3E8DA

Crystal structures of the kinase domain of akt2 in complex with atp-competitive inhibitors
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
Knots found
sequence length
335
structure length
315
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITHFPQFDYSASIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-beta serine/threonine-protein kinase
publication title Aminofurazans as potent inhibitors of AKT kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 315
sequence length 335
chains with identical sequence B
other databases KnotProt 2.0: Artifct K 41 41
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e8dA01
1EH4A 4E1ZA 5K4JA 5IQCA 3LJ1A 2GTNA 2ZAZA 1FVVA 4I5CA 3TV6A 4HCUA 2R3NA 4E3CA 3C50A 3HV5A 4AW1A 1YWVA 4C3PA 2A19B 4HZRA 3QA0A 5EDQA 4C8BA 5AP2A 3PZHA 4FIIA 4LI5A 4NIFA 1E9HA 5TR6A 4ALUA 3JY9A 4RIXA 4FTOA 4OGRA 5HNIX 1IR3A 2GHLA 3GB2A 1UV5A 4PDOA 2EXEA 2HZNA 2XCHA 5AUXA 3HA6A 4TXCA 5I9XA 4QP6A 3QTXA 1WVXA 4YBKA 4QP8A 3RM7A 4A9UA 3TKHA 3DTWA 3SW7A 3TDVA 4DF3A 5LQFA 3H30A 1UU9A 4U79A 3CEKA 5DWRA 3AC2A 3VJOA 3TUCA 1PRYA 2PUIA 2EWAA 4RPVA 2IW8A 3IDBA 4UWBA 4R5SA 4YJNA 4A07A 4AW0A 4CFWA 2C6MA 3ZRMA 5HLWA 3AMBA 3NWWA 3PY1A 4FSWA 4O0UA 4C38A 3JXWA 4YJSA 2P2IA 3AT4A 3F2NA 3QTWA 4EH6A 1FPUA 5JH6A 4O38A 3OHTA 1J1CA 1SNXA 2BRBA 3GCUA 4CKRA 3VUGA 3GU7A 4BWKA 3BU3A 3Q4UA 1BLXA 2JEDA 4G1WA 5HEZA 3ORMA 2PWLA 3BELA 3PIYA 1J3HA 4NKSA 5CZIA 2J4ZA 1REKA 2RG5A 3QAME 2W5AA 4FTMA 2R3JA 3KC3A 3QYZA 4IIRA 4XRLA 3ZZWA 3SXRA 2JKOA 2FUMA 4AOTA 4DGMA 2W1ZA 2UVYA 4KINA 5IA1A 5DT0A 4AA4A 2XNEA 3N4UA 4IAIA 2UW4A 4KBCA 2GQRA 1XH5A 2W4KA 3I0QA 5DH3A 5DRDA 4WG3A 3MV5A 4G9CA 4L67A 3P5KA 5JFWA 2RFDA 1YOJA 4ACGA 4HGTA 4I0TA 4QNAA 3IG7A 5I9WA 5K0XA 1H1RA 3BBTB 5AAGA 3EQGA 4BKZA 3QTIA 3U55A 4UV0A 5KBQA 3JY0A 2R0IA 3QTZA 4BCQA 2IJMA 3P0MA 4R7IA 1Y57A 4RVLA 4ALWA 4CZYB 4WHZA 2XNNA 3SLSA 5FXRA 3D0EA 5EW8A 2BDFA 4BI0A 5LJJA 3LXKA 4U7ZA 1UKHA 3IPHA 4C59A 3U9NA 3R02A 4RA4A 4RSSA 3Q32A 3QFVA 5GJGA 3GU5A 4J52A 4DCAA 4DH7A 3A4OX 4TYJA 2HXLA 3VUDA 3A7FA 2YM5A 5C01A 3E8CA 3GVUA 5D7VA 3V5LA 2W17A 3ORTA 2PMLX 3WARA 4D4YA 3L8PA 4JBVA 4GKHA 3OCSA 5A14A 3RBWA 2J90A 3L9PA 1GZKA 2XJ1A 3GQIA 4FTKA 4J96A 5I9YA 4DBXA 4LGHA 4DGOA 2ZDTA 2OH0E 1IA8A 3DA6A 4M12A 3QF9A 4QP3A 1YVJA 4K0YA 4EWQA 3BKBA 3H3CA 4O22A 3R04A 1YI4A 3PZEA 5I0BA 4EH2A 3I1AA 3CR0A 2BAKA 3AMAA 1Z5MA 4CQGA 2FSTX 1FOTA 4M13A 5HESA 3KVXA 5FLFA 4V04A 2XNBA 3A7JA 2UW9A 2B9JA 4JOAA 4R6VA 4MTAA 1NA7A 4GG7A 5AR8A 4W9XA 3R71A 3QX2A 4JDKA 3R7OA 3F5UA 4XG4A 4ITJA 3DKOA 5AR2A 1E1XA 2J5FA 2QOHA 4HGSA 4WT6A 3ZSIA 5JGAA 4MH7A 3PJ2A 4YHJA 3FKLA 2Y6OA 4HVHA 5JFXA 3FLQA 1OBGA 3F5XA 2JLDA 1HOWA 4O1PA 4TWCA 3F2RA 2VWVA 3I0OA 4CFNA 2WTCA 3ZM4A 3NYNA 4IVCA 3NRMA 5CX9A 3MVJA 4QD6A 5T3QA 5M53A 5DT3A 2RGPA 2C3LA 1W82A 2R3PA 2UUEA 5HCZA 3R7YA 2PU8A 3PJ3A 3R30A 5DFPA 5F1ZA 4J71A 4IZAA 4EOMA 3ROCA 4BDEA 1KE6A 5F95A 3JPVA 2OF2A 4C4EA 3JYAA 3KCKA 1BMKA 1UNHA 1ZWSA 1UKIA 2HXQA 2F7EE 4L42A 4MK0A 4XMOA 3TUDA 4R3PA 3R8UA 3RVGA 3W32A 3GP0A 5LWMA 4QYFA 5EQYA 5B7VA 4GIHA 3MH2A 1PXIA 1S9IA 4YMJA 3T9TA 2YJSA 3DBFA 4MD7E 4A4XA 4JBQA 3WBLA 5A6OA 4F7JA 1AGWA 1OIUA 1U5QA 5A9UA 4NFNA 3KA0A 2XIRA 3FHIA 4ANOA 1SNUA 1CTPE 3D9VA 4XG2A 4ENXA 4RVKA 4YC6A 3WF7A 4CT2A 2XNGA 4RJ5A 3QZHA 4YJOA 4EJNA 3N4VA 4G2FA 2A1AB 4IH8A 4KBAA 3BQCA 3MVMA 2ZVAA 4OTIA 5EM8A 4C58A 1CKIA 5FEQA 4GFOA 4FZ7A 4F7NA 3IW4A 4I5HA 3TNWA 1XO2B 3QTQA 1KV2A 4KAOA 4C4GA 4QYGA 4FUYA 4UMPA 3MN3A 4Q9SA 2CGWA 4RX8A 4QPMA 4ZJVA 5IUGA 4RJ4A 3R1NA 5L8KA 1ZZ2A 3D5VA 5EW3A 2UVZA 2YM8A 4ERWA 2W4OA 3UP7A 4CFFA 3QZGA 3FLWA 3OMVA 4RJ8A 1RDQE 3D15A 4QMLA 3VUMA 2W7XA 2ZM1A 3B8RA 1PXJA 2VTLA 3L8XA 3OEFX 3QLGA 4IEBA 4JRNA 4MVFA 4XHKB 4L7SA 5HQ0A 4FV6A 3D5UA 3PSDA 2G01A 4IXPA 2HAKA 3A61A 4E26A 3E87A 5GNKA 5JFVA 3UQGA 3ROYA 1X8BA 4FG7A 1SMHA 4XX9A 3FDNA 3GC7A 4TY1A 4HVIA 3OCBA 3TUBA 5GIOE 1KV1A 5IU2A 1PXOA 4FIJA 4GW8A 2BIYA 2OXXA 5EHYA 4YZ9A 4A9RA 3SG8A 2CHLA 2P0CA 4L3PA 3FQSA 4FKOA 2OZAB 4GUEA 2R7BA 4EH9A 3K54A 1VR2A 3WI6A 3UTOA 4DG3E 3UG1A 4UYNA 3KVWA 1OKWA 4WD5A 3MS9A 4XG9A 2IN6A 3RWPA 4GG5A 3II5A 2BAJA 4F70A 4ZY4A 4AFEA 3DAKA 5CEQA 2QURA 5ITAA 3R8MA 5M55A 5LCJA 3S3IA 2WXVA 4W8EA 1XJDA 1GJOA 2Z7LA 4RIOA 4MWHA 3HMOA 3EN4A 3W33A 3PXYA 2UZUE 1OL2A 2WMWA 5LVLA 4BKYA 4ZIMA 3SW4A 2BTSA 1PYXA 2QONA 3GCQA 4MNEB 3FMKA 4JDJA 3I5NA 3A8XA 2R4BA 3LIJA 3Q5IA 5HO7A 3P7AA 2UW5A 3HUCA 1Q8ZA 1IG1A 2XK9A 3GBZA 3N51A 2HZ0A 4AQCA 5KBRA 4BGQA 3NW7A 5IQAA 4WNMA 3F5GA 2PZRA 5L2QA 1WBTA 3GI3A 4FTIA 5CNNA 4FOCA 3VRYA 1ZY4A 4NT4A 2OFUA 3IGGA 5M09A 2IO6A 5C8KA 1H1QA 1IASA 1F5QA 2H8HA 4KS7A 5CQWA 4UMTA 2C0TA 4JR3A 3UQCA 4ZSEA 2XVDA 1XWSA 2PE0A 5DR2A 3UVPA 4XNEA 4CVAA 4MX9A 2XP2A 4N6ZA 3DJ7A 4E6CA 1DI9A 3DAEA 4FICA 4AT5A 4X3FB 2XIKA 2F57A 5AEPA 5IH6A 3DAJA 5HBHA 2BZJA 4FI1A 4B7TA 3FZRA 5HOAA 1URCA 4F7LA 5IA4A 3ELJA 4L01A 1FVRA 3CKXA 4RGJA 2BHHA 4YPDA 5HO8A 2B7AA 2Y7JA 4NKAA 4Z9LA 3AC1A 2OJFE 3L9MA 5FQDC 3ZFYA 1GOLA 2VWUA 4ZLOA 4A7CA 3O8TA 5K4IA 3REPA 5L6WL 3HP5A 3Q04A 3OUKA 4C36A 5AR5A 1YRPA 1VYZA 2PZ5A 2VTTA 3TDWA 3CSVA 