1CMKE

Crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
publication title Crystal structures of the myristylated catalytic subunit of cAMP-dependent protein kinase reveal open and closed conformations.
pubmed rcsb
source organism Sus scrofa
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1cmkE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1cmkE02
4HYUA 2XYUA 4LOPA 4JJRA 5AAFA 4L01A 4KS7A 4FG7A 2XK6A 5L2QA 2C0OA 1W84A 5DR9A 3BCEA 1GAGA 4NFMA 3DJ5A 3GFWA 3QYZA 2RFDA 3GOKA 2JIIA 3HMIA 3ACJA 3FMHA 3KQ7A 2OH0E 5E92A 5CEMA 2GQRA 4JBOA 1BKXA 2WB8A 3PLAE 3C51A 4GT3A 4A4LA 4DC2A 4AZEA 5A4TA 5E8SA 4DF3A 4DT8A 5DPVA 3B8RA 5G1XA 5TOZA 4F9CA 4NCTA 4DHFA 4B9DA 4G3EA 3H30A 5AP2A 2LGCA 3PWDA 5D7AA 5FM3A 4CQEA 2VX3A 4FK3A 1ZYCA 2CN8A 4CT2A 4USEA 4YR8A 4ZSAA 5EQEA 3EQGA 3F88A 4JOAA 2RFEA 5CX9A 3TUCA 4H39A 3RPOA 3WF5A 3DK3A 4J98A 1T45A 3IW5A 5CI7A 3DFAA 4NTTA 3BEGA 4ZTSA 5HO8A 4D2SA 2UW3A 4FKTA 5TT7A 2EXMA 4GFOA 4XV9A 2BDJA 2OJJA 3L8PA 4G9CA 2R3QA 3D0EA 3DDQA 3ULZA 4EHEA 5KKRB 3LXPA 4QD6A 1XH4A 2A27A 3VUTA 4QTCA 5IEYA 3R2YA 5HNIX 1PRYA 3DK7A 3TKIA 1K2PA 3DV3A 4UB7A 3F7WA 4BDFA 3HP5A 3NYXA 1IAHA 1BLXA 4ANOA 1H1RA 5E9EA 3ETAA 3P7BA 5HESA 5HVYA 2BR1A 4TYJA 1W7HA 4WSYA 4BR3A 3QHWA 4PQNA 3ORIA 3KXGA 5FDXA 3SA0A 5CXZA 4CVAA 2VTJA 1XHAA 3A62A 2GS2A 3BHYA 4O7SA 1PXIA 1GNGA 2PMNX 4FYNA 4R8QA 4F0GA 3ZLYA 4BHNA 4RJ8A 3RMFA 2VO7A 4PTCA 4IANA 2C3LA 2WIPA 1Q8ZA 3CSVA 2VNWA 3NIEA 4ERWA 3FMEA 4YTFA 2C4GA 2C6DA 2XJ1A 3OCSA 3Q4CA 4IM0A 4U80A 4X6QC 4G9RA 4C62A 5IH4A 2CDZA 3KXZA 2WO6A 4XRJA 2I1MA 3A4PA 4TKSA 2R5TA 1SYKA 2HW7A 4OT5A 3DA6A 1XBAA 2J50A 2JIUA 3QYWA 5HD4A 4FIIA 3TKHA 2W17A 4YJRA 3QZGA 5HU3A 3L9MA 3P5KA 3I0QA 4LMUA 4EOIA 3EWHA 4KNBA 1Y6AA 3W8LA 4M66A 2XM8A 4FTOA 2JITA 2B9JA 4U40A 4TWNA 5DEYA 2OXXA 4J97A 3QAME 4JG7A 2WTKB 4HPUE 4EH7A 5A6NA 5J7HA 5CU0A 1PXMA 3EL7A 4QPAA 2QO7A 4ZJIA 3D7ZA 2OSCA 4HPTE 4DGGA 2Z02A 1ND4A 4L3JA 2R4BA 3C4FA 4FKGA 3BGQA 2NO3A 3P0MA 4YHFA 4OBQA 4CFMA 3BZ3A 2WHBA 3QHRA 1YXXA 3OWJA 4WBBB 2XYNA 2JKOA 2CPKE 4FV0A 4BDBA 3IOKA 4UV0A 3V51A 5HORA 5A4EA 4EOPA 3VUKA 4ORKA 5DR6A 2FSTX 2WQOA 4W4WA 4CSVA 4DFXE 4FKWA 2PY3A 4XOZA 4O86A 4L3LA 1WBOA 3DGKA 2CMWA 4PDSA 2BVAA 4MF0A 3H0YA 3BHVA 4UMTA 1FVRA 1V0OA 4K1BA 4MKCA 5DOSA 5EYDA 3ZYAA 4UX9A 2UW4A 3WBLA 2IN6A 2GHGA 3LKMA 4TYHA 4MD8E 2XJ2A 4IWOA 2EU9A 1U59A 4UWBA 3UPXA 4BFMA 4DT9A 4FT5A 4MXOA 3EIDA 5AR5A 5AUZA 2W9FB 4EOQA 3P4KA 3WE4A 3LQ5A 3QX2A 4PWNA 2B9HA 2OJ9A 5E8TA 3UZRA 2H34A 5GZ9A 5KHWA 3NUYA 4FL3A 5CSVA 2P2IA 1OIUA 4KKEA 2RIOA 1SVHA 3F7ZA 1YRPA 3N51A 4IHPA 3UNKA 3OFMA 5B2MA 3S0OA 2R7BA 3FMNA 3EMGA 3PZHA 2PZYA 3UOLA 4DBNA 3LHJA 1OB3A 2W9ZB 4TWCA 4FKQA 4X3FA 3WZEA 4FT7A 2H8HA 3I79A 3U6JA 3ROCA 3ZS5A 4ACCA 4JDHA 5B0XA 4PPBA 2P55A 4C3RA 5AUYA 1J91A 2BTSA 2OKRA 2XEYA 4FEWA 1JBPE 2QOOA 2R3JA 4BTFA 3H0ZA 1W98A 1XH9A 2CHLA 3CP9A 3LLTA 3MFSA 4L42A 2BPMA 3PG1A 4V04A 3C4CA 4X0MA 3S95A 5K5NA 3AC2A 2WTCA 3FXWA 4O7LA 4NIFA 2YM8A 4RWKA 4RLKA 4QMMA 2C69A 2YLFA 3SXRA 3BRBA 1LPUA 2YJSA 2WELA 4ZY6A 4IZYA 4ASZA 1JSVA 3EHAA 3OXZA 4I23A 4WHZA 1IASA 2IZSA 2PK9A 2QD9A 2PWLA 4OTRA 1ZLTA 2X8DA 2ZMDA 4DH8A 2VNYA 3QLFA 4B6LA 1JNKA 3EN7A 4ZTLA 3L1SA 3IOPA 4H36A 1H0WA 3ODZX 4PP9A 5D12A 2QU6A 1FVTA 4GYGA 2RGPA 3F66A 3IG7A 4A7CA 3QCSA 1J1BA 5I9ZA 3HAVA 1WVXA 4V05A 4L3PA 1XO2B 2C3KA 3FYJX 3CEKA 4ZTRA 2Y6OA 5I9WA 3O50A 5IMEA 3MFUA 1R3CA 4U79A 4ASXA 5HTBA 5CEPA 3RINA 3WOWA 4K0YA 2CCIA 2XK8A 3ANRA 3F9NA 4WA9A 5A3XA 3ZDIA 4HVGA 3R9NA 5L6PA 3CQWA 3ZFMA 3LQ8A 1XH7A 1GJOA 3MTFA 2UZLA 2WD1A 3WZUA 1RE8A 3VW6A 3Q6UA 3FMJA 3QWKA 3BHUA 4P4CA 1OUKA 3P86A 3PUPA 4UWCA 1LR4A 2PE1A 4X2GA 4LGGA 4QMYA 3W8QA 2VWUA 5IUGA 5GIPE 2B9IA 5A14A 1K9AA 3DKFA 3R28A 3UJGA 5BYLA 1CDKA 4GT4A 3W16A 3N4UA 2YJRA 4CYIA 4DH5A 3GFEA 1ZMVA 4KB8A 3NS9A 2QHNA 4IVDA 2V55A 3CJFA 3OWLA 5E8WA 3RJCA 5HBEA 3TV6A 3I0OA 2UW8A 4E6CA 2O65A 4HVIA 4X3JA 3TJCA 4QMPA 2J90A 5CVFA 2VN9A 3POOA 4AW1A 3K54A 4J53A 4IFGA 3SXSA 4A07A 3RK9A 4FKPA 4YJQA 2VTMA 2UZNA 3V5WA 2R3OA 3GC9A 4FG8A 4NM7A 4AZSA 3FKOA 5JFSA 4AGDA 2HXQA 3QQLA 3BYUA 4L53A 1OMWA 3GI3A 4G34A 4C57A 2FYSA 1H1PA 1OIRA 2HY81 4ARKA 4FIGA 4HGTA 5KMMA 2DWBA 1KV1A 2YM7A 1BL6A 2YEXA 3RWQA 5B2LA 3ATTA 4PP7A 4UMUA 4DEEA 1P4OA 1Q8WA 2ZM1A 3I6UA 3SHEA 3O17A 3U4UA 2VX0A 4FEQA 2ZM4A 4ID7A 2J5EA 5LWMA 3V5JA 1L3RE 5AP1A 4BCJA 5E1SA 2C6EA 5CAPA 4EHVA 5LXMA 4AZTA 3M2WA 3OCTA 4H3QA 1JAMA 2C5VA 4QYFA 4ZP5A 3HMOA 3KN5A 4E26A 4BZNA 2BKKA 4FI1A 5ANJA 3SLSA 4K8AA 4CYJA 4Z7GA 2W4OA 3A7FA 4TW9A 4HZRA 3HDNA 3MH3A 2REIA 1YI4A 3QRKA 3DBDA 4RQKA 4FL1A 4IM2A 3EOCA 3IDBA 3L8VA 5LQFA 3FHRA 3GUBA 3GCPA 2R3FA 2VTPA 3BX5A 3LFFA 4HCVA 4KRDA 1XBCA 4RLLA 2CKPA 1YOMA 3RZFA 1ZXEA 3TIYA 3EQHA 3WF6A 1PYXA 2OXYA 3UG1A 3ZM9A 1IA9A 3OWKA 3W10A 4L6QA 5EH0A 3AT3A 3SW7A 4FIFA 4Q9SA 4AGWA 2C68A 2WNTA 2X9EA 3VS2A 5FXRA 4RT7A 3ZC6A 4D1XA 2PUNA 3PVGA 3V8SA 4IEBA 5DR2A 5CNOA 2RFSA 4C33A 4JX3A 5A54A 1YXTA 4JQ7A 5EI6A 4BCGA 4DG3E 4L43A 5AP0A 5IQGA 3GCQA 3QD0A 4LOOA 4U5JA 4S2ZA 3QCQA 4DEDA 3Q5ZA 3I5NA 5IISA 2JKQA 2R9SA 5I9YA 3COIA 1M2QA 