2QOOA

Human epha3 kinase and juxtamembrane region, y596f:y602f:y742f triple mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
273
Chain Sequence
TFVDPVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGFVHRDLAARNILINSNLVCKVSDFPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin receptor
total genus 89
structure length 273
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qooA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qooA01
2VX3A 3OBJA 4XOYA 3UNZA 4YTHA 3RWPA 2XNMA 4RJ4A 4B9DA 2WOUA 4WKQA 4E7WA 5KKRB 1QL6A 2PE1A 3FZTA 4RRVA 2W4KA 3G6GA 4U45A 3RPYA 3VBYA 3W55A 5HG9A 2X2LA 2YIYA 3C4FA 1GIJA 2QOKA 3QYZA 5CEOA 4HPTE 5HORA 3KC3A 4BTKA 2CLXA 1MRVA 5L6PA 4IVBA 2PVJA 4LMUA 2VTRA 4X0MA 3C1XA 4XV3A 2PZ5A 3I4BA 3OC1A 2XK7A 3PJ1A 1XH5A 4AS0A 5J7HA 2A0CX 2O8YA 2C1BA 5CXZA 3UG2A 1XO2B 3ZDUA 2JAVA 4YP8A 3VO3A 3P7AA 2VTJA 3FC2A 5HU9A 5HG8A 3TNWA 3VS7A 4TYGA 4AFJA 2KULA 1TQMA 2X9FA 2YCSA 4BI0A 5IQGA 5AV1A 2OSCA 3FI2A 4EH2A 4I5PA 4D55A 3ZO1A 3PVBA 2BAJA 4L00A 4IJ9A 4JX3A 3T3UA 4D5HA 1OIUA 4F6WA 3QTUA 4ZLZA 2BPMA 4ZTRA 3FKOA 3RM7A 3ZFMA 2OI4X 4ACMA 2CNQA 4QMVA 2OXXA 2ZB0A 3CJFA 5D11A 3T9TA 4E4XA 4D1ZA 5ANGA 2X7FA 2HWOA 3MSSA 4FV6A 2GDOA 3KCFA 5EQEA 3PRIA 3LFCA 4YZNA 1OKZA 3LQ8A 3DBQA 1Q8TA 4JIKA 3L9PA 3I81A 3TZ7A 3OWLA 5AUXA 5GZ8A 1QPEA 3PWDA 1UU3A 2DWBA 2UZBA 2R3JA 3WOWA 5C4KA 2G9XA 3V04A 1ZYDA 5FP6A 1XQZA 2QVSE 3AT2A 4R6VA 3RBWA 5B2MA 2ONLC 2VX1A 3MIAA 4RIWB 3SOAA 5AR7A 4C3RA 4PP7A 4EUTA 1PXJA 3T8OA 3C4EA 4FSYA 1XBCA 3FUPA 1HOWA 2ITPA 5AIRA 2A19B 3KXMA 4IX4A 4WUNA 3ZDIA 3HRFA 4DH7A 2PUPA 2XNPA 3QLGA 5D10A 5KMJA 2JDRA 2HZIA 4YMJA 1Q8ZA 2W1DA 4EC8A 2JFMA 2Y8OA 4H36A 2R3RA 3SXFA 3EFJA 5DR6A 2BRNA 2VUWA 2UVZA 4EZ7A 4L7SA 3DCVA 5LWMA 5JRQA 3KRXA 4ZSAA 3NUXA 3QC4A 5EW8A 3Q5IA 3KRWA 5IMXA 3RAIA 4CV9A 2X6DA 4QMPA 4WNMA 4EOPA 1E1XA 3GU5A 5FDXA 4AT3A 2OJGA 4A9TA 4FNXA 1QPJA 4BDFA 5TT7A 3FLZA 3I5NA 3QLFA 3CR0A 4U43A 2XIZA 4NK9A 3G90X 5EHYA 5CU3A 3VS6A 2C0OA 4WRSA 4P5ZA 3E93A 3UIBA 3RTPA 4FT7A 4B8MA 4TTHB 3V51A 3I7BA 4EBVA 3IONA 1PMVA 1YHWA 1WVYA 3QXPA 3COHA 2X39A 3OXIA 3WE4A 1YWRA 3E88A 4PNKA 4OAUC 3QU0A 3U9NA 3KULB 5HIBA 4LOOA 4F1TA 4IVDA 4JRNA 4QP6A 5EDQA 3VAPA 2WMAA 1Y6AA 4RQVA 5DRDA 2YHVA 3I7CA 4QPAA 4EK6A 4ONAA 3V5PA 2C5XA 5F1ZA 3R7YA 3G9LX 2JBPA 5GJGA 4TWOA 5IEXA 1ZARA 4BDIA 3TKIA 3R7GA 4A4OA 4AAAA 2XCKA 4FGRA 4GU6A 4CXAA 1MP8A 4IAYA 2CMWA 4J95A 2R64A 1OMWA 4DF3A 3EOCA 3UC4A 1SVGA 2QNJA 4HNIA 1JQHA 3GCQA 3P23A 2C5OA 3D4QA 4H3QA 2BAQA 1STCE 3ORLA 4V05A 1JKKA 4YJTA 2CN5A 3HA6A 5L8LA 3OVVA 3GBZA 3S95A 2F9GA 3QKLA 3MH0A 3QCXA 3TV6A 2E2BA 2WTWA 4C58A 4ZAUA 2JGZA 4OGRA 3W33A 3QTIA 4TYHA 3BWFA 2BVAA 3WBLA 5T3QA 4O0SA 2OW3A 1M2RA 2WMTA 4JDKA 1OIRA 1J3HA 5HCYA 4E5BA 2Y4PA 3NUPA 2WTCA 1H0WA 5CVFA 5IA3A 2HY0A 1JKTA 1ZOEA 1PW2A 3TN8A 5CYIA 5IA2A 2QG7A 4AG8A 4UWYA 4MVFA 4I93A 1A06A 4OTPA 2E9OA 3HRBA 3P86A 5IISA 2QKWB 2X8IA 5BVWA 4DN5A 3C9WA 5B7VA 2A27A 5AP0A 3Q6WA 4GRBA 1O9UA 2VTIA 3HMOA 1LUFA 2XBAA 1Y91A 3NNWA 3SQQA 3ZMMA 4DTKA 2B54A 4EOLA 3PIZA 4X2GA 5JQ5A 4O1PA 4IFGA 1JSVA 1KE7A 3DY7A 4CCUA 3IOPA 4QP9A 2Y6MA 3VBWA 3NAXA 4ZZOA 4M67A 3DNEA 1WAKA 4TYIA 5H2UA 3GNIB 4TZRA 5FQDC 5CY3A 5BMSA 2IJMA 3F66A 4X3FA 4MD9E 5AM7A 3PLSA 4W8EA 2Y4IB 4RJ7A 3OCBA 4R5YA 5CU6A 4D2VA 3MH2A 1KE8A 3DNDA 3DZOA 5IF1A 5K5XA 3MIYA 3O8TA 3OCTA 2XNEA 4IWPA 4O0WA 2JKQA 4RJ3A 3S4QA 3H9FA 3JYAA 3CQWA 3VF8A 1IEPA 1YHSA 3P0MA 4HCUA 3PSDA 3FQHA 4GJ2A 2VO6A 4TYJA 5M4CA 2GHLA 1XH8A 2GNIA 3HRCA 3R8VA 3HMNA 1M52A 4BGQA 3KXXA 4D1XA 3BCEA 4BTMA 4MBLA 2BHHA 1RE8A 3CTJA 4I5HA 5CSXA 2FSMX 4F9WA 4QNAA 3NEWA 4XX9A 3RNIA 2UZTA 4G3DA 4PF4A 4EOIA 1E9HA 5EYMA 4E4LA 5JN2A 4XG9A 1SNXA 3MY5A 5E7RA 3ZM4A 4QMSA 3TNIA 4JDHA 4HVDA 4RJ8A 4EH9A 4QQTA 5AJQA 4X2JA 2XJ2A 3LM5A 4X3FB 2VWVA 5J9LA 2NP8A 3GC8A 3KU2A 1GNGA 5D1JA 3R9NA 3ZLSA 2ZDTA 3QCQA 3D5UA 4NFNA 1X8BA 2CGWA 2Q83A 3FZRA 2YCQA 4MWIA 4BDBA 5JT2A 4QYGA 4FG8A 4RWJA 4JOAA 3LXNA 5HLPA 5E8SA 4O91A 2B55A 2XNOA 4QQ5A 3BYMA 1OPJA 4ZTHA 2QI8A 5EDPA 2OZAB 5LVLA 3EIDA 4BR3A 4ASEA 3BPRA 4FYOA 4XG3A 5FP5A 5KX8A 3L9LA 3QZIA 5CX9A 5D41A 3MA3A 2HZNA 2OG8A 4MNEB 4ITJA 4ALUA 4JG7A 4FEVA 3AC3A 3FBVA 3PA5A 4GCJA 3QTRA 4XOZA 2B9HA 2H9VA 2J0KA 1U54A 4YPSA 3JVSA 3DAKA 2YABA 4OTGA 3ZS5A 4FNWA 4ZJVA 2YM4A 3AMAA 5KHWA 1RJBA 3E3PA 3UOJA 2XKDA 3NUNA 3IKAA 5FXSA 1O6LA 4HNFA 1NVSA 1F5QA 1UNGA 4HCTA 3RVGA 4AGCA 2QR8A 1WCCA 4XUFA 3WYXA 3TWJA 4FNYA 4FTCA 4CGAA 1FVTA 3BRBA 4E6QA 3F3ZA 2IVSA 3UIXA 4C3FA 4R3PA 5DEYA 3LZBA 4LOPA 4NCTC 4L67A 3LW0A 3VRYA 4ASDA 4BFMA 4WUAA 4M68A 1T46A 5AV3A 4PPBA 4IFCA 4E26A 4CZYB 2VTMA 3ZC5A 4Q9SA 2IZSA 1U5QA 4BVUA 4O81A 1LEZA 4HCVA 4I41A 4IAFA 3KN5A 3R1SA 2UVXA 2YWPA 3DK7A 3QQUA 4C34A 3F6XA 2P4IA 2PVMA 2YACA 3F5UA 3P79A 4ENYA 3KFAA 5C03A 1J7LA 2BZJA 5ICPA 3UIMA 4FL1A 3O96A 3QUEA 4YO4A 4YC3A 4XBUA 3UDBA 5HICA 3CTQA 3OWJA 4EL9A 4A7CA 3Q4TA 3FMJA 3Q6UA 4TPTA 4TXCA 5B0XA 4F9YA 4FUXA 4IHPA 4CV8A 2NPQA 5LMKC 1KE5A 4DH5A 3IPHA 2UW9A 5A4TA 5HLNA 3ANQA 1BL7A 2YFXA 4MCVA 2G2FA 1JOWB 5M4FA 2QOIA 4UV0A 3I0QA 2BMCA 4FTKA 4QYEA 1P2AA 4F7NA 3ORKA 1JPAA 