1CMKE

Crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
publication title Crystal structures of the myristylated catalytic subunit of cAMP-dependent protein kinase reveal open and closed conformations.
pubmed rcsb
source organism Sus scrofa
total genus 105
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1cmkE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1cmkE02
3EN9A 5CTPA 2I40A 4WKQA 2NO3A 3E62A 2VU3A 3I7BA 4FKTA 4X3FB 5CENA 2UZVA 2AC5A 4D2TA 2QC6A 4NH1A 3NW6A 3OWJA 3GU8A 1W83A 3QYWA 3FI4A 4AFEA 5J7HA 1FVTA 1PMUA 1IASA 4ACCA 4YSJA 3OWPA 4O0SA 4E5WA 4O0VA 4XG9A 4GT3A 4L6QA 3ZM4A 5EG3A 2ITYA 3NEWA 4FTTA 4ZTNA 4L00A 3ZUTA 5HLNA 2RG6A 5K5XA 3QQGA 4IDTA 2IZRA 5L2TA 3L8XA 5E8YA 4ACGA 3D5XA 3UVQA 5FDPA 4FR4A 4WRSA 3Q9ZA 4P5QA 4W8DA 1MUOA 1AQ1A 2VWWA 3C4WA 5ETCA 5HO8A 3LXPA 3VRZA 4IM3A 1Y6AA 3C50A 3OEZA 4TPTA 5E90A 4ITIA 4IB1A 4RMZA 2ZV9A 5DE2A 4JG6A 4L3PA 4BCGA 4QYFA 3TTJA 3II5A 3V01A 3U51A 4I21A 3MI9A 1KE9A 3ZS5A 3WF8A 2C1BA 5CEIA 3ZRLA 1RJBA 5EOLA 3SA0A 2YCFA 3VRYA 4FSTA 3V5PA 4FSZA 2XCKA 4E4MA 1ZYJA 3UGCA 5IUGA 3TDVA 3HZTA 1E1XA 2G1TA 2CNQA 2UVZA 2WTVA 3OW4A 3PXZA 4PP7A 3D0EA 3AC2A 3QF9A 4DH5A 4ANNA 1PXIA 4KA3A 2W1EA 4BICA 3IW5A 3UC3A 3GEQA 4WT6A 1BI7A 4U42A 2PVYA 3KY2A 4AT5A 4R1YA 4DH3A 4BDDA 3C1XA 3RINA 2Z7LA 3MGYA 4II5A 5IQCA 3HV3A 4QYYA 2CDZA 5GIPE 2WAJA 4E8AA 5IUIA 1M2QA 5IQDA 3NX8A 1URCA 5KMMA 5E4HA 4I0SA 3QZHA 3VUIA 5LARA 1OPKA 4KS7A 1AGWA 3DKFA 3ZDUA 1ZAOA 3AT4A 3IDBA 4IFGA 4QQJA 5I9WA 2J0KA 2NPQA 3RWQA 3TWJA 2HY81 5FGKA 5JT2A 4AWIA 2OF4A 2UVYA 4M14A 3R1YA 2CGXA 3KFAA 2CGVA 3F69A 3GGFA 3EQPA 4BDBA 4E5AX 3NSZA 3RK5A 5M07A 3ULIA 4A4OA 3IS5A 3EB0A 2B54A 5AUUA 2ETKA 2YEXA 1P4OA 5EKNA 4I0RA 4GJ2A 5HESA 3TXOA 4O7ZA 1SVHA 