5KCVA 1TQPA 5C8NA 3UC3A 1IA8A 3UMWA 5H8GA 2R7IA 5T68A 2WTJA 3AMBA 3RK5A 4B0GA 1XQZA 5IQFA 4Y5QA 2QKRA 1F3MC 3E62A 2Q0NA 4QYEA 5FWKK 5JH6A 3MH0A 4FZDB 4K77A 3D15A 4AF3A 5AV1A 1V0BA 3HX4A 2YDJA 1NXKA 4Q2AA 3GBZA 1WBVA 3FV8A 3C5UA 3FKLA 3FKNA 3NUPA 3HDMA 3FLZA 4NZWB 3NSZA 2B55A 4BB4A 3ANQA 5L2IA 5FP5A 4FV5A 3E7VA 4AU8A 2OU7A 5M44A 5M08A 5CF6A 4BDKA 3PVWA 3TV4A 3DAKA 1XKKA 2QG7A 4PMTA 3UZPA 4C4FA 4DH1A 5EKOA 3JR1A 4F6WA 3EQCA 3SGCA 4KBAA 2ACXA 4IWPA 3HMPA 4FK6A 3QGWA 3SC1A 5HVKA 5HZNA 2DYLA 3HMMA 5IDPA 4DA5A 4S33A 3VBYA 4BDIA 2XIYA 5LMKA 2BFYA 3ZU7A 3F3WA 1O6LA 3EKKA 2PUUA 3GU4A 4WG4A 3UNJA 1PY5A 1UKIA 4U97A 3WI6A 4CLJA 4EZ5A 4F70A 4FTNA 3ZC5A 4KUJA 3QKMA 3SXFA 2OJIA 3SOCA 5M06A 3ERKA 2X0GA 4I20A 3IGGA 4FTLA 2W7XA 3LVPA 4ZLYA 2YDIA 4RWIA 4D58A 1V0PA 3COMA 3OW3A 4U3YA 3RKBA 5D9HA 5KMLA 1L8TA 5IQHA 3NVMB 4TNBA 4A9SA 5J9YA 2HW6A 3HNGA 3JY9A 3R30A 5AA8A 4KWPA 3RI1A 2JFMA 2PMLX 1V1KA 4IWQA 1LP4A 2E2BA 4RWJA 4PMSA 3FXZA 4C58A 3SD0A 4NFNA 5ANKA 3ZZEA 4BCNA 4JX7A 3IECA 4C35A 5J1VA 4EZ7A 3MS9A 2VGPA 4O1PA 3DAJA 2QU5A 1IRKA 3CQEA 3EN4A 2OJFE 4GFMA 3FI2A 5HE0A 2C6TA 4RFYA 3Q4ZA 1A48A 4FSWA 3DTCA 5J7BA 3MJ2A 4O6LA 3GQLA 3CBLA 3W55A 3U9CA 2DUVA 1H1SA 2F9GA 4AFEA 4QMWA 2E9VA 3SG8A 5CU6A 4XRLA 2C1BA 4N70A 4HJOA 4O81A 2YIYA 3PPZA 5HI2A 3JY0A 5EYCA 4RJ4A 3PE1A 3COKA 5ETCA 4AW0A 5I9UA 4F1TA 4YNOA 4RC3A 4ZAUA 5LVMA 3C13A 5DBXA 5BMSA 4O7ZA 5JGAA 3DB6A 2A4LA 4G6LA 5E8VA 3NYNA 4C4HA 4L8MA 3RHXA 1UWHA 3UO5A 3ALNA 4KAOA 4XBUA 2YIQA 4AQCA 1NVSA 4QMTA 3PSDA 5JMSA 3U6IA 5AFVA 1MRVA 4FZ6A 5DNRA 3G90X 4JBPA 2CLXA 4GV1A 4IADA 4R6VA 3VS3A 3TUBA 4FSMA 2ZAZA 5IEVA 3PRIA 4DBXA 2O3PA 4I3ZA 5K9IA 2XB7A 4O0VA 1UVRA 4OBOA 1MUOA 5FG8A 3C4WA 2UUEA 5BQ0A 2XKEA 2R3KA 1O6YA 3UIMA 4B7TA 4CKRA 2X8IA 1ZWSA 1WAKA 3WF8A 4BI0A 4O84A 4ITHA 3QF9A 4Z3VA 3OTVA 2BMCA 1SVGA 4R78A 2OIBA 3KKVA 3I81A 4C38A 1CKJA 3OOGA 3A7JA 4LRJA 1E1VA 4AXAA 5K5XA 4TYIA 4GG5A 4D9UA 2OJGA 4M7IA 2NP8A 5AA9A 3EN9A 4BCFA 2ERZE 4EC8A 5AUTA 5BNJA 4EOKA 4WNKA 4I0TA 3VN9A 2WMUA 5IKWA 2XBJA 4FTIA 3AC4A 4O83A 4BKJA 3CKXA 4EI4A 2JDVA 3A60A 3QTZA 3R6XA 4G3FA 1MQ4A 2HZIA 2A1AB 4LGHA 4QP7A 2BDFA 1FOTA 3IPHA 3WIKA 3ZONA 3VJNA 3DKCA 4QMZA 4BCQA 4CKIA 4FOBA 4JRNA 3KFAA 3PIXA 3FZOA 1W8CA 4PNKA 4AE6A 4IX5A 2ZJWA 3Q53A 3QXPA 2RSVA 4BDEA 1A06A 1GZ8A 3A8XA 3R8UA 5CI6A 2PVRA 1QPEA 3MDYA 4QMVA 2GNHA 5JRQA 4ZSGA 3D2IA 4EL9A 4ZS0A 3OBJA 1PXNA 4E4MA 5CQWA 3S4QA 3WZKA 4EK6A 2WFYA 2I0YA 4O6EA 4C02A 5I5ZA 4R77A 3D83A 2I40A 5IA3A 4GU6A 3OW4A 4CCUA 4D4VA 3UQGA 3BLHA 3KC3A 5EHYA 3I5ZA 1OM1A 3BE9A 2XCHA 4W8DA 1PJKA 2XEZA 3DDPA 5EI2A 2C0IA 2HZNA 5DA3A 1FVVA 2YA9A 3O71A 4OUCA 4D0XA 3QWJA 5IPJA 3G6GA 4JNWA 5AR3A 3PJ8A 2CNQA 1H0VA 1P2AA 2WPAA 3LCOA 4EZ3A 3QUPA 3KRJA 5C4LA 2UZTA 5FM2A 3AC3A 4CRSA 5HBJA 3F3TA 1RJBA 3EN6A 1TKIA 4RGJA 1NW1A 2ITQA 1WFCA 3CPCA 4MYGA 2WMXA 5AAGA 4LM5A 4O91A 2P2HA 3MJ1A 5DT4A 4FUXA 3D5WA 2F7EE 4LQMA 5AJQA 5HIEA 4PF4A 1AD5A 1H08A 2PTKA 2RKUA 2ITWA 1ZOEA 3Q4UA 3FY0A 4X2FA 5AR2A 4P7EA 4U3ZA 5DT0A 4BDAA 2ITNA 4FNXA 2I7QA 2ZMCA 2HENA 1M7QA 2IWIA 5L2SA 5EG3A 5HOAA 4I92A 2KULA 5HICA 4IC8A 3LJ2A 5DN3A 3H4JA 3W33A 2C5NA 5LVNA 1Q3DA 3ELJA 4M97A 2X8EA 4EK5A 3W1FA 4JVGA 3HP2A 2P33A 3QBNA 3FPMA 3QTWA 4FSRA 4JAIA 1SVEA 4KSPA 4P5QA 3JVRA 4QQCA 2GNGA 2OBJA 4BVUA 3UOJA 2WMWA 4HYIA 3QTSA 3MSSA 4AOJA 4AOTA 3MN3A 1CMKE 1R0EA 4QMUA 3U8WA 5CT7A 3HYHA 3QA8A 3AT4A 5CASA 1U46A 2ZYBA 1KSWA 5EDRA 3BQRA 4U44A 2ITPA 4LRMA 4LYNA 4F9BA 3HA6A 3UGCA 2ITYA 3PE2A 4GS6A 4F9WA 4RJ5A 4ANSA 2QOCA 2VTOA 5EHOA 4XG8A 4M0ZA 3MA6A 4MBJA 3WF7A 3MPAA 2V22A 4NT4A 3RTPA 4A9RA 4AP7A 3KXXA 4UN0C 3W32A 4WNPA 4LOQA 3OCGA 4PPCA 5JZNA 1P4FA 4KIKB 4YBKA 3UDBA 4DGOA 5CEIA 3MBLA 2PMOX 4KIPA 2PZRA 2WQNA 4GU9A 3DCVA 5CNNA 5L3AA 3ZUVA 2X6DA 3LJ0A 4CTCA 4N0SA 1WMKA 3LCSA 3S1HA 3W2PA 3IDPA 4MH7A 4CFVA 4ZZNA 1BMKA 4FODA 4WUNA 2WKMA 2BIYA 4GMYA 3G15A 3CKWA 2PVMA 5EM7A 2OFUA 4Q9ZA 4FEXA 2J0MB 4HW7A 5A4CA 1E1XA 2QONA 2WMBA 4F64A 4AS0A 2IVSA 5AR8A 3TNQB 3C0IA 5EI8A 3GQIA 3PIYA 3FQHA 1ZZLA 3ORZA 2QVSE 2VWVA 5EOLA 4RFMA 4I94A 4QPMA 4MD7E 2Y4IB 3LXLA 1SZMA 4GK3A 2WMSA 3NNVA 4RIXB 3IW6A 3TZ9A 4BI2A 4EQCA 5CT0A 5KMJA 2O64A 3AD6A 3PJCA 3PJ1A 3QA0A 2WOTA 3RCJA 1YI3A 2GTNA 3S3IA 4YO6A 5I4NA 2YM6A 4OTWA 2JD5A 2J0KA 5F20A 3HV7A 4ACHA 3V6RA 4ALVA 5CWZA 3PXYA 1R78A 1OVEA 5CYIA 3ZFYA 4TXCA 4WBOA 1H01A 5HTIA 4ZMEA 5HLNA 2B9FA 3Q9YA 2IZTA 3ZUUA 4EYJA 4OTPA 4JDJA 2C6KA 2GNIA 4YJNA 3VJOA 4BIBA 2Q0BA 4BIDA 3AG9A 5JQ5A 3QUDA 4GSBA 4IJ9A 2NRUA 4PDOA 4YPDA 3TL8A 1KUTA 3EYGA 4I0SA 3GU6A 2PZIA 3NWWA 3FY2A 4RJ6A 4HZSA 2PVNA 3EQBA 1J1CA 4L7FA 4E20A 3UMXA 5CVHA 1UNHA 2Z7SA 3OHTA 3R63A 5D7VA 4EBVA 3AMYA 3K5VA 3FC2A 4GIIA 3FQEA 4JDIA 2YWPA 4MXCA 3T9TA 3ZRKA 3VRZA 4CG9A 2IO6A 3DT1A 3C9WA 4XNEA 4U81A 4FTAA 4NCTC 2W5BA 4PTGA 4RVKA 3V04A 3EQPA 1J7LA 2GTMA 5ACKA 4RVMA 1YHSA 2CKEA 3D94A 4FSTA 4XG4A 1IEPA 4BDGA 4IDVA 1OL5A 4BCKA 3VQHA 2IG7A 2R3LA 3I4BA 4UYNA 2SRCA 5EOBA 3MVJA 2NPQA 5CSPA 4AOIA 3VBTA 4TT7A 2Y8OA 3PSBA 1APME 5KNJA 2J4ZA 3A7HA 1ZOHA 3RNYA 1OKZA 4BYIA 3FJQE 4WG5A 2FA2A 3R8LA 2RG5A 