A4TA 4YTHA 4O7WA 3TTIA 4BHZA 1W84A 3G15A 2J5EA 2VV9A 4KSPA 2ZM4A 4BVUA 3RWPA 4OT5A 3RWQA 3VHEA 2PU8A 1H0VA 3GU4A 1IAJA 3L9LA 4QQCA 3OUNB 1FPUA 3TNWA 1G8KA 4G6NA 5D10A 5JQ5A 1APME 2YDIA 5JGAA 4M13A 2A19B 3UJGA 2XK9A 2FSLX 1XBCA 1JKSA 1R0PA 3CD8A 2GFSA 4FL3A 2XCKA 4WA9A 1IRKA 2BIKB 4JL9A 1XQZA 2WTKB 4BKZA 5D7VA 3E64A 3C4XA 4EHEA 5HG5A 3D7TB 3NIZA 5FDPA 4X3JA 5M55A 4RX5A 4FEUA 3T9IA 2IW9A 5CSVA 4CV9A 1M2PA 3UOLA 4LL0A 1HCKA 2W1CA 3I5ZA 3VNTA 4I6HA 5EFQA 4DH7A 1IEPA 3MTLA 2CKPA 3QXPA 4CCUA 5F95A 3H0YA 5EG3A 3OBJA 5J95A 5F1ZA 4WNPA 4M0YA 4FKQA 3UNJA 4YJUA 1XH7A 2OZAB 2BRMA 4RIWB 4P5QA 3HA6A 3WZUA 4DEAA 5AP7A 3EQIA 4BCPA 3VUHA 5EHLA 1LP4A 4PUZA 4PNIA 5EDQA 3W2QA 3UP2A 4AXAA 3NFFB 2OJFE 4ARKA 5AAEA 3PTGA 4R5SA 1YHWA 3HYHA 3NZ0A 4IVDA 5HEZA 3QQLA 3T3VA 3LFQA 3BBTB 3VC4A 4FEQA 3RM6A 2C6MA 3R1NA 3OVVA 4CFMA 2IEWA 3EZVA 3ZRMA 5C03A 4OTWA 3CR0A 2XCHA 5HOAA 4A9SA 4JG6A 3HVCA 3TV4A 2XUUA 3D5WA 3ORKA 5KMIA 1J7UA 4JI9A 3F6XA 1OB3A 3DU8A 5EYKA 5EHOA 3BKBA 1OIRA 1MQ4A 2QO9A 4C2VA 4U42A 3R8MA 5LCJA 3F82A 3E8EA 4C8BA 1UKHA 2YFXA 4RLKA 1U5RA 3UVRA 1H25A 1H4LA 2Z8CA 1QCFA 3II5A 4C34A 2BTSA 5JFWA 2XVDA 3I6UA 4CFUA 2E9UA 4QMTA 2CN5A 5E7RA 3R04A 1OM1A 5JGDA 5AUTA 2QCSA 5IDPA 2OG8A 4I5HA 4ZJIA 2XNPA 3FZSA 2ZFYA 1F3MC 3CE3A 3F7WA 4NKAA 5I9UA 3MVMA 3BGZA 4LV5A 3M11A 3O2MA 3GXLA 4C7TA 3QQJA 4H3PA 3JS2A 4BKJA 4CRLA 2XIXA 4MH7A 1EH4A 4UZDA 4E6AA 4LYNA 3U9NA 4NYEA 4I21A 5HBJA 1PMVA 4L01A 4BDBA 2ZV2A 3ATSA 3RAKA 2IO6A 2YDKA 1YOMA 4P4CA 4G3CA 5HNBA 1BI7A 5T68A 4ENXA 2YM6A 3D4QA 3ANRA 5IQBA 3RPSA 2F7XE 1URCA 3FEGA 3F7ZA 4IACA 4D5HA 2C30A 4JQ8A 4F0GA 4JBQA 4YU2A 