4D58A 4JIKA 3U9NA 3LW0A 1ZOGA 3IO7A 3IOKA 4Y46A 3OY3A 2J6MA 4XG6A 5J1WA 4F9WA 3ZYAA 2W05A 3EKKA 4RIXA 5EHLA 5HX8A 5K9IA 3FXWA 2B7AA 2YIYA 2UW8A 4MH7A 3R30A 4MX9A 3P7BA 2XMYA 3L9NA 2I0HA 5AUTA 4ZS0A 3KULA 4W4VA 5AUZA 3POZA 4F1TA 4HYSA 1OKZA 3D9VA 4AG8A 4IAKA 1KOBA 2PZ5A 1Z5MA 3C0GA 3O8UA 3NUPA 3WF5A 1P5EA 2QKRA 4NIFA 3A62A 2IVUA 5IZFA 4QYHA 3RPRA 1H01A 4DGNA 4KBKA 5JSMA 5AR7A 3O7LB 5DGZA 2IW9A 4XHKB 3V8WA 3RPSA 2FGIA 4D1SA 3SG8A 2C6KA 1YXTA 3MIYA 1KE5A 2IVSA 4X2FA 4Y72A 5DLSA 4BL1A 4M0YA 2UW0A 2PZIA 3COHA 4EH7A 3TDWA 2VWVA 5CAUA 1X8BA 3ZOSA 4B6LA 2HIWA 4BDAA 4CSVA 4A9YA 2UZTA 4GH2A 2SRCA 5AMNA 3A61A 3HMNA 4LMNA 3TCPA 3I5ZA 1VJYA 3G9LX 5AP1A 5EW3A 5KE0A 3ZUUA 5AAGA 4EORA 4IC8A 3ZXZA 1PMVA 4J7BA 4BGHA 3COIA 1KOAA 3PJ1A 3RNYA 2HAKA 4OUCA 2YWVA 5TR6A 2F2UA 2J2IB 3FL4A 3OWLA 4BIEA 5AV4A 2VTRA 3AMBA 3GU6A 5CF6A 4BVUA 2E9NA 1JLUE 5HG8A 2QODA 5FXRA 3SKCA 2R7IA 4RVLA 3BYUA 4EOPA 4I3ZA 3G5DA 2QU6A 5HG7A 1BI8A 4FTIA 3EQBA 5KMIA 5CEOA 4EOJA 2OK1A 1OIYA 3ODZX 4IZ7A 4XG8A 1BUHA 4XOZA 5L8LA 5E92A 4Y95A 5TO8A 4CLIA 4MYGA 2OZAA 4G3FA 4TL0A 1Y91A 4YJRA 4AW1A 4M69A 1A48A 2ITTA 4LUDA 5HLPA 1SMHA 5I9ZA 5HBEA 2BZIB 4BKZA 4FT5A 3TNPC 4EK3A 4I41A 4YLKA 3PFQA 1PW2A 2VWXA 3QTSA 4FZ6A 2JDSA 3KULB 2WQMA 3VW6A 3RWPA 1CTPE 3JS2A 3A7FA 3SOCA 3FBVA 4FSQA 1RDQE 4FKRA 3Q9WA 1ERKA 1JOWB 4G31A 4BTKA 4C3PA 3P0MA 4NIFB 2YIWA 4RIWA 2EU9A 3Q4TA 5EYDA 3MTLA 4MXYA 4DBNA 3PP0A 2W1FA 3C4EA 4QP7A 4ORKA 5AUWA 4IVDA 3FMJA 3RK9A 4O21A 3EH9A 3FSKA 3SRVB 4IMYA 1WBNA 1WBWA 3W1FA 3ZBXA 4K9YA 4OAUC 3GCPA 5E9EA 5BVFA 4AGUA 4JBVA 3F88A 5DEYA 1L3RE 2P2HA 2AC3A 5FEQA 5IG1A 5JKGA 2UZEA 2XKFA 2FB8A 4HPTE 1CKPA 2PZRA 2GQRA 1Q8YA 1JQHA 4R78A 3R9RA 3K3IA 4C02A 4BI0A 4J98A 3EQDA 3HMMA 2P2IA 3NNWA 