2GNGA 3EQPA 3D2IA 3FLSA 2ZM1A 1ZXEA 1WMKA 3F3VA 2HXLA 4S32A 2ZV7A 4JLCA 4FT9A 3SDJA 1H00A 5IA1A 2F2CB 3EMGA 4MXXA 3EQHA 3M2WA 4I5CA 2PVYA 3WE8A 3PXYA 1GY3A 4GUEA 4M3QA 4UWBA 3AOXA 2WOTA 3GOKA 2VTPA 2JFLA 2QOLA 4FZFB 3KEXA 3R9DA 4IZ7A 4HGEA 2WFYA 3MS9A 5KO1A 2R5TA 4F7JA 4N6ZA 3PXQA 1YDTE 4GIIA 4X3FC 3CPBA 3FKNA 4Y72A 4AGDA 5TKDA 4XRJA 4DFBA 3VS3A 3L8PA 4F6SA 2QLQA 5HQ0A 1CKIA 3B8QA 4YHFA 3EQRA 4UMPA 2B53A 3LFSA 3EN6A 2OXDA 5CI6A 4KIPA 4QD6A 4RX5A 1J7IA 4LG4A 4I0TA 1XBBA 3TNQB 5HBJA 3BYOA 3LLAA 4Y46A 2X7GA 1OL7A 1DI9A 4CT2A 3UPZA 1OIQA 3PPJA 3C50A 2LAVA 1ZY5A 4MBIA 2IW9A 1PXKA 1ZOHA 2C3KA 4LGGA 4O84A 1H1WA 3BLRA 3KMUA 3R9HA 1U5RA 3PXRA 4F7SA 3DTCA 3Q4UA 4C2WA 3EN4A 3GU4A 4J8NA 3W2CA 3U6JA 4J8MA 4HVGA 2YJRA 4L42A 4G16A 3PXKA 4BI1A 3MY1A 5HD4A 4OTWA 4R78A 1IR3A 1YQJA 4WRGA 3GUBA 3DV3A 5KZIA 3NIZA 4D9UA 3E8EA 4NCTA 3JUHA 1G3NA 4I22A 5H3QA 5HG5A 5EQPA 4OTRA 4EOKA 4YSJA 4UYNA 5D7AA 2JITA 5E9EA 3NW5A 3OCGA 4EK4A 1SMHA 2PZRA 4FK6A 4LRMA 4CMUA 4O2PA 2QHNA 3MA6A 4DFNA 3ZZEA 5AUVA 4G3EA 4CCBA 3AT3A 4MNFA 3BU3A 5CASA 2A2AA 3WYYA 3OD6X 4XMOA 3KF7A 4ACDA 4Z16A 5FXRA 4J97A 4FR4A 2W1HA 3VF9A 1WBSA 3UP7A 4FTOA 4BL1A 3UOKA 4F0IA 4UN0C 4B0GA 4R5SA 2WTJA 4FKPA 4NJDA 4QMWA 4X2FA 1OZ1A 1PKGA 3LIJA 2WQMA 2X2KA 2UUEA 3NVMB 2X8DA 2WZJA 4ZLYA 3H10A 2X7OA 4UY9A 1QMZA 1UU8A 4RA4A 4CZUA 4RX8A 4LMNA 2GTMA 3TZ8A 4U80A 2BRMA 4IAKA 3QZFA 4A9RA 3PY1A 4KBCA 4U44A 4FGBA 4AGWA 2BILB 5TOZA 3TJCA 5AUUA 5CEKA 3FI8A 3GEQA 4NJ3A 4RFYA 3D0EA 4EWQA 3EQGA 4FIHA 4DTAA 4O1OA 3ZUTA 5I9ZA 2ZMDA 4EWHA 4JVGA 3DU8A 4XHKB 3AGLA 4G5PA 4B4LA 1VZOA 1OL1A 5FXQA 4JNWA 1BKXA 4L3JA 4DBXA 3CPCA 2WMQA 5K3YA 1XH4A 3RPVA 1XJDA 4M0ZA 4IM2A 4QP1A 5G6VA 4W9WA 2ITYA 4ZTNA 3W2OA 3ZO4A 4O7WA 1R1WA 3E62A 3REPA 5LARA 4CYJA 3IW7A 2B1PA 3HMMA 4YZ9A 3L1SA 1R39A 3FHRA 4UZDA 1KSWA 2VTSA 3LCOA 3Q96A 3BV2A 3KK9A 5KCVA 3HDMA 4S30A 5CQUA 3VUGA 5C27A 4F0FA 3FPQA 4M66A 2GFCA 4CMOA 3HECA 2FA2A 4AW1A 3C0GA 5DI1A 3V5JA 4JG8A 4GSBA 4RLLA 5CVGA 3ALOA 1FBNA 3FAAA 4YJSA 3TG1A 2PULA 5HGIA 4HOKA 5HTCA 2Y0AA 2PMNX 3A7IA 4BDCA 3MFTA 5I9YA 5IQIA 1TQIA 4AQCA 4PDSA 4FSTA 4GG7A 4ZSJA 3FXZA 2PY3A 3NNXA 3ZUVA 3TUBA 3QHRA 2IVVA 2Y7JA 2WKMA 3R9RA 2C69A 3ZTXA 5J5SA 2VU3A 2F4JA 5L6OA 4I92A 4EI4A 3O71A 4YZBA 4MEDA 4QP8A 4AA0A 4APPA 1W98A 3GCSA 3M1SA 2QO9A 4FMQA 2WMBA 4A9UA 3HV3A 4YU2A 3AMBA 2JLDA 5A54A 5J9YA 3GC7A 4MWHA 4G9CA 2PK9A 3KVWA 2BFYA 3ODZX 3PXFA 3U9CA 3NYOA 5CNNA 4CT1A 4CTCA 5EG3A 2YDIA 3W16A 4G17A 1S9IA 2QURA 5ACBC 4CKJA 4BDEA 1YI6A 3EQDA 3NNUA 3TZMA 2IVUA 3OXTA 4XV1A 2WTDA 4J52A 5F20A 1PMUA 4EOMA 3CC6A 4WO5A 1WBWA 4YTIA 1U4DA 2J5FA 4MXOA 3SW7A 3MVLA 3R8MA 5K4IA 2WQEA 2WMXA 3F5GA 3BE9A 4U40A 5B2LA 1KOAA 4CRLA 4DFZE 1ZRZA 3BI6A 4BCGA 2HENA 3NIEA 3I6UA 3FMLA 3QRJA 2XJ0A 3SXRA 4BCOA 3HNGA 1PRYA 4FTIA 4F4PA 5BNJA 2B0QA 3QRUA 3VUHA 3UMXA 2Z7QA 4F6UA 4ZOGA 3PJ8A 5DNRA 2YLFA 3ZRKA 3OWPA 4YJRA 5HCXA 2CKOA 3G0EA 4V01A 5AP3A 2JKKA 2GS6A 3UVPA 1WVWA 4ZMEA 3V01A 4BDKA 5E8VA 4D0WA 4M69B 4O0TA 5L3AA 2A1AB 3AD5A 4ANNA 4LUDA 3H0ZA 5BUIA 3DBCA 4N0SA 2W5HA 3OWKA 3UZPA 2DYLA 5CEPA 4G1WA 4IC7A 5A4LA 5AAEA 3FMEA 2XZSA 2BCJA 4IB0A 3GU7A 5DYJA 3ZSHA 5HHWA 5IQBA 1SYKA 3KRLA 4Q5EA 4MXYA 1M2QA 5HIEA 2QODA 3OP5A 2B9JA 2YN8A 3O7LB 5FD2A 2RG5A 1YWNA 5H8EA 1RDQE 3TIZA 1MUOA 1JKLA 4LL5A 5DR9A 1T45A 3Q3BA 4TY1A 5HE0A 3DJ6A 3EHAA 5AUWA 3VULA 4CQEA 1BUHA 2XEZA 4RJ6A 4C36A 2QONA 2GMXA 2PTKA 1F0QA 3NLBA 4FTRA 4II5A 4XP3A 4KKEA 3BV3A 4U42A 2J5EA 2YDJA 4C61A 2WTKC 4EQMA 5KNJA 2ITTA 3KY2A 3UO4A 4GK4A 3ZSIA 3P78A 4XNEA 5IKWA 1PXMA 4Y73A 1P4FA 1ZYLA 2CKEA 3MN3A 2F7XE 3RK9A 4YBKA 4BCIA 4J99A 3R8UA 5HCZA 3MVHA 1WFCA 5C8MA 2ITUA 2OZAA 5M08A 3NMUF 4FKSA 3W18A 3MFUA 5IZFA 4RG0A 3U8WA 2XIXA 4BIEA 3CGOA 4C2VA 3LMGA 4F09A 3UO5A 1LPUA 3E63A 4RVKA 4AFEA 3KK8A 3II5A 3SGCA 2C68A 4DT9A 4CYIA 3LXKA 5AUTA 5TF9A 1YI4A 5DT0A 1A9UA 3SAYA 4E3CA 1YI3A 4QQJA 2C6OA 1Z9XA 2CGXA 3MTLA 1M2PA 4ACGA 3D94A 2CNVA 5JZNA 2QQ7A 5I4NA 4KBKA 1I09A 2VTTA 1V1KA 3D9VA 1UU7A 2ERKA 1R0EA 4FKIA 4NU1A 5AP5A 4XG4A 4FA2A 3WF6A 1OBGA 2E9PA 2IW8A 2W1ZA 2QLUA 3HYHA 4IJPA 4LRKA 3EZVA 5HZNA 2PMIA 1U54B 4IX3A 3LE6A 5CI7A 4D58A 2R3PA 5CAPA 5CF4A 1ND4A 4JRVA 3E7OA 2VTOA 4GL9A 4HGSA 2XK9A 3IDCA 4WOVA 2AYPA 2GQSA 4I0SA 5FTOA 3A7JA 2BRBA 2C6KA 4QOXA 3O2MA 4BB4A 5EKNA 3RJCA 1WZYA 4CG9A 3BEAA 3DFAA 5IEVA 2BZHB 3F69A 1Q3WA 5KHXA 2HELA 5IQHA 4F9AA 4JG6A 2FSOX 5E1SA 2CCHA 4HW7A 5I3RA 2V7AA 3AT4A 3HV6A 3P7BA 2IPXA 5B2KA 4BYJA 4H05A 4O22A 4D1SA 3B2TA 4IACA 1CM8A 2JIVA 3DLSA 4OAVB 2G2IA 5CZIA 4M0YA 4C38A 4K2RA 5JKGA 4NW6A 4FV3A 4BCPA 4HPUE 5I9VA 3K54A 3TJDA 2V7OA 3HMPA 4RA5A 5DVRA 4LV5A 3IOKA 4H1MA 5EI2A 4ACCA 4JAIA 3Q9XA 4DGGA 2QOHA 4WHZA 1ZMUA 5IQEA 1GZ8A 3PG1A 4BGHA 3UODA 5HLWA 5L2SA 3QD3A 2O3PA 5IQCA 3IK3A 5CQWA 2IZUA 4TNDA 2PVLA 4YGAA 3ZBXA 4ZLOA 3PPKA 3CCNA 4V04A 3FZOA 4XLIA 4AA4A 1FMOE 3RM6A 4NWMA 2BFXA 2HZ0A 3KL8A 3BLQA 5IH6A 3IS5A 3D14A 2W1CA 2PYWA 4FIFA 1H24A 3CS9A 2VN9A 1GIIA 2J50A 1BX6A 5CU0A 3VS0A 2XNNA 3ID6C 3DTWA 3CQUA 2ZDUA 5M07A 4QP4A 4AU8A 3BBWA 2CHLA 2GSFA 4DEIA 1NXKA 3D2KA 2R7IA 3G9NA 2I0EA 3GU6A 