3VBXA 4RC3A 4CD0A 5ETAA 2C47A 2C3JA 3AGLA 1A9UA 4HOKA 4HNIA 4WBOA 1OIQA 1O6KA 4XYFA 3P78A 5AUVA 4C3RA 2BROA 3C4CA 3HV3A 2FYSA 4IZ5A 3KRXA 4K11A 4OLIA 4QYYA 2VWZA 4BDFA 3NS9A 4QTEA 5KNJA 5M51A 1OMWA 3QHWA 1L8TA 3HAMA 2QHNA 3NZ0A 4PRJA 4PF4A 3RI1A 3TJDA 3WYXA 3WF8A 4CGAA 4AN3A 4ZTQA 2OZAA 3Q5ZA 1OL6A 3TNQB 2W99B 4TKSA 4PDYA 3BGQA 2WELA 3UOJA 4ANNA 5FG8A 4E4LA 5L6OA 1RE8A 3PWYA 5BVKA 4P2KA 4XLIA 3ZLXA 3ATSA 1M7NA 4BN1A 5FWKK 1B6CB 2PUNA 3F3ZA 3ZLSA 3G0FA 4QOXA 2YWVA 3GGFA 5D41A 4FT3A 3IW6A 5L2SA 5KKRC 5CF8A 2RKUA 4H1MA 4U8ZA 3VHKA 3DZQA 4OTFA 5TOZA 2GU8A 1LEWA 3EOCA 4FVQA 4X2JA 4XG3A 2BPMA 1JPAA 3CCNA 3ZSHA 2UW0A 3ANRA 3GENA 3OT8A 5FEDA 4UXQA 5JGBA 3FWQA 4Y83A 1XBAA 4FGBA 2UZBA 3GXLA 2AC5A 2ACXA 3EN9A 4EKLA 1ZYLA 3HP2A 5HIBA 4QP9A 1O6LA 3AGMA 5M4IA 3UZTA 4H05A 2O3PA 2IW6A 2VTPA 4EH8A 1P2AA 1O6YA 4NYEA 3DK7A 3F88A 3RCDA 3LMHA 4YC3A 5IH4A 3ZBFA 2NP8A 4EBVA 4YZBA 4FV7A 5IKWA 3FMDA 4B8MA 2C5XA 5CY3A 4A9TA 1NXKA 4U42A 5FDXA 2DWBA 2VZ6A 5AR7A 4YHFA 1QPCA 3HL7A 3COKA 1W7HA 4AZTA 3E64A 4NK9A 4DLJA 4O0RA 3FBVA 5CXHA 3H9OA 1ZMUA 4AE6A 5CQUA 3BU5A 3FMNA 3OOMA 1J91A 3FLZA 2BZHB 1OKVA 3W16A 3ZFMA 3Q9XA 4FSMA 4PMSA 3CTQA 5IISA 3OW4A 5GINE 1WBSA 3FXZA 2XRUA 3R2BA 5CEOA 3BWFA 4U3YA 3IW8A 3VS1A 1JSTA 4E73A 4X21A 3EFLA 3OUNB 4IDVA 4MBJA 3CE3A 1SVEA 3ODYX 5HVJA 4EUUA 4I24A 4OBQA 4ZMFA 4L45A 4XCUA 2JAMA 2C30A 3BBWA 4G34A 2CGUA 1GAGA 3RPOA 4I5PA 2C3KA 3EJ1A 4QYHA 4HVSA 3I7BA 2YJRA 2UW7A 4IBMA 2UW8A 4PX6A 3VW6A 3HRBA 2WMQA 4C4HA 3TM0A 4XP0A 3LFNA 4AXAA 1YXVA 5AX3A 2BR1A 2UV2A 5H3QA 3OS3A 3F2AA 4N6YA 3SV0A 2PYWA 2X7FA 3E63A 4KNBA 5CAPA 1PMUA 4J8MA 4R5YA 3FJQE 3QKMA 3EN5A 2IPXA 3KN5A 4QMTA 1WMKA 4P90A 3DKFA 2XNMA 4JXFA 1ZOEA 3FZ1A 3I60A 3MSSA 4PQNA 4APCA 5HIEA 5LMBA 3OG7A 3T8OA 5EI8A 3DNEA 4OUCA 2OG8A 2YIRA 2QO9A 5KKRB 2FVDA 1H1PA 1Y8YA 3FY0A 3FEGA 4YTHA 1QMZA 2J0MB 3ZEWA 3FLSA 4FT9A 3MB6A 1ZXEA 4AG8A 1NY3A 4FYOA 5I9VA 1J1BA 2XKFA 5HO6A 3ZONA 3GCSA 4IANA 5K3YA 2Y4IC 4WBBB 3F5PA 3QL8A 3VRZA 4HYIA 4IWPA 2E9OA 4ZZOA 3C51A 2ERKA 3L1SA 3G33A 3MIYA 3P7CA 2C6OA 2VTJA 5J95A 2QOIA 4BCJA 3RGFA 5HG7A 3VBWA 2XB7A 4WRSA 3ZLWA 4KA3A 5AM6A 1R1WA 5HBEA 2VUWA 3LE6A 3FI4A 5EM7A 4J8NA 4E5BA 5IZFA 4EH5A 4BCGA 3NAYA 3RP9A 4DE4A 3SA0A 5D1JA 3IOPA 3WYYA 3D7ZA 4HJOA 4S32A 4AUAA 1JSUA 1WBVA 2IVUA 3LQ8A 4U44A 4G3EA 4I5MA 2OIDA 4F65A 4FNWA 4O7VA 3FE3A 3R7EA 2Y9QA 3CPBA 3WZJA 4F63A 3ZH8A 3Q9WA 5FRIA 3VC4A 4TWOA 3COHA 4YZMA 3RZFA 4DLIA 3EB0A 2VU3A 4O7SA 3VJNA 1AQ1A 2BFYA 2J9MA 4DA5A 3R28A 4MYGA 4D1XA 4KIQA 4GK3A 5A46A 4JRVA 1VZOA 2XRWA 1F3MC 3P7BA 3OCTA 4K8AA 5J1WA 2C6LA 2HY81 2W5HA 3PY0A 2VD5A 4O84A 3ZRLA 3UDBA 5HCXA 3C0HA 2QOKA 4HNFA 4DH1A 1P14A 4DFUA 5FTOA 3V8TA 4BYIA 1BI8A 4AZFA 3GFWA 2I1MA 2Y6MA 4I6QA 1CDKA 1ZZLA 4FV5A 4BZDA 4I22A 3PE1A 2O0UA 4QMWA 4O0VA 1UA2A 3ET7A 4CFUA 2UZEA 4J98A 2ITQA 3Q2MA 3FSFA 5IMXA 4BBMA 3ZC6A 3FI3A 1KE8A 4J95A 5F4NA 1UWJA 3F3VA 2UZTA 4MQ1A 4W8DA 4BC6A 2R3KA 3DB6A 4OBPA 3EQPA 5CAOA 3A2CA 1SVHA 4UEUA 2X8IA 3H0ZA 4I41A 2CN5A 2PY3A 1M14A 3NIEA 2XF0A 3NUPA 5IQBA 3ZEPA 4BDGA 3Q9ZA 1ZY5A 3MDYA 3PPJA 3MY5A 3EZVA 5J9YA 4U81A 3DNDA 2IZRA 1YXXA 2QLQA 3EL8A 5E8TA 4ZMEA 2RSVA 1FVTA 4GS6A 4EOPA 4D2WA 4NIFB 4NW6A 5CU3A 4ZZNA 4KSQA 4RIXB 4W9WA 3QZIA 4D0XA 4CTBA 2W1GA 4F08A 3QTSA 3VHEA 3HMMA 4BB4A 3VO3A 3NNWA 4QMUA 5D11A 5FBOA 2JDSA 4CRSA 5ICPA 4BY9E 5IQGA 3KMWA 2OK1A 3PVBA 4X7QA 1H26A 3ACKA 3KRWA 2CKPA 3W10A 3LCDA 2WAJA 1OGUA 3HV4A 3NUSA 4G5PA 4FZFB 3F61A 4GH2A 4NH1A 4FNXA 3R9OA 4O81A 5CTPA 4IB0A 3UNJA 3CLYA 2E9VA 2E9NA 2B4SB 3OFMA 3KL8A 2JIVA 4N0SA 4D0WA 3SAYA 3PDTA 4O6EA 2GHMA 3KXXA 3E7VA 5KO1A 4F1MA 3OWPA 3T3UA 3O8UA 2WTVA 4Y72A 2VWIA 4QMOA 4I3ZA 1NW1A 3BI6A 2VTRA 1IAHA 2XIYA 1VYWA 1R3CA 1W83A 4N57A 3R1YA 2XIZA 3DK3A 2PTKA 2W1IA 4QMPA 3WZEA 4R1YA 2ITVA 3KQ7A 2X2KA 5DOSA 5BVFA 3DCVA 4V0GB 3F82A 2BZKB 4YJRA 3R0TA 5EI2A 3LHJA 1W98A 4Q5HA 3E92A 4DEIA 4CMTA 3HKOA 4WNPA 2W05A 3OXZA 5HORA 4DH3A 2FB8A 1OZ1A 1Q8UA 3QUEA 2YABA 4RQVA 4YZDA 4I0RA 4DFLA 1NT2A 4EK8A 2XK3A 4PL4A 2LAVA 3KK9A 3TKIA 4EI4A 3OWLA 4ONAA 5M4UA 5IQEA 3V5PA 2OSCA 5E90A 3B2TA 5CYIA 1YHSA 4RWLA 3IS5A 1BKXA 3QZFA 5EI6A 4DN5A 2UZLA 4LRJA 3D2KA 4E93A 3IK3A 1PY5A 3DLZA 3R00A 4TYGA 5J9ZA 4QMNA 5CALA 1B38A 1M17A 3CJGA 3HRFA 3HVCA 4U43A 3WE8A 3D4QA 5E1SA 3V5QA 5HI2A 1YI3A 3DU8A 5IDPA 2HY0A 2F2CB 3AMYA 3GC8A 2FSOX 2EUFB 5HE2A 3F3TA 4RX5A 2W5BA 4FSTA 3UC3A 2PMNX 3RPSA 1Y6BA 3FI8A 4CG9A 3PRFA 2XK4A 1GIJA 3BX5A 3SC1A 3QD2B 3GU4A 4HZSA 5HX6A 3UO5A 1JKTA 3QWKA 3G6HA 4PP7A 5KHXA 3W8LA 2Z60A 4FA2A 3PJ1A 3LQ5A 2P2HA 4AGUA 2BMCA 3K3JA 4BGHA 1FBNA 4O86A 3LQ3A 5AUTA 2F7ZE 4FZAB 2HZIA 2QR7A 1W84A 2QO2A 3D7TB 3C5UA 3G6GA 1UVRA 3QQLA 2J0LA 3T9IA 4QMMA 4PP9A 3EZRA 3DQXA 2WNTA 4FK3A 5KMNA 1ZMWA 4G3FA 4C4FA 4D4VA 3F3UA 3MA6A 4X2KA 5C26A 1ATPE 1UWHA 3NX8A 4FSQA 4GVAA 2C6TA 3ORIA 4XBUA 4E4NA 2RFEA 4JJRA 4PTGA 4OAVB 2VO7A 3MW1A 4OTQA 2CLXA 2ZYBA 4ACCA 3BPRA 4I0SA 2R5TA 4FIFA 2XCKA 3Q52A 1ND4A 2ZB0A 4IFGA 4BCFA 4ZTHA 2SRCA 4FTQA 3R9HA 4BIBA 3MIAA 5ETFA 2UW3A 3IW5A 4EOIA 4GYIA 4V0GA 4FKWA 4R77A 3U54A 3D83A 4AGDA 4J53A 2OFVA 2PVNA 4DG2E 