3GP0A 4IFGA 4N6YA 5KBQA 4WIHA 3O23A 5AR2A 5M57A 4X7QA 3TZ7A 3CGFA 2C47A 4KIOA 3Q5IA 4MWIA 1NVSA 3IGGA 4R3RA 1LPUA 1OL5A 4G9RA 1G5SA 2BRHA 5BMSA 5J8IA 3S95A 3V5PA 4NH1A 4QMWA 2PUPA 2B9IA 4D5KA 3DAEA 1MRUA 1YI4A 2C1AA 2PZIA 2VWBA 4O2ZA 2I0VA 4AQKA 2X4FA 5EKOA 2XIKA 5GINE 4A06A 3TUDA 3I60A 2H6DA 3QGWA 4PMTA 3RTPA 1H28A 3QKLA 4YSJA 4JAJA 3BWJA 4EH2A 4AFEA 4FE2A 2NPQA 3BLAA 3Q6UA 4AGCA 4B8MA 3FKOA 3P08A 2HWPA 4GU6A 4XOYA 4EOJA 2IF8A 5HTCA 3D14A 3DS6A 3O5AA 3LHJA 4GT5A 4XMOA 3OUKA 4JQ7A 2V7OA 4UXLA 2XK6A 4X3FB 4ZTRA 4DFXE 5J7HA 2XNNA 3C5UA 4KIQA 5HE3A 3TNQB 4O7SA 4OT6A 4YLKA 1O6YA 1BI8A 5LMBA 4F6SA 4ANNA 2J4ZA 5E8WA 5CXZA 4DC2A 2VUWA 4LOQA 5EKNA 2ZDUA 4ZSGA 3QRTA 4DGMA 3PP1A 3QZGA 3DZOA 3MN3A 3DOGA 3O8UA 2IZSA 3PJ8A 4LL5A 5C26A 5L3AA 4UZHA 1H8FA 3G33A 3AD6A 3GU5A 3MWUA 4RA5A 5C1QB 2UW3A 3WF5A 3EL8A 4IDVA 5AP3A 5B2KA 3PRFA 3TTJA 4PL4A 4DFNA 3NVKI 2YA9A 2P3GX 3ZBXA 4EOPA 1E1VA 4QDVA 3ZCLA 4BGQA 2V0DA 2WMAA 3OEZA 3GC8A 4CVAA 2F49A 4JX3A 4Q5EA 4WG3A 4I4EA 1SVEA 3FC1X 3KEXA 3WF8A 4ERWA 2JLDA 4LGHA 4ZIMA 5C01A 4L45A 1WBVA 3GT8A 2GS6A 5KBRA 1IAHA 3QUEA 5EM8A 2NRUA 2Z7SA 2VTIA 3GOPA 4IX6A 2V5QA 5H8EA 4FEXA 1SNUA 3WYXA 4TYIA 4USFA 4N4SA 4AZVA 3AQVA 2X8EA 2R3JA 2XYNA 4E1ZA 4JBVA 4M66A 5KHXA 2A27A 1Q41A 5EK7A 2YITA 5I3RA 2CGUA 4JRVA 4NTSA 2UUEA 5DE2A 2Y8OA 3VN9A 4FNYA 4BI2A 3FSKA 4IVBA 3R21A 3QUDA 1FBNA 1P5EA 4KIPA 3R2BA 4E73A 3OTUA 5KE0A 2ONLA 4EOSA 1OPKA 3TKHA 3QHRA 3NYXA 4O0TA 1ERKA 3W8LA 2GPHA 2IW8A 5KMKA 4BGHA 4FTKA 4CXAA 5BYYA 2JEDA 4B7TA 2Q0BA 1XO2B 4HGTA 5D12A 3DJ5A 3KB7A 4D2VA 1G8JA 3WZDA 4LV7A 3EB0A 3TIYA 1PRYA 4EK8A 4LDTA 2QURA 