3V5TA 3U4UA 4E5WA 1S9JA 4E93A 2W1IA 4C02A 3RI1A 4AX8A 3LMHA 4D4SA 3C5IA 4RIOA 5AV4A 2C6TA 2WO6A 1O6KA 4IAZA 4K33A 4L8MA 3BYUA 3PPZA 1TVOA 2WMUA 4KAOA 2RF9A 3QKKA 5AR5A 4YC8A 3HL7A 3E87A 3OG7A 5EOBA 4H1JA 4FV8A 2IN6A 4I3ZA 4ITIA 3ANRA 4UMTA 4IW0A 1V0PA 4ZIMA 4BWPA 4QT1A 5JGBA 2B9FA 2OO8X 3UNKA 3FSKA 1KWPA 3DB8A 1QCFA 1JLUE 2VTHA 4FKWA 4QMLA 3TUDA 4XH6A 2C3JA 4AGUA 4DHFA 3Q2MA 3EQFA 4WD5A 4D28A 3BBTB 1P14A 4CZTA 5M44A 3QZHA 1FVRA 4D2PA 5AA9A 5IH4A 4FKVA 5IQDA 4L53A 4FICA 2KTYA 4YZMA 4DG3E 5CAVA 2OBJA 3MJ1A 4HYSA 5KKRC 4LM5A 2ACXA 3R02A 4IZYA 4O0VA 4Y95A 4BHNA 5LQFA 3QGYA 5FWKK 4FKLA 1KE6A 2ETKA 3AC4A 3LPBA 3PIXA 1B39A 3A4PA 4DGOA 4FKOA 3PA4A 3Q9YA 2UZWE 4IADA 3ATSA 3BHYA 3SHEA 1PXIA 2W9FB 3ZOSA 2HIWA 3RK5A 4GT4A 2GHMA 2YJSA 4FT3A 2FYSA 4PMPA 1UVRA 2XK4A 3V8TA 4AZSA 4NT4A 1MRUA 2PZYA 3K3IA 2VO7A 2J7TA 3Q52A 3NNVA 2NO3A 4PNIA 4ZP5A 4R7IA 3TEIA 3F7ZA 5IU2A 2YM7A 2ZV8A 5E8WA 1DAWA 4A4LA 4C62A 3H9RA 3DK3A 1M7QA 3ORTA 5EH0A 3NUSA 4AT5A 4L6QA 4EHEA 3BYVA 1ZZ2A 4TNBA 3DA6A 2EVAA 3HX4A 5KUPA 2RFNA 4QTBA 4X6RA 4M8TA 3FWQA 2DUVA 3UOHA 2W1EA 3QXOA 2G2HA 1B38A 4RMZA 4FVRA 4JDJA 2VTQA 3FMDA 3PY0A 5H8BA 3UC3A 3DXPA 4F1OA 3R2BA 4JBOA 2ITQA 4Y5HA 4D2WA 3UZRA 3KXHA 5CU2A 5T68A 2F57A 3V8SA 3W8QA 2OWBA 5J79A 3FLYA 2WEVA 4X21A 3BGZA 3NDMA 4TN6A 2B9IA 3NUAA 3I6WA 3GU8A 2XNGA 3FZPA 2HYYA 3A7HA 4YPDA 4DFXE 2J0JA 3L8VA 4MYGA 5JH6A 2VWIA 4DEDA 3N4UA 1ZY4A 2YZLA 2CPKE 3OUNB 5JGDA 4YC6A 1DI8A 1M14A 3O23A 5F4NA 3VUTA 4DTBA 3R30A 2EB3A 2O64A 4NSTA 3FY0A 3R7IA 3CY3A 2QG5A 1JVPP 2NRUA 3VJOA 5CLPA 2W7XA 3G5DA 4IB5A 2I1MA 3RPOA 2HW6A 4HYIA 2CGUA 4RGJA 3WIKA 4AT4A 3NW7A 4XV9A 5EDRA 2PE0A 3EH9A 4KUJA 5M09A 2W1GA 3JY9A 5HTIA 4IWQA 2FVDA 4L46A 4YJUA 4UX9A 4ZS4A 4MD7E 4MXAA 3DBFA 5JRSA 1VEBA 3OTVA 4CRSA 3W2SA 1H0VA 2CNUA 1UNHA 3CIKA 3DKFA 3AD4A 4A9YA 2QU6A 4JJRA 3RK7A 3GCUA 4YJPA 3EN5A 1DM2A 3HMIA 3R9OA 3V8WA 4D2SA 3IGOA 3KF4A 4FIGA 4G3GA 5L8KA 5AR4A 2JAMA 5DG5A 2PUIA 4G5JA 3TT0A 2BZIB 4QMOA 5ANKA 3BE2A 4FV9A 1H07A 2W06A 1KOBA 2VO0A 5ETIA 3VWAA 2P2IA 3R00A 1Y8YA 1JBPE 4FIIA 4H58A 2EUFB 3FMHA 3NUYA 3GCVA 3QTWA 4A9SA 4DG0E 3ORNA 4AN9A 5FDPA 4ZTMA 4RC2A 3W1FA 4ZY6A 5L2WA 4PL5A 1OL5A 3D7ZA 3DXNA 4ZJIA 1OIYA 2VO3A 5HNGA 1V0OA 3ZFXA 1VR2A 3KMMA 2UVYA 4JDIA 4YO6A 3FE3A 2GNHA 3LFQA 2JKOA 1W83A 4FTNA 5EQYA 3G0FA 2HXQA 1U46A 1G5SA 4UXQA 4IBMA 3RKBA 4IMYA 4FEWA 2CGVA 3DQXA 4CTBA 4YNEA 4DFYA 4FV5A 1SM2A 3Q9ZA 3RCDA 4YUQA 5HTBA 3TV4A 4GKHA 4WG4A 4BWXA 4O0RA 3CBLA 4BKYA 3ACJA 3QQJA 4OBQA 1YXUA 5F9EA 2XKEA 4XP0A 3KRRA 5DIAA 4E1ZA 5E1EA 5JFVA 4QP2A 4O83A 2XIRA 4C4IA 3CKWA 4FE2A 5ETAA 1YHVA 1FGIA 3RCJA 2X8EA 4HJOA 2PL0A 4G3CA 4FZAB 4K6ZA 3GVUA 2R0IA 3I60A 4ZEGA 3RHKA 4BHZA 5M51A 3U54A 3LAUA 4EHVA 5GJDA 3MYGA 4ITHA 1MQBA 3A8XA 4ENXA 2YAAA 3T9IA 4RWKA 2VD5A 2BUJA 1JSTA 5AR3A 2RIOA 4FSWA 5HO8A 3ZFYA 3MFSA 2PHKA 2Z7SA 3UPXA 1OL2A 2FSTX 3PFQA 3AMYA 3U6IA 1IASA 2BDWA 4GYIA 3AGMA 4XYFA 5AP2A 3QD0A 4P5QA 1IAJA 3HLLA 3OFMA 1IG1A 3V5LA 4AWIA 3JR1A 4O7TA 4NIFA 3QUDA 5A3XA 4F1MA 4I4EA 4L43A 3VBVA 2BAKA 1ZAOA 2WHBA 3MVJA 2XP2A 3LQ5A 3N4VA 2J90A 4UMRA 2R3LA 4EH4A 5GJFA 3PE1A 5IH5A 5EM5A 4QTDA 4IWDA 2C3LA 2Q0NA 1H25A 3ORIA 4YJOA 5IQAA 5K5NA 4DEGA 3SA0A 4ZSEA 5HVKA 4K0YA 4RWLA 4OTQA 5AWMA 4LL0A 2OF2A 3GB2A 1CDKA 4ASZA 4D2TA 1AD5A 2XVDA 5E91A 4YTCA 4LFIA 3R63A 4WNKA 3SVVA 4D0XA 1GOLA 3Q53A 3HUBA 3QA8A 1FQ1B 5HNBA 3ULIA 4HZSA 2VZ6A 2VTLA 5CF8A 4CFMA 3ROYA 1R78A 4GIHA 5L4QA 4BIDA 4FEXA 4OTDA 1SVEA 2OIQA 3HAMA 3O50A 4S2ZA 3FMNA 3FYKX 2BIYA 1FVVA 2PWLA 3HDNA 4AP7A 4QMMA 2YA9A 3BYSA 3PZEA 3FQEA 2JIIA 2XMYA 2XYNA 3PJ3A 3K5VA 1SVHA 3DZQA 3LLTA 4DEHA 5DE2A 2OK1A 2ETRA 1P4OA 4A06A 4QMYA 4AN2A 5ITAA 5BPYA 4E73A 2FSLX 1O6YA 4J71A 5BYZA 5IDPA 3NWWA 5EM6A 5FLFA 2HWPA 3EKNA 4QP7A 4QMQA 5HBEA 2ZB1A 3EJ1A 4QYFA 2C30A 3L9MA 3MBLA 4RFZA 3O7LD 4RVLA 4TWNA 2VTAA 3UGCA 3MB6A 5FGKA 3MPTA 4CNHA 4UYAA 4FKTA 4FSUA 5DN3A 5I9XA 4IAIA 4D9TA 5HX6A 3FYJX 4USEA 4EQCA 5KE0A 5FM3A 5HE2A 1JAMA 4JI9A 5E8UA 4ALWA 5CF6A 3T3VA 4Z7HA 1HCKA 1PY5A 3DLZA 3EFWA 5JFSA 4NH1A 3QFVA 4TYEA 2ZMCA 5C4LA 5AEPA 4E5AX 3AC5A 2P3GX 3KGAA 1CSNA 5EK7A 4BIBA 3K2LA 2GQGA 3NGAA 5FEDA 4S31A 4W4YA 3VW8A 4RWIA 4F70A 1OUKA 3BX5A 3PSCA 3JPVA 4XS2A 2QC6A 2EXEA 3COKA 5LVOA 2H34A 1MRYA 3PIYA 4LYNA 4UB7A 2X0GA 3BEGA 2C6IA 4ZJJA 3OOMA 1Q8UA 5HE1A 3QAME 2H96A 2UZVA 4GJ3A 2VAGA 2WNTA 3TZ9A 4AW2A 2XRWA 4DCAA 3ORPA 4GFMA 4CFVA 5AIKA 4BZDA 4YHJA 3IGGA 4NTSA 3UBDA 2J0IA 4FV1A 2YM5A 3TNHA 4LI5A 4JS8A 3WZUA 3C7QA 3CXWA 4IB3A 3TV7A 1BI8A 3WF7A 4M13A 3VS1A 3THBA 3E64A 3JXWA 4DE4A 2UW3A 3S1HA 3PVWA 2GPHA 4EZ3A 4BCMA 3F5XA 2XKFA 4GH2A 2W5AA 3EZRA 3PSBA 4OTFA 2HW7A 4M7IA 2YIXA 3TKUA 1Q24A 5IA0A 5AUZA 4QPMA 2YDKA 4C7TA 4GVJA 4KS7A 2W17A 2R3FA 5H8GA 3SV0A 5BUJA 2JDTA 4U8ZA 4W4XA 2C6MA 4QMUA 5BQ0A 2IWIA 2VV9A 3QF9A 4BF2A 1XH7A 5AP1A 4D4VA 3ZEWA 5CEQA 1XH9A 5EM8A 4EYMA 2I0HA 4H3BA 5ETCA 5TE0A 2PUUA 1JWHA 3MH3A 3O0GA 5I5ZA 2AUHA 2VNWA 4P7EA 4MXCA 5AR2A 5FEQA 4ALVA 5IA5A 4G6LA 2A4LA 2F49A 3KB7A 4V0GA 5CEMA 2FO0A 3FLNC 1IRKA 1UU9A 3IQ7A 5ANEA 1BYGA 3W2PA 5GIPE 3U4WA 3P4KA 5CT7A 4DAWA 