3G9LX 4S2ZA 5CEKA 1OIYA 4YJTA 5D12A 3ORZA 3POZA 5CVFA 4IC8A 2RFNA 3HA8A 4MF1A 3ULZA 4Z7GA 1JNKA 2OICA 3UO6A 2R64A 2ZV9A 3A7GA 3ORPA 5C8NA 3PIXA 5DGZA 5DYJA 1XKKA 2B0QA 3QRIA 1SYKA 2AUHA 2E2BA 3MPMA 4O0YA 5KE0A 5CAUA 1Q4LA 2OJIA 3QLFA 1YDTE 3RPVA 3BV3A 3MYGA 4UALA 4AOJA 4WKQA 2XM8A 3EQIA 4JQ7A 4U0IA 4ENYA 3ZLYA 2P4IA 4RC2A 2WKMA 4AA0A 4YO4A 3DBQA 3OY3A 4RJ6A 3ULIA 1RW8A 3PXRA 4ZEGA 5A4LA 4IWQA 4BCHA 2VTSA 3R73A 2A27A 2V0DA 4D5HA 1Z9XA 2ERZE 2YM3A 4IHPA 1YKRA 1GZNA 2R3FA 2WGJA 4UWCA 3RINA 5B2LA 4AF3A 1XH4A 4YLLA 2O8YA 3R9RA 3MH0A 4EOSA 3UIBA 3POOA 4HCVA 3BYUA 4F6UA 1S9JA 1LR4A 1PF8A 3RJCA 3BGZA 4BCNA 3R6XA 4XOZA 1HCKA 3UIMA 2I0EA 4O21A 3ORLA 1MUOA 3F6XA 5HNBA 2CNUA 5EOBA 2VWXA 2XM9A 4MXYA 4Y5HA 4YJVA 5F9EA 3DPKA 3D7TA 2XS0A 3QD3A 3FMHA 3UODA 3QC4A 5ACKA 1PXMA 2QG7A 3QCQA 2DQ7X 3QD0A 4QMVA 4W4XA 4CCUA 4CXAA 4KWPA 3MVHA 3O2MA 5A3XA 5EYKA 3RCJA 1TQPA 2QI8A 5HD4A 3O7LB 5M07A 3COMA 2C6IA 4PL5A 1XR1A 2VX1A 3S95A 3NNVA 4W4YA 3GCPA 3ZO4A 4DEAA 2RF9A 3TL8A 4JQ8A 3K2LA 3VS2A 3H9RA 2OJGA 3AQVA 3PA5A 4H36A 2A2AA 2UZVA 2X81A 3GOPA 3BYOA 3G5DA 1JQHA 2Y4PA 4AN9A 4TL0A 5L4QA 1OKYA 3A62A 4NTTA 2WTWA 2Z8CA 3HLLA 4BDKA 5HX8A 3BLRA 3QA8A 5EG3A 4XP3A 1J7IA 5JEBA 1CKPA 4KKGA 3QD4A 2J0IA 3FLNC 4DCEA 4C35A 4EJ7A 3KRLA 4I4FA 1XBBA 3UP2A 4V01A 2PVLA 4EOOA 3WF9A 2HK5A 1M7QA 5E7RA 3E3PA 2WB8A 1DAYA 3QRKA 4LM5A 4NW5A 4ZXTA 1FINA 3ZMMA 3C4WA 1YI6A 4F09A 3MPTA 2XBAA 3LM0A 2QU6A 1AD5A 4JBPA 2AYPA 1UU7A 2J0KA 3QGYA 2YAAA 1XH7A 4YU2A 2GNFA 2R0UA 2W1HA 5ANKA 3PA3A 4LV8A 5H9BA 4AAAA 5I9ZA 5L6PA 3DKCA 5AIKA 4F6WA 4K1BA 4M15A 1PKDA 3LFDA 5DPVA 2ZMDA 5ETCA 3TV7A 3QCYA 4EK3A 2GCDA 5E8VA 4ZY6A 1URWA 4H58A 4AT3A 3GEQA 4CEGA 3FHRA 4DEDA 5BPYA 1TVOA 2VTHA 5L8JA 1FMKA 1SZMA 5I5ZA 4H39A 2B53A 2R3LA 4WA9A 4RBLA 4F9WA 5L3AA 3TCPA 5IA2A 3JVSA 2EXMA 4GJ3A 3PPKA 5LOHA 3EKKA 3VS4A 5AP5A 3DDQA 3MWUA 1YXSA 4JX7A 5AP3A 3RK5A 4B8LA 4MNFA 2JDOA 2HW7A 3G2FA 3HRCA 4ID7A 4Z7HA 5BYZA 3FLYA 4ZSAA 2O2UA 4DG0E 1KOAA 3AT2A 3V04A 5CT0A 5EM5A 3OVVA 3A4PA 2HCKA 4WSQA 3DV3A 4M67A 4C7TA 2PVMA 3MA3A 5L2WA 5DN3A 3S4QA 4CZTA 2QOQA 3VUKA 3UYTA 4E5WA 3UIXA 4ZK5A 3WZUA 5A4CA 4QP7A 5AV0A 4P5ZA 2YDJA 4YTIA 4EK6A 2WEVA 2NRYA 3QYWA 4NEUA 4TW9A 4CMUA 2YM4A 2QKWB 3BEAA 1M2RA 4BCIA 2HENA 3MJ1A 5KMIA 4ZTSA 4RVMA 2YITA 3KREA 5CU2A 3LFBA 2WTJA 5AUWA 5LCKA 2WTDA 3B8QA 2C5YA 3GNIB 4S33A 2F49A 2X8DA 5IQHA 3UIUA 3Q4CA 4Z16A 1CM8A 2VWBA 4AU8A 3RHXA 3E62A 3FI2A 4IVBA 5DLSA 1ZARA 4HPTE 4MXZA 1H00A 5JMSA 1IA9A 3MBLA 3LZBA 4W4VA 5HTCA 5CWZA 1Z57A 5E8YA 4LYNA 5IUIA 3QWJA 4AZSA 4D4SA 4FSZA 2Z02A 2HIWA 4TRLA 1H0VA 2EVAA 3NSZA 3ZXZA 4ANMA 3EWHA 3DT1A 5KMMA 2LGCA 3U4UA 2PL0A 2PVYA 4DEHA 3ZDIA 2PE2A 2BRHA 4JAJA 1H0WA 4G6OA 3ZCLA 4DT8A 4FT5A 3QQJA 4DGNA 3DJ5A 3E8NA 3W2CA 5HU3A 4RQKA 2F9GA 1V0OA 4EWHA 5ANOA 4R78A 3QQKA 1LPUA 3EHAA 3C13A 2W1FA 1DAWA 4BZOA 5IEXA 2VNWA 3KCFA 3NUYA 4TWPA 2Q0BA 3EMGA 3OY1A 4KBKA 5ANEA 4ZZMA 3KB7A 4LUEA 4IB3A 1K3AA 2OWBA 3U87A 5A4TA 1JWHA 5IDNA 2ESMA 3VAPA 3MTFA 4FVPA 5T68A 3EFJA 2C1AA 5EHOA 4FEQA 4GRBA 3ID6C 2PUUA 4QMZA 4C0TA 2FGIA 2KTYA 1DI8A 2YDKA 4O7LA 5J87A 2ETMA 2BZIB 2YIYA 2YCSA 1APME 3E5AA 2FSMX 2J51A 4NFMA 4WUAA 4E6DA 5IUHA 2CSNA 3RK9A 5CANA 5KMLA 2FA2A 1WFCA 4FKQA 5GZAA 2C6DA 1ZYDA 2C69A 5LWNA 3LFSA 2XEYA 4UZHA 5FXQA 4LL0A 5JKGA 4GIIA 4MKCA 5K0KA 3C4XA 4G16A 3RAIA 5CENA 3SDJA 3VBQA 3ZTXA 4USFA 4MXCA 3IGOA 3S00A 3W2QA 2HYYA 2GPHA 3TNIA 5JZJA 4D1ZA 3FMJA 3QQGA 3AD4A 4C33A 5CI7A 3HMIA 2YISA 5AADA 5F94A 4QNYA 2CGVA 1JSVA 5L2TA 4AT4A 3MH1A 2VO0A 3AD6A 3LFQA 4O2PA 1W0XC 4DINA 3OTUA 3SQQA 4ASZA 4TWNA 4TT7A 5CEIA 5EHLA 5CF5A 2XKEA 5CNOA 3C0IA 3R21A 4EZ7A 4EUTA 4I93A 3KRJA 2ZMCA 4HYHA 5FTQA 3W1FA 4YJQA 5LARA 4NZWB 4J1RA 5HICA 4FEXA 4IM2A 2WOTA 3KF7A 2BTRA 2QCSA 2A0CX 4MCVA 3Q60A 3THBA 3VQHA 4BCMA 2C5VA 2WMUA 4HGLA 5B2KA 1OUKA 3RWQA 4BZNA 3BYVA 3RAKA 3C4FA 5LVPA 4TPTA 4KB8A 3Q3BA 5KX8A 5JRSA 4JG7A 3TNPC 4LOPA 3BHHA 2IZTA 5CU0A 4FNYA 4JIKA 3C4ZA 2YCQA 3GC9A 4GK4A 3HAVA 4O7WA 2B55A 5IQIA 1UU3A 2WQNA 4IQ6A 4M69A 4QQJA 2PHKA 1H1SA 2JDRA 2GTMA 2YWPA 3M42A 3O51A 1Q62A 1YQJA 5HVYA 3H9FA 3O23A 5AUZA 3EQRA 2CNQA 2DYLA 2GNJA 4YBJA 3UOLA 3KMMA 4DGLC 4I21A 5DHJA 3PE2A 2OXYA 3MI9A 4YURA 4ZP5A 3TIZA 5IQDA 3OROA 2WHBA 2ZM4A 1OBDA 4F99A 4ZS4A 2Y8OA 3D5WA 3FMEA 3PXQA 3WF5A 5I3RA 4D2VA 4GK2A 1M2QA 1WBNA 3COIA 2PVRA 3EL7A 3EN7A 1PMNA 3PRIA 4FTLA 4FV2A 5I3OA 4AX8A 4BTFA 4OBOA 1ZYCA 3H10A 2FSLX 3C9WA 4KKEA 3TG1A 1J7UA 1SVGA 3HGKA 3ZRKA 4GL9A 4BF2A 4QQCA 3QX4A 1WVWA 2YIQA 4FV0A 2YM7A 5DRBA 1KWPA 2JKQA 4GUBA 4OT6A 3U6JA 2YCFA 2C5OA 1UNLA 4D2SA 1GY3A 5CU4A 5AV3A 4E4MA 2OH4A 2WQBA 1K2PA 5HTIA 3LXPA 2ITUA 4NUSA 3ZUUA 3I81A 4QTDA 4BDCA 5FTGA 3P79A 3PG1A 5A54A 2XMYA 4RZVA 4D5KA 4DFXE 2QKRA 5EKOA 3SX9A 1JKKA 4KIKB 4LV5A 4S30A 4CTCA 3VBVA 4GFGA 3A99A 3Q4TA 2X7OA 4O7ZA 4D58A 4K18A 3K5VA 4FSYA 3C5IA 1B39A 4PMTA 3UBDA 4RX7A 2R3IA 3F66A 4PDPA 3RZBA 4RWKA 2GSFA 2W96B 3OP5A 5D10A 5ANDA 3RALA 4D2PA 5JRQA 3A8WA 4OTRA 3JS2A 1A48A 4X2FA 3CKWA 3NEWA 2UZOA 4S31A 3SOAA 3UYSA 5AAEA 3BGPA 1JKLA 3PLSA 4C37A 2BCJA 3P9JA 4AW5A 3L8SA 3WZDA 4ZTMA 2JITA 