2ETKA 4RC2A 1HCLA 2ONLC 2NYAA 3ANQA 4OGRA 4XV9A 3FYKX 2B1PA 4O7VA 4UMTA 5DVRA 4I20A 1ZOGA 3KXXA 3OTVA 4DYMA 5JKGA 2ITZA 3BCEA 4YO4A 4FT7A 4J53A 5TE0A 5AAGA 2X1NA 4F9CA 3JYAA 4TXCA 2IVTA 3W18A 1KV2A 2VTPA 3ZZEA 3FDNA 1GJOA 4FSZA 3UGCA 2O8YA 3FLZA 4ALUA 2Y0AA 2YCQA 3GQIA 4ACCA 4NM3A 4NW5A 1PJKA 5CQUA 3TWJA 5DNRA 2BFXA 4EUTA 1KE5A 1U5QA 4QOXA 2J5FA 1YXSA 4BDDA 4LUDA 4MBLA 3UO5A 5JK3A 2VX1A 4PTGA 2PE1A 4RBLA 1J7IA 3AT3A 2P55A 5I5ZA 4U41A 5IMXA 4LV8A 2IVVA 3MV5A 3E3PA 3KXHA 3PE1A 3MY1A 3G5DA 4FV0A 4Z16A 4ZSAA 1Q8ZA 3QUPA 4IBMA 3EIDA 4K1BA 5HCYA 5FTQA 1GIJA 5M56A 1CMKE 5C8MA 3RHKA 3HRFA 3RAWA 4GKHA 4ZSJA 2UW7A 4ANOA 4Y85A 1Q8TA 2XM8A 3P4KA 3FMHA 3DKOA 4IXPA 4ALWA 4I22A 3MA3A 2WKMA 2R64A 5CAVA 3NUXA 4CFXA 3B2TA 4TWNA 5TOZA 4YNOA 2JFMA 2O3PA 1PF8A 2WMSA 3QWKA 3KK9A 4FYNA 4M0ZA 2ZVAA 5I3OA 3UBDA 4BIDA 2G1TA 2BDWA 5K5NA 5A46A 4AG8A 4CNHA 3AKJA 3HUBA 4CQGA 4RIXB 3UIUA 4EYMA 3QRJA 4RIWA 5GZ8A 1W0XC 2X7FA 3QLFA 4L68A 5CU6A 4ZP5A 3Q3BA 4TYHA 3AC4A 2GNLA 3PJ2A 3GC0A 3A62A 5HHWA 5TO8A 2XBJA 2VTQA 3AT2A 3IW4A 2UW4A 2VTSA 4DG3E 5L2TA 3JUHA 3BELA 3DB8A 2W5HA 3SAYA 4CQEA 4JXFA 1SVHA 2W17A 2GSFA 4EH8A 2WMUA 4F64A 4EQCA 3WIKA 5DOSA 3FKLA 3KIOC 2HOGA 3DGKA 5HBHA 4GSBA 3MFSA 3ZBFA 5HG9A 2ACXA 4TYGA 4D1XA 3P7AA 1FMOE 3LOKA 4FTJA 3VUGA 1YWRA 2FA2A 2GFCA 3R1YA 4KABA 4N70A 4AT3A 3W2PA 5IKWA 4DEGA 3A4PA 5ICPA 5KMMA 4BI1A 3DFAA 1YQJA 3IK3A 5E8VA 2PPQA 3EJ1A 5AP2A 3A99A 4GVJA 5FDXA 3QTXA 2X7OA 4NK9A 4NU1A 2UVYA 3TACA 2VX0A 3BU3A 1KWPA 1BKXA 5LXMA 1QPDA 4MD8E 3T8OA 4O83A 3WBLA 3PA3A 4XH6A 2YCFA 2QHMA 4FNZA 1RDQE 4XG7A 5CAPA 5FM2A 1WAKA 2V22A 2VNWA 4JT3A 2OJJA 