4O7VA 4RIWA 3TIYA 2YCRA 5JEBA 4J98A 4I6BA 3R22A 3GP0A 3C0IA 3OT3A 2NNWB 3ZYAA 5ANDA 3ZLWA 4J7BA 4FBXA 5TO8A 4KRDA 3C51A 2I0YA 4CQGA 2HK5A 5BVNA 1AQ1A 4FTMA 1EH4A 4R7HA 3FDNA 4AW5A 3UJGA 4CFNA 4S33A 4TL0A 3L8SA 4CKIA 3F82A 4QMNA 1XHAA 3E8NA 2OLCA 4WG5A 3G15A 4MBJA 4CFXA 3QCYA 4QNYA 4FEUA 2XK8A 5LMKA 5E4HA 3FZSA 4M12A 3ZLXA 4O82A 1G8SA 2BRGA 2C5YA 4W8DA 5EYCA 4MH7A 3N51A 3VRZA 2G15A 2OH0E 4R77A 3MB7A 5FG8A 2ZVAA 4AZTA 5CWZA 1J7UA 2GQRA 2C0IA 2WB8A 5AA8A 2EXCX 4EKKA 2RFEA 1LEWA 2XJ1A 2WXVA 2GNLA 2GS2A 2GTNA 3EYHA 5AUYA 4KIQA 2O0UA 5M55A 3OCSA 1OBDA 1DS5A 2YISA 2VWYA 5EM7A 4FV2A 1GZKA 2X1NA 4XEYA 1YW2A 3OROA 4FZ6A 4Y5QA 4ZMFA 1LR4A 4N57A 5EYKA 5GNKA 3MPMA 5BMMA 4JQ7A 3CP9A 1Q8WA 3NSZA 4GW8A 3ZM9A 3E7VA 3VW6A 5D9HA 4P4CA 5KMMA 4BCNA 4YNOA 3BU6A 1GAGA 5DGZA 4PY1A 3QD4A 3ZHPC 4R3RA 3KULA 3IW4A 5HOAA 2C4GA 4QP3A 2QO2A 3HUCA 4DFLA 4MAOA 3IDPA 4EOSA 4V0GB 3S2PA 3IW5A 5IQFA 5HBHA 2BDJA 5BVKA 2V5QA 4TYHB 4C0TA 4O96A 4AACA 2REIA 4L45A 5E8YA 5DFPA 1PYEA 4I21A 4I5MA 2ZJWA 4QYHA 4WSQA 4PMSA 1W7HA 2Y9QA 3ZCLA 3DBEA 4IX6A 4ANQA 4W9XA 3HZTA 2PMLX 1L3RE 2ZM4A 4G6NA 2JDSA 4K1BA 2WAJA 4MNEA 3PWYA 4DGLC 2EB2A 2WGJA 2YM3A 4FIEA 4XV2A 4AE6A 4UBAA 3PDTA 2R9SA 1KV2A 3NAYA 2OICA 3B2WA 3W8LA 2PE2A 2BKZA 2EU9A 4FYNA 4NUSA 3LVPA 5GHVA 3R1NA 5KZ0A 3QTZA 5HKMA 3OZ6A 4TT7A 4BTFA 5AX3A 4EONA 3OW3A 2R0UA 4XLVA 3SG9A 3PJCA 2J9MA 2WQOA 4PMTA 2Z7LA 2F7ZE 3F7WA 4FL2A 4L9IA 2R3KA 2PU8A 4GVAA 1IA8A 3BQCA 5E8ZA 4D4RA 4KSQA 3QYWA 4MTAA 3UE4A 4DGMA 4NZWB 3Q2JA 5M06A 1OECA 4N4SA 3KVXA 5DOSA 4F08A 4FTTA 3PRFA 3D5WA 4HGTA 2UW0A 1ERKA 3NW6A 3RINA 4F0GA 2OJFE 4QRCA 5HNIX 5IG1A 3MESA 3QC9A 4YJVA 4Z55A 5FTGA 2AC3A 1K9AA 2OF4A 3LOKA 3QL8A 4PX6A 3NS9A 4DITA 3U6HA 4YURA 5AFVA 1J1CA 3DKOA 2OJJA 5FRIA 2HOGA 3FQSA 3NR9A 4U41A 4BKJA 3OY3A 2G01A 4GFOA 2XBJA 3HEGA 4YJNA 5C01A 3POZA 4DH1A 2CCIA 3A7GA 3IDBA 4QO9A 4PUZA 4X7QA 3VBTA 2BR1A 4Z7GA 5ACKA 3R7VA 5LOHA 1CKJA 3O8PA 3SC1A 3DJ7A 4MK0A 5FEEA 1SZMA 5L2TA 2VRXA 5IPJA 5FM2A 4BCFA 3HA8A 2UV2A 2E9UA 5CENA 2ITNA 4MD8E 3EQCA 3VJNA 5FBNC 2B52A 3KXGA 1CTPE 2YLEA 1H28A 4FKQA 1ATPE 4TWPA 5AR8A 4M97A 3DKGA 5IDNA 3C4CA 3A62A 4JQ8A 5A4EA 3MWUA 2PVNA 5C8KA 4AA5A 1PXOA 4DBNA 2C6LA 2J2IB 4FV0A 4IE9A 4FNZA 5H9BA 1H27A 2G1TA 2YERA 3QA0A 3ATTA 5JFWA 4KD1A 4BDJA 5AAGA 2C0TA 1DAYA 2XF0A 5I9WA 5I0BA 1YVJA 2ZV9A 5M53A 5HI2A 5HESA 2V62A 3OOGA 1XH6A 3DK6A 5HG7A 3LFEA 4ZY5A 2WMWA 3FZ1A 4FT0A 2XCHA 4EK5A 4J1RA 3ET7A 2RFDA 3VS4A 3R2YA 3CEKA 4G2FA 2JEDA 3G33A 1ZOGA 4GFGA 5CS6A 4GKIA 4RZVA 4X2NA 3C4ZA 5J5TA 3CTHA 3R7OA 4CEGA 4USDA 3PP1A 3S3IA 4ZS0A 5JMSA 5DT3A 2VWZA 3LCSA 4ID7A 2QOQA 4NYEA 1J91A 4CFUA 3F2NA 4GK2A 1Q41A 5HE3A 3TDWA 4PDOA 1H26A 5LWNA 3ZH8A 4GU9A 1A48A 3E3BX 2ZV2A 1REKA 4FT5A 3RAKA 4BRXA 4CSVA 4O0YA 3LJ2A 3ZXZA 3QRTA 1YXVA 3K5UA 3RP9A 2Z2WA 2OKRA 1OGUA 3R8PA 2GCDA 3VUIA 5KMNA 1VYZA 2XM9A 3AC2A 1BMKA 4XG8A 2ITXA 4IC8A 4LGHA 4U7ZA 5HX8A 2QOCA 3Q60A 4FV4A 3R8LA 3G51A 2QOOA 1ZZLA 4K11A 3R1QA 1KV1A 3FMMA 2OIDA 1W82A 3F5PA 3DPKA 2XK6A 4XG7A 3PY3A 5KMOA 2PUNA 3UNJA 2J6MA 3DDQA 2VGOA 3F88A 3M42A 3PP0A 3KKVA 1XKKA 2I0VA 4IIRA 5ANJA 2UW7A 4BTJA 5BYYA 1JNKA 1VJYA 1GIHA 3A99A 2R3NA 2ZYBA 3CLYA 1RQQA 3DDPA 4C8BA 4U97A 5DA3A 4KINA 4UEUA 3NZ0A 4RT7A 4O7SA 5J9ZA 2OFVA 3NYNA 5CAUA 5L8JA 5CALA 5GINE 3RPRA 3ZRMA 2C5NA 4QMTA 1JSUA 1UWHA 4FTAA 4RIXA 3ACKA 5HO7A 4IZ5A 4NEUA 3NRMA 5BVEA 3H0YA 4IH8A 4PV0A 3NYXA 2FUMA 4QQCA 4CFFA 4EHZA 4ORKA 4HZRA 3KXNA 4YJQA 4IEBA 2FGIA 4GV1A 3FL5A 3QCSA 3ZRLA 1K2PA 3F2AA 4HYUA 5AMNA 4R1VA 4FSRA 4KRCA 4R1YA 4U3YA 3UG1A 3RMFA 5LXMA 3TKHA 3IG7A 2QU5A 3NYVA 4WIHA 5AP7A 4R8QA 4GUBA 3OBGA 4BBFA 2UW5A 5AV2A 3DB6A 4DT8A 1YXXA 3VUKA 4G34A 3GT8A 4X2KA 2XM8A 3MH1A 1FMKA 4IANA 4BC6A 3P08A 3KXZA 2QO7A 1YXSA 1Q62A 2UW6A 4EQUA 5A6OA 2VWUA 1YOJA 3BKBA 3DAJA 3JY0A 4APCA 2HAKA 1YDRE 3LFDA 4AOJA 5CAOA 2WMVA 4TWCA 4E4NA 3OEZA 4IM3A 2BKKA 3ULZA 2J0MB 1CKPA 3EL7A 3P7CA 2FB8A 3GQIA 4WG3A 3JS2A 3ORMA 3QRIA 4JBQA 4B7TA 4J53A 4MHAA 2GFSA 3BHVA 5DR2A 3UP2A 5M56A 3D5VA 4IVAA 4M84A 4PTEA 3QQKA 4ZZNA 2OIBA 2W99B 3A2CA 5BVFA 1H4LA 3W10A 4PWNA 1UV5A 3OY1A 3EFLA 4DGNA 2AC5A 3RHXA 4GMYA 4L3PA 5J95A 3WI6A 4DLIA 1IAHA 1XWSA 2RL5A 4L52A 4NM5A 4I6QA 3BZ3A 4RC4A 5DWRA 5L2IA 5K0KA 2PPQA 1BLXA 2ESMA 2WQNA 3GENA 3HKOA 4NKSA 1PKDA 4OT6A 4KABA 2IG7A 2XUUA 4GS6A 4RC3A 3R7EA 4NM0A 1Y57A 5CTPA 2LGCA 4QTEA 4EUUA 3MV5A 4U3ZA 3AG9A 4KS8A 5LMAA 4ZY4A 2C1AA 1SNUA 2EXMA 4JXFA 3F3WA 2ITVA 3B8RA 3CJGA 3RZBA 3RAWA 4ANMA 5J8IA 3LKMA 1OUYA 3FJQE 4EJNA 2IW6A 1GZOA 4E6CA 4USFA 4FI1A 4ASXA 4GK3A 2BZKB 2HCKA 3P9JA 2HY81 5AADA 3QWJA 2Z02A 4DH8A 4NL0A 5J1VA 3AC1A 4KWPA 3ZXTA 5J1WA 3HP5A 3ENHA 3WZEA 4QTAA 4NM3A 4D4YA 2YWVA 5JQ8A 4DH3A 4FTUA 3RALA 4O38A 2R3HA 2ERZE 4XRLA 1PXNA 3V6SA 2R4BA 3CGFA 3H9OA 5ANIA 3E92A 2UZEA 2ITOA 4YSMA 4LUEA 3F9NA 3UO6A 3VNTA 5ETFA 5FTQA 1QPDA 2QOBA 4MF0A 4U81A 3F3TA 2CKPA 3DJ5A 2JIUA 3RAHA 1H8FA 4FTJA 4IM0A 4OBPA 3HV7A 4FSQA 3PLAE 3R01A 3ZBFA 3I0OA 3WF8A 3GOPA 3BHTA 4O21A 4G3FA 4C4GA 2YEXA 1W84A 1HCLA 3PG3A 5FBOA 1WBOA 4EORA 1YRPA 3GC9A 5HEZA 3HP2A 2BALA 3LFNA 3EB0A 5A46A 1PYXA 