2C5NA 2UZBA 3LE6A 4ZAUA 1H1RA 2PE2A 3I0QA 4QTDA 2WQEA 3SHEA 3W32A 2GFCA 1CKIA 4D28A 4R7BA 5IEXA 2GTNA 4FV6A 3JY9A 1PXLA 4RRVA 5ANOA 2R3QA 2BRBA 4PY1A 1OKWA 4O7TA 2OF2A 3CPBA 3RTPA 3E64A 5DH3A 3V8TA 5IA1A 2B4SB 5EW9A 2J50A 4BBEA 3D5WA 4FG7A 3PZHA 3QFVA 3TV4A 4I0TA 3ORIA 5CU3A 4DTBA 2R3JA 4RJ3A 4D9TA 4CYJA 2CN8A 3EYGA 3R01A 4CFWA 4YMJA 4IWDA 3NAYA 4HJOA 5HNIX 4ZLZA 3PVBA 3ZFMA 2X81A 3TV7A 4HVGA 4E7WA 4QRCA 4RWIA 4I6HA 3PXYA 3FV8A 3SD0A 3G0FA 2BALA 2VO6A 4OTWA 3K5VA 3BQRA 1WBVA 4NK9A 5AUXA 3RAIA 4PTEA 3PXRA 1QPCA 3MVLA 5JZNA 4EOIA 1R0EA 2JKQA 3QWKA 4XRJA 3WE4A 3TNWA 2VWYA 4CZUA 3QRTA 5DWRA 3DXQA 2C47A 3BE9A 5CS6A 2CCHA 1H26A 4L53A 3W2QA 5KMOA 2VAGA 1OB3A 3FSFA 5LCKA 4IE9A 4JDJA 3B2WA 4R5YA 4ZSEA 3DGKA 4X3JA 3QCXA 5IA0A 3NVMB 5CEPA 4FZAB 2VX3A 1YKRA 2RL5A 4PDPA 4E6DA 3QC9A 3F2RA 4IAIA 3PA4A 5GNKA 3NNUA 4K77A 4AZTA 4EHZA 5BUEA 3C5UA 1RE8A 4XG7A 5EK7A 3FMHA 1W7HA 5AFVA 4FEXA 3R8VA 2UVXA 3IW6A 4ZJJA 4EOLA 3F2NA 3R7UA 5DG5A 4S34A 2VN9A 3JUHA 5HVYA 4BDFA 4JG7A 5EDQA 3O51A 2OICA 1LR4A 2F7ZE 2ITUA 4M84A 1SNUA 3CLYA 4FL3A 2R64A 2JDVA 3TM0A 5JZJA 3SV0A 2XNEA 5T3QA 4EUTA 5B7VA 4DGOA 4EZ3A 1Q8TA 4L52A 2H34A 5GJDA 5H3QA 3NYVA 4RIYB 4GFMA 4O0TA 5E8XA 4H58A 1CSNA 3G0EA 5FEDA 2W5HA 4EOQA 2PVKA 3E8DA 4PMMA 3RKBA 2HW7A 5L8JA 3FHRA 1U4DA 4ZXTA 2JAVA 3EYHA 5GINE 4FTKA 2E2BA 3A7JA 2HWPA 5JGDA 5HU3A 3RM7A 4ENXA 3EHAA 4UX9A 5HTCA 5BNJA 1SVGA 4CT1A 3PE2A 4QMOA 3BHUA 3U55A 4FV8A 4ITJA 3HP5A 1PXKA 2XBAA 3V8SA 2QQ7A 3UP2A 4F0GA 4Q9SA 1IA9A 1J1CA 5DI1A 5DR2A 3RAWA 1WBOA 3N51A 3R63A 5DBXA 3I60A 2BKKA 2YAKA 4WD5A 2XP2A 2CNUA 2WO6A 3CCNA 1R78A 3BX5A 5KMKA 5LMKA 3P78A 4DFBA 1HCKA 2VTPA 3EQIA 4YZ9A 3PA5A 4FGRA 1JPAA 1MRVA 3VAPA 4LL0A 2WTDA 2V55A 3EZRA 4R1VA 2ACXA 4U0IA 