3D94A 3L9LA 1T46A 2ONLC 3MB7A 4U3ZA 4FV1A 2WMAA 4X2GA 3TKUA 3ZOSA 3SOCA 2YA9A 5BVDA 4L8MA 1KSWA 4BGGA 3TIYA 1SM2A 4IAKA 1CKJA 2PVKA 4FK6A 4ANLA 2BDJA 5CSXA 4BBFA 2X1NA 4FNZA 3U51A 5HG5A 4NL0A 4MXXA 4FTUA 3PFQA 4CNHA 2WMTA 3DOGA 3BHYA 4L52A 3G15A 3A7HA 1XH9A 2GFCA 2X2MA 4JVGA 3S1HA 5DE2A 4U6RA 4BRXA 3SRVB 2VWWA 3FAAA 3CP9A 3FMMA 4G6NA 4Q9ZA 5JN2A 3U6IA 2VTNA 4ITHA 3VS0A 2CKQA 3ZSGA 4GFMA 4U9AA 4RWIA 4QQ5A 4R1VA 4NJDA 2GNGA 2ZB1A 4K9YA 3RM6A 3UC4A 2RIOA 1O9UA 5IG1A 5AUUA 5GZ8A 2V22A 1UNGA 4MXAA 2C5NA 2ZDUA 4OTHA 5EW9A 4BI1A 5M57A 2XKCA 1H24A 2QG5A 2J7TA 2VX3A 3U4WA 2X6DA 5EQEA 2VTAA 4NM3A 2P55A 4QTBA 5ANJA 5FM2A 4BI2A 3TZ9A 5JQ5A 4Y85A 3NVKI 4F9AA 3PUPA 3O96A 2GDOA 4FKGA 2Z7SA 3PVUA 3FPQA 2XK7A 4FT7A 1H8FA 3DLSA 5GJFA 4FMQA 3G0EA 2JC6A 5EDRA 4FIHA 4NCTA 4RLKA 3P1AA 5AP0A 4FL1A 5I4NA 3RAWA 3EQHA 2VAGA 2QOOA 4IWDA 4GT3A 4NM5A 4PY1A 2PSQA 2J6MA 4MQ2A 3CC6A 4PPBA 5AP1A 4D9TA 4KIKA 2P33A 2HOGA 4NM7A 1KE7A 4WUNA 5AP7A 4OTDA 4TYHB 3ALOA 4F9BA 3SHEA 5LMKA 3R7UA 4DFNA 5IEYA 3CQUA 3E93A 4IM0A 4J97A 4OTGA 4X0MA 4YGAA 4BKJA 4EZ5A 5CF4A 2BDWA 3BHUA 4IDTA 2C4GA 4F64A 2UZNA 3JUHA 1FGKA 2YZLA 4EL9A 1XBCA 1OPJA 3BHVA 4O0TA 4EQUA 2F2UA 3CQEA 5TE0A 3BYMA 4V05A 3Q9YA 4BTMA 3LFEA 4I4EA 4KRCA 2WMBA 3EYGA 4UBAA 3LFAA 3Q4ZA 1JBPE 1Q41A 1YOLA 3ORKA 4RIYB 4C02A 5A4QA 3QUDA 4MD8E 4USEA 4XLVA 5AR3A 1YHVA 1H25A 3CQWA 3EIDA 1OVEA 3FMLA 4K77A 2R3MA 2ITZA 2Y4IB 3F7WA 3KXNA 4IB1A 2YN8A 1NVSA 3MPAA 4GT5A 4GSBA 4USDA 3V6RA 3JVRA 1WAKA 5J5SA 4KD1A 5F20A 3VS6A 3LLAA 2R3OA 5BYYA 4K6ZA 2WD1A 4LGDA 4TYIA 3PSCA 4QO9A 5BUEA 4R7HA 3HV6A 1VEBA 2V7OA 3PVWA 4ZS0A 3NW5A 3VW8A 2C0IA 2W4JA 3GFEA 3HDMA 5GJDA 3KU2A 1G8SA 2IG7A 3QQUA 2QODA 3EN6A 2WU6A 3ORXA 5G1XA 3MFTA 3UZPA 4FC0A 2RFSA 3O17A 3UNZA 3HUBA 3SRVA 4OTWA 5JK3A 3CY2A 4KKHA 3NIZA 5KCVA 2AC3A 2R7IA 5BQ0A 5HLNA 2YCRA 3V01A 4LUDA 3HECA 4KRDA 2WOUA 4YSJA 3TN8A 4L3LA 1YXUA 5H8GA 3UG2A 3ZO1A 4JG8A 5HIDA 4HVDA 4BICA 4B4LA 3QXOA 4FYNA 4PNIA 1OB3A 4QMSA 2X7GA 4IAFA 3W55A 4IFCA 5AUYA 5BVEA 2VO3A 4ZSGA 4DTBA 4EYMA 1JVPP 3OWKA 1Q99A 3EFWA 3PYYA 4H1JA 4FTNA 5EYMA 2VTMA 3LJ0A 4AOIA 4IWOA 5JFSA 3ACJA 4QTAA 4OAUC 1G3NA 4UZDA 4FKRA 2XYUA 2B1PA 4YPSA 3UOKA 4QP2A 1YDRE 3CPCA 3L8VA 3F7ZA 1GZ8A 2Z7RA 3FXXA 4L00A 2BRNA 1BUHA 3IONA 3LMGA 2BAQA 5C8MA 3K5UA 1JKSA 1ERKA 3WILA 3HMNA 2P3GX 4DAWA 3VBTA 2W1DA 3ENHA 4TYHA 4QTCA 4B99A 3NUAA 5EKNA 4JR7A 2JBPA 3KGAA 4JI9A 4QPSA 4YR8A 5BX0A 3IQ7A 4P7EA 2QLUA 1L3RE 4UMQA 3ZZEA 3DB8A 3DFCB 2OJJA 3K3IA 4XP2A 5CEMA 1E1VA 5BUIA 1ZAOA 5FUTA 4P4CA 4FTTA 4EQMA 3FXWA 3TNHA 3AG9A 5IA5A 3D2IA 2PVFA 4JDIA 2GS2A 2VNYA 4RRVA 4ASXA 5IA0A 5D9HA 4CZUA 4BWPA 4J7BA 3QHRA 3NVMB 1NVRA 2ONLA 3EQBA 3R63A 4RIYA 3UQFA 4UWYA 2YZAA 3DBCA 4FR4A 3S0OA 4YZNA 4XH6A 2I6LA 1REJA 2UVXA 4F7SA 4O0XA 3LPBA 4Y8DA 3WF6A 1OECA 1Q8TA 4DT9A 1MQBA 4B0GA 5HVKA 3CS9A 4O27B 4RIWA 2XKDA 3MJ2A 5C9CA 5A6NA 4PPCA 5KMKA 4CYIA 4YC8A 5DR9A 3VBYA 3VN9A 4BDBA 4U40A 3VWAA 3W2PA 3DGKA 2B9HA 1Q24A 4C61A 4IVDA 3D14A 1QPEA 1STCE 2H34A 3GQLA 3VS5A 4RLLA 4FV9A 3RNIA 4K33A 4I6FA 4LRKA 2YERA 3BLHA 4M84A 5HG8A 5CZHA 1LUFA 1Q8YA 2B54A 3VVHA 3OBGA 5E8ZA 4UMRA 5LVNA 3KRRA 2CGXA 4FG8A 1OI9A 4LMNA 4LQMA 4QRCA 4XBRA 5J5TA 4Q5EA 1TQIA 3PG3A 4RVTA 5TT7A 3E3BX 4R7BA 1PJKA 3R9DA 5CSWA 4QMYA 4Y73A 1IAJA 4IX5A 2CMWA 4DFBA 4O0WA 3ZBXA 2OGVA 2XEZA 3KY2A 3P23A 4LFIA 5HGIA 1WBWA 1M2PA 2NPQA 4WRGA 5AP6A 5CVGA 4NU1A 4A9YA 1PKGA 1OL5A 3LLTA 4WSYA 2VN9A 3GOKA 4YJPA 3FY2A 3MFRA 2CKOA 2XZSA 3AC5A 2VGOA 4KS8A 1XQZA 2VV9A 3CIKA 5FBNC 3TV4A 4Z3VA 5AV2A 5K5XA 1NVQA 3EFKA 3V51A 3C4EA 3QBNA 4LL5A 2GFSA 3V3VA 4AZWA 3NNXA 1H4LA 4BCPA 3AT3A 3F3WA 5AX9A 4CCBA 4ZLYA 2HW6A 3VNTA 3LCSA 4EQCA 3F9NA 3OWJA 4NSTA 1XH8A 3UOHA 4C2VA 4PV0A 4DH8A 2WQEA 2OJ9A 1KE9A 2ETKA 2ZOQA 4GU6A 2C6KA 4ZOGA 5FP5A 4F6SA 2X4FA 3W18A 4O91A 5L8LA 5EK7A 5AFVA 4IAAA 1Y8GA 2VO6A 3W2RA 2GNHA 2H9VA 4U80A 1MP8A 4II5A 2BRGA 3EKNA 4FKUA 4FOBA 5KZIA 4GCJA 1GNGA 3KK8A 4RG0A 3RMFA 4HYSA 3UVQA 5KUPA 3NUXA 2IVSA 4ARKA 4UB7A 2CNVA 4YNEA 5JGDA 3KXGA 1I09A 4IC7A 5DEWA 2VWYA 3PPZA 3VQUA 4IMYA 4TZRA 3LCOA 3WIGA 1U54A 4AZEA 5HU9A 2PPQA 3FYJX 4DHFA 3UPZA 4W4WA 3FYKX 3LXLA 1OPLA 2CJMA 1H28A 5CF6A 3TZ8A 3DFAA 5E4HA 1PMEA 5BVNA 2G2HA 5IQFA 4BCKA 4I6BA 2BKZA 4ZTNA 1PW2A 1OPKA 2E9UA 4I92A 3R1SA 4RWJA 5CASA 4O7NA 5FXSA 2VRXA 3KMUA 1ZLTA 3R7VA 4D55A 4G5JA 2C1BA 3P86A 4F4PA 5HG9A 3UNKA 2ZV8A 2QNJA 1OKZA 4GT4A 4GU9A 3KXMA 4ZSJA 3I5ZA 4DGGA 4FL2A 4CG8A 5HE1A 3HZTA 4G31A 1OUYA 2F4JA 2XUUA 3QXPA 4BL1A 4L68A 3R7IA 5DVRA 3E8EA 2CPKE 4MXOA 4D28A 3DY7A 4UX9A 4CFXA 5CEPA 4CRLA 3PY3A 3N4TA 5G6VA 1GZOA 3WZKA 1BL7A 2WZJA 3BIZA 3DKGA 5C4KA 3AD5A 3G51A 4PPAA 4EORA 4YZCA 2A4LA 3PVGA 5GIPE 1V0PA 1ZOGA 2C0OA 2IVVA 2XBJA 3LKMA 3C0GA 4O82A 4E5AX 2XJ0A 3FL5A 4XG6A 4Y5QA 4EHGA 2ETRA 2Z2WA 4F9YA 4G3DA 4IVAA 5AIRA 2F7XE 3G9NA 3NPCA 1RQQA 3QKLA 2IW9A 3S2PA 4EHZA 3LMIA 4RFZA 1H27A 1PXNA 4FKVA 4I94A 4AGWA 3EYHA 2I0VA 4IADA 5K5NA 4IJ9A 3IECA 3UJGA 3V8SA 3IDPA 1PYEA 2X39A 4HCTA 2JFLA 3R8PA 5B0XA 5CU6A 2GHGA 1KUTA 2PVHA 3I79A 2UZDA 2R3GA 3PSBA 5FM3A 2ITNA 2JDVA 5AJQA 5BYLA 3KXZA 5HCYA 