2JD5A 2W0JA 5L6WL 4B99A 5LVMA 2GS7A 4PL4A 4O7YA 3KA0A 4U9AA 5ANOA 3F3UA 5BYLA 2GHGA 3LMIA 1ZMWA 2VNYA 4YLKA 5HD7A 4ZXTA 5A14A 3KCKA 4IXPA 4MKCA 4NKAA 4BN1A 3UYTA 5CVHA 3WF5A 3D15A 4AXAA 4EH8A 2J4ZA 4EOQA 4Z9LA 3CD8A 2X2MA 3UQFA 3FEGA 2XA4A 3BHHA 2GNFA 3AC8A 4C4HA 4NTTA 2O2UA 2WMSA 4K77A 1WVXA 1YWVA 2QD9A 4ZTQA 4AZEA 3S0OA 4KKGA 4EOOA 3ZONA 2VTNA 1Q99A 3U51A 2YIRA 4FKGA 3MW1A 5M4IA 3LJ0A 3FL4A 3UQCA 2Z60A 2VWBA 4Y83A 1K3AA 3N4TA 3C0HA 5L2QA 4G31A 2UW8A 4EC9A 4EOJA 4JX7A 5KMLA 2R3GA 5GIOE 2O5KA 5CNOA 2BROA 3E5AA 3QQHA 5HIDA 1KUTA 2PMOX 4R7BA 4UMUA 1Z5MA 1FGKA 2QR7A 1PF8A 2EWAA 2XIKA 4W4WA 5AAFA 1H1PA 2E9NA 1RW8A 4ANLA 4M14A 3PZHA 2CN8A 3WIGA 4BGGA 2XEYA 4FSMA 2DQ7X 5EKOA 2PZIA 3LJ1A 3QWKA 4E6DA 3FXXA 3P1AA 4O7LA 5BX0A 3PVUA 5IUHA 3TUCA 2WEIA 1Q3DA 4JT3A 3VS2A 3OUKA 3Q32A 2R3QA 2VGPA 3L9NA 5CSVA 2JDVA 5IEYA 2XH5A 4FKRA 3IO7A 2OZOA 3O8UA 4F9CA 2DS1A 5HVJA 4JR3A 3HV4A 2R3MA 2GU8A 4KB8A 4K18A 4LOQA 3OHTA 5CANA 3QKMA 4FOBA 4GG5A 4Q2AA 1URWA 5AM6A 4PDPA 3QHWA 1YXTA 5J87A 4F64A 4PTGA 1REJA 3K3JA 4I0RA 4YLLA 4YLJA 3F61A 5AV0A 3ENMA 4EBWA 2X4ZA 1OL6A 3MPAA 4N6YA 5KBQA 3R8ZA 3LQ3A 4DC2A 4C35A 4XP2A 3ELJA 3V6RA 2C6DA 2X9EA 4I20A 1NVRA 2WQBA 3C13A 4FKUA 4KIKB 3IW6A 5DHJA 4AUAA 3G2FA 4F99A 3VC4A 2WTIA 2IVTA 2W4JA 1Q8YA 3TNPC 5TR6A 2F7EE 4OLIA 3GQLA 5HU3A 3ORZA 1CMKE 3CE3A 3BLHA 4FOCA 1IA9A 4IZAA 3HV5A 1M7NA 4Q5HA 3C4WA 5KMKA 4ZSLA 3QX4A 2IO6A 4WBOA 3TXOA 3UIUA 4UMQA 3H30A 4RIYB 4C37A 4F65A 3DAEA 1ZMVA 2YCFA 3COMA 2PVRA 4FVPA 4YZDA 5BUEA 3UQGA 2XB7A 4PDYA 4DFUA 3E8CA 4KA3A 3PYYA 3RNYA 1TKIA 5DRBA 4IVCA 4K8AA 1P5EA 2PSQA 2BDFA 4OTIA 5E90A 4BCJA 3GGFA 1H01A 4XCUA 3OF0A 3M11A 4EZ5A 2SRCA 3ZC6A 2W05A 4O6EA 4BZNA 4ZTLA 3PTGA 4OUCA 3DBDA 2J51A 4F9BA 4FKJA 4CD0A 4JL9A 5HO6A 2IZTA 3PA3A 3QALE 4PTCA 5EHLA 4ZK5A 4IDVA 4AF3A 4BBMA 4RVTA 4L68A 4LRJA 5AP6A 1BL6A 3RWQA 2Y6OA 1TQPA 3Q9WA 3WF9A 4B8LA 2CJMA 3W2RA 3MJ2A 3R04A 4PL3A 4YTFA 2W1FA 3FSFA 1B6CB 2CSNA 3VHKA 4IX5A 3ZU7A 5LVNA 5J7BA 3MTFA 4QTCA 4U5JA 2PVHA 3EQIA 3V5QA 2I7QA 4LQMA 2H6DA 3R6XA 2ZOQA 3GFEA 3SG8A 4RIYA 3ROCA 2UZNA 2Z8CA 1UNLA 3F2RA 5CSPA 4KIKA 3OMVA 4OT5A 4DEEA 5IMEA 4HVHA 3OT8A 3I79A 2OXYA 4DEBA 5I3OA 3VHEA 3JVRA 3D7TB 3ZSGA 4E4MA 3TTIA 4CMTA 4EEVA 4CKRA 2C6EA 3FKLA 2YM8A 3QQGA 3TM0A 4MX9A 4NIFB 4MQ2A 3Q5ZA 2OU7A 5E8XA 4CG8A 3DT1A 3ETAA 3QX2A 2YIQA 3WZKA 4EYJA 1H1QA 2ZAZA 4QMZA 4XBRA 3C4XA 3MFRA 4AZFA 3AD6A 4M15A 5GZ9A 4HVSA 4IAAA 3MI9A 2V22A 2I40A 3QQLA 1Z57A 4OW8A 2BTRA 3SXSA 3PVGA 4KBAA 4QMXA 4EK8A 2GNJA 4UXLA 3NX8A 3BELA 2R3OA 3PXZA 4EJ7A 2O63A 3OW4A 2PVFA 4EH6A 4Z3VA 4FSZA 3R71A 1L8TA 4FX3A 4E20A 3LFFA 5EHOA 4KNBA 5BVDA 3ALNA 4JAJA 5F94A 1F3MC 4ANBA 3LXLA 4I94A 1AGWA 2W96B 2X4FA 3L8XA 2WELA 5G1XA 3A7FA 3ZUUA 5DH3A 1FPUA 4C4JA 2VWXA 4DYMA 5EW3A 3UMWA 1FOTA 2F2UA 4UALA 3PE2A 2V0DA 1H08A 2WIHA 1YKRA 3UVRA 5GZAA 1WBTA 4O6LA 4BY9E 4FTLA 4NM7A 4XG2A 3KN6A 1R0PA 5D12A 3RPSA 3CQEA 3NCGA 3R83A 1UA2A 4FIJA 5CZHA 4EH7A 3VBQA 5DBXA 2QCSA 5DPVA 2RSVA 1OPLA 2UZLA 3SLSA 2P33A 4CFWA 2W9ZB 3QD2B 3LFAA 4BDDA 2QOFA 4JIAA 4FF8A 2VWWA 4C57A 4CLJA 2OGVA 2W4OA 2ITWA 2ITZA 4RZWA 2CLQA 5KBRA 3BQRA 5C26A 1PJKA 3R28A 4RX7A 4O7RA 3DFCB 1YDSE 3LXPA 4ZZMA 3W32A 4FODA 5EFQA 4DINA 5JGAA 2JKMA 2RKUA 4PPCA 2ZM3A 3GI3A 4RFMA 3DXQA 1FINA 4O7ZA 2YAKA 4LGDA 3UVQA 5IUIA 4DA5A 4S34A 3O51A 4L7FA 3ORXA 4FUYA 4GT3A 4I6HA 3DS6A 4KKHA 5CU4A 5EI6A 3KRJA 1KE9A 4PMMA 3A60A 4IQ6A 4TKSA 2RGPA 3FXWA 3E8DA 1WBVA 3SOCA 3H3CA 1PHKA 3W2QA 3FV8A 2OH4A 2PVKA 3A8WA 5LJJA 3QUPA 3S00A 1OKVA 4RIXB 1ZYSA 4X3JA 4YZCA 1XR1A 4EHGA 2H8HA 5A4QA 3G6HA 3FLQA 4JBVA 2WMRA 2Z7RA 5C8NA 3A61A 2C3IB 4D2RA 2W5BA 3FHIA 5EI8A 3RGFA 4DCEA 5A6NA 2XIYA 2P55A 1URCA 4AOIA 4FC0A 4AOTA 2IZRA 2XYUA 3HGKA 3PUPA 4QPSA 4L44A 5HVYA 4ERWA 1ZWSA 4JQEA 4BCQA 1G8AA 1NY3A 3H4JA 5M57A 3EL8A 5JSMA 2PZPA 2WPAA 3I5ZA 1OI9A 3R0TA 3LCTA 4H39A 4FTQA 3OTUA 3TI1A 2UZOA 4BWKA 2QHMA 1UWJA 3DQWA 3R73A 4OTHA 4RVMA 5CXHA 1OVEA 1U59A 3WARA 5DEWA 3TDVA 2XS0A 5D7VA 3CD3A 4DG2E 2J0LA 4HYHA 2R3IA 3EQBA 3MDYA 3BWJA 3IECA 4G6OA 4O2ZA 5T6KA 3UYSA 4FK3A 4AZVA 1WBPA 2WIPA 3CSVA 3U55A 4BCHA 3VUMA 2NRYA 2VX0A 2C5VA 4N70A 4ANSA 2CKQA 4Q9ZA 3QRKA 4MF1A 4NFMA 1YOMA 4J96A 3VBXA 5EOLA 3EN9A 3FLWA 3QGWA 2Q0BA 4PPAA 2JBOA 4C33A 5JZJA 5K9IA 2YZAA 1W0XC 4H3PA 5CSHA 3UOLA 3AQVA 4HGLA 4E6AA 4HVIA 4EKLA 5CF5A 4C4EA 4BBEA 3Q4ZA 2B7AA 2WTKB 4WA9A 4I4FA 4FZ7A 4FZDB 5E8TA 4YBJA 3ZZWA 4JBPA 3ZLYA 3VN9A 2OFUA 3TTJA 1OKYA 2YM6A 4BZOA 1UKIA 4XG6A 4OBOA 4CVAA 1OM1A 3Q4CA 3C5UA 4AW0A 4UWCA 5A9UA 4O0XA 1Q61A 3LFBA 4UZHA 4GT5A 1UKHA 1Q5KA 3D7TA 1XBAA 4FEQA 3CKXA 3KREA 3WZDA 4K9YA 4AN3A 1OKWA 1OPKA 3RZFA 3N9XA 3ERKA 2Y4IC 4AZWA 3QTSA 5BVOA 2CDZA 4G9RA 4TW9A 4GEOA 2WU7A 4IDTA 4FL3A 5FUTA 3OS3A 4GYGA 5EYDA 3WZJA 4C4FA 3GCPA 4EH5A 4PQNA 3BHUA 4RQKA 1H1RA 1YOLA 4A4XA 4ZSGA 1OITA 4WNPA 5AP4A 5K4JA 3AXWA 1PXPA 2BTSA 3Q04A 1Y6BA 3WILA 4X6QC 5C1QB 1NVQA 2P2HA 3NPCA 5IUGA 3P5KA 3O17A 3A4OX 1E1VA 3NCZA 5F95A 4BICA 3GFWA 4P2KA 1BI7A 1GJOA 4D5KA 4O27B 2OJ9A 4XJ0A 3MY0A 2HZ4A 4TRLA 1MQ4A 3GXLA 4ARKA 4Y8DA 3UZTA 2R7BA 3COIA 3R1YA 3CY2A 