3DBCA 5CEKA 4H1MA 4YJPA 3OOMA 2HY0A 4D2SA 4USEA 4FV1A 2PK9A 5L8JA 3OFMA 1Y6BA 3HRCA 4LMUA 4OBPA 1Q61A 4BL1A 1JOWB 1JNKA 1PXOA 3PY0A 2BHHA 4IC7A 4AP7A 1H1SA 1H0WA 3ZSIA 4BJJA 2A98A 2FUMA 2PUUA 4FKGA 3VJOA 3ZLSA 1R1WA 1BL7A 2BR1A 4OTQA 4FSQA 4BDCA 3JR1A 3VBTA 1L3RE 5F9EA 5BVNA 3TZ8A 3QD3A 2JBOA 4U80A 1QL6A 4E5BA 3ROCA 3QF9A 3PA4A 4LUEA 3RJCA 5B2LA 1JSUA 2B52A 4IAYA 4QMQA 2C6EA 4E7WA 5M4UA 2WHBA 4YTFA 2OF2A 3LMHA 2XK4A 3EKKA 1YRPA 4U3ZA 5E1SA 4I6LA 5IMEA 4G16A 2YWVA 4NKSA 2GTNA 3LFNA 5AV1A 2YAKA 4Z3VA 4CFVA 3MJ1A 3CQWA 2PVHA 1WCCA 1OUKA 4GIIA 4AACA 3QKMA 4DITA 3LCOA 3IS5A 1SYKA 5FWKK 5B2MA 4IB1A 3SW7A 5ACBC 4U43A 4G3DA 4QT1A 5DIAA 4GFGA 2B55A 5JN2A 5CEIA 4GVAA 3HX4A 3TV6A 3EWHA 3FE3A 1Z57A 3POZA 2ITXA 4P7EA 3ZSHA 3NAXA 4BTMA 2XK7A 2EXCX 4U79A 4ONAA 3TDWA 2XH5A 3ET7A 4O6EA 3FWQA 5IUGA 3LLAA 4JBOA 2C5VA 3VUDA 4GG7A 4CT1A 3R83A 2VX3A 3QQHA 3F3VA 2VTRA 5CI6A 2VTTA 2WQEA 3AT4A 3FUPA 4KKHA 4AQCA 4HYUA 3HUCA 5HNGA 4F6UA 2R3LA 2VWZA 5HG7A 4AN2A 2OKRA 3BLQA 4CRSA 2W1FA 4IAFA 2WTCA 2O0UA 3HECA 4GH2A 2WEVA 4ZSLA 4O4FA 2G2FA 3R8LA 1OECA 1JAMA 4CFNA 2GNIA 1GOLA 3V6SA 3HAMA 4FODA 1UNHA 4F7JA 4GIHA 5EM7A 1ZXEA 3Q60A 4AZFA 2FSTX 5K0XA 3PXRA 2ZMDA 4KNBA 1P4OA 3D2IA 3GCSA 5IDNA 3NFGB 4QP1A 2Q83A 5EQPA 4FTMA 4L52A 2BTRA 4NEUA 2Z7RA 3TXOA 2G2HA 1XH6A 1KE6A 1DM2A 2X2KA 4S30A 5KX8A 3Q9YA 4ID7A 2J6MA 4FIEA 3FI8A 3CC6A 4O96A 2CN8A 5L4QA 3KVWA 3P0MA 3R6XA 2KULA 5BMMA 4R1VA 3VUIA 2YJSA 3W0QA 3UTOA 2W05A 3I7CA 4EK6A 2OGVA 5C9CA 3QXOA 4BR3A 3MY5A 4AN3A 2BRGA 4UN0C 5FEQA 4WBOA 2RG5A 4RSSA 5K0KA 3H10A 2PYWA 3TV7A 3CQUA 3PSCA 1WBTA 4Z7GA 3R9OA 4F9AA 5DR2A 2DUVA 