4NWMA 4QT1A 4F0FA 2O65A 5M4FA 4B9DA 3MTLA 3A60A 1FMOE 2C68A 3KEXA 3QALE 4K2RA 4R3RA 5EYDA 1H01A 3W8QA 5KMOA 4PUZA 5KMJA 4FE2A 1OL1A 4C34A 4FTAA 3KN6A 1P4OA 5AAFA 3RTPA 3QQFA 4DEEA 4XJ0A 4ANQA 3MESA 4GEOA 3QTUA 3WE4A 2CCHA 4TYEA 1CMKE 4WG4A 4WG5A 1WZYA 2ITWA 2O63A 4J99A 3TZMA 5H8BA 4CT1A 4L3JA 4L7FA 3ANQA 4BDIA 4BDHA 3NDMA 2G15A 3AC3A 4XEYA 4FZ6A 2EB3A 2JFMA 5FEEA 1Q8WA 3MVLA 3AC8A 2OF4A 2WEIA 4EBWA 1ZYSA 4DEBA 4FZDB 5TF9A 4FKTA 1MRUA 4FEVA 5CLPA 3VS7A 3VUTA 1XHAA 1YWRA 1MQ4A 3GU8A 4O96A 1QPJA 4WNOA 2ZM3A 1P5EA 4FODA 2OKRA 4F0IA 2WU7A 3P4KA 3QTRA 3ZU7A 4D2RA 4FIGA 2J0JA 4TTHB 1Q97A 4QQTA 4D9UA 3IO7A 2ITOA 4KSPA 3IOKA 4QPAA 1IEPA 2C3IB 2WO6A 1JLUE 3DTCA 2OU7A 3EQDA 4X3FC 5EFQA 3O0GA 4FG9A 2I7QA 1OM1A 4OTPA 2B9FA 2WQMA 4RA5A 4RFMA 5M56A 4FUXA 3KULB 3EH9A 5CVHA 3TZ7A 2W1EA 3CXWA 4OW8A 3V5TA 4ACDA 4EOJA 2QQ7A 1H08A 1PMVA 4RT7A 3A7IA 5E1EA 3OXTA 4RX9A 4ACMA 3G90X 3TXOA 4FKLA 4QMXA 2QOFA 4AACA 4HPUE 4O0SA 3AOXA 2B9IA 3OTVA 4M97A 1MRYA 5C03A 4ITIA 3NUNA 3TTIA 2NO3A 5GZ9A 3CTJA 2BRMA 4ASEA 1V1KA 1PXKA 3QU0A 4F0GA 2GMXA 5BVOA 5BUJA 3CJFA 2YHVA 3EQFA 4PWNA 3NNUA 5DIAA 4U41A 5FD2A 4KABA 4BDAA 3PWDA 4I6HA 4DBNA 3MY0A 2VTOA 4R8QA 4PL3A 3NLBA 3OW3A 3PP0A 2Q0NA 1U5RA 2C6EA 3ZXTA 1H1WA 3HDNA 3PA4A 1YHWA 2QR8A 5KZ0A 5HBJA 5CS6A 3ZS5A 4D2TA 2OXDA 3I6UA 4BHNA 3OOGA 5L2IA 3LW0A 2GQSA 4JLCA 5K9IA 3QRJA 3M11A 3UGCA 1H07A 2FH9A 4I20A 4IX4A 4X6QC 3M2WA 3AXWA 3DXPA 2YDIA 5LVMA 3ALNA 4IM3A 4WNKA 4EC9A 5J1VA 4M69B 4EK5A 5DMZA 5M08A 4I23A 4NTSA 2I40A 4OT5A 5E8XA 4H3BA 2WIPA 1BYGA 2PMIA 1XH6A 4U5JA 4MHAA 1OITA 4JNWA 4C62A 2JIUA 2RL5A 4GVJA 4FGRA 4XS2A 3E7OA 4M0YA 1YW2A 1K9AA 2HWPA 2PVJA 2G2IA 2ITPA 4XG8A 1WVYA 2Z7QA 3I4BA 3R83A 2J2IB 4DYMA 4EH7A 5CXZA 2PZIA 3H4JA 4RFYA 4FKJA 3NCZA 3R7GA 5J8IA 2V62A 4EOLA 4EYJA 5AV1A 4HVGA 4QP1A 4BIEA 3QRTA 2BUJA 4YJUA 1YXTA 5EM6A 4ERKA 3LM5A 5IPJA 2OLCA 4O7YA 3HMPA 4X6RA 4MBLA 4EONA 4CQEA 4A06A 3ITZA 2WTIA 3OT3A 4IX3A 1ZRZA 4JL9A 3U9CA 4X3JA 2JDTA 1U46A 2G1TA 4DTKA 2GQGA 3FKOA 1GIHA 3DQWA 2BKKA 1DS5A 4Z55A 2I0HA 3CGFA 2JD5A 3BV2A 4OR5A 3ATTA 1Y91A 4PMMA 4NCTC 5ACBC 3RPRA 4ZAUA 4DFZE 2ZJWA 4WIHA 4N4SA 5E8SA 4ZLZA 2JIIA 1G5SA 3QC9A 4FIEA 4XUFA 3PLAE 3KF4A 3DBEA 2REIA 3KULA 4FVRA 2RG6A 3BU6A 3CY3A 4PDSA 2EXCX 5CSVA 4E6AA 3CD8A 1FGIA 3C1XA 5DBXA 2JBOA 4AW2A 2Q83A 3NYXA 2PZYA 2BFXA 2PZPA 4YNOA 3BQRA 4MD9E 5HE3A 4QMQA 4JG6A 5CI6A 3QUPA 5LMKC 5T6KA 4YTCA 3OEZA 3I7CA 2JKMA 4M3QA 4MAOA 5E92A 3UE4A 4QP4A 4IAYA 2ZV7A 3FSKA 1CSNA 2YACA 3BE9A 4BHZA 4C2WA 1BI7A 2GS7A 2WMRA 4NM0A 4CFMA 4CYJA 4BTJA 4IZYA 4YUQA 2G2FA 3DXQA 1W8CA 3LOKA 4IE9A 3PTGA 5M06A 3OF0A 4G17A 5ANIA 2NRUA 5AA9A 3SGCA 4FKSA 3NMUF 2WIHA 2OW3A 1ZYJA 3ZFXA 3SVVA 2WMXA 3SXSA 3BLQA 2YEXA 5J9LA 4DTAA 4YO6A 5E8WA 4IJPA 3Q6UA 3SKCA 3F69A 3PXFA 3IW7A 2WMSA 3DXNA 4BBEA 1V0BA 4UN0C 3U8WA 5CAVA 1R39A 4KIOA 4M68A 4U45A 3KXHA 2CDZA 1OIRA 5HHWA 2VX0A 3P08A 4DITA 3O8PA 2WTKC 4ZSLA 3TI1A 3N9XA 2YFXA 3OC1A 5LVOA 3VUHA 4UY9A 3CGOA 3H0YA 4MNEA 4FT0A 3VS3A 3HV7A 2BHEA 2PUPA 2XIXA 5EQPA 3NCGA 5DNRA 4ZJJA 4FV8A 4JIAA 4XV2A 2WFYA 4RC4A 5CT7A 1OL7A 4AA5A 3MY1A 3BZ3A 1U59A 2KULA 3M1SA 3OXIA 3VUIA 4JT3A 2X9FA 1YOMA 5LMAA 3NYVA 2R3QA 4CMOA 4C4IA 4O6LA 2PULA 2QC6A 2WPAA 4I1ZA 5BVWA 5DG5A 5IMEA 4BR3A 1R0EA 1UU8A 2XH5A 3UZRA 2VTQA 3OZ6A 2W9ZB 3ZHPC 5AR4A 2OBJA 2O5KA 4DEGA 5E9EA 5CSPA 2J5EA 3PIZA 3VIDA 4ALVA 4FBXA 4X3FA 4CKJA 2ITYA 3PXZA 3PXKA 1P4FA 1I44A 2HWOA 2X8EA 5BMMA 3FZTA 4YSMA 3CD3A 4XG7A 1JAMA 5HD7A 5HZNA 1Q3DA 1BL6A 4G3GA 2H96A 1DM2A 3D5XA 2PMOX 1YDSE 3R8VA 4CKIA 2GNIA 2G9XA 1MRVA 2GNLA 4D4RA 4JS8A 3FKNA 2VGPA 5TO8A 3FQEA 2CN8A 2OIQA 3HEGA 3I6WA 5I9UA 3O71A 3TT0A 4ZTRA 5HE0A 2BILB 2WQOA 4G9RA 3FPMA 3GT8A 3LCKA 5JZNA 4ZJIA 2X9EA 3HX4A 3MH3A 5EYCA 4EHEA 2UW6A 5BMSA 3DK6A 3NAXA 5GHVA 4FTRA 1PXPA 2VTIA 3OD6X 2WMVA 2X4ZA 5KHWA 4AWIA 5FDPA 2OZOA 3ETAA 4E20A 4TNDA 3MFSA 3FZOA 2E9PA 4IACA 5B2MA 4L43A 4IAZA 4AP7A 2YLFA 4HW7A 4IW0A 2R3HA 4AN2A 2XNOA 1LP4A 4U97A 5DT4A 3TEIA 3B2WA 3ZO3A 2XA4A 3OBJA 2V7AA 3ERKA 3IKAA 5JSMA 3ODZX 4KUJA 4GYGA 1Y6AA 3BEGA 3ZM9A 4G3CA 3NUUA 4HGEA 3VF9A 4XV3A 4APPA 2HZ4A 5EOLA 5DI1A 4E7WA 4RJ3A 2WTKB 4FF8A 3Q96A 1FQ1B 4PTEA 3QQHA 4EOKA 5CSHA 1HCLA 4LMUA 4FSNA 3FUPA 5DEYA 5BNJA 4DFYA 3ZDUA 4P5QA 1U4DA 3WOWA 1TKIA 3NGAA 1R0PA 4FX3A 4QYEA 4BWXA 3FL4A 2EB2A 2J50A 4C4JA 5IF1A 4D1SA 1JOWB 4M14A 3DBDA 4PTCA 1YWNA 3DDPA 2R3RA 4YLKA 2JKKA 3AC4A 4FTCA 4XV9A 3SD0A 4PNKA 2IZSA 3LJ2A 4WOVA 4BFMA 4LGGA 2W06A 4IB5A 5J79A 3TTJA 4JBOA 3MFUA 3VULA 1Q3WA 5LXMA 3FZSA 4RMZA 3TJCA 3ZYAA 4ACHA 1PHKA 3ZUTA 2UZWE 2X2LA 5EDPA 1J7LA 5AV4A 3OCGA 2IVTA 3O7LD 4YTFA 2FO0A 4O1OA 3RNYA 4HYUA 3UPXA 3R22A 5HLPA 5FP6A 3HNGA 2R9SA 3ENMA 2YAKA 2H6DA 3VF8A 4E8AA 2XYNA 1G8AA 1VJYA 4EHVA 4PMPA 4ORKA 4FV4A 5DR6A 5DA3A 5HNGA 4EKKA 4WO5A 3Q2JA 2YIXA 3LFFA 3FZPA 4NJ3A 3UMXA 3HYHA 4BDJA 5JT2A 2DUVA 3DZOA 4ZTLA 5TKDA 3JR1A 5AP4A 2QHMA 2YLEA 1GIIA 3V6SA 4FL3A 5A4EA 4EEVA 3R9NA 4MBIA 2DS1A 3BE2A 3RPYA 3TACA 3V5JA 3R8ZA 5IA3A 3FQHA 3LAUA 2EU9A 3NW6A 3NR9A 1M52A 2CLQA 1QCFA 2ITXA 4G6LA 3QRUA 3V5WA 3UMWA 4F9CA 2R2PA 1KOBA 2PE1A 