1WBTA 3L8SA 4O7NA 2J51A 4Y95A 1BUHA 2BAQA 3LFSA 5D10A 2GU8A 3FI4A 2W1DA 4GRBA 3UQCA 4RSSA 4QYHA 4QTEA 5E4HA 3UVRA 5L8LA 4F7LA 1WBNA 4FSYA 1R0PA 3V3VA 2YLEA 1YXVA 3ZLWA 3HEGA 3GENA 4XG2A 3P7AA 3QQHA 5JZJA 2NNWB 5JQ8A 5AMNA 4DFUA 3NAXA 3EJ1A 5BX0A 4JG8A 1ATPE 4ZY5A 3VUGA 3DB8A 4I21A 5DT3A 4F1MA 5CSHA 4EH8A 2VUWA 4AX8A 1QPCA 3ZHPC 4EWHA 4I6QA 2V0DA 4O22A 1AGWA 3KULB 5BUJA 4IAKA 2VWZA 4FSQA 4M67A 5HIBA 5J95A 3DXQA 3ZO3A 2PZ5A 3RP9A 2QNJA 4BCIA 5HG8A 4E4NA 3RM7A 2XK4A 5JRSA 4CT1A 3DJ7A 4EH5A 4PPAA 4K18A 1WVWA 4Y73A 3CD3A 4YHJA 5EW3A 4NEUA 5AEPA 1JPAA 1QPDA 1DAWA 4EOSA 3LLAA 4HOKA 1A9UA 5BUEA 4FEUA 2ITVA 5C01A 3HMNA 1J3HA 4M14A 4RFZA 4YC6A 3A4OX 4RJ7A 3R9DA 3UP2A 1H26A 3OC1A 4U8ZA 4GJ2A 3TNWA 3UOKA 4ACMA 1JKKA 2CSNA 3QKLA 4AZWA 4C7TA 4D2TA 2YZAA 4L44A 3NAYA 1PXLA 4U41A 4XP0A 1KE9A 3DBCA 3EN5A 3EQDA 5CEQA 4DG2E 3IONA 4RX9A 5HG9A 4OTHA 2ZVAA 5ANIA 1SNXA 4FF8A 3TNPC 5JEBA 4NU1A 3V5LA 3RVGA 3DNDA 3ZEPA 4FC0A 4F0IA 2PVYA 5KMOA 4XCUA 3VO3A 2EUFB 5A46A 5JT2A 1MRUA 3MIYA 5AAEA 3R8PA 5C1QB 2OZAB 5BVWA 4Z9LA 4IB3A 2X1NA 2GPHA 2PVJA 3GU8A 4BKZA 4CZTA 1H27A 1O6KA 2PMIA 5LVLA 3BGZA 2IW8A 2UV2A 3SQQA 4C3FA 3BWJA 4CV9A 4WKQA 2UW0A 4K33A 4M84A 3Q3BA 3E63A 4JLCA 5FTQA 4BRXA 2B1PA 2W4KA 3NW5A 3GT8A 3QTUA 4FIHA 4CD0A 5LVOA 2HZ4A 3DNEA 4I1ZA 4WD5A 4J99A 3JXWA 4QP4A 2I0VA 2HCKA 2C5YA 1GIIA 4RC2A 3QD4A 3C4ZA 5BVKA 3ZMMA 1NVQA 4XG7A 5M55A 5CAQA 2BAKA 1JQHA 2FGIA 5HVJA 3TCPA 2H96A 4FKUA 2GS6A 2UZWE 4L67A 2GNLA 4W4YA 4ZJJA 1XR1A 4FZAB 5EFQA 3P79A 3AT2A 4QP8A 4I6HA 2IVTA 4NW6A 2XCKA 2PPQA 2PVKA 3DU8A 3NYVA 4X3FC 2ZOQA 4GVJA 4I4EA 3UP7A 4M13A 4PDYA 4U7ZA 1DM2A 5J79A 2XNEA 4G5JA 4BC6A 5CSWA 4ZIMA 4MEDA 3I60A 2FVDA 4CRLA 1UU7A 3ZDUA 2XIKA 2X7FA 4X2JA 4XUFA 4IIRA 4E73A 4FMQA 3VW8A 3EFWA 2FSOX 4O0XA 5FTOA 4CFWA 3NUAA 5FQDC 5ANGA 4YC8A 2ETRA 2W05A 5CALA 3TXOA 4EK4A 1NVRA 3ZSGA 5I3RA 4OAVB 3FMMA 2ITXA 2BHEA 1UNLA 5AP4A 3BI6A 3GEQA 4N57A 1GY3A 2R64A 3LAUA 3FDNA 3DXNA 3EH9A 1YXUA 3FLNC 3PVBA 3RALA 1W83A 2AC3A 4H1MA 3RGFA 1YHWA 4H3BA 2X2KA 4G3DA 5M53A 4YTHA 3EFLA 1U5RA 4KIKA 4QPSA 1H8FA 3TZ8A 4I22A 3KL8A 2R3GA 2JDSA 2ONLA 4YP8A 2XM9A 3GCUA 4ZTMA 4GG7A 4Y46A 5HEZA 4RBLA 2BRMA 3NYOA 1XH8A 4DITA 3O8UA 2UW6A 3LFQA 2QQ7A 3GCVA 3HA8A 4J8NA 4JIAA 1M14A 2C6OA 2PL0A 3FEGA 2E9NA 4PL4A 4LL0A 2UW7A 1REJA 4P2KA 5HCYA 4IAZA 2R2PA 5BYYA 2VO6A 4IZ7A 2WTWA 3DK6A 5CAUA 3C4XA 5AX3A 3LM0A 5HG5A 5ICPA 4AZVA 3MH2A 3VHKA 5IU2A 1Z5MA 2VTNA 3VS6A 4DFNA 4RIXA 4FE2A 2UZDA 4YU2A 3R9HA 1FPUA 4NM0A 4OTDA 5AP5A 4BGGA 4FBXA 2QOHA 2AYPA 3KCKA 4QYYA 4IM3A 3KRLA 3FQSA 5IH5A 2WOUA 1OBGA 3U87A 1PHKA 4N6YA 3R21A 3BPRA 4MWHA 1YVJA 3C0HA 5IH6A 5AV2A 3Q9ZA 2UZEA 4DE4A 3CGOA 4FL2A 1GIHA 3UVPA 2OLCA 4BN1A 3NZ0A 4ACDA 4D9TA 1NA7A 4YPSA 2XNPA 4ZTHA 3Q6WA 4C4IA 4D2VA 1EH4A 3NGAA 4PX6A 4F99A 3I1AA 5HNBA 4E93A 2J7TA 2OIDA 2WMAA 1FGIA 5A6OA 4G2FA 3DKGA 2J9MA 4APPA 4X6RA 2X6EA 4I5HA 3ZSIA 4W4VA 1DI9A 3NDMA 4EONA 3OEZA 4O82A 4BBMA 1KE6A 4DFYA 4B4LA 3AXWA 5L2WA 5I9XA 1TVOA 4L46A 3UYTA 4UMRA 2VU3A 2YCRA 1CKPA 3G5DA 3NLBA 4K9YA 4AA0A 5FUTA 1URWA 3OD6X 4OLIA 3AQVA 4XEYA 4EH9A 4L9IA 5M51A 2C6LA 3HUCA 1MRYA 4B99A 4BY9E 5BVNA 3THBA 3OF0A 3D4QA 4C2WA 3N4TA 3R83A 2WGJA 3FL4A 3R01A 4ONAA 3BV2A 4AUAA 5HO7A 2VTQA 1FMOE 1YDTE 2EB3A 5E90A 5FRIA 5E1EA 4YHTA 1Q8TA 5FXSA 2BRNA 1XJDA 3VS7A 2J6MA 2BDWA 3OT8A 4JQ8A 4KIOA 3NMUF 1UV5A 2GS7A 1H4LA 3P78A 4FKSA 2UZBA 2J0IA 4PNIA 5KKRC 5KUPA 4UMQA 4MNEB 5IQAA 3H10A 2F7ZE 3E3PA 4D4SA 4MVFA 1M17A 4B8MA 1UA2A 4LFIA 2YCFA 2IW6A 4OTFA 3EFJA 5JKGA 4DH3A 1Q99A 2PVLA 3JUHA 4NTSA 1CM8A 4CMTA 1OUYA 3IO7A 4C34A 4M68A 4MWIA 3F2NA 4KKHA 3DAEA 4RZWA 1DS5A 4XV1A 4MX9A 3TG1A 3K5UA 4A4OA 3QALE 3SVVA 4X21A 4IQ6A 2Y0AA 4CG8A 3W2SA 3LCDA 3CPBA 4YZBA 3R9RA 3KULA 4O7TA 3MVHA 4O0WA 3JYAA 3V5PA 4WRSA 4FV3A 5LARA 1CTPE 4I6BA 4E8AA 4V01A 5GZAA 5L8KA 5M4CA 3QTXA 3R8MA 4F0FA 5I0BA 3T9IA 3UPZA 3DKOA 1Y8GA 4YSJA 1VR2A 1WBWA 3EQIA 5JFXA 3NCZA 5GIOE 3CD8A 5EQPA 3IKAA 3LFAA 5CTPA 3DS6A 4AGCA 3FZ1A 3FZSA 5IZFA 3ROYA 1XBBA 3CCNA 4FNYA 3GP0A 4DH7A 3VQUA 2XKCA 3ACKA 2GMXA 2VWYA 4BTJA 2HXLA 1SM2A 2EWAA 2J0JA 4JBVA 4PL5A 3RZBA 1JWHA 2WTKC 4NKAA 2PSQA 2XMYA 3HGKA 5AIKA 3BQCA 1Q4LA 3MH1A 1NY3A 1GZKA 4AT4A 3SV0A 2XNGA 3BELA 3IS5A 1VYWA 5GHVA 4D0WA 3DBQA 4D4YA 4OT6A 1YWRA 1JKSA 5FP6A 3O8TA 1PW2A 2YCQA 1Q8UA 4MXXA 4O0SA 4ZMFA 5M57A 2UZOA 3L9NA 4RRVA 5K0XA 2OZAA 2QLUA 2A19B 1OKWA 3DJ6A 3FI3A 4FV4A 4ITIA 4QP6A 5HNGA 3RK7A 2R0IA 3VULA 4DLJA 5BVOA 3LQ3A 2Y4PA 1JOWB 2VAGA 5HQ0A 2GNJA 3QQUA 5LMKC 4MD9E 3BEAA 1G8AA 5EW8A 3LFNA 2WQEA 5GINE 3O8PA 3ZO1A 1WBSA 4MBLA 3HUBA 1UU3A 3QTRA 4IX6A 4PRJA 4HVSA 5LWNA 3DQXA 1UU9A 2R3IA 4PY1A 5DHJA 4H3PA 1Y91A 2VO3A 3BGPA 4TYEA 5L2TA 4YJSA 4V0GB 2YAAA 2XNBA 5ITAA 2OICA 2PVHA 4FKOA 4G31A 3RAWA 5H8EA 3BYMA 1G8SA 4FV7A 5HX8A 2GFSA 3FL5A 5EYKA 4BWXA 3HAMA 1OKVA 2YITA 1Q24A 4E3CA 3FBVA 2YHVA 4GCJA 3V5TA 4MXAA 2HAKA 1YWNA 2BALA 2JDTA 4MBIA 4YGAA 3V8TA 2Z7RA 3FMDA 5D11A 4YLJA 3UC4A 5TO8A 1VJYA 2PHKA 3F3VA 3FSFA 3U55A 4F65A 3UODA 1I44A 5C8KA 5FGKA 4AWIA 5JK3A 4W9XA 3R00A 4ZZOA 2EXCX 2BKZA 4USFA 