3DDPA 4I5PA 4M14A 3ACKA 3PLSA 3D9VA 3P5KA 5FTOA 3T9TA 4CFWA 4QRCA 5ANOA 3PFQA 4EC8A 3OXIA 4QMPA 5BNJA 1PYXA 5HQ0A 5JRQA 5E4HA 4F0IA 4IAZA 4O4DA 2WIPA 2X4ZA 3FMMA 3ORMA 3UVQA 2X8DA 5JH6A 3G9NA 2WQMA 3BPRA 4C3FA 3LM0A 5IH4A 4BDIA 4M67A 4ZTQA 4C4GA 3MH3A 4DTAA 3TUCA 2I40A 4O4EA 3RPOA 1UKIA 4Q2AA 4BCQA 5G6VA 4C59A 4HW7A 3ZH8A 5A54A 3PPJA 2OBJA 5AAFA 4N0SA 1T46A 3A2CA 5CS6A 5ETCA 3BEGA 2ZM1A 3FJQE 3V5QA 4F09A 5CASA 2C6TA 5AIRA 5IF1A 5DEYA 1ZY5A 4ANMA 3NYOA 3B8QA 2F4JA 3F2AA 5HORA 3GB2A 1OGUA 4AOTA 5CSHA 4YP8A 5HE2A 3UDBA 3QTQA 3TZ9A 3UE4A 4FSRA 3DJ7A 3LMGA 4XRLA 3UDZA 2OK1A 4K0YA 3C50A 3HV3A 2CGWA 3UMWA 3LFAA 4L53A 1UU3A 3H9RA 1Q8UA 3F3UA 2ZM3A 4O22A 2OFVA 4C4EA 2EXMA 3BEAA 2QQ7A 4RC4A 4MEDA 4K8AA 3KA0A 3ZOSA 1H07A 2GCDA 3OWKA 5IG1A 2G01A 3T3UA 2JKQA 4NTTA 3HV6A 4C4HA 3W0NA 4EZ7A 3M2WA 2QOOA 4RGJA 4FKOA 2BUJA 3E8CA 3QHWA 5M07A 2P0CA 5HO6A 3RPVA 2HIWA 5IZFA 4D4YA 5M53A 4X6QC 3I7BA 4ZTLA 2ZOQA 2ZV9A 3ZZWA 2QD9A 5AR5A 5LARA 4QMUA 4EWQA 3ZO3A 2W1IA 4F78A 2ZV7A 4B6LA 3K3JA 1VYZA 3UMXA 4YR8A 2WMQA 2CPKE 5HO8A 3TUBA 1PXLA 2WNTA 2YM8A 5IQIA 3LFSA 2BILB 4R6VA 5GJGA 2JDOA 4WO5A 3MB6A 3EQPA 3UP7A 1DAYA 4ORKA 3QC4A 4PPCA 4ZS4A 2VWVA 3UQGA 2E9NA 4BKYA 3GFEA 3UPZA 1IA8A 4A4XA 2R3RA 4CT2A 3AC3A 4OTPA 4YO6A 2J0LA 4ASEA 4D0XA 1JKLA 4A9TA 3S4QA 4RC3A 1NXKA 4EK4A 3PFYA 4A9UA 2ZYBA 5FTGA 3EN6A 5LMAA 4R3CA 4F99A 4ZMFA 4FSTA 3IDCA 2BZKB 1Q97A 4L44A 3GVUA 4OUCA 4ZTNA 2YAAA 3OF0A 5I9VA 3ODYX 3SOAA 5HX8A 4GS6A 1ZWSA 4I6FA 2I1MA 3G6HA 5T3QA 4U9AA 2BKZA 5AIKA 4ZJJA 5J7BA 4MQ2A 3DBEA 4I1ZA 4XNEA 2HWOA 4ZAUA 5EM5A 1H1RA 4G2FA 3UVPA 3LXKA 3O7LB 3LCTA 3VUMA 