2ITTA 2XK6A 1QL6A 4H3PA 4JAIA 4MWIA 4CV8A 5C1QB 5ANGA 2BALA 4AE9A 2IWIA 5D7AA 1ZMVA 2JGZA 2QVSE 2ZV2A 1PXLA 3BWJA 3WIKA 3NYOA 4TN6A 4AGCA 4FSUA 4JQEA 3SG9A 4F1OA 4JX3A 3ORNA 3PJCA 4ANSA 4EOQA 5C4LA 5AWMA 3R1QA 4AS0A 4L44A 2JAVA 4M0ZA 4R3CA 4RIWB 4CLIA 5E91A 4O7TA 3U6HA 4LG4A 2YM6A 2CCIA 5AA8A 2X6EA 3W2SA 1KE5A 2OI4X 1A06A 2BIKB 4M7IA 1T45A 5FGKA 4A9SA 4BDDA 2QD9A 4L53A 4F1TA 5H8EA 4EC8A 4XV1A 4RJ7A 4C57A 3E8DA 4L9IA 3KFAA 4IX6A 3LFCA 1LEZA 4CLJA 3FC2A 3FV8A 4JDHA 4CFVA 2V55A 4FSRA 3RKBA 2QOBA 5M44A 4ASDA 1RJBA 2I0YA 4M8TA 4YP8A 3ZUVA 1R78A 4B6LA 3RHKA 3R2YA 3T3VA 4N70A 2W1CA 3MGYA 5AM7A 4AFJA 2QO7A 1WBOA 5CAQA 3FC1X 4Q2AA 5IEVA 2W9FB 3GC0A 3RAHA 4FKIA 4BIDA 3BRBA 2B52A 3C7QA 2Y0AA 3BCEA 4L6QA 4YHTA 3L9NA 2W0JA 4LOOA 1IRKA 5E8UA 4XRJA 5JQ8A 3BHTA 4GKIA 4M66A 4O83A 5AMNA 4LOQA 3LVPA 4RZWA 1F0QA 3BYSA 3DS6A 4A4LA 3R01A 4BYJA 5EH0A 5H2UA 3ZC5A 4FTJA 3SXFA 4EK4A 1BX6A 3IDCA 3LXNA 4ANBA 4AZVA 4ZY5A 5HKMA 2O64A 2XNPA 4YLJA 4KIPA 4DC2A 3R8LA 3DJ6A 2XJ2A 5M4CA 3O50A 4A4OA 3PP1A 4XOYA 5ETIA 2OIBA 3GU6A 2QOLA 1Q5KA 2CKEA 3Q6WA 4CV9A 3GUBA 4EH3A 2YIWA 4UMUA 4BTKA 3QCSA 4S34A 4O2ZA 4FEUA 4BVUA 2OO8X 1WCCA 4X2NA 5J7BA 1QPDA 2GS6A 2PK9A 4MF0A 3QCXA 4EH4A 2QU5A 2V5QA 4FEWA 4FV3A 3E88A 4BCOA 4EZ3A 1WBPA 5IH5A 3UVRA 4UXLA 3LCTA 1TQMA 2IZUA 3KKVA 4GJ2A 4IZ7A 4E4XA 4E6QA 1U54B 3TWJA 3GCVA 3QGWA 2NNWB 2X0GA 4GV1A 2XK8A 3EQCA 4CSVA 4O7RA 3Q53A 5HTBA 3CTHA 3UO4A 3ZO2A 5J7HA 3QKKA 1ZOHA 2QOCA 3W2OA 2HELA 4UYAA 3CBLA 3RK7A 5C27A 3V8WA 4GMYA 4FKPA 2BVAA 4L46A 4TNBA 4H3QA 4MEDA 1Q61A 4C3FA 4Y95A 4Y46A 4DH5A 3PJ8A 4LRMA
chains in the Genus database with same CATH superfamily
1EH4A 4E1ZA 5K4JA 5IQCA 3LJ1A 3W0SA 2GTNA 2ZAZA 1FVVA 4I5CA 3TV6A 4HCUA 2R3NA 4E3CA 3C50A 3HV5A 4AW1A 1YWVA 4C3PA 2A19B 4HZRA 3QA0A 5EDQA 4C8BA 5AP2A 3PZHA 4FIIA 4LI5A 4NIFA 1E9HA 5TR6A 4ALUA 3JY9A 4RIXA 4FTOA 4OGRA 5HNIX 1IR3A 2GHLA 3GB2A 1UV5A 4PDOA 2EXEA 2HZNA 2XCHA 5AUXA 3HA6A 4TXCA 5I9XA 4QP6A 3QTXA 1WVXA 4YBKA 4QP8A 3RM7A 4A9UA 3TKHA 3DTWA 3SW7A 3TDVA 4DF3A 5LQFA 3H30A 1UU9A 4U79A 3CEKA 5DWRA 3AC2A 3VJOA 3TUCA 1PRYA 2PUIA 2EWAA 4RPVA 2IW8A 3IDBA 4UWBA 4R5SA 4YJNA 4A07A 4AW0A 4CFWA 2C6MA 3ZRMA 5HLWA 3AMBA 3NWWA 3PY1A 4FSWA 4O0UA 4C38A 3JXWA 4YJSA 2P2IA 3AT4A 3F2NA 3QTWA 4EH6A 1FPUA 5JH6A 4O38A 3OHTA 1J1CA 1SNXA 2BRBA 3GCUA 4CKRA 3VUGA 3GU7A 4BWKA 3BU3A 3Q4UA 1BLXA 2JEDA 4G1WA 5HEZA 3ORMA 2PWLA 3BELA 3PIYA 1J3HA 4NKSA 5CZIA 2J4ZA 1REKA 2RG5A 3QAME 2W5AA 4FTMA 2R3JA 3KC3A 3QYZA 4IIRA 4XRLA 3ZZWA 3SXRA 2JKOA 2FUMA 4AOTA 4DGMA 2W1ZA 2UVYA 4KINA 5IA1A 5DT0A 4AA4A 2XNEA 3N4UA 4IAIA 2UW4A 4KBCA 2GQRA 1XH5A 2W4KA 3I0QA 5DH3A 5DRDA 4WG3A 3MV5A 4G9CA 4L67A 3P5KA 5JFWA 2RFDA 1YOJA 4ACGA 4HGTA 4I0TA 4QNAA 3IG7A 5I9WA 5K0XA 1H1RA 3BBTB 5AAGA 3EQGA 4BKZA 3QTIA 3U55A 4UV0A 5KBQA 3JY0A 2R0IA 3QTZA 4BCQA 2IJMA 3P0MA 4R7IA 1Y57A 4RVLA 4ALWA 4CZYB 4WHZA 2XNNA 3SLSA 5FXRA 3D0EA 5EW8A 2BDFA 4BI0A 5LJJA 3LXKA 4U7ZA 1UKHA 3IPHA 4C59A 3U9NA 3R02A 4RA4A 4RSSA 3Q32A 3QFVA 5GJGA 3GU5A 4J52A 4DCAA 4DH7A 3A4OX 4TYJA 2HXLA 3VUDA 3A7FA 2YM5A 5C01A 3E8CA 3GVUA 5D7VA 3V5LA 2W17A 3ORTA 2PMLX 3WARA 4D4YA 4QDEA 3L8PA 1TFFA 4JBVA 4GKHA 3OCSA 5A14A 3RBWA 2J90A 3L9PA 1GZKA 2XJ1A 3GQIA 4FTKA 4J96A 5I9YA 4DBXA 4LGHA 4DGOA 2ZDTA 2OH0E 1IA8A 3DA6A 4M12A 3QF9A 4QP3A 1YVJA 4K0YA 4EWQA 3BKBA 3H3CA 4O22A 3R04A 1YI4A 3PZEA 5I0BA 4EH2A 3I1AA 3UDZA 3UDTA 3CR0A 2BAKA 3AMAA 1Z5MA 4CQGA 2FSTX 1FOTA 4M13A 5HESA 3KVXA 5FLFA 4V04A 2XNBA 3A7JA 2UW9A 2B9JA 4JOAA 4R6VA 4MTAA 1NA7A 4GG7A 5AR8A 4W9XA 3R71A 3QX2A 4JDKA 3R7OA 3F5UA 4XG4A 4ITJA 3DKOA 5AR2A 1E1XA 2J5FA 2QOHA 4HGSA 4WT6A 3ZSIA 5JGAA 4MH7A 3PJ2A 4YHJA 3FKLA 2Y6OA 4HVHA 5JFXA 3FLQA 1OBGA 3F5XA 2JLDA 1HOWA 4O1PA 4TWCA 3F2RA 2VWVA 3I0OA 4CFNA 2WTCA 3ZM4A 4DDIA 3NYNA 4IVCA 3NRMA 5CX9A 3MVJA 4QD6A 5T3QA 5M53A 5DT3A 2RGPA 2C3LA 1W82A 2R3PA 2UUEA 5HCZA 3R7YA 2PU8A 3PJ3A 3R30A 5DFPA 5F1ZA 4J71A 4IZAA 4EOMA 3ROCA 4BDEA 1KE6A 5F95A 3JPVA 2OF2A 4C4EA 3JYAA 3KCKA 1BMKA 1UNHA 1ZWSA 1UKIA 2HXQA 2F7EE 4L42A 4MK0A 4XMOA 3TUDA 4R3PA 3R8UA 3RVGA 3W32A 3GP0A 5LWMA 4QYFA 5EQYA 5B7VA 4GIHA 3MH2A 1PXIA 1S9IA 4YMJA 3T9TA 2YJSA 4DHZA 3DBFA 4MD7E 4A4XA 4JBQA 3WBLA 5A6OA 4F7JA 1AGWA 1OIUA 1U5QA 5A9UA 4NFNA 3KA0A 2XIRA 3FHIA 4ANOA 1SNUA 1CTPE 3D9VA 4XG2A 2X0QA 4ENXA 4LDTA 4RVKA 4YC6A 3WF7A 4CT2A 2XNGA 4RJ5A 3QZHA 4YJOA 4EJNA 3N4VA 4G2FA 2A1AB 3W0MA 4IH8A 4KBAA 3BQCA 3MVMA 2ZVAA 4OTIA 5EM8A 4C58A 1CKIA 5FEQA 4GFOA 4FZ7A 4F7NA 3IW4A 4I5HA 3TNWA 1XO2B 3QTQA 1KV2A 4KAOA 4C4GA 4QYGA 4FUYA 4UMPA 3MN3A 4Q9SA 2CGWA 4RX8A 4QPMA 4ZJVA 5IUGA 4RJ4A 3R1NA 5L8KA 1ZZ2A 3D5VA 5EW3A 2UVZA 2YM8A 4ERWA 2W4OA 3UP7A 4CFFA 3QZGA 3FLWA 3OMVA 4RJ8A 1RDQE 3D15A 4QMLA 3VUMA 2W7XA 2ZM1A 3B8RA 1PXJA 2VTLA 3L8XA 3OEFX 3QLGA 4IEBA 4JRNA 4MVFA 4XHKB 4L7SA 5HQ0A 4FV6A 3D5UA 3PSDA 2G01A 4IXPA 2HAKA 3A61A 4E26A 3E87A 5GNKA 5JFVA 3UQGA 3ROYA 1X8BA 4FG7A 1SMHA 4XX9A 3FDNA 3GC7A 4TY1A 4HVIA 3OCBA 3TUBA 5GIOE 1KV1A 5IU2A 1PXOA 4FIJA 4GW8A 3W0RA 2BIYA 2OXXA 5EHYA 4YZ9A 4A9RA 3SG8A 2CHLA 2P0CA 4L3PA 3FQSA 4FKOA 2OZAB 4GUEA 2R7BA 4EH9A 3K54A 