4EC9A 4IX3A 3NVKI 3R8VA 2G01A 4HNFA 2XBAA 2DS1A 3KMMA 1PXKA 2JAMA 4O7RA 2XA4A 2X7GA 3FWQA 4KD1A 5DMZA 2O5KA 4EKLA 4IZ5A 4I4FA 1OL2A 4RX8A 4CKJA 4UALA 4YZNA 4F08A 3ZXTA 4J96A 3OY3A 3VUDA 3DZQA 3D2KA 3VS4A 2WQBA 4GVAA 2PYWA 3AMAA 2G1TA 4G17A 3ZRLA 4O0RA 1YDRE 4FTKA 5KX8A 3MPTA 5DFPA 5JN2A 1T46A 5EM6A 3KY2A 2XKDA 3OS3A 3MVMA 4E1ZA 4CZYB 4S30A 2W1IA 4FV6A 5HBHA 1YOLA 4ACGA 3P23A 4ZTQA 1H25A 2B7AA 2G15A 3IW7A 4W4XA 5AWMA 5AX9A 4CMUA 4YTCA 3R1QA 4RX7A 2W5HA 4JRVA 4LMNA 4NH1A 4FZFB 4O0TA 4TZRA 3SAYA 1J7IA 2JGZA 3A8WA 3AC1A 3OEFX 1OL7A 4MXZA 4RIWB 3DLZA 1O9UA 4GUEA 3R7IA 4RX5A 5CAOA 2FH9A 3WILA 4GIHA 5CQUA 2PU8A 2P3GX 4HNIA 4M69B 3GB2A 1SMHA 4AAAA 5F9EA 4YC3A 4WT6A 1IAJA 2HY0A 4AW2A 3O2MA 3SG9A 4BBEA 2ETMA 5CF4A 1I09A 3ET7A 4IH8A 1YDSE 4IAAA 1UU8A 4PDPA 2DQ7X 2RFNA 3AC8A 4HGEA 2CGXA 3QRIA 4TYGA 3R8ZA 4BZDA 3VUIA 4RVTA 4TY1A 5ACBC 3D5UA 3H9FA 5K0KA 3VUHA 3R2BA 3UVQA 5EM5A 2VTAA 4FV8A 5KHXA 4YSMA 3Q9WA 4FV9A 4E4LA 1PF8A 3P9JA 3L8XA 2XNMA 5AUVA 1JSTA 3TDVA 4EJNA 2UW9A 2PULA 4EH4A 3PDTA 3FZTA 2YZLA 5J1WA 3O0GA 3BYVA 4MTAA 4FOCA 3LM5A 4M3QA 2VWBA 2OXDA 3ZBXA 5KZIA 3LCTA 5DH3A 1MQBA 4USDA 4FA2A 1YI6A 5DI1A 1FMKA 4P90A 4UXQA 1AQ1A 4TTHB 2Y7JA 1Y8YA 2ZDTA 4DTAA 1GZOA 4J8MA 3AC5A 2XK7A 3BU5A 3MIAA 4C3PA 2OIQA 2I0EA 1Z57A 2J2IB 3OUKA 4C8BA 3LMHA 3TDWA 1Q97A 3VS1A 1Q8YA 2XIXA 1P5EA 2B54A 3KA0A 3KRXA 5H8BA 3UBDA 3ZUTA 5IQBA 4IVCA 3A99A 4IC7A 4ANLA 3O7LB 2C0TA 5FD2A 4RWLA 4UZDA 5JGDA 1RQQA 3NCGA 4S34A 3UIXA 4OAUC 3ZXZA 3LXKA 5DIAA 5FLFA 3QGYA 3N9XA 4J52A 4OTIA 2IJMA 3BLRA 3DBEA 4FKIA 4AZFA 4DTKA 3MFTA 4D5HA 2WIHA 4BICA 3D5XA 2W0JA 3PRFA 4Y5HA 3W2CA 3OT3A 5CU3A 4EUUA 1ZYDA 4P5ZA 4L00A 3TT0A 4DEIA 3LFCA 4CXAA 5C03A 3T3UA 4AN3A 3PA5A 5BVDA 2OH4A 2ZB1A 4FNWA 5F94A 2VWWA 1Q5KA 4YBJA 4C4GA 5EKNA 3NW7A 3A7GA 3GVUA 4CV8A 4U45A 2XH5A 4LUDA 2JBPA 4LGDA 3UG2A 3P1AA 2O0UA 1U5QA 4K2RA 3CQUA 2VTTA 2EB2A 4AA5A 1J7UA 5JGBA 3GGFA 2B52A 4KIQA 3Q96A 2KTYA 5F95A 3TIZA 5BUIA 1ERKA 4FEVA 4BL1A 5E8YA 3QLGA 2WMQA 1R39A 2BILB 2W1ZA 4HVDA 3NIZA 3ZOSA 2YIXA 3DTWA 4G6OA 3D9VA 3U54A 3R71A 5BYZA 1JKLA 4BWKA 4BWPA 4D5KA 1HOWA 5J9LA 4AGUA 4UWYA 4L68A 2OGVA 5FBOA 1B6CB 2V7AA 5CXHA 2YERA 3RPYA 4XYFA 4NYEA 3PPJA 4I0RA 3RCDA 4CTBA 4EHGA 3MFRA 2GNFA 1HCLA 2F2CB 2ITTA 5EDQA 1ZMWA 3L9LA 4ZEGA 3TV7A 3VBXA 5KBQA 3V01A 5L6OA 2C30A 4S31A 5CZHA 3R7YA 3VWAA 3MY5A 3GU7A 3OROA 3QKKA 4M12A 4GK4A 2VX1A 5CAVA 2J0LA 5BMMA 3F5XA 2E9UA 4OTGA 5CF8A 2WU6A 4IZAA 5KMIA 1ZRZA 5C8MA 4DTBA 1TQIA 3FUPA 3QQKA 1FINA 3KU2A 1PMNA 3E8DA 3G9LX 3LFBA 4APCA 2QURA 5CANA 4I24A 2BZKB 1Q62A 4HVHA 3NNXA 3UIBA 2Y6MA 1JSUA 3HVCA 4S32A 2P4IA 3ZH8A 1KE8A 4A06A 1E9HA 2CGVA 2O2UA 2XUUA 4GUBA 2ZV9A 4ALWA 3MY0A 4ITJA 5AR4A 5AV4A 3M42A 2W1CA 4E6DA 4A4XA 1OITA 3MWUA 4L7SA 1URCA 3MW1A 3UE4A 5HGIA 3VNTA 4BYJA 4W9WA 4PL3A 4EORA 5CEKA 3VC4A 4ANNA 2OK1A 4IVBA 4PUZA 3IW8A 3FLQA 5B2KA 2HELA 3KVWA 4V0GA 4XLVA 3RAHA 4YMJA 3SDJA 2PUPA 2WZJA 3PJ2A 3QC9A 2FSMX 3CGFA 4CLIA 2RL5A 1RW8A 4DFZE 4DN5A 2PE0A 3DFCB 4KBCA 4F1OA 2UZUE 5B7VA 3BU3A 4TRLA 3ZCLA 2BAJA 2NRYA 3PG3A 5D41A 3ALOA 3ZFXA 4HCTA 4N4SA 2BROA 3MY1A 4F63A 5KBRA 3VS0A 2OI4X 5KE0A 3UQFA 3ZO2A 3MA3A 3BKBA 4O38A 1OBDA 3IQ7A 2C5XA 3B2WA 3A61A 3AD4A 4ZTNA 3VIDA 4C4JA 4KKGA 4QYGA 4Y8DA 5IA2A 2A2AA 4FZ7A 4MQ2A 4LUEA 4RC4A 4YTIA 5G6VA 2QODA 4F09A 3VF8A 3F3UA 1OI9A 3QCYA 2W06A 4BCMA 4QQ5A 2YFXA 4L45A 4HYHA 1DAYA 4MAOA 3UO4A 3U6HA 4GKHA 3HRCA 4WIHA 3NR9A 4PMMA 3MI9A 5AADA 4O0YA 1KE5A 3R7VA 4WSQA 1H28A 2W1FA 4N6ZA 4ASEA 3R22A 4BDJA 4IX4A 3UYSA 4O7VA 1OGUA 1FQ1B 4CFXA 5BVFA 2UVYA 2YM5A 4WRGA 2CNUA 3GNIB 3PPKA 4YJPA 3BWFA 4C61A 4IW0A 3HECA 2BUJA 1ZYSA 3KN6A 4KRCA 4ZXTA 5ETAA 3WZDA 1PKDA 2QG5A 4NSTA 2JBOA 3E8EA 4O96A 1YHVA 3LW0A 5DLSA 5H2UA 4F9AA 1JKTA 3F2AA 4K6ZA 2FUMA 2AC5A 4ZS4A 5ANEA 4WO5A 3QU0A 3Q9XA 4GKIA 1M7NA 3OWPA 2WMVA 4JBQA 2QOIA 5LMAA 1G3NA 4NM5A 5JSMA 3Q5IA 5IUHA 3ORXA 1H1WA 5AP3A 3KXNA 1QCFA 5IG1A 3OVVA 5DGZA 3PWYA 3RAIA 3QTQA 4RIWA 3SW4A 3OXIA 4MNFA 4B8LA 3T8OA 4O27B 4OTQA 2CGUA 2QOBA 2W1HA 3O23A 3PY3A 4PTEA 5CSXA 3RM6A 4M69A 3CXWA 2R3HA 5AR7A 5M4FA 1OL1A 1FBNA 2VTHA 3EL8A 4F7JA 3K3JA 2UZVA 4R3CA 5EDPA 2XRUA 3BU6A 2AUHA 5FDPA 4BZOA 3VBWA 3GCSA 4LI5A 5AUWA 1Y57A 4FV2A 4I93A 2OO8X 3OMVA 3HRFA 4Y72A 1OPKA 3KGAA 3C50A 2WU7A 1WCCA 5AUUA 4O7YA 4IMYA 3Q04A 1OIYA 1NT2A 2R3PA 1IG1A 2F49A 4RG0A 2WTVA 3H9RA 4U6RA 4ZLOA 4QP3A 4NJDA 1PMVA 5DG5A 3OOMA 3ULIA 3RPVA 3TACA 1PXOA 4CQGA 4UY9A 2X2LA 4GEOA 3ZEWA 2ZDUA 3BBTB 4AW5A 2H6DA 4QTDA 3F2RA 4MF1A 2QOKA 3E7OA 4MQ1A 1ZOGA 2A0CX 2YIRA 2HOGA 3QZIA 5E7RA 3PP0A 1YWVA 4QQJA 2FSLX 4DYMA 4EH6A 3G2FA 4QRCA 5A4LA 3VHEA 3FZPA 1CKIA 5AM6A 3RNIA 2VTRA 4XX9A 3TI1A 3OG7A 2CKOA 4I5MA 5T3QA 3ZLSA 3W2OA 4AA4A 4QMLA 4EQMA 2V5QA 3NNUA 3QQGA 4IDTA 4TN6A 3BIZA 4IAFA 5HIDA 3A7IA 4IVAA 3QZFA 4U43A 4EK3A 2HK5A 2V7OA 4KSQA 4PV0A 3CTJA 3DY7A 3CE3A 3EZVA 3OY1A 3ZBFA 4JAJA 1Q41A 4BCOA 3GXLA 3QXOA 4FV1A 5J8IA 4H1JA 1WVYA 4G16A 4IJPA 3RPSA 4EH3A 5M4UA 1K3AA 4GYIA 1OL6A 2X4FA 3C5IA 1WBPA 2CCHA 3EYHA 3MV5A 4YJVA 3OCBA 5HTCA 4FICA 5LVPA 5FBNC 2I6LA 3MPMA 