3VVHA 2R2PA 4IB1A 3BIZA 4ACHA 4P90A 5JFXA 3LCDA 3SX9A 4C59A 3POOA 3FI4A 3LHJA 3GC0A 1GZNA 4RX9A 2FH9A 4PP9A 3SRVA 4FG7A 4NW5A 4A07A 4U79A 3NVKI 4BDGA 1I44A 1QPCA 1NA7A 1LP4A 3FI3A 3FPMA 3EKKA 3NUUA 5CSWA 5CEIA 4BI2A 4I1ZA 2BIKB 4JR7A 3VIDA 4BDHA 4F63A 4R3CA 2WD1A 4FG9A 4RSSA 4RPVA 3U87A 1ZLTA 1H1SA 3QTQA 4EH3A 1NT2A 3QBNA 1PMEA 5K0XA 4RBLA 2XRUA 3VQHA 3ZEPA 1PMNA 2UW4A 4L3LA 3UTOA 2E9VA 4B6LA 3EFKA 5I9UA 4BKZA 5LVPA 4IWOA 4Y85A 2OJIA 4QYYA 4EK3A 3EWHA 4FV7A 4ANOA 1M17A 3TCPA 1NW1A 1JKSA 4O0UA 4ERKA 5CAQA 5LCJA 2XKCA 3HVCA 1ZYJA 5LCKA 4M69A 4W4VA 4WBBB 3TACA 3FMKA 3FY2A 4RLKA 3ITZA 4U0IA 3ODYX 2RFSA 2B4SB 4MQ1A 4LV8A 4YR8A 1Q4LA 5DMZA 4KSPA 1R3CA 1V0BA 1Y8GA 3V5WA 3LCKA 4C3PA 2X81A 3D83A 4KIOA 2WU6A 4F7LA 3DGKA 5LMBA 3MVMA 3ZO3A 2QKRA 4E8AA 3OEFX 5A4CA 5DT4A 2WTVA 4YHTA 3R21A 4I24A 4DEAA 4OR5A 1WBNA 2RG6A 3DOGA 2BHEA 3VQUA 4DLJA 4BCKA 3D5XA 3PJ2A 3I1AA 3MGYA 1VYWA 4FSNA 3EN7A 4BYIA 4MXZA 2YIWA 4L01A 2ONLA 1Q97A 2XK3A 2I6LA 3KMWA 1OB3A 2P0CA 3BGPA 4WT6A 2UZDA 1APME 3SRVB 3SW4A 3VS5A 2BRHA 4PRJA 4WSYA 1J1BA 3QTXA 2C47A 5C9CA 1ZYCA 5JK3A 3OXZA 3SD0A 1PXLA 2V55A 4WNOA 5DLSA 5M4UA 4O7NA 3QQFA 3BGQA 3EYGA 3HAVA 5IA4A 5CT0A 3QZGA 5EW9A 5E92A 5KMIA 5AX9A 3LM0A 4AE9A 4FVQA 2X6EA 3KQ7A 2XNBA 4O86A 4BDAA 4I23A 3R7UA 4CLIA 3IW8A 3BU5A 2JC6A 4I6FA 2ETMA 4U6RA 3V3VA 4RJ5A 3FC1X 2UZUE 3SKCA 2O65A 3VUDA 3ZO2A 2JDOA 2YITA 3DKCA 3TL8A 1W8CA 4ZTSA
chains in the Genus database with same CATH superfamily
2VX3A 3OBJA 4XOYA 3UNZA 4YTHA 3RWPA 2XNMA 4RJ4A 4B9DA 2WOUA 4WKQA 4E7WA 5KKRB 1QL6A 2PE1A 3FZTA 4RRVA 2W4KA 3G6GA 4U45A 3RPYA 3VBYA 3W55A 5HG9A 2X2LA 2YIYA 3C4FA 1GIJA 2QOKA 3QYZA 5CEOA 4HPTE 5HORA 3KC3A 4BTKA 2CLXA 1MRVA 5L6PA 4IVBA 2PVJA 4LMUA 2VTRA 4X0MA 3C1XA 4XV3A 2PZ5A 3I4BA 3OC1A 2XK7A 3PJ1A 1XH5A 4AS0A 5J7HA 1W2CA 2A0CX 2O8YA 2C1BA 5CXZA 3UG2A 1XO2B 3ZDUA 2JAVA 4YP8A 3VO3A 3P7AA 2VTJA 3FC2A 5HU9A 5HG8A 3TNWA 3VS7A 4TYGA 4AFJA 2KULA 1TQMA 2X9FA 2YCSA 4BI0A 5IQGA 5AV1A 2OSCA 3FI2A 4EH2A 4I5PA 4D55A 3ZO1A 3PVBA 2BAJA 4L00A 4IJ9A 4JX3A 3T3UA 4D5HA 1OIUA 4F6WA 3QTUA 4ZLZA 2BPMA 4ZTRA 3FKOA 3RM7A 3ZFMA 2OI4X 4ACMA 2CNQA 4QMVA 2OXXA 2ZB0A 3CJFA 5D11A 3T9TA 4E4XA 4D1ZA 5ANGA 2X7FA 2HWOA 3MSSA 4FV6A 2GDOA 3KCFA 5EQEA 3PRIA 3LFCA 4YZNA 1OKZA 3LQ8A 3DBQA 1Q8TA 4JIKA 3L9PA 3I81A 3TZ7A 3OWLA 5AUXA 5GZ8A 1QPEA 3PWDA 1UU3A 2DWBA 2UZBA 2R3JA 3WOWA 2NYAA 2G9XA 3V04A 1ZYDA 5FP6A 1XQZA 2QVSE 3AT2A 4R6VA 3RBWA 5B2MA 2ONLC 2VX1A 3MIAA 4RIWB 3SOAA 5AR7A 4C3RA 4PP7A 4EUTA 1PXJA 3T8OA 3C4EA 4FSYA 1XBCA 3FUPA 1HOWA 2ITPA 5AIRA 2A19B 3KXMA 4IX4A 4WUNA 3ZDIA 3HRFA 4DH7A 2PUPA 2XNPA 3QLGA 5D10A 5KMJA 2JDRA 2HZIA 4YMJA 1Q8ZA 2W1DA 4EC8A 2A98A 2JFMA 2Y8OA 4H36A 2R3RA 3SXFA 3EFJA 5DR6A 2BRNA 2VUWA 2UVZA 4EZ7A 4L7SA 3DCVA 5LWMA 5JRQA 3KRXA 4ZSAA 3NUXA 3QC4A 5EW8A 3Q5IA 3KRWA 5IMXA 1ST4A 3RAIA 4CV9A 2X6DA 4QMPA 4WNMA 4I6LA 4EOPA 1E1XA 3GU5A 5FDXA 4AT3A 2OJGA 4A9TA 4FNXA 1QPJA 4BDFA 5TT7A 3ML1A 3FLZA 3I5NA 3QLFA 3CR0A 4U43A 2XIZA 4NK9A 3G90X 5EHYA 5CU3A 4DDGA 3VS6A 2C0OA 4WRSA 4P5ZA 3E93A 3UIBA 3RTPA 4FT7A 4B8MA 4TTHB 3V51A 3I7BA 4EBVA 3IONA 1PMVA 1YHWA 1WVYA 3QXPA 3COHA 2X39A 3OXIA 3WE4A 1YWRA 3E88A 4PNKA 4OAUC 3QU0A 3U9NA 3KULB 5HIBA 4LOOA 4F1TA 4IVDA 4JRNA 4QP6A 5EDQA 3VAPA 2WMAA 1Y6AA 4RQVA 5DRDA 2YHVA 3I7CA 4QPAA 4EK6A 4ONAA 3V5PA 2C5XA 5F1ZA 3R7YA 3G9LX 2JBPA 5GJGA 4TWOA 5IEXA 1ZARA 4BDIA 3TKIA 3R7GA 4A4OA 4AAAA 2XCKA 4FGRA 4GU6A 4CXAA 1MP8A 4IAYA 2CMWA 4J95A 2R64A 1OMWA 4DF3A 3EOCA 3UC4A 1SVGA 2QNJA 4HNIA 1JQHA 3GCQA 3P23A 2C5OA 3D4QA 4H3QA 2BAQA 1STCE 3ORLA 4V05A 1JKKA 4YJTA 2CN5A 3HA6A 5L8LA 3OVVA 3GBZA 3S95A 2F9GA 3QKLA 3MH0A 3QCXA 3TV6A 2E2BA 2WTWA 4C58A 4ZAUA 2JGZA 4OGRA 3W33A 3QTIA 4TYHA 3BWFA 2BVAA 3WBLA 5T3QA 4O0SA 2OW3A 1M2RA 2WMTA 4JDKA 1OIRA 1J3HA 5HCYA 4E5BA 2Y4PA 3NUPA 2WTCA 1H0WA 5CVFA 5IA3A 2HY0A 1JKTA 1ZOEA 1PW2A 3TN8A 5CYIA 5IA2A 2QG7A 4AG8A 4UWYA 4MVFA 4I93A 1A06A 4OTPA 2E9OA 3HRBA 3P86A 5IISA 2QKWB 2X8IA 5BVWA 4DN5A 3C9WA 5B7VA 2A27A 5AP0A 3Q6WA 4GRBA 1O9UA 2VTIA 3HMOA 1LUFA 2XBAA 1Y91A 3NNWA 3SQQA 3ZMMA 4DTKA 2B54A 4EOLA 3PIZA 4X2GA 5JQ5A 4O1PA 4IFGA 1JSVA 1KE7A 3DY7A 4CCUA 3IOPA 4QP9A 2Y6MA 3VBWA 3NAXA 4ZZOA 4M67A 3DNEA 1WAKA 4TYIA 5H2UA 3GNIB 4TZRA 5FQDC 5CY3A 5BMSA 2IJMA 3F66A 4X3FA 4MD9E 5AM7A 3PLSA 4W8EA 4JMQA 2Y4IB 4RJ7A 3OCBA 4R5YA 5CU6A 4D2VA 3MH2A 1KE8A 3DNDA 3DZOA 5IF1A 5K5XA 3MIYA 3O8TA 3OCTA 2XNEA 4IWPA 4O0WA 2JKQA 4RJ3A 3S4QA 3H9FA 3JYAA 3CQWA 3VF8A 1IEPA 1YHSA 3P0MA 4HCUA 3PSDA 3FQHA 4GJ2A 2VO6A 4TYJA 5M4CA 2GHLA 1XH8A 2GNIA 3HRCA 3R8VA 3HMNA 1M52A 4BGQA 3KXXA 4D1XA 3BCEA 4BTMA 4MBLA 2BHHA 1RE8A 3CTJA 4I5HA 5CSXA 2FSMX 4F9WA 4QNAA 3NEWA 4XX9A 4O4EA 2UZTA 4G3DA 4PF4A 3RNIA 1E9HA 5EYMA 4E4LA 4EOIA 5JN2A 4LDTA 4XG9A 1SNXA 3MY5A 5E7RA 3ZM4A 4MUQA 4QMSA 3TNIA 4JDHA 4HVDA 4RJ8A 4EH9A 4QQTA 5AJQA 4X2JA 2XJ2A 3LM5A 4X3FB 2VWVA 5J9LA 2NP8A 3GC8A 2XAOA 3KU2A 1GNGA 5D1JA 3R9NA 3ZLSA 2ZDTA 3QCQA 3D5UA 4NFNA 1X8BA 2CGWA 2Q83A 3FZRA 2YCQA 4MWIA 4BDBA 5JT2A 4QYGA 4FG8A 4RWJA 4JOAA 3LXNA 5HLPA 5E8SA 4O91A 2B55A 2XNOA 4QQ5A 3BYMA 1OPJA 4ZTHA 2QI8A 