1VR2A 3WI6A 3UTOA 4DG3E 3UG1A 4UYNA 3KVWA 1OKWA 4WD5A 3MS9A 4XG9A 2IN6A 3RWPA 4GG5A 3II5A 2BAJA 4F70A 4ZY4A 4AFEA 3DAKA 5CEQA 2QURA 5ITAA 3R8MA 5M55A 5LCJA 3S3IA 2WXVA 4W8EA 1XJDA 1GJOA 2Z7LA 4RIOA 4MWHA 3HMOA 3EN4A 3W33A 3PXYA 2UZUE 1OL2A 2WMWA 5LVLA 4BKYA 4ZIMA 3SW4A 2BTSA 1PYXA 2QONA 3GCQA 4MNEB 3FMKA 4JDJA 3I5NA 3A8XA 2R4BA 3LIJA 3Q5IA 5HO7A 3P7AA 2UW5A 3HUCA 1Q8ZA 1IG1A 2XK9A 3GBZA 3N51A 2HZ0A 4AQCA 5KBRA 4BGQA 3NW7A 5IQAA 4WNMA 3F5GA 2PZRA 5L2QA 1WBTA 3GI3A 3KIOC 4FTIA 5CNNA 4FOCA 3VRYA 1ZY4A 4NT4A 3W0PA 2OFUA 3IGGA 5M09A 2IO6A 5C8KA 1H1QA 1IASA 1F5QA 2H8HA 4KS7A 5CQWA 4UMTA 2C0TA 4JR3A 3UQCA 4ZSEA 2XVDA 1XWSA 2PE0A 5DR2A 3UVPA 4XNEA 4CVAA 4MX9A 2XP2A 4N6ZA 3DJ7A 4E6CA 1DI9A 3DAEA 2XAMA 4FICA 4AT5A 4X3FB 2XIKA 2F57A 4O4CA 5AEPA 5IH6A 3DAJA 5HBHA 2BZJA 4FI1A 4B7TA 3FZRA 5HOAA 1URCA 3O5AA 4F7LA 5IA4A 3ELJA 4L01A 1FVRA 3CKXA 4RGJA 2BHHA 4YPDA 5HO8A 2B7AA 2Y7JA 4NKAA 4Z9LA 3AC1A 2OJFE 3L9MA 5FQDC 3ZFYA 1GOLA 2VWUA 4ZLOA 4A7CA 3O8TA 5K4IA 3REPA 5L6WL 3HP5A 3Q04A 3OUKA 4C36A 5AR5A 1YRPA 1VYZA 2PZ5A 2VTTA 3TDWA 3CSVA 3VBXA 4RC3A 4CD0A 5ETAA 2C47A 2C3JA 3AGLA 1A9UA 4HOKA 4HNIA 4WBOA 1OIQA 1O6KA 4XYFA 3P78A 5AUVA 4C3RA 2BROA 3C4CA 3HV3A 2FYSA 4IZ5A 3KRXA 4K11A 4OLIA 4QYYA 2VWZA 4BDFA 3NS9A 4QTEA 5KNJA 5M51A 1OMWA 3QHWA 1L8TA 3HAMA 2QHNA 3NZ0A 4PRJA 4PF4A 3RI1A 3TJDA 3WYXA 3WF8A 4CGAA 4AN3A 4DHIB 4ZTQA 2OZAA 3Q5ZA 1OL6A 3TNQB 2W99B 4TKSA 4PDYA 3BGQA 2WELA 3UOJA 4ANNA 5FG8A 4E4LA 5L6OA 1RE8A 3PWYA 5BVKA 4P2KA 4XLIA 3ZLXA 3ATSA 1M7NA 4BN1A 5FWKK 1B6CB 2PUNA 3F3ZA 3ZLSA 3G0FA 4QOXA 2YWVA 3GGFA 5D41A 4FT3A 3IW6A 5L2SA 5KKRC 5CF8A 2RKUA 4H1MA 4U8ZA 3VHKA 3DZQA 4OTFA 5TOZA 2GU8A 3W0QA 1LEWA 3EOCA 4FVQA 4X2JA 4XG3A 2BPMA 1JPAA 3CCNA 3ZSHA 2UW0A 3ANRA 3GENA 3OT8A 5FEDA 4UXQA 5JGBA 3FWQA 4Y83A 1XBAA 4FGBA 2UZBA 3GXLA 2AC5A 2ACXA 3EN9A 4EKLA 1ZYLA 3HP2A 5HIBA 4QP9A 1O6LA 3AGMA 5M4IA 3W0OA 3UZTA 4H05A 2O3PA 2IW6A 2VTPA 4EH8A 1P2AA 1O6YA 4NYEA 3DK7A 3F88A 3RCDA 3LMHA 4YC3A 5IH4A 3ZBFA 2NP8A 4EBVA 4YZBA 4FV7A 5IKWA 3FMDA 4B8MA 2C5XA 5CY3A 4A9TA 1NXKA 4U42A 5FDXA 2DWBA 2VZ6A 5AR7A 4YHFA 1QPCA 3HL7A 3COKA 1W7HA 4AZTA 3E64A 4NK9A 4DLJA 4O0RA 3FBVA 5CXHA 3H9OA 1ZMUA 4AE6A 5CQUA 3BU5A 3FMNA 3OOMA 1J91A 3FLZA 2BZHB 1OKVA 3W16A 3ZFMA 3Q9XA 4FSMA 1W2DA 3CTQA 4PMSA 3OW4A 5IISA 5GINE 1WBSA 3FXZA 2XRUA 3R2BA 5CEOA 3BWFA 4U3YA 3IW8A 3VS1A 1JSTA 4E73A 4X21A 3EFLA 3OUNB 4IDVA 4MBJA 3CE3A 1SVEA 3ODYX 5HVJA 4EUUA 4I24A 4OBQA 4ZMFA 4L45A 4XCUA 2JAMA 2C30A 3BBWA 4G34A 2CGUA 1GAGA 3RPOA 4I5PA 2C3KA 3EJ1A 4QYHA 4HVSA 3I7BA 2YJRA 2UW7A 4IBMA 2UW8A 4PX6A 3VW6A 3HRBA 2WMQA 4C4HA 3TM0A 4XP0A 3LFNA 4AXAA 1YXVA 5AX3A 2BR1A 2UV2A 5H3QA 3OS3A 3F2AA 4N6YA 3SV0A 2PYWA 2X7FA 3E63A 4KNBA 5CAPA 1PMUA 4J8MA 4R5YA 3FJQE 3QKMA 3EN5A 2IPXA 3KN5A 4QMTA 1WMKA 4P90A 3DKFA 2XNMA 4JXFA 1ZOEA 3FZ1A 3I60A 3MSSA 4PQNA 4APCA 5HIEA 5LMBA 3OG7A 3T8OA 5EI8A 3DNEA 4OUCA 2OG8A 2YIRA 2QO9A 5KKRB 2FVDA 1H1PA 1Y8YA 3FY0A 3FEGA 4YTHA 1QMZA 2J0MB 3ZEWA 3FLSA 4FT9A 3MB6A 1ZXEA 4AG8A 1NY3A 4FYOA 5I9VA 1J1BA 2XKFA 5HO6A 3ZONA 3GCSA 4IANA 5K3YA 2Y4IC 4WBBB 3F5PA 3QL8A 3VRZA 4HYIA 4IWPA 2E9OA 4ZZOA 3C51A 2ERKA 3W0NA 3L1SA 3G33A 3MIYA 3P7CA 2C6OA 2VTJA 5J95A 2QOIA 4BCJA 3RGFA 5HG7A 3VBWA 2XB7A 4WRSA 3ZLWA 4KA3A 5AM6A 1R1WA 5HBEA 2VUWA 3LE6A 3FI4A 5EM7A 4J8NA 4E5BA 5IZFA 4EH5A 4BCGA 3NAYA 3PFYA 3RP9A 4DE4A 3SA0A 5D1JA 3IOPA 3WYYA 3D7ZA 4HJOA 4S32A 4AUAA 1JSUA 1WBVA 2IVUA 3LQ8A 4U44A 4G3EA 4I5MA 2OIDA 4F65A 4FNWA 4O7VA 3FE3A 3R7EA 2Y9QA 3CPBA 3WZJA 4F63A 3ZH8A 3Q9WA 5FRIA 3VC4A 4TWOA 3COHA 4YZMA 3RZFA 4DLIA 3EB0A 2VU3A 4O7SA 3VJNA 1AQ1A 2BFYA 2J9MA 4DA5A 3R28A 4MYGA 4D1XA 4KIQA 4GK3A 4AXCA 5A46A 4JRVA 1VZOA 2XRWA 1F3MC 3P7BA 3OCTA 4K8AA 5J1WA 2C6LA 2HY81 2W5HA 3PY0A 2VD5A 4O84A 3ZRLA 3UDBA 5HCXA 2AEGA 3C0HA 2QOKA 4HNFA 4DH1A 1P14A 4DFUA 5FTOA 3V8TA 4BYIA 1BI8A 4AZFA 3GFWA 2I1MA 2Y6MA 4I6QA 1CDKA 1ZZLA 4FV5A 4BZDA 4I22A 3PE1A 2O0UA 4QMWA 4O0VA 1UA2A 3ET7A 4CFUA 2UZEA 4J98A 2ITQA 3Q2MA 3FSFA 5IMXA 4BBMA 3ZC6A 3FI3A 1KE8A 4J95A 5F4NA 1UWJA 3F3VA 2UZTA 4MQ1A 4W8DA 4BC6A 2R3KA 3DB6A 4OBPA 3EQPA 5CAOA 3A2CA 1SVHA 4UEUA 2X8IA 3H0ZA 4I41A 2CN5A 2PY3A 1M14A 4FRFA 3NIEA 2XF0A 3NUPA 5IQBA 3ZEPA 4BDGA 3Q9ZA 1ZY5A 3MDYA 3PPJA 3MY5A 4DDGA 3EZVA 5J9YA 2XARA 4U81A 3DNDA 2IZRA 1YXXA 2QLQA 3EL8A 5E8TA 4ZMEA 2RSVA 1FVTA 4GS6A 4EOPA 4D2WA 4NIFB 4NW6A 5CU3A 4ZZNA 4KSQA 4RIXB 4W9WA 3QZIA 4D0XA 4CTBA 2W1GA 4F08A 3QTSA 3VHEA 3HMMA 4BB4A 1ST0A 4AXDA 3VO3A 3NNWA 4QMUA 5D11A 5FBOA 2JDSA 4CRSA 5ICPA 4BY9E 5IQGA 3KMWA 2OK1A 3PVBA 4X7QA 1H26A 3ACKA 3KRWA 2CKPA 3W10A 3LCDA 2WAJA 1OGUA 1TZDA 3HV4A 3NUSA 4G5PA 4FZFB 3F61A 4GH2A 4NH1A 4FNXA 3R9OA 4O81A 5CTPA 4IB0A 3UNJA 3CLYA 2E9VA 2E9NA 2B4SB 3OFMA 3KL8A 2JIVA 4N0SA 4D0WA 3SAYA 3PDTA 4O6EA 2GHMA 3KXXA 3E7VA 5KO1A 4F1MA 3OWPA 3T3UA 3O8UA 2WTVA 4Y72A 2VWIA 2X0PA 4QMOA 4I3ZA 1NW1A 3BI6A 2VTRA 1IAHA 2XIYA 1VYWA 1R3CA 1W83A 4N57A 3R1YA 2XIZA 3DK3A 2PTKA 2W1IA 4QMPA 3WZEA 4R1YA 2ITVA 3KQ7A 2X2KA 5DOSA 5BVFA 3DCVA 4V0GB 3F82A 2BZKB 4YJRA 3R0TA 5EI2A 3LHJA 1W98A 4Q5HA 3E92A 4DEIA 4CMTA 3HKOA 4WNPA 