3PJ3A 2QKWB 5AV3A 1YKRA 2R3NA 3E92A 5HO6A 2WQMA 4KBKA 5AP7A 1LEZA 1Z9XA 5IMXA 5T6KA 4GJ3A 2O8YA 4RIYB 5M56A 2RG6A 4DEGA 3QUEA 3ZO4A 2GSFA 1PMUA 1Y6BA 4EHZA 3W18A 3E64A 4XV2A 5D1JA 3KMWA 5IQIA 3HKOA 4IACA 2C3IB 3KF4A 5F1ZA 1OZ1A 4DFLA 5E91A 1OPJA 3F82A 4JQEA 3FI8A 3Q2MA 4FSNA 4FUYA 4LV5A 3VUMA 3G9NA 3LZBA 4JDKA 4YZDA 3EQRA 5TE0A 3MTLA 3LFDA 2QI8A 2ETKA 2YCSA 3QTIA 4BGQA 3POZA 2C47A 2EXEA 5TR6A 2C1AA 3PZEA 4QMXA 4AE9A 5CY3A 4R5YA 3T3VA 2Z7QA 4QMQA 1F5QA 3PA3A 1G5SA 2ERKA 3PXQA 2GCDA 4QMSA 3UO6A 3HLLA 3FYKX 5HG7A 2OG8A 5J9ZA 4QTBA 4YZ9A 4C37A 4ZLZA 4EQUA 1XH6A 5IQCA 4JXFA 4QT1A 3TTIA 4D2WA 4R7HA 4HGLA 2OF4A 4FKVA 4QMOA 5F4NA 1KWPA 3G51A 4Q5EA 5IUIA 5KZ0A 3HV3A 2ONLC 1YW2A 5HCXA 5HHWA 3GC0A 2ESMA 2QOFA 4ANMA 3UOHA 4EWQA 5CF5A 4ZK5A 3Q60A 3Q52A 1BI7A 4BTKA 4FTMA 4YNEA 3P7CA 5AV0A 4DG0E 4E5BA 3PXZA 2XF0A 4FT0A 3CR0A 2W1GA 3PSCA 1BL7A 4PMPA 5CU2A 4C4EA 3NX8A 3VVHA 2FB8A 3VF9A 2X39A 5CVGA 4QP1A 2OFVA 3BBWA 3BLQA 3MYGA 5IA1A 2Y4IC 5IA5A 1ZYLA 3R9OA 3R04A 2G9XA 4NL0A 1UKHA 4XG9A 3HL7A 3HZTA 3O96A 3PXFA 3U51A 3ZZWA 4OBPA 3K2LA 5IF1A 4F6SA 4I5PA 4M8TA 4A9YA 4EOMA 1F0QA 2O63A 3BHHA 2GHLA 4X2NA 5I3OA 3I6WA 4QO9A 3E3BX 5HE3A 2X81A 3GC7A 4GFGA 5LCJA 4AFJA 2JFLA 2R0UA 4DCEA 3KREA 4OW8A 1XH5A 2XS0A 3W2QA 2FO0A 4FTRA 3LXNA 5HLPA 5HD7A 4FIJA 3JS2A 4WG3A 4IFCA 1PMEA 3UNZA 3WYXA 4BTMA 4F6UA 3ID6C 3VBVA 2JEDA 1ZAOA 5CZIA 3NW6A 2C6IA 3IGOA 5DVRA 4AACA 4J1RA 3QX4A 4GH2A 3FXXA 4R1VA 5HKMA 2X4ZA 2VZ6A 4EUTA 4E5WA 5ETIA 2QR8A 3G6HA 3GOPA 1GZNA 3W2RA 2YABA 4R7IA 2G2HA 3ORPA 4CCBA 3MVLA 5FEQA 2CGWA 5C9CA 3NNWA 3REPA 3C1XA 2BZIB 4E7WA 4BBFA 4ERKA 2HIWA 5FEDA 3QQFA 3I7BA 3Q2JA 4DCAA 2IVUA 3FLSA 3KK9A 4WNOA 3QCXA 2WAJA 4H58A 1P14A 3B8QA 5TKDA 4DGMA 3E8CA 4DINA 2VO0A 3OBGA 4MCVA 4GK2A 5L4QA 4GW8A 3IW4A 4M15A 2LAVA 3TWJA 3F6XA 4XS2A 3ZTXA 4RJ3A 5E8ZA 1S9JA 3R7GA 1LUFA 4FG9A 3KF7A 3IK3A 3R7EA 4RQVA 3R7OA 1BI8A 3SRVB 3CTQA 4A9TA 4YUQA 1H24A 5CLPA 4AN9A 4XLIA 4XV3A 4O21A 4E5AX 3AD5A 4CFNA 2F7XE 2J5FA 4J71A 1B39A 2P0CA 5JFVA 4RMZA 1QMZA 3FZRA 4XP3A 4BIEA 4JT3A 3FE3A 2C5OA 2HYYA 3RBWA 2XP2A 5M09A 4QQTA 2VTIA 3EKNA 5HE1A 2JDOA 4Z16A 1LEWA 2ITUA 4BDHA 2BRBA 3LE6A 3LMIA 2QO2A 4QMNA 4CNHA 2XZSA 3FLWA 4RVLA 5AP6A 3VBQA 2B0QA 5JFWA 4EOJA 5FEEA 2C3JA 5IQEA 5ANDA 4DEBA 2WTDA 5LOHA 4J7BA 4MHAA 3ZM4A 2YDKA 4IE9A 1Q61A 3NUSA 3BV3A 4RA4A 3QRTA 4NKSA 4RZVA 4WNMA 5CENA 3WARA 4ANBA 2VD5A 2CNVA 4YZMA 4XG6A 2ZB0A 3V5QA 4O1OA 1PXPA 1W0XC 4YURA 3ODYX 5DEWA 2QC6A 2XJ0A 4OGRA 4JR3A 4FTQA 4WUAA 3EFKA 4JIKA 5IA0A 4AT5A 1XWSA 1MP8A 3PXRA 4XHKB 2ZM3A 1M2PA 2YIWA 4DFBA 2PE2A 4BCHA 3H9OA 2QHMA 3K3IA 5CEOA 4BKYA 4FVQA 1OPLA 1YOJA 3PYYA 1ZY5A 3NUUA 4NM3A 3ZSHA 3CIKA 1U54B 1ZMUA 2BTRA 3L9PA 3WIGA 3DOGA 1W82A 2JC6A 3LIJA 3V6SA 4UZHA 4FNZA 3R0TA 2BFXA 3HV5A 3RAKA 2QLQA 3ZLXA 1UWJA 1KOBA 2E9OA 2PUIA 5DYJA 5KMNA 3BYSA 3KEXA 4R1YA 2WEVA 1OKYA 3H3CA 4FTCA 4ZJVA 2VWIA 3NUXA 3AGLA 4NUSA 2WMRA 4BHZA 4ZOGA 3SX9A 3KMUA 5BPYA 1GOLA 2X2MA 3D7TB 4NWMA 1IR3A 5IEXA 4F4PA 3NRMA 2X7OA 4ENXA 3BE2A 3ORLA 1KV2A 2XKFA 4KA3A 4EEVA 4YZCA 4IBMA 2F2UA 3FMLA 3U4WA 4GT5A 4DEHA 3CLYA 3KXHA 3CS9A 4CFFA 4CMOA 2V62A 4L52A 4XG3A 5DWRA 2Y9QA 3QQJA 3ENMA 5ANOA 4JL9A 3OP5A 4DEAA 3NEWA 1VYZA 2BHHA 2XNOA 3ORKA 4UYAA 5J5TA 4JS8A 2IW9A 3MESA 4C59A 4HYSA 5K4JA 1PKGA 3B2TA 3R1SA 4RIYA 4C0TA 1S9IA 4G3GA 1HCKA 3G33A 2JAVA 5E8UA 2YAKA 4YO4A 4MXYA 5L6WL 3TEIA 3VAPA 3G0FA 3DBFA 4D28A 1BX6A 3Q32A 3TNHA 3FPQA 4BDCA 1YQJA 3SOAA 4IB0A 4EK8A 3R02A 2EVAA 4YJOA 5C4KA 4ZY4A 5IQDA 2YM4A 3F69A 5K3YA 3TN8A 3TZMA 1REKA 4E6AA 5M4IA 3E88A 5GJGA 5DRBA 4UBAA 2OW3A 4ZSJA 5C27A 3TZ7A 2RF9A 3DLSA 5GJFA 1QPJA 5AUXA 3PA4A 3A2CA 2XK9A 3R73A 4XMOA 5E8XA 4CZUA 4LRKA 2QOQA 3E5AA 2CKQA 3FMKA 2ITZA 5M07A 2YISA 4IXPA 4QTAA 3DPKA 3VS5A 4IB5A 5J87A 1X8BA 4O2PA 2Z8CA 3QL8A 4O7WA 5EW9A 4XP2A 4YLKA 4R3RA 2C6MA 2JKKA 5IDNA 2BIKB 2OWBA 5J5SA 4JG6A 4D2RA 4I5CA 4ZSEA 2BZHB 2XRWA 4QNYA 4ANQA 3EB0A 4I6FA 1VZOA 2GQGA 2W99B 3KXMA 5DE2A 3CTHA 3O51A 3TNIA 4AT3A 2HWPA 5GZ8A 4FTJA 4F9YA 3Q4TA 4GL9A 3F61A 5LMBA 3QRUA 1ZYJA 2JDRA 4K11A 4E6QA 1PXJA 3PXKA 4R5SA 4RIOA 3LJ1A 3UZTA 4FSZA 4G3CA 3II5A 4KS8A 4LV8A 3KB7A 3JPVA 1RDQE 3RHKA 3E87A 3FSKA 3P08A 4A9UA 4EH2A 4FGRA 5A9UA 4IB1A 4QOXA 5KMKA 2VWXA 1U4DA 4BCPA 3PTGA 4IAYA 2G2FA 2XVDA 4CFUA 5HU9A 2Z7LA 1Q3WA 2F4JA 4DAWA 5BVEA 4D1SA 4HCUA 4DLIA 2XIRA 2W1EA 4LL5A 1OECA 2YACA 2ZV2A 1H00A 3OXTA 5EM8A 4OR5A 3C0GA 3KVXA 3PP1A 5IA4A 3HRBA 4Z55A 5GJDA 5HLWA 2XNNA 3F5UA 3WE8A 2VV9A 5EK7A 4W8EA 4NW5A 4FIEA 2CJMA 2E9PA 5C26A 4X7QA 2ZV8A 2GQSA 3OTUA 2UVZA 3MB6A 4FTUA 5LCKA 5EQYA 3PLSA 3PVUA 2QOLA 3DQWA 3QD3A 1H1QA 2WXVA 3PY1A 5KO1A 4EKKA 4FVPA 4HGSA 3CC6A 4Y85A 4R7BA 4NJ3A 2BRHA 2ITOA 4ZSLA 4TL0A 3CJGA 2F57A 1JLUE 3HV4A 3UIUA 1GIJA 2W4JA 3KRRA 3DZOA 2IPXA 4QNAA 1TQMA 3EZRA 2WMTA 3CY3A 3FAAA 3FC1X 5I9VA 3KCFA 2BRGA 5A4QA 4KINA 2PVFA 4FSUA 2QO9A 3N4VA 1OIQA 4U0IA 3ORTA 4BGHA 3GU5A 3ORNA 3R1NA 3KK8A 4TYHB 5CS6A 4F7NA 2XIZA 4UEUA 5EHLA 4Y83A 5LJJA 4QP2A 3ATSA 3RPRA 4JI9A 3MGYA 2YWVA 1JVPP 5ETFA 4R3PA 4FX3A 4MNEA 4D2PA 3NUNA 2QR7A 2G2IA 