5EDPA 2OZAB 5LVLA 3EIDA 4BR3A 4ASEA 3BPRA 4FYOA 4XG3A 5FP5A 5KX8A 3L9LA 3QZIA 5CX9A 5D41A 3MA3A 2HZNA 2OG8A 4MNEB 4ITJA 4ALUA 4JG7A 4FEVA 3AC3A 3FBVA 3PA5A 4GCJA 3QTRA 4XOZA 2B9HA 2H9VA 2J0KA 1U54A 4YPSA 3JVSA 3DAKA 2YABA 4OTGA 3ZS5A 5C4KA 4FNWA 4ZJVA 2YM4A 3AMAA 5KHWA 1RJBA 3E3PA 3UOJA 2XKDA 3NUNA 3IKAA 5FXSA 1O6LA 4HNFA 1NVSA 1F5QA 1UNGA 4HCTA 3RVGA 4AGCA 2QR8A 1WCCA 4XUFA 3WYXA 3TWJA 4FNYA 4FTCA 4CGAA 1FVTA 3BRBA 4E6QA 3F3ZA 2IVSA 3UIXA 4C3FA 4R3PA 5DEYA 3LZBA 4LOPA 4NCTC 4L67A 3LW0A 3VRYA 4ASDA 4BFMA 4WUAA 4M68A 1T46A 5AV3A 4PPBA 4IFCA 4E26A 4CZYB 2VTMA 3ZC5A 4Q9SA 2IZSA 1U5QA 4BVUA 4O81A 1LEZA 4HCVA 4I41A 4IAFA 3KN5A 3R1SA 2UVXA 2YWPA 3AKKA 3DK7A 3QQUA 4C34A 3F6XA 2P4IA 2PVMA 2YACA 3F5UA 3P79A 4ENYA 3KFAA 5C03A 1J7LA 2BZJA 5ICPA 3UIMA 4FL1A 3O96A 3QUEA 4YO4A 4YC3A 4XBUA 3UDBA 5HICA 3CTQA 3OWJA 4EL9A 4A7CA 3Q4TA 3FMJA 3Q6UA 4TPTA 4TXCA 5B0XA 4F9YA 4FUXA 4IHPA 4CV8A 2NPQA 5LMKC 1KE5A 4DH5A 3IPHA 2UW9A 5A4TA 5HLNA 3ANQA 1BL7A 2YFXA 4MCVA 2G2FA 1JOWB 5M4FA 2QOIA 4UV0A 3I0QA 2BMCA 4FTKA 4QYEA 1P2AA 4F7NA 3ORKA 1JPAA 2GNGA 3EQPA 1ST0A 3D2IA 3FLSA 2ZM1A 1ZXEA 1WMKA 3F3VA 2HXLA 4S32A 2ZV7A 4JLCA 4FT9A 3SDJA 1H00A 5IA1A 2F2CB 3EMGA 4MXXA 3EQHA 3M2WA 4I5CA 2PVYA 3WE8A 3PXYA 1GY3A 4GUEA 4M3QA 4UWBA 3AOXA 2WOTA 3GOKA 2VTPA 2JFLA 2QOLA 4FZFB 3KEXA 3R9DA 4IZ7A 4HGEA 2WFYA 3MS9A 5KO1A 2R5TA 4F7JA 4N6ZA 3PXQA 1YDTE 4GIIA 4X3FC 3CPBA 3FKNA 4Y72A 4AGDA 5TKDA 4XRJA 4DFBA 3VS3A 3L8PA 4F6SA 2QLQA 5HQ0A 1CKIA 2X0OA 3B8QA 4YHFA 3EQRA 4UMPA 2B53A 3LFSA 3EN6A 2OXDA 5CI6A 4KIPA 4QD6A 4RX5A 1J7IA 4LG4A 4I0TA 1XBBA 3TNQB 5HBJA 3BYOA 3LLAA 4Y46A 2X7GA 1OL7A 1DI9A 4CT2A 3UPZA 1OIQA 3PPJA 3C50A 2LAVA 1ZY5A 4MBIA 2IW9A 1PXKA 1ZOHA 2C3KA 4LGGA 4O84A 1H1WA 3BLRA 3KMUA 3R9HA 1U5RA 3PXRA 4F7SA 3DTCA 3Q4UA 4C2WA 3EN4A 3GU4A 4J8NA 3W2CA 3U6JA 4J8MA 4HVGA 2YJRA 4L42A 4G16A 3PXKA 4BI1A 3MY1A 5HD4A 4OTWA 4R78A 1IR3A 1YQJA 4WRGA 3GUBA 3DV3A 5KZIA 3NIZA 4D9UA 3E8EA 4NCTA 3JUHA 1G3NA 4I22A 5H3QA 5HG5A 5EQPA 4OTRA 4EOKA 4YSJA 4UYNA 5D7AA 2JITA 5E9EA 3NW5A 3OCGA 4EK4A 1SMHA 2PZRA 4FK6A 4LRMA 4CMUA 4O2PA 2QHNA 3MA6A 4DFNA 3ZZEA 5AUVA 4G3EA 4CCBA 3AT3A 4MNFA 3BU3A 5CASA 2A2AA 3WYYA 3OD6X 4XMOA 3KF7A 4ACDA 4Z16A 5FXRA 4J97A 4FR4A 2W1HA 3VF9A 1WBSA 3UP7A 4FTOA 4BL1A 3UOKA 4F0IA 4UN0C 4B0GA 4R5SA 2WTJA 4FKPA 4NJDA 4QMWA 4X2FA 1OZ1A 1PKGA 3LIJA 2WQMA 2X2KA 2UUEA 3NVMB 2X8DA 2WZJA 4ZLYA 3H10A 2X7OA 4UY9A 1QMZA 1UU8A 4RA4A 4CZUA 4RX8A 4LMNA 2GTMA 3TZ8A 4U80A 2BRMA 4IAKA 3QZFA 4A9RA 3PY1A 4KBCA 4U44A 4FGBA 4AGWA 2BILB 5TOZA 3TJCA 5AUUA 5CEKA 3FI8A 3GEQA 4NJ3A 4RFYA 3D0EA 4EWQA 3EQGA 4FIHA 4DTAA 4O1OA 3ZUTA 5I9ZA 2ZMDA 4EWHA 4JVGA 3DU8A 4XHKB 3AGLA 4G5PA 4B4LA 1VZOA 1OL1A 5FXQA 4JNWA 1BKXA 4L3JA 4DBXA 3CPCA 2WMQA 5K3YA 1XH4A 3RPVA 1XJDA 4M0ZA 4IM2A 4QP1A 5G6VA 4W9WA 2ITYA 4ZTNA 3W2OA 3ZO4A 4O7WA 1R1WA 3E62A 3REPA 5LARA 4CYJA 3UDSA 3IW7A 2B1PA 3HMMA 4YZ9A 3L1SA 1R39A 3FHRA 4UZDA 3TMOA 1KSWA 2VTSA 3LCOA 3Q96A 3BL9A 3BV2A 3KK9A 5KCVA 3W0OA 3HDMA 4S30A 5CQUA 3VUGA 5C27A 4F0FA 3FPQA 4M66A 2GFCA 4CMOA 3HECA 2FA2A 4AW1A 3C0GA 5DI1A 3V5JA 4JG8A 4GSBA 4RLLA 5CVGA 3ALOA 1FBNA 3FAAA 4YJSA 3TG1A 2PULA 5HGIA 4HOKA 5HTCA 2Y0AA 2PMNX 3A7IA 4BDCA 3MFTA 5I9YA 5IQIA 1TQIA 4AQCA 4PDSA 4FSTA 4GG7A 4ZSJA 3FXZA 2PY3A 3NNXA 3ZUVA 3TUBA 3QHRA 2IVVA 2Y7JA 2WKMA 3R9RA 2C69A 3ZTXA 5J5SA 2VU3A 2F4JA 5L6OA 4I92A 4EI4A 3O71A 4YZBA 4MEDA 4QP8A 4AA0A 4APPA 1W98A 3GCSA 3M1SA 2QO9A 4FMQA 2WMBA 4A9UA 3HV3A 4YU2A 3AMBA 2JLDA 5A54A 5J9YA 3GC7A 4MWHA 4G9CA 2PK9A 3KVWA 2BFYA 3ODZX 3PXFA 3U9CA 3NYOA 5CNNA 4CT1A 4CTCA 5EG3A 2YDIA 3W16A 4G17A 1S9IA 2QURA 5ACBC 4CKJA 4BDEA 1YI6A 3EQDA 3NNUA 3TZMA 2IVUA 3OXTA 4XV1A 2WTDA 4J52A 5F20A 1PMUA 4EOMA 3CC6A 4WO5A 1WBWA 1G8JA 4YTIA 1U4DA 2J5FA 4MXOA 3SW7A 3MVLA 3R8MA 5K4IA 2WQEA 2WMXA 3F5GA 3BE9A 4U40A 5B2LA 1KOAA 4CRLA 4DFZE 1ZRZA 3BI6A 4BCGA 2HENA 3NIEA 3I6UA 3FMLA 3QRJA 2XJ0A 3SXRA 4BCOA 3HNGA 1PRYA 4FTIA 4F4PA 5BNJA 2B0QA 3QRUA 3VUHA 3UMXA 2Z7QA 4F6UA 4ZOGA 3PJ8A 5DNRA 2YLFA 3ZRKA 3OWPA 4YJRA 5HCXA 2CKOA 3G0EA 4V01A 5AP3A 2JKKA 2GS6A 3UVPA 1WVWA 4ZMEA 3V01A 4BDKA 5E8VA 4D0WA 4M69B 4O0TA 5L3AA 2A1AB 3AD5A 4ANNA 4LUDA 3H0ZA 4AXEA 5BUIA 3DBCA 4N0SA 1XMMA 2W5HA 3OWKA 3UZPA 2DYLA 5CEPA 4G1WA 4IC7A 5A4LA 5AAEA 3FMEA 2XZSA 2BCJA 4IB0A 3GU7A 5DYJA 3ZSHA 5HHWA 5IQBA 1SYKA 3KRLA 4Q5EA 4MXYA 1M2QA 5HIEA 2QODA 3OP5A 2B9JA 2YN8A 3O7LB 5FD2A 2RG5A 1YWNA 5H8EA 1RDQE 3TIZA 1MUOA 1JKLA 4LL5A 5DR9A 1T45A 3Q3BA 4TY1A 5HE0A 3DJ6A 3EHAA 5AUWA 3VULA 4CQEA 1BUHA 2XEZA 4RJ6A 4C36A 2QONA 2GMXA 2PTKA 1F0QA 3NLBA 4FTRA 4II5A 4XP3A 4KKEA 3BV3A 4U42A 2J5EA 2YDJA 4C61A 2WTKC 4EQMA 5KNJA 2ITTA 3KY2A 3UO4A 4GK4A 3ZSIA 3P78A 4XNEA 5IKWA 1PXMA 4Y73A 1P4FA 1ZYLA 2CKEA 3MN3A 2F7XE 3RK9A 4YBKA 4BCIA 4J99A 3R8UA 5HCZA 3MVHA 4AAYA 1WFCA 5C8MA 2ITUA 2OZAA 5M08A 3NMUF 4FKSA 3W18A 3MFUA 5IZFA 4RG0A 3U8WA 2XIXA 4BIEA 3CGOA 4C2VA 3LMGA 4F09A 3UO5A 1LPUA 3E63A 4RVKA 4AFEA 3KK8A 3II5A 3SGCA 2C68A 4DT9A 4CYIA 3LXKA 5AUTA 5TF9A 1YI4A 5DT0A 1A9UA 3SAYA 4E3CA 1YI3A 4QQJA 2C6OA 1Z9XA 2CGXA 3MTLA 1M2PA 4ACGA 3D94A 2CNVA 