2W05A 3OXZA 5HORA 4DH3A 2FB8A 1OZ1A 1Q8UA 3QUEA 2YABA 4RQVA 4YZDA 1ST4A 4I0RA 4DFLA 1NT2A 4EK8A 2XK3A 4PL4A 2LAVA 3KK9A 3TKIA 4EI4A 3OWLA 4ONAA 5M4UA 5IQEA 3V5PA 2OSCA 5E90A 3B2TA 5CYIA 1YHSA 4RWLA 3IS5A 1BKXA 3QZFA 5EI6A 4DN5A 2UZLA 4LRJA 3D2KA 4E93A 3IK3A 1PY5A 1XMMA 3DLZA 3R00A 4TYGA 5J9ZA 4QMNA 5CALA 1B38A 1M17A 3CJGA 3HRFA 3HVCA 4U43A 3WE8A 3D4QA 5E1SA 3V5QA 5HI2A 1YI3A 3DU8A 5IDPA 2HY0A 2F2CB 3AMYA 3GC8A 2FSOX 2EUFB 5HE2A 3F3TA 4RX5A 2W5BA 4FSTA 3UC3A 2PMNX 3RPSA 1Y6BA 3FI8A 4CG9A 3PRFA 2XK4A 1GIJA 3BX5A 3SC1A 3QD2B 3GU4A 4HZSA 5HX6A 3UO5A 1JKTA 3QWKA 3G6HA 4PP7A 5KHXA 3W8LA 2Z60A 4FA2A 3PJ1A 3LQ5A 2P2HA 4AGUA 2BMCA 3K3JA 4BGHA 1FBNA 4O86A 3LQ3A 5AUTA 2F7ZE 4FZAB 3AKKA 2HZIA 2QR7A 1W84A 2QO2A 3D7TB 3C5UA 3G6GA 1UVRA 3QQLA 2J0LA 3T9IA 4QMMA 4PP9A 3EZRA 3DQXA 2WNTA 4FK3A 5KMNA 1ZMWA 4G3FA 4C4FA 4D4VA 3F3UA 3MA6A 4X2KA 5C26A 1ATPE 1UWHA 3NX8A 4FSQA 4GVAA 2C6TA 3ORIA 4XBUA 4E4NA 2RFEA 4JJRA 4PTGA 4OAVB 2VO7A 3MW1A 4OTQA 2CLXA 2ZYBA 4ACCA 3BPRA 4AXFA 4I0SA 2R5TA 4FIFA 2XCKA 3Q52A 1ND4A 2ZB0A 4IFGA 4BCFA 4ZTHA 2SRCA 4FTQA 3R9HA 4BIBA 3MIAA 5ETFA 2UW3A 3IW5A 4EOIA 4GYIA 4V0GA 4FKWA 4R77A 3U54A 3D83A 4AGDA 4J53A 2OFVA 2PVNA 4DG2E 3G9LX 4S2ZA 5CEKA 1OIYA 4YJTA 5D12A 3ORZA 3POZA 5CVFA 4IC8A 2RFNA 3HA8A 4MF1A 3ULZA 4Z7GA 1JNKA 2OICA 3UO6A 2R64A 2ZV9A 3A7GA 3ORPA 5C8NA 3PIXA 5DGZA 5DYJA 1XKKA 2B0QA 3QRIA 1SYKA 2AUHA 2E2BA 3MPMA 4O0YA 5KE0A 5CAUA 1Q4LA 2OJIA 3QLFA 1YDTE 3RPVA 3BV3A 3MYGA 4UALA 4AOJA 4WKQA 2XM8A 3EQIA 4JQ7A 4U0IA 4ENYA 3ZLYA 2P4IA 4RC2A 2WKMA 4AA0A 4YO4A 3DBQA 3OY3A 4RJ6A 3ULIA 1RW8A 3PXRA 4ZEGA 5A4LA 4IWQA 4BCHA 2VTSA 3R73A 2A27A 2V0DA 4D5HA 1Z9XA 2ERZE 2YM3A 4IHPA 1YKRA 1GZNA 2R3FA 2WGJA 4UWCA 3RINA 5B2LA 4AF3A 1XH4A 4YLLA 2O8YA 3R9RA 3MH0A 4EOSA 3UIBA 3POOA 4HCVA 3BYUA 4F6UA 1S9JA 1LR4A 1PF8A 3RJCA 3BGZA 4BCNA 3R6XA 4AAYA 4XOZA 1HCKA 3UIMA 2I0EA 4O21A 3ORLA 1MUOA 3F6XA 5HNBA 2CNUA 5EOBA 2VWXA 2XM9A 4MXYA 4Y5HA 4YJVA 5F9EA 3DPKA 3D7TA 2XS0A 3QD3A 3FMHA 3UODA 3QC4A 5ACKA 1PXMA 2QG7A 3QCQA 2DQ7X 3QD0A 4QMVA 4W4XA 4CCUA 4CXAA 4KWPA 3MVHA 3O2MA 5A3XA 5EYKA 3RCJA 1TQPA 2QI8A 5HD4A 3O7LB 5M07A 3COMA 2C6IA 4PL5A 1XR1A 2VX1A 3S95A 3NNVA 4W4YA 3GCPA 3ZO4A 4DEAA 2RF9A 3TL8A 4JQ8A 3K2LA 3VS2A 3H9RA 2OJGA 3AQVA 3PA5A 4H36A 2A2AA 2UZVA 2X81A 3GOPA 3BYOA 3G5DA 1JQHA 2Y4PA 4AN9A 4TL0A 5L4QA 1OKYA 3A62A 4NTTA 2XAOA 2WTWA 2Z8CA 3HLLA 4BDKA 5HX8A 3BLRA 3QA8A 5EG3A 4XP3A 1J7IA 5JEBA 1CKPA 4KKGA 3QD4A 2J0IA 3FLNC 4DCEA 4C35A 4EJ7A 3KRLA 4I4FA 1XBBA 3UP2A 4V01A 2PVLA 4EOOA 3WF9A 2HK5A 1M7QA 5E7RA 3E3PA 2WB8A 1DAYA 3QRKA 4LM5A 4NW5A 4ZXTA 1FINA 3ZMMA 3C4WA 1YI6A 4F09A 3MPTA 2XBAA 3LM0A 2QU6A 1AD5A 4JBPA 2AYPA 1UU7A 2J0KA 3QGYA 2YAAA 1XH7A 4YU2A 2GNFA 2R0UA 2W1HA 5ANKA 3PA3A 4LV8A 5H9BA 4AAAA 5I9ZA 5L6PA 3DKCA 5AIKA 4F6WA 4K1BA 4M15A 1PKDA 3LFDA 5DPVA 2ZMDA 5ETCA 3TV7A 3QCYA 4EK3A 2NYAA 2GCDA 5E8VA 4ZY6A 1URWA 4H58A 4AT3A 3GEQA 4CEGA 3FHRA 4DEDA 5BPYA 2XANA 1TVOA 2VTHA 5L8JA 1FMKA 1SZMA 5I5ZA 4H39A 2B53A 2R3LA 4WA9A 4RBLA 4F9WA 5L3AA 3TCPA 5IA2A 3JVSA 2EXMA 4AXEA 4GJ3A 3PPKA 5LOHA 3EKKA 3VS4A 5AP5A 3DDQA 3MWUA 1YXSA 4JX7A 5AP3A 3RK5A 4B8LA 4MNFA 2JDOA 2HW7A 3G2FA 3HRCA 4ID7A 4Z7HA 5BYZA 3FLYA 4ZSAA 2O2UA 4DG0E 1KOAA 3AT2A 3V04A 5CT0A 5EM5A 3OVVA 3A4PA 2HCKA 4WSQA 3DV3A 4M67A 4C7TA 2PVMA 3MA3A 5L2WA 5DN3A 3S4QA 4CZTA 2QOQA 3VUKA 3UYTA 4E5WA 3UIXA 4ZK5A 3WZUA 5A4CA 4QP7A 5AV0A 4P5ZA 2YDJA 4YTIA 4EK6A 2WEVA 2NRYA 3TYKA 3QYWA 4NEUA 4TW9A 4CMUA 2YM4A 2QKWB 3BEAA 1M2RA 4BCIA 2HENA 3MJ1A 5KMIA 4ZTSA 4RVMA 2YITA 3KREA 5CU2A 3LFBA 2WTJA 5AUWA 5LCKA 2WTDA 3B8QA 2C5YA 3GNIB 4S33A 2F49A 2X8DA 5IQHA 3UIUA 3Q4CA 4Z16A 1CM8A 2VWBA 4AU8A 3RHXA 3E62A 3FI2A 4IVBA 5DLSA 1ZARA 4HPTE 4MXZA 1H00A 5JMSA 1IA9A 3MBLA 3LZBA 4W4VA 5HTCA 5CWZA 1Z57A 5E8YA 4LYNA 5IUIA 3QWJA 4AZSA 4D4SA 4FSZA 2Z02A 2HIWA 4TRLA 1H0VA 2EVAA 3NSZA 3ZXZA 4ANMA 3EWHA 3DT1A 5KMMA 2LGCA 3U4UA 2PL0A 2PVYA 4DEHA 3ZDIA 2PE2A 2BRHA 4JAJA 1H0WA 4G6OA 3ZCLA 4DT8A 4FT5A 3QQJA 4DGNA 3DJ5A 3E8NA 3W2CA 5HU3A 4RQKA 2F9GA 1V0OA 4EWHA 5ANOA 4R78A 3QQKA 1LPUA 3EHAA 3C13A 2W1FA 1DAWA 4BZOA 5IEXA 2VNWA 3KCFA 3NUYA 4TWPA 2Q0BA 3EMGA 3OY1A 4KBKA 5ANEA 4ZZMA 3KB7A 4LUEA 4IB3A 1K3AA 2OWBA 3U87A 5A4TA 1JWHA 5IDNA 2ZFYA 2ESMA 3VAPA 3MTFA 4FVPA 5T68A 3EFJA 2C1AA 5EHOA 4FEQA 4GRBA 3ID6C 2PUUA 4QMZA 4C0TA 2FGIA 2KTYA 1G8JA 1DI8A 2YDKA 3P5JC 4O7LA 5J87A 2ETMA 2BZIB 2YIYA 2YCSA 1APME 3E5AA 2FSMX 2J51A 4NFMA 4WUAA 4E6DA 5IUHA 2CSNA 3RK9A 5CANA 5KMLA 2FA2A 1WFCA 4FKQA 5GZAA 2C6DA 1ZYDA 2C69A 5LWNA 3LFSA 2XEYA 4UZHA 5FXQA 4LL0A 5JKGA 4GIIA 4MKCA 5K0KA 3C4XA 4G16A 3RAIA 5CENA 3SDJA 3VBQA 3ZTXA 4USFA 4MXCA 3IGOA 3S00A 3W2QA 2HYYA 2GPHA 3TNIA 5JZJA 4D1ZA 3FMJA 3QQGA 3AD4A 4C33A 5CI7A 3HMIA 2YISA 5AADA 5F94A 4QNYA 2CGVA 1JSVA 5L2TA 4AT4A 3MH1A 2VO0A 3AD6A 3LFQA 4O2PA 1W0XC 4DINA 3OTUA 3SQQA 4ASZA 4TWNA 4TT7A 5CEIA 5EHLA 5CF5A 2XKEA 5CNOA 3C0IA 3R21A 4EZ7A 4EUTA 4I93A 3KRJA 2ZMCA 4HYHA 5FTQA 3W1FA 4YJQA 5LARA 4NZWB 4J1RA 5HICA 4FEXA 4IM2A 2WOTA 3KF7A 2BTRA 2QCSA 2A0CX 4MCVA 3Q60A 3THBA 3VQHA 4BCMA 2C5VA 2WMUA 4HGLA 5B2KA 1OUKA