4EOLA 1KE7A 5HX6A 2R3RA 3AOXA 1H07A 1CSNA 3M11A 4XBRA 1BYGA 3D5VA 4Q5HA 4FKRA 2CLQA 3SRVA 3U9NA 4TWPA 4ASDA 2BCJA 4G5PA 3IDCA 3BYOA 3FHIA 3LMGA 2WEIA 4WOVA 4YLLA 4FTTA 4X3FB 3BHTA 3TKUA 3TM0A 2Z60A 4RA5A 2JKMA 3I7CA 5L8JA 4D1ZA 2WTIA 4I41A 2OF2A 4EOOA 3LPBA 4D55A 2B53A 2UW5A 1B38A 4AG8A 4BDDA 4UMPA 3HV6A 4JR7A 3E93A 3MB7A 3O7LD 3WZJA 4DGNA 3WYYA 3R1YA 3JVSA 4II5A 4EYMA 1PYEA 2W5AA 3VRYA 4FYOA 2QCSA 4ENYA 2XK3A 4YJTA 2CN5A 1VEBA 3CY2A 1SNUA 3QZHA 5H9BA 3D14A 3SKCA 4C2VA 2IZRA 4NIFB 4H05A 2HZ0A 4M0YA 3TTJA 4XOYA 3C7QA 3QFVA 5H3QA 3RWPA 1KOAA 4FKJA 4O0UA 2JIVA 4XJ0A 3LCKA 1QL6A 3QD2B 4LG4A 5AM7A 5HCZA 3ZRMA 2OZOA 2IVVA 4J95A 4TNDA 1DI8A 1WZYA 4IWDA 2W96B 3F5PA 2JLDA 4EBWA 3DXPA 2VTSA 4IAIA 4XH6A 4NK9A 5EYMA 2VTLA 3TJDA 3M1SA 4RPVA 4BF2A 2X9FA 3ITZA 4DGLC 4G1WA 2YN8A 4F7SA 4X2KA 4QP9A 4BI1A 1YXSA 3E8NA 3COHA 2YM3A 3OUNB 4U42A 3OZ6A 4KABA 4FGBA 5GNKA 2I0HA 1M52A 2H9VA 3WF9A 2Q83A 4FR4A 2ZV7A 1U54A 2GDOA 4TPTA 4CGAA 3LOKA 1FGKA 4Z7HA 1M2RA 3C4EA 5HE2A 5K4IA 3R7UA 3V8WA 4CEGA 4EJ7A 2GFCA 1ZZ2A 2PZPA 3S2PA 2VGOA 5CU4A 5FTGA 3PFQA 4FT9A 4ZZMA 3QRJA 3UTOA 2IZUA 4AN2A 4G6NA 4C36A 3F3ZA 1R1WA 4FVRA 3D7TA 3LFEA 4U9AA 3G0EA 2HWOA 3QC4A 3EQFA 1ZARA 3NPCA 4O2ZA 4MK0A 4UXLA 4FKLA 4ALUA 2BZJA 2UVXA 3GC8A 5TF9A 2R3MA 1UNGA 3AGMA 2B4SB 3S00A 2GHMA 3TUDA 3FLYA 3PIZA 3PY0A 5FXQA 5DRDA 4D4RA 1ZY4A 2VRXA 4TWOA 5AIRA 3ENHA 4FT3A 4E4XA 4YJUA 3F5GA 2Z2WA 1STCE 3ORMA 3KRWA
chains in the Genus database with same CATH superfamily
4HYUA 2XYUA 4LOPA 4JJRA 5AAFA 4L01A 4KS7A 4FG7A 2XK6A 4O4FA 5L2QA 2C0OA 1W84A 5DR9A 3BCEA 1GAGA 4NFMA 3DJ5A 3GFWA 3QYZA 2RFDA 3GOKA 2JIIA 3HMIA 3ACJA 3FMHA 3KQ7A 2OH0E 5E92A 5CEMA 2GQRA 4JBOA 1BKXA 2XANA 2WB8A 3PLAE 3C51A 4GT3A 4A4LA 4DC2A 4AZEA 5A4TA 5E8SA 4DF3A 4DT8A 5DPVA 3B8RA 5G1XA 5TOZA 4F9CA 4NCTA 1G8JA 4DHFA 4B9DA 4G3EA 3H30A 5AP2A 2LGCA 3PWDA 5D7AA 5FM3A 4CQEA 2VX3A 4FK3A 1ZYCA 2CN8A 4CT2A 4USEA 4YR8A 4ZSAA 5EQEA 3EQGA 3F88A 4JOAA 2RFEA 5CX9A 3TUCA 4H39A 3RPOA 3WF5A 3DK3A 4J98A 1T45A 3IW5A 5CI7A 3DFAA 4NTTA 3BEGA 4ZTSA 5HO8A 4D2SA 2UW3A 4FKTA 5TT7A 2EXMA 4GFOA 4XV9A 2BDJA 2OJJA 3L8PA 4G9CA 2R3QA 3D0EA 3DDQA 3ULZA 4EHEA 5KKRB 3LXPA 4QD6A 1XH4A 2A27A 3VUTA 4QTCA 5IEYA 3R2YA 5HNIX 1PRYA 3DK7A 3TKIA 1K2PA 3DV3A 4UB7A 3F7WA 4BDFA 3W0QA 3HP5A 3NYXA 1IAHA 1BLXA 4ANOA 1H1RA 5E9EA 3ETAA 3P7BA 5HESA 5HVYA 2BR1A 4TYJA 1W7HA 4WSYA 4BR3A 3QHWA 4PQNA 3ORIA 3KXGA 5FDXA 3SA0A 5CXZA 4CVAA 2VTJA 1XHAA 3A62A 2GS2A 3BHYA 4O7SA 1PXIA 1GNGA 2PMNX 4FYNA 4R8QA 4F0GA 3ZLYA 4BHNA 4RJ8A 3RMFA 2VO7A 4PTCA 4IANA 2C3LA 2WIPA 1Q8ZA 3CSVA 2VNWA 3NIEA 4ERWA 3FMEA 4YTFA 2C4GA 2C6DA 2XJ1A 3OCSA 3Q4CA 4IM0A 4U80A 4X6QC 4G9RA 4C62A 5IH4A 2CDZA 3KXZA 2WO6A 4XRJA 2I1MA 3A4PA 4TKSA 2R5TA 1SYKA 2HW7A 4OT5A 3DA6A 1XBAA 2J50A 2JIUA 3QYWA 5HD4A 4FIIA 3TKHA 2W17A 4YJRA 3QZGA 5HU3A 3L9MA 3P5KA 3I0QA 4LMUA 4EOIA 3EWHA 4KNBA 1Y6AA 3W8LA 4M66A 2XM8A 4FTOA 2JITA 2B9JA 4U40A 4TWNA 5DEYA 2OXXA 4J97A 3QAME 4JG7A 2WTKB 4HPUE 4EH7A 5A6NA 5J7HA 5CU0A 1PXMA 3EL7A 4QPAA 2QO7A 4ZJIA 3D7ZA 2OSCA 4HPTE 4DGGA 2Z02A 1ND4A 4L3JA 2R4BA 3C4FA 4FKGA 3BGQA 2NO3A 3P0MA 4YHFA 4LDTA 4OBQA 4CFMA 3BZ3A 2WHBA 3QHRA 1YXXA 3OWJA 4WBBB 2XYNA 2JKOA 2CPKE 4FV0A 4BDBA 3IOKA 4UV0A 3V51A 5HORA 5A4EA 4EOPA 3VUKA 4ORKA 5DR6A 2FSTX 2WQOA 4W4WA 4CSVA 4DFXE 4FKWA 3UDSA 2PY3A 4XOZA 4O86A 4L3LA 1WBOA 3DGKA 2CMWA 4PDSA 2BVAA 4MF0A 3H0YA 3BHVA 4UMTA 1FVRA 1V0OA 4K1BA 4MKCA 5DOSA 5EYDA 3ZYAA 4UX9A 2UW4A 3WBLA 2IN6A 2GHGA 3LKMA 4TYHA 4MD8E 2XJ2A 4IWOA 2EU9A 1U59A 4UWBA 3UPXA 4BFMA 4DT9A 4FT5A 4MXOA 3EIDA 5AR5A 5AUZA 2W9FB 4EOQA 3P4KA 3WE4A 3LQ5A 3QX2A 4PWNA 2B9HA 2OJ9A 5E8TA 3UZRA 2H34A 5GZ9A 5KHWA 3NUYA 4FL3A 5CSVA 2P2IA 1OIUA 4KKEA 2RIOA 1SVHA 3F7ZA 1YRPA 3N51A 4IHPA 3UNKA 3OFMA 5B2MA 3S0OA 2R7BA 3FMNA 3EMGA 3PZHA 2PZYA 3UOLA 4DBNA 3LHJA 1OB3A 2W9ZB 4TWCA 4FKQA 4X3FA 3WZEA 4FT7A 2H8HA 3I79A 3U6JA 3ROCA 3ZS5A 4ACCA 4JDHA 5B0XA 4PPBA 2P55A 4C3RA 5AUYA 1J91A 2BTSA 2OKRA 2XEYA 4FEWA 1JBPE 2QOOA 2R3JA 4BTFA 3H0ZA 1W98A 1XH9A 2CHLA 3CP9A 3LLTA 3MFSA 4L42A 2BPMA 3PG1A 4V04A 3C4CA 4X0MA 3S95A 5K5NA 3AC2A 2WTCA 3FXWA 4O7LA 4NIFA 2YM8A 4RWKA 4RLKA 4QMMA 2C69A 2YLFA 3SXRA 3BRBA 1LPUA 2YJSA 2WELA 4ZY6A 4IZYA 4ASZA 1JSVA 3EHAA 3OXZA 4I23A 4WHZA 1IASA 2IZSA 2PK9A 2QD9A 2PWLA 4OTRA 1ZLTA 2X8DA 2ZMDA 4DH8A 2VNYA 3QLFA 4B6LA 1JNKA 3EN7A 4ZTLA 3L1SA 3IOPA 4H36A 1H0WA 3ODZX 4PP9A 5D12A 2QU6A 1FVTA 4GYGA 2RGPA 3F66A 3IG7A 4A7CA 2IF8A 3QCSA 1J1BA 5I9ZA 3HAVA 1WVXA 4V05A 4L3PA 1XO2B 2C3KA 3FYJX 3CEKA 4ZTRA 2Y6OA 5I9WA 3O50A 5IMEA 3MFUA 1R3CA 4U79A 4ASXA 5HTBA 5CEPA 3RINA 3WOWA 4K0YA 2CCIA 2XK8A 3ANRA 3F9NA 4WA9A 5A3XA 3ZDIA 4HVGA 3R9NA 5L6PA 3CQWA 3ZFMA 3LQ8A 1XH7A 1GJOA 3MTFA 2UZLA 2WD1A 3WZUA 1RE8A 3VW6A 3Q6UA 3FMJA 3QWKA 3BHUA 4P4CA 1OUKA 3P86A 3PUPA 4UWCA 1LR4A 2PE1A 4X2GA 4LGGA 4QMYA 3W8QA 2VWUA 1ST0A 5IUGA 5GIPE 2B9IA 5A14A 2AEGA 3AKKA 1K9AA 3DKFA 3R28A 3UJGA 5BYLA 1CDKA 4GT4A 3W16A 3N4UA 2YJRA 4CYIA 4DH5A 3GFEA 1ZMVA 4KB8A 3NS9A 2QHNA 4IVDA 2V55A 3CJFA 3OWLA 5E8WA 3RJCA 3PUFC 5HBEA 3TV6A 3I0OA 2UW8A 4E6CA 