5JZNA 2QQ7A 5I4NA 4KBKA 1I09A 2VTTA 1V1KA 3D9VA 1UU7A 2ERKA 1R0EA 4FKIA 4NU1A 5AP5A 4XG4A 4FA2A 3WF6A 1OBGA 2E9PA 2IW8A 2W1ZA 2QLUA 3HYHA 4IJPA 4LRKA 3EZVA 5HZNA 2PMIA 1U54B 4IX3A 3LE6A 5CI7A 4D58A 2R3PA 5CAPA 5CF4A 1ND4A 4JRVA 3E7OA 2VTOA 4GL9A 4HGSA 2XK9A 3IDCA 4WOVA 2AYPA 2GQSA 4I0SA 5FTOA 4O4DA 3A7JA 2BRBA 2C6KA 4QOXA 3O2MA 4BB4A 5EKNA 3RJCA 1WZYA 4CG9A 3BEAA 3DFAA 5IEVA 2BZHB 3F69A 1Q3WA 5KHXA 2HELA 5IQHA 4F9AA 4JG6A 2FSOX 5E1SA 2CCHA 4HW7A 5I3RA 2V7AA 3AT4A 3HV6A 3P7BA 2IPXA 5B2KA 4BYJA 4H05A 4O22A 4D1SA 3B2TA 4IACA 1CM8A 2JIVA 3DLSA 4OAVB 2G2IA 5CZIA 4M0YA 4C38A 4K2RA 4DGLC 5JKGA 4NW6A 4FV3A 4BCPA 4HPUE 5I9VA 3K54A 3TJDA 2V7OA 3HMPA 4RA5A 5DVRA 4LV5A 3IOKA 4H1MA 5EI2A 4ACCA 4JAIA 3Q9XA 4DGGA 2QOHA 4WHZA 1ZMUA 5IQEA 1GZ8A 3PG1A 4BGHA 3UODA 5HLWA 5L2SA 4QDVA 3QD3A 2O3PA 5IQCA 3IK3A 5CQWA 2IZUA 4TNDA 2PVLA 4YGAA 3ZBXA 4ZLOA 3PPKA 3CCNA 4V04A 3FZOA 4XLIA 4AA4A 1FMOE 3RM6A 4NWMA 2BFXA 2HZ0A 3KL8A 3BLQA 1W2DA 5IH6A 3IS5A 3D14A 2W1CA 2PYWA 4FIFA 1H24A 3CS9A 2VN9A 1GIIA 2J50A 1BX6A 5CU0A 3VS0A 2XNNA 3ID6C 3DTWA 3CQUA 2ZDUA 5M07A 2IF8A 4QP4A 3BBWA 2CHLA 2GSFA 4AU8A 4DEIA 1NXKA 3D2KA 2R7IA 3G9NA 2I0EA 3GU6A 3V5TA 3U4UA 4E5WA 1S9JA 4E93A 2W1IA 4C02A 3RI1A 4AX8A 3LMHA 4D4SA 3C5IA 4RIOA 5AV4A 2C6TA 2WO6A 1O6KA 4IAZA 4K33A 4L8MA 3BYUA 3PPZA 1TVOA 2WMUA 4KAOA 2RF9A 3QKKA 5AR5A 4YC8A 3HL7A 3E87A 3OG7A 5EOBA 4H1JA 4FV8A 2IN6A 4I3ZA 4ITIA 3ANRA 4UMTA 4IW0A 1V0PA 4ZIMA 4BWPA 4QT1A 5JGBA 2B9FA 2OO8X 3UNKA 3FSKA 1KWPA 3DB8A 1QCFA 1JLUE 2VTHA 4FKWA 4QMLA 3TUDA 4XH6A 2C3JA 4AGUA 4DHFA 3Q2MA 3EQFA 4WD5A 4D28A 3BBTB 1P14A 4CZTA 5M44A 3QZHA 4BJJA 1FVRA 4D2PA 5AA9A 5IH4A 4FKVA 5IQDA 4L53A 4FICA 2KTYA 4YZMA 4DG3E 5CAVA 2OBJA 3MJ1A 4HYSA 5KKRC 4LM5A 2ACXA 3R02A 4IZYA 4O0VA 4Y95A 4BHNA 5LQFA 3QGYA 5FWKK 4FKLA 1KE6A 2ETKA 3AC4A 3LPBA 3PIXA 1B39A 3A4PA 4DGOA 4FKOA 3PA4A 3Q9YA 2UZWE 4IADA 3ATSA 3BHYA 3SHEA 1PXIA 2W9FB 3ZOSA 2HIWA 3RK5A 4GT4A 2GHMA 2YJSA 4FT3A 2FYSA 4PMPA 1UVRA 2XK4A 3V8TA 4AZSA 4NT4A 1MRUA 2PZYA 3K3IA 2VO7A 2J7TA 3Q52A 3NNVA 2NO3A 4PNIA 4ZP5A 4R7IA 3TEIA 3F7ZA 5IU2A 2YM7A 2ZV8A 5E8WA 1DAWA 4A4LA 4C62A 3H9RA 3DK3A 1M7QA 3ORTA 5EH0A 3NUSA 4AT5A 4L6QA 4EHEA 3BYVA 1ZZ2A 4TNBA 3DA6A 2EVAA 3HX4A 5KUPA 2RFNA 4QTBA 4X6RA 4M8TA 3FWQA 2DUVA 3UOHA 2W1EA 3QXOA 2G2HA 1B38A 4RMZA 4FVRA 4JDJA 2VTQA 3FMDA 3PY0A 5H8BA 3UC3A 3DXPA 4F1OA 3R2BA 4JBOA 2ITQA 4Y5HA 4D2WA 3UZRA 3KXHA 5CU2A 5T68A 2F57A 3V8SA 3W8QA 2OWBA 5J79A 3FLYA 2WEVA 4X21A 3BGZA 3NDMA 4TN6A 2B9IA 3NUAA 3I6WA 3GU8A 2XNGA 3FZPA 2HYYA 3A7HA 4YPDA 4DFXE 2J0JA 3L8VA 4MYGA 5JH6A 2VWIA 4DEDA 3N4UA 1ZY4A 2YZLA 2CPKE 3OUNB 5JGDA 4YC6A 1DI8A 1M14A 3O23A 5F4NA 3VUTA 4DTBA 3R30A 2EB3A 2O64A 4NSTA 3FY0A 3R7IA 3CY3A 2QG5A 1JVPP 2NRUA 3VJOA 5CLPA 2W7XA 3G5DA 4IB5A 2I1MA 3RPOA 2HW6A 4HYIA 2CGUA 4RGJA 3WIKA 4AT4A 3NW7A 4XV9A 5EDRA 2PE0A 3EH9A 4KUJA 5M09A 2W1GA 3JY9A 5HTIA 4IWQA 2FVDA 4L46A 4YJUA 4UX9A 4ZS4A 4MD7E 4MXAA 3DBFA 3BL7A 4QDEA 5JRSA 1VEBA 3OTVA 4CRSA 3W2SA 1H0VA 2CNUA 1UNHA 3CIKA 3DKFA 3AD4A 4A9YA 2QU6A 4JJRA 3RK7A 3GCUA 4YJPA 3EN5A 1DM2A 3HMIA 3R9OA 3V8WA 4D2SA 3IGOA 3KF4A 4FIGA 4G3GA 5L8KA 5AR4A 2JAMA 5DG5A 2PUIA 4G5JA 3TT0A 2BZIB 4QMOA 2X0PA 3BE2A 4FV9A 1H07A 2W06A 1KOBA 2VO0A 5ANKA 5ETIA 3VWAA 2P2IA 3R00A 1Y8YA 1JBPE 4FIIA 4H58A 2EUFB 3FMHA 3NUYA 3GCVA 3QTWA 4A9SA 4DG0E 3ORNA 4AN9A 4AQKA 5FDPA 4ZTMA 4RC2A 3W1FA 4ZY6A 5L2WA 4PL5A 1OL5A 3D7ZA 3DXNA 4ZJIA 1OIYA 2VO3A 5HNGA 1V0OA 3ZFXA 1VR2A 3KMMA 2UVYA 4JDIA 4YO6A 3FE3A 2GNHA 4O4FA 3LFQA 2JKOA 1W83A 4O4CA 4FTNA 5EQYA 3G0FA 2HXQA 1U46A 1G5SA 1XMLA 4UXQA 3PUFC 4IBMA 3RKBA 4IMYA 4FEWA 2CGVA 3DQXA 4CTBA 4YNEA 4DFYA 4FV5A 1SM2A 3Q9ZA 3RCDA 4YUQA 5HTBA 3TV4A 4GKHA 4WG4A 4BWXA 4O0RA 3CBLA 4BKYA 3ACJA 3QQJA 4OBQA 1YXUA 5F9EA 2XKEA 4XP0A 3KRRA 5DIAA 4E1ZA 5E1EA 5JFVA 2ZFYA 4QP2A 4O83A 3W0QA 4QEBA 2XIRA 4C4IA 3CKWA 4FE2A 5ETAA 1YHVA 1FGIA 3RCJA 2X8EA 4HJOA 2PL0A 4G3CA 4FZAB 4K6ZA 3GVUA 2R0IA 3I60A 4ZEGA 3RHKA 4BHZA 5M51A 3U54A 3LAUA 4EHVA 5GJDA 4DHIB 3MYGA 4ITHA 1MQBA 3A8XA 4ENXA 2YAAA 3T9IA 4RWKA 2VD5A 2BUJA 1JSTA 5AR3A 2RIOA 4FSWA 5HO8A 3ZFYA 3MFSA 3BLAA 2PHKA 2Z7SA 3UPXA 1OL2A 2FSTX 3PFQA 3AMYA 3U6IA 1IASA 2BDWA 4GYIA 3AGMA 4XYFA 5AP2A 4O4BB 3QD0A 4P5QA 1IAJA 3HLLA 3OFMA 1IG1A 3V5LA 4AWIA 3JR1A 4O7TA 4NIFA 3QUDA 5A3XA 4F1MA 4I4EA 4L43A 3VBVA 2BAKA 1ZAOA 2WHBA 3MVJA 2XP2A 3LQ5A 3N4VA 2J90A 4UMRA 2R3LA 4EH4A 5GJFA 3PE1A 5IH5A 5EM5A 4QTDA 4IWDA 2C3LA 2Q0NA 1H25A 3ORIA 4YJOA 5IQAA 5K5NA 4DEGA 3SA0A 4ZSEA 5HVKA 4K0YA 4RWLA 4OTQA 5AWMA 4LV7A 4LL0A 2OF2A 3GB2A 1CDKA 4ASZA 4D2TA 3W0SA 1AD5A 2XVDA 5E91A 4YTCA 4LFIA 3R63A 4WNKA 3SVVA 4D0XA 1GOLA 3Q53A 3HUBA 3QA8A 1FQ1B 5HNBA 3ULIA 4HZSA 2VZ6A 2VTLA 5CF8A 4CFMA 3ROYA 1R78A 4GIHA 5L4QA 4BIDA 3W0MA 4FEXA 4OTDA 1SVEA 2OIQA 3HAMA 3O50A 4S2ZA 3FMNA 3FYKX 2BIYA 1FVVA 2PWLA 3HDNA 4AP7A 4QMMA 2YA9A 3BYSA 3PZEA 3FQEA 2JIIA 2XMYA 2XYNA 3PJ3A 3K5VA 1SVHA 3DZQA 3LLTA 4DEHA 5DE2A 2OK1A 2ETRA 1P4OA 4A06A 4QMYA 4AN2A 5ITAA 5BPYA 4E73A 2FSLX 1O6YA 4J71A 5BYZA 5IDPA 3NWWA 5EM6A 5FLFA 2HWPA 3EKNA 4QP7A 4QMQA 5HBEA 2ZB1A 3EJ1A 4QYFA