1K2PA 4GIIA 4EQUA 2RGPA 4IX4A 3V5QA 1OL6A 4JQ7A 3FXZA 4BCKA 4E6QA 3OS3A 2R3OA 1YVJA 3BEGA 4DLIA 2W0JA 3R7OA 3ZDIA 2ZM1A 5CEMA 1G8SA 1TQIA 5K4IA 1IRKA 4CCBA 4MXCA 2WMQA 2QOKA 4JDIA 5JGAA 5KBQA 4RSSA 4XUFA 2RFEA 1Q8ZA 2LGCA 2J7TA 4PP9A 5AUVA 4FT3A 4OBOA 3NGAA 5AIRA 3TZ7A 2VTHA 4WUAA 2WOTA 4FIJA 3O0GA 3VS3A 4LMUA 2Z8CA 3ROYA 3FPQA 1VYWA 4LM5A 4J99A 5GIOE 3D7TB 5HD4A 4B0GA 5ANDA 5IH4A 5IPJA 3SAYA 5M53A 4W4XA 1P4FA 4ANLA 4C62A 3QYZA 3C4FA 3DAKA 2JEDA 3I7CA 3UJGA 4IB5A 4EQMA 2OW3A 2OSCA 4IVBA 2O65A 4KIOA 1M17A 1U46A 2R0UA 4Y5QA 4AA5A 4EOKA 4F64A 4GYGA 5FWKK 4TYJA 4IB0A 4AZVA 3OBJA 3AD6A 3LCOA 4C0TA 3FLQA 4I5PA 2ZV2A 2GNGA 4FKWA 4GT5A 3JY0A 4KSQA 2PVFA 2R7BA 3FXXA 5ITAA 3L9MA 5BVOA 5ETIA 3SXSA 4F6SA 3POOA 1QPEA 4C4EA 1Y8YA 2G01A 3A60A 3GFWA 3MS9A 4WIHA 4FTUA 5EM6A 4IWPA 3RVGA 4D1ZA 4DG0E 3HV7A 3R28A 4C2VA 4BKJA 4QMLA 3UOJA 2Z7QA 3LM0A 3FMEA 1YDTE 3AXWA 2A0CX 3ODYX 4MNFA 5DN3A 2CHLA 3OZ6A 3THBA 4C38A 5FP6A 5L6OA 3P5KA 3QZIA 4HGLA 3FZOA 1JKKA 4L3JA 2GQSA 3EMGA 5HNBA 3EFWA 1YXSA 4MQ2A 4EH4A 4BTJA 2X1NA 4FIGA 3QD2B 4BTMA 4ZTRA 4WNPA 2VZ6A 2Y9QA 3GT8A 4NT4A 4AXAA 2DS1A 4CD0A 5GZ9A 4A4XA 5I3RA 3SDJA 3TACA 4BGGA 2QKWB 2UW6A 3Q2MA 3CGFA 3FLWA 3D2IA 5B0XA 3RGFA 3BEAA 3ITZA 1OIQA 2G9XA 2V5QA 3Q60A 3SRVA 5BPYA 4YPSA 3KXNA 1ZMVA 2QONA 2WMXA 4GU6A 4I92A 3IW7A 3MH0A 4XG3A 4X0MA 2WKMA 3ZONA 2ZDUA 2CLXA 4FV3A 2YHVA 3A8XA 3CTQA 5HI2A 4E4XA 4D4YA 5E8ZA 4MF0A 4ASDA 5C4KA 4YHJA 3FPMA 5CVFA 3LHJA 3KXXA 4ZMFA 3QC4A 2HK5A 3ACJA 2JAMA 3PJ2A 4BF2A 3R83A 2QR7A 4YTIA 4NU1A 3IDPA 3QA0A 4WUNA 4A06A 4F08A 4JR3A 2QLQA 5FBNC 5C27A 1CMKE 4EKLA 4FEUA 3EIDA 5DRDA 4UBAA 1Q5KA 5DPVA 3G90X 3AQVA 4ASZA 4BCJA 1SZMA 4IACA 4D5HA 2OJFE 3AD5A 4KKGA 4U3ZA 4B8LA 4O2ZA 4U43A 4EH6A 3PXQA 1H0VA 