2O65A 4HVIA 4X3JA 3TJCA 4QMPA 2J90A 5CVFA 2VN9A 3POOA 4AW1A 3K54A 4J53A 4IFGA 3SXSA 4A07A 3RK9A 4FKPA 4YJQA 2VTMA 2UZNA 3V5WA 2R3OA 3GC9A 4FG8A 4NM7A 4AZSA 3FKOA 5JFSA 4AGDA 4O4BB 2HXQA 3QQLA 3BYUA 4L53A 1OMWA 3GI3A 4G34A 4C57A 2FYSA 1H1PA 1OIRA 2HY81 4ARKA 2XALA 4F78A 4FIGA 4HGTA 5KMMA 2DWBA 1KV1A 2YM7A 1BL6A 2YEXA 3RWQA 5B2LA 3ATTA 4PP7A 4UMUA 4DEEA 1P4OA 1Q8WA 2ZM1A 3I6UA 3SHEA 3O17A 3U4UA 2VX0A 4FEQA 2ZM4A 4ID7A 2J5EA 5LWMA 3V5JA 1L3RE 5AP1A 4BCJA 5E1SA 2C6EA 5CAPA 4EHVA 5LXMA 4AZTA 3M2WA 3OCTA 4H3QA 1JAMA 2C5VA 4QYFA 4ZP5A 3HMOA 3KN5A 4E26A 4BZNA 2BKKA 4FI1A 5ANJA 3SLSA 4K8AA 4CYJA 4Z7GA 2W4OA 3A7FA 4TW9A 4HZRA 3HDNA 3MH3A 2REIA 1YI4A 3QRKA 3DBDA 4RQKA 4FL1A 4IM2A 3EOCA 3IDBA 3L8VA 5LQFA 3FHRA 3GUBA 3GCPA 2R3FA 2VTPA 3BX5A 3LFFA 4HCVA 4KRDA 1XBCA 4RLLA 2CKPA 1YOMA 3RZFA 1ZXEA 3TIYA 3EQHA 3WF6A 1PYXA 2OXYA 3UG1A 3ZM9A 1IA9A 3OWKA 3W10A 4L6QA 5EH0A 3AT3A 3SW7A 4FIFA 4Q9SA 4AGWA 2C68A 2WNTA 2X9EA 3VS2A 5FXRA 4RT7A 3ZC6A 4D1XA 2PUNA 3PVGA 3V8SA 4IEBA 5DR2A 5CNOA 2RFSA 4C33A 4JX3A 5A54A 1YXTA 4JQ7A 5EI6A 4BCGA 4DG3E 4L43A 5AP0A 5IQGA 3GCQA 3QD0A 4LOOA 4U5JA 4S2ZA 3QCQA 4DEDA 3Q5ZA 4AXDA 3I5NA 5IISA 2JKQA 2R9SA 5I9YA 3COIA 1M2QA 5KCVA 1TQPA 5C8NA 4FRFA 3UC3A 1IA8A 3TMOA 3UMWA 5H8GA 2R7IA 5T68A 2WTJA 3AMBA 3RK5A 4B0GA 1XQZA 5IQFA 4Y5QA 2QKRA 1F3MC 3E62A 2Q0NA 4QYEA 5FWKK 5JH6A 3MH0A 4FZDB 4K77A 3D15A 4AF3A 5AV1A 1V0BA 3HX4A 2YDJA 1NXKA 4Q2AA 3GBZA 1WBVA 3FV8A 3C5UA 3FKLA 3FKNA 3NUPA 3HDMA 3FLZA 4NZWB 3NSZA 2B55A 4BB4A 3ANQA 5L2IA 5FP5A 4FV5A 3E7VA 4AU8A 2OU7A 5M44A 5M08A 5CF6A 4BDKA 3PVWA 3TV4A 3DAKA 1XKKA 2QG7A 4PMTA 3UZPA 4C4FA 4DH1A 5EKOA 3JR1A 4F6WA 3EQCA 3SGCA 4KBAA 2ACXA 4IWPA 3HMPA 4FK6A 3QGWA 3SC1A 5HVKA 5HZNA 2DYLA 3HMMA 5IDPA 4DA5A 4S33A 3VBYA 4BDIA 2XIYA 5LMKA 2BFYA 3ZU7A 3F3WA 1O6LA 3EKKA 2PUUA 3GU4A 4WG4A 3UNJA 1PY5A 1UKIA 4U97A 3WI6A 4CLJA 4EZ5A 4F70A 4FTNA 3ZC5A 4KUJA 3QKMA 3SXFA 2OJIA 3SOCA 5M06A 3ERKA 2X0GA 4I20A 3IGGA 4FTLA 2W7XA 3LVPA 4ZLYA 2YDIA 4RWIA 4D58A 1V0PA 3COMA 3OW3A 4U3YA 3RKBA 5D9HA 5KMLA 1L8TA 5IQHA 3NVMB 4TNBA 4A9SA 5J9YA 2HW6A 3HNGA 3JY9A 3R30A 5AA8A 4KWPA 3RI1A 2JFMA 2PMLX 1V1KA 4IWQA 1LP4A 2E2BA 4RWJA 4PMSA 3FXZA 4C58A 3SD0A 1XMLA 4NFNA 5ANKA 3ZZEA 4BCNA 4JX7A 3IECA 4C35A 5J1VA 4EZ7A 3MS9A 2VGPA 4O1PA 3DAJA 2QU5A 1IRKA 3CQEA 3EN4A 2OJFE 4GFMA 3FI2A 5HE0A 2C6TA 4RFYA 3Q4ZA 1A48A 4FSWA 3DTCA 5J7BA 3MJ2A 4O6LA 3GQLA 3CBLA 3W55A 3U9CA 2DUVA 1H1SA 2F9GA 4AFEA 4QMWA 2E9VA 3SG8A 5CU6A 4XRLA 2C1BA 4N70A 4HJOA 4O81A 2YIYA 3PPZA 5HI2A 3JY0A 5EYCA 4RJ4A 3PE1A 3COKA 5ETCA 4AW0A 5I9UA 4F1TA 4YNOA 4RC3A 4ZAUA 5LVMA 3C13A 5DBXA 5BMSA 4O7ZA 5JGAA 3DB6A 2A4LA 4G6LA 5E8VA 3NYNA 4C4HA 4L8MA 3RHXA 1UWHA 3UO5A 3ALNA 4KAOA 4XBUA 2YIQA 4AQCA 1NVSA 1W2FA 4QMTA 3PSDA 5JMSA 3U6IA 5AFVA 1MRVA 4FZ6A 5DNRA 3G90X 4JBPA 2CLXA 4GV1A 4IADA 4R6VA 3VS3A 3TUBA 4FSMA 2ZAZA 5IEVA 3PRIA 4DBXA 2O3PA 4I3ZA 5K9IA 2XB7A 4O0VA 1UVRA 4OBOA 1MUOA 5FG8A 3C4WA 2UUEA 5BQ0A 2XKEA 2R3KA 1O6YA 3UIMA 4B7TA 4CKRA 2X8IA 1ZWSA 1WAKA 3WF8A 4BI0A 4O84A 4ITHA 3QF9A 4Z3VA 3OTVA 2BMCA 1SVGA 4R78A 2OIBA 3KKVA 3I81A 4C38A 1CKJA 3OOGA 3A7JA 4LRJA 1E1VA 1W2CA 4AXAA 5K5XA 4TYIA 4GG5A 4D9UA 2OJGA 4M7IA 2NP8A 5AA9A 3EN9A 4BCFA 2ERZE 4EC8A 5AUTA 5BNJA 4EOKA 4WNKA 4I0TA 3VN9A 2WMUA 5IKWA 2XBJA 4FTIA 3AC4A 4O83A 4BKJA 3CKXA 4EI4A 2JDVA 3A60A 3QTZA 3R6XA 4G3FA 1MQ4A 2HZIA 2A1AB 4LGHA 4QP7A 2BDFA 1FOTA 3IPHA 3WIKA 3ZONA 3VJNA 3DKCA 4QMZA 4BCQA 4CKIA 4FOBA 4JRNA 3KFAA 3ML1A 3PIXA 3FZOA 1W8CA 4PNKA 3W0SA 4AE6A 4IX5A 2ZJWA 3Q53A 3QXPA 2RSVA 4BDEA 1A06A 1GZ8A 3A8XA 3R8UA 5CI6A 2PVRA 1QPEA 3MDYA 4QMVA 2GNHA 5JRQA 4ZSGA 3D2IA 4EL9A 4ZS0A 3OBJA 1PXNA 4E4MA 5CQWA 3S4QA 3WZKA 4EK6A 3KIOC 2WFYA 2I0YA 4O6EA 4C02A 5I5ZA 4R77A 3D83A 2I40A 5IA3A 4GU6A 3OW4A 4CCUA 4D4VA 3UQGA 3BLHA 3KC3A 5EHYA 3I5ZA 1OM1A 3BE9A 2XCHA 4W8DA 1PJKA 2XEZA 3DDPA 5EI2A 2C0IA 2HZNA 5DA3A 1FVVA 2YA9A 3O71A 4OUCA 4D0XA 3QWJA 5IPJA 3G6GA 4JNWA 5AR3A 3PJ8A 2CNQA 1H0VA 1P2AA 2WPAA 3LCOA 4EZ3A 3QUPA 3KRJA 5C4LA 2UZTA 5FM2A 3AC3A 4CRSA 5HBJA 3F3TA 1RJBA 3EN6A 1TKIA 4RGJA 1NW1A 1W2DA 1WFCA 2ITQA 3CPCA 2WMXA 4MYGA 5AAGA 4LM5A 4O91A 2P2HA 3MJ1A 5DT4A 4FUXA 3D5WA 2F7EE 4LQMA 5AJQA 5HIEA 4PF4A 1AD5A 1H08A 2PTKA 2RKUA 2ITWA 1ZOEA 3Q4UA 3FY0A 4X2FA 5AR2A 4P7EA 4U3ZA 5DT0A 4BDAA 2ITNA 4FNXA 2I7QA 2ZMCA 2HENA 1M7QA 2IWIA 5L2SA 5EG3A 5HOAA 4I92A 2KULA 5HICA 4IC8A 3LJ2A 5DN3A 3H4JA 3W33A 2C5NA 5LVNA 1Q3DA 3ELJA 4M97A 4QEBA 2X8EA 4EK5A 3W1FA 4JVGA 3HP2A 2P33A 3QBNA 3FPMA 3QTWA 4FSRA 4JAIA 1SVEA 4KSPA 4O4EA 3JVRA 4P5QA 4QQCA 3W0NA 2GNGA 2OBJA 4BVUA 3UOJA 2WMWA 4HYIA 3QTSA 3MSSA 4AOJA 4AOTA 3MN3A 1CMKE 1R0EA 4QMUA 3U8WA 5CT7A 3HYHA 3QA8A 3AT4A 5CASA 1U46A 2ZYBA 1KSWA 5EDRA 3BQRA 4U44A 2ITPA 4LRMA 4LYNA 4F9BA 3HA6A 3UGCA 2ITYA 3PE2A 4GS6A 4F9WA 3UDTA 4RJ5A 4ANSA 2QOCA 2VTOA 5EHOA 4XG8A 4M0ZA 3MA6A 4MBJA 3WF7A 3MPAA 2V22A 4NT4A 3RTPA 4A9RA 4AP7A 3KXXA 4UN0C 2XAOA 3W32A 4WNPA 4LOQA 3OCGA 4PPCA 5JZNA 1P4FA 4KIKB 4YBKA 3UDZA 3UDBA 4DGOA 5CEIA 3MBLA 2PMOX 4KIPA 2PZRA 2WQNA 4GU9A 3DCVA 5CNNA 5L3AA 3ZUVA 2X6DA 