4I94A 2EUFB 4K9YA 5ETAA 2YLFA 2A1AB 2UZOA 4L3JA 1Z9XA 3MY0A 1UVRA 3QALE 5L2IA 3AG9A 5AR8A 4DHFA 1TQIA 1Y57A 2XB7A 5HIBA 3U4WA 1G3NA 3QQUA 4KINA 3GCUA 3FBVA 3D94A 3PIZA 4LOPA 2XA4A 5FUTA 1M7QA 4CGAA 4C02A 1QPEA 2VWWA 4FKWA 2R3FA 3BQCA 2QR7A 2QONA 4O0XA 5CU3A 3JVRA 2G9XA 2SRCA 3BU5A 3P1AA 4FG7A 3HA8A 4NUSA 1ZY4A 3VQHA 4APCA 4CEGA 3PXQA 4E6QA 4FK6A 3DAJA 3DT1A 1GNGA 3VS6A 4AT4A 4CTCA 1R3CA 2AC3A 5FBNC 4V05A 2R0UA 1FVVA 4OAUC 2PVLA 3BV2A 3GUBA 4TYEA 4G17A 1F0QA 5J5SA 4IWDA 1JBPE 1MQBA 3C7QA 3ORXA 4GCJA 4KS7A 4CMUA 5AM7A 5LVNA 2H9VA 2R5TA 2YISA 3HAVA 3SXSA 2I0HA 4TTHB 4V0GB 5F4NA 3S3IA 3LW0A 4DEHA 4RLLA 4QD6A 4AW2A 3LCSA 3KCFA 3GI3A 5K4IA 3Q4TA 4Q5HA 4APPA 2XEYA 3O71A 5DG5A 3P7CA 4AZEA 3S1HA 5IA5A 3L8PA 3PWYA 2VTNA 3N4VA 4O27B 2OZOA 2R3IA 2R7BA 4LRJA 4CMTA 4IZYA 4XRJA 3OY3A 4E4LA 3VS0A 3D0EA 5CEMA 2JKKA 5IA1A 5CT7A 1M7NA 5D9HA 3MW1A 2F2UA 3E93A 5CYIA 3ZC5A 5J1WA 4I23A 4U44A 3D5XA 4JAIA 2YERA 3PY1A 3MPMA 3KN6A 1GIIA 3TJDA 3ZO4A 4I0RA 3ZS5A 3DK7A 3DXPA 3KRWA 4KB8A 4M8TA 3SRVA 2HZNA 4DFYA 4UMPA 3QD4A 2EU9A 4IZ5A 5I4NA 4RX9A 5HCXA 3BLHA 4TZRA 3DNEA 3NYNA 3CQEA 1NW1A 3ZFYA 4WUAA 4YJSA 1K9AA 4D28A 4N6ZA 3UO6A 4CCBA 2VN9A 2XEZA 4FVQA 4FTQA 4MHAA 2IJMA 5CWZA 2VO7A 1BMKA 3FPQA 5FXRA 2UW8A 4H3QA 3SVVA 3PVBA 2HW6A 3U55A 4G3GA 3KMWA 1IASA 4D1ZA 3UG2A 2O2UA 3EFWA 3NGAA 4IB3A 2UZDA 3SQQA 4UMRA 3FQHA 2CGVA 4QMMA 3Q4CA 1GAGA 2NO3A 2XIRA 3FY2A 4TYHB 3OG7A 2V55A 4YLJA 4L3PA 2OIDA 3SX9A 4R7HA 4WNKA 4RWJA 3WOWA 4JDKA 2HZ4A 1RW8A 2AQXA 4J52A 4TRLA 4E4MA 1K2PA 1IR3A 3R01A 3H9OA 2JFLA 1M17A 2OSCA 1OZ1A 4HPTE 3C1XA 3VRZA 4ZMEA 4PTCA 1OMWA 3KULB 2HK5A 3W0PA