3BKBA 4RWKA 4I6QA 3QTWA 3KRXA 3T9IA 5JRQA 4UALA 3C7QA 3RAKA 3QD4A 4JX7A 5CYIA 4IX3A 3ZHPC 4UMUA 2BUJA 4GW8A 1F5QA 3PRIA 4RJ5A 4MQ1A 5D9HA 3GCQA 4H1MA 3KGAA 3BHVA 4TY1A 2OH0E 3Q53A 3QRUA 5AV0A 5FM2A 5M55A 4TW9A 4LGDA 3BYSA 1NXKA 5K4JA 2XK7A 3GC8A 2V7AA 3PY3A 4IH8A 4PNKA 3O71A 4GKIA 3CBLA 2C3LA 4AW0A 4PL5A 1H08A 3O50A 4YGAA 2VV9A 3FQSA 2XNGA 4ANBA 3EFLA 4XBUA 3FZTA 4RC2A 3GOKA 2HZNA 2ZVAA 5CNNA 3MFRA 2QHNA 3EN4A 4AP7A 4FTNA 3ERKA 4FTOA 5A3XA 4BHZA 2B9JA 4RA5A 2YABA 4DT8A 3OTUA 5CANA 2NP8A 4GG7A 4QTCA 4X2GA 4OTQA 4ALUA 2XKCA 4JG8A 2R4BA 4JRNA 1OUKA 4FV1A 1KV2A 3QWJA 5J95A 4DGLC 4EZ7A 3UIBA 3KVXA 3DZOA 5IA4A 4ZEGA 4BR3A 4KAOA 4Z9LA 5EOBA 3H30A 3NR9A 4L9IA 4S30A 1V0PA 5M08A 5HCXA 2XS0A 4YJOA 3COKA 3QTRA 2UW4A 3BWFA 4I5HA 2ITZA 2PU8A 3P1AA 1Q24A 2GHGA 2R3NA 3DS6A 5EH0A 3EN6A 2EWAA 4WSQA 1WBTA 4XP3A 4AW5A 4RFMA 2PVHA 3T9TA 2YM6A 2B9IA 4TYHA 3WE8A 1XH6A 2XNBA 1XBCA 4DTKA 5L2IA 3UBDA 4YZMA 1Q61A 1FVVA 4TZRA 4PMPA 4AUAA 2OJJA 4YPDA 4JT3A 2PYWA 2BRMA 3PVUA 5FBOA 3PVWA 3W10A 2E9OA 3HVCA 1T45A 4DH8A 4F1MA 1O6LA 5E8VA 5L3AA 2ZDTA 3HMPA 4EK6A 4X3FC 5CVGA 4BFMA 5A4LA 4BDJA 4FSWA 1FVRA 1Z9XA 4TWCA 1R39A 5JQ5A 4AAAA 3ACKA 4IWQA 5JFVA 1TVOA 2BDWA 4FIEA 3DTWA 3VUHA 3O96A 3R1QA 3GCSA 5IQIA 2C5YA 4IVCA 3K54A 2WOUA 2XK8A 4AS0A 4QTEA 5BQ0A 1Q99A 2QNJA 2HZ4A 2KTYA 1QL6A 3D7ZA 4HNIA 4I6FA 4ACDA 4LRMA 5A54A 5IH5A 1H0WA 3D4QA 2XUUA 1ZMWA 2IO6A 2VTMA 1OKYA 2JBOA 2OFUA 3OCTA 3HDMA 5AP4A 5KZIA 2OU7A 4GSBA 3W55A 1B38A 2CMWA 3LQ8A 1GOLA 3VQUA 3HUCA 4ZJVA 5A4QA 4IM2A 3F5XA 3T3VA 2W1ZA 4FTJA 2ZV8A 4C4FA 1ZXEA 4ZTSA 4IBMA 3OMVA 2Y4IB 4FICA 3QXOA 1XKKA 3I5NA 5DNRA 4RGJA 3UOLA 2CN5A 4O38A 5CI6A 3GVUA 3PJ8A 2VO0A 2FSLX 4BDKA 4FV5A 5J8IA 4WSYA 3GP0A 4M7IA 1KE8A 4XJ0A 1FGKA 4