3LJ0A 4CTCA 4N0SA 1WMKA 3LCSA 3S1HA 3W2PA 3IDPA 4MH7A 4CFVA 4ZZNA 1BMKA 4FODA 4WUNA 2WKMA 2BIYA 4GMYA 3G15A 3CKWA 2PVMA 5EM7A 2OFUA 4Q9ZA 4FEXA 2J0MB 4HW7A 5A4CA 1E1XA 2QONA 2WMBA 4F64A 4AS0A 2IVSA 5AR8A 3TNQB 3C0IA 5EI8A 3GQIA 3PIYA 3FQHA 1ZZLA 3ORZA 2QVSE 2VWVA 5EOLA 4RFMA 4I94A 4QPMA 4MD7E 2Y4IB 3LXLA 1SZMA 4GK3A 2WMSA 3NNVA 4RIXB 3IW6A 3TZ9A 4BI2A 4EQCA 5CT0A 5KMJA 2O64A 3AD6A 3PJCA 3PJ1A 3QA0A 2WOTA 3RCJA 1YI3A 2GTNA 3S3IA 4YO6A 5I4NA 2YM6A 4OTWA 2JD5A 2J0KA 5F20A 3HV7A 4ACHA 3V6RA 4ALVA 5CWZA 3PXYA 1R78A 1OVEA 5CYIA 3ZFYA 4TXCA 4WBOA 1H01A 5HTIA 4ZMEA 5HLNA 2B9FA 3Q9YA 2IZTA 3ZUUA 4EYJA 4OTPA 4I6LA 4JDJA 2C6KA 2GNIA 4YJNA 3VJOA 4BIBA 2Q0BA 4BIDA 3AG9A 5JQ5A 3QUDA 4GSBA 4IJ9A 2NRUA 4PDOA 4YPDA 3TL8A 1KUTA 3EYGA 4I0SA 3GU6A 2PZIA 3NWWA 3FY2A 4RJ6A 4HZSA 2PVNA 3EQBA 1J1CA 4L7FA 4E20A 3UMXA 5CVHA 1UNHA 2Z7SA 3OHTA 3NFFB 3R63A 5D7VA 4EBVA 3AMYA 3K5VA 3FC2A 4GIIA 3FQEA 4JDIA 2YWPA 4MXCA 3T9TA 3ZRKA 3VRZA 4CG9A 2IO6A 3DT1A 3C9WA 4XNEA 4U81A 4FTAA 4NCTC 2W5BA 4PTGA 4RVKA 3V04A 3EQPA 1J7LA 2GTMA 5ACKA 4RVMA 1YHSA 2CKEA 3D94A 4FSTA 4XG4A 1IEPA 4BDGA 4IDVA 1OL5A 4BCKA 3VQHA 2IG7A 2R3LA 3I4BA 4UYNA 2SRCA 5EOBA 3MVJA 2NPQA 5CSPA 4AOIA 3VBTA 4TT7A 2Y8OA 3PSBA 1APME 5KNJA 2J4ZA 3A7HA 1ZOHA 3RNYA 1OKZA 4BYIA 3FJQE 4WG5A 2FA2A 3R8LA 2RG5A 1WBTA 3L8SA 3BL9A 4O7NA 2J51A 4Y95A 1BUHA 2BAQA 3LFSA 5D10A 2GU8A 3FI4A 2W1DA 4GRBA 3UQCA 4RSSA 4QDEA 4QYHA 4QTEA 5E4HA 3UVRA 5L8LA 4F7LA 1WBNA 4FSYA 1R0PA 3V3VA 2YLEA 1YXVA 3ZLWA 3HEGA 3GENA 4XG2A 3P7AA 3QQHA 5JZJA 2NNWB 5JQ8A 5AMNA 4DFUA 3NAXA 3EJ1A 5BX0A 4JG8A 1ATPE 4DDGA 4ZY5A 3VUGA 3DB8A 4I21A 5DT3A 4F1MA 5CSHA 4EH8A 2VUWA 4AX8A 1QPCA 3ZHPC 4EWHA 4I6QA 2V0DA 4O22A 1AGWA 3KULB 5BUJA 4IAKA 2VWZA 4FSQA 4M67A 5HIBA 5J95A 3DXQA 3ZO3A 2PZ5A 3RP9A 2QNJA 4BCIA 5HG8A 4E4NA 3RM7A 2XK4A 5JRSA 4CT1A 3DJ7A 4EH5A 4PPAA 4K18A 1WVWA 4Y73A 3CD3A 4YHJA 5EW3A 4NEUA 5AEPA 1JPAA 1QPDA 1DAWA 4EOSA 3LLAA 4HOKA 1A9UA 5BUEA 4FEUA 2ITVA 5C01A 3HMNA 1J3HA 4M14A 4RFZA 4YC6A 3A4OX 4RJ7A 3R9DA 3UP2A 1H26A 3OC1A 4U8ZA 4GJ2A 3TNWA 3UOKA 4ACMA 1JKKA 2CSNA 3QKLA 4AZWA 4C7TA 4D2TA 2YZAA 4L44A 3NAYA 1PXLA 4U41A 4XP0A 1KE9A 3DBCA 3EN5A 3EQDA 5CEQA 4DG2E 3IONA 4RX9A 5HG9A 4OTHA 2ZVAA 5ANIA 1SNXA 4FF8A 3TNPC 5JEBA 4NU1A 3V5LA 3RVGA 3DNDA 3ZEPA 4FC0A 4F0IA 1TFFA 2PVYA 5KMOA 4XCUA 3VO3A 2EUFB 5A46A 5JT2A 1MRUA 3MIYA 5AAEA 3R8PA 5C1QB 2OZAB 5BVWA 4Z9LA 4IB3A 2X1NA 2GPHA 2PVJA 3GU8A 4BKZA 4CZTA 1H27A 1O6KA 2PMIA 5LVLA 3BGZA 2IW8A 2UV2A 3SQQA 4C3FA 3BWJA 4CV9A 4WKQA 2UW0A 4K33A 4M84A 3Q3BA 3E63A 4JLCA 5FTQA 4BRXA 2B1PA 2W4KA 3NW5A 3GT8A 3QTUA 4FIHA 4CD0A 5LVOA 2HZ4A 3DNEA 4I1ZA 4WD5A 4J99A 3JXWA 4QP4A 2I0VA 2HCKA 2C5YA 1GIIA 4RC2A 3QD4A 3C4ZA 5BVKA 3ZMMA 1NVQA 4XG7A 5M55A 5CAQA 2BAKA 1JQHA 2FGIA 5HVJA 3TCPA 2H96A 4FKUA 2GS6A 2UZWE 4L67A 2GNLA 4W4YA 4ZJJA 4QDVA 1XR1A 4FZAB 5EFQA 3P79A 3AT2A 4QP8A 4I6HA 2IVTA 4NW6A 2XCKA 2PPQA 2PVKA 3DU8A 3NYVA 4X3FC 2ZOQA 4GVJA 4I4EA 3UP7A 4M13A 4PDYA 4U7ZA 1DM2A 5J79A 2XNEA 4G5JA 4DHJA 4BC6A 5CSWA 4ZIMA 4MEDA 3I60A 2FVDA 4CRLA 1UU7A 3ZDUA 2XIKA 2X7FA 4X2JA 4XUFA 4IIRA 4E73A 4FMQA 3VW8A 3EFWA 2FSOX 4O0XA 5FTOA 4CFWA 3NUAA 4O4CA 5FQDC 5ANGA 4YC8A 2ETRA 2W05A 5CALA 3TXOA 4EK4A 1NVRA 3ZSGA 5I3RA 4OAVB 3FMMA 2ITXA 2BHEA 1UNLA 5AP4A 3BI6A 3GEQA 4N57A 1GY3A 3O5AA 2R64A 3LAUA 3FDNA 3DXNA 3EH9A 1YXUA 3FLNC 3PVBA 3RALA 1W83A 2AC3A 4H1MA 3RGFA 1YHWA 4H3BA 2X2KA 4G3DA 5M53A 4YTHA 3EFLA 1U5RA 4KIKA 4QPSA 1H8FA 3TZ8A 4I22A 3KL8A 2R3GA 2JDSA 2ONLA 4YP8A 2XM9A 3GCUA 4ZTMA 4GG7A 2XAMA 4Y46A 5HEZA 4RBLA 2BRMA 3NYOA 1XH8A 4DITA 3O8UA 2UW6A 3LFQA 2QQ7A 3GCVA 3HA8A 4J8NA 4JIAA 1M14A 2C6OA 2PL0A 3FEGA 2E9NA 4PL4A 4LL0A 2UW7A 1REJA 4P2KA 5HCYA 4IAZA 2R2PA 5BYYA 2VO6A 4IZ7A 2WTWA 3DK6A 5CAUA 3C4XA 5AX3A 3LM0A 5HG5A 5ICPA 4AZVA 3MH2A 3VHKA 5IU2A 1Z5MA 2VTNA 3VS6A 4DFNA 4RIXA 4FE2A 2UZDA 4YU2A 3R9HA 1FPUA 4NM0A 4OTDA 5AP5A 4BGGA 4FBXA 2QOHA 2AYPA 3KCKA 4QYYA 4IM3A 3KRLA 3FQSA 5IH5A 2WOUA 1OBGA 3U87A 1PHKA 4N6YA 3R21A 3BPRA 4MWHA 1YVJA 3C0HA 5IH6A 5AV2A 3Q9ZA 2UZEA 4DE4A 3CGOA 4FL2A 1GIHA 3UVPA 2OLCA 4BN1A 3NZ0A 4ACDA 4D9TA 1NA7A 4YPSA 2XNPA 4ZTHA 3Q6WA 4C4IA 4D2VA 1EH4A 3NGAA 4PX6A 4F99A 3I1AA 5HNBA 4E93A 2J7TA 2OIDA 2WMAA 1FGIA 5A6OA 4G2FA 3DKGA 2J9MA 4APPA 4X6RA 2X6EA 4I5HA 3ZSIA 4W4VA 1DI9A 3NDMA 4EONA 3OEZA 4O82A 4BBMA 1KE6A 4DFYA 4B4LA 3AXWA 5L2WA 5I9XA 1TVOA 4L46A 3UYTA 4UMRA 2VU3A 2YCRA 1CKPA 3G5DA 3NLBA 4K9YA 4AA0A 5FUTA 1URWA 3OD6X 4OLIA 3AQVA 4XEYA 4EH9A 4L9IA 5M51A 2C6LA 3HUCA 1MRYA 4B99A 4BY9E 5BVNA 3THBA 3OF0A 3D4QA 4C2WA 3N4TA 3R83A 2WGJA 3FL4A 3R01A 4ONAA 3BV2A 4AUAA 5HO7A 2VTQA 1FMOE 1YDTE 2EB3A 5E90A 5FRIA 5E1EA 4YHTA 1Q8TA 5FXSA 2BRNA 1XJDA 3AKLA 3VS7A 2J6MA 2BDWA 3OT8A 4JQ8A 4KIOA 3NMUF 1UV5A 2GS7A 1H4LA 3P78A 4FKSA 2UZBA 2J0IA 4PNIA 5KKRC 5KUPA 4UMQA 4MNEB 5IQAA 3H10A 2F7ZE 3E3PA 4D4SA 4MVFA 1M17A 4B8MA 1UA2A 4LFIA 2YCFA 2IW6A 4OTFA 3EFJA 5JKGA 4DH3A 1Q99A 2PVLA 3JUHA 4NTSA 1CM8A 4CMTA 1OUYA 3IO7A 4C34A 4M68A 4MWIA 3F2NA 4KKHA 3DAEA 4RZWA 1DS5A 4XV1A 4MX9A 3TG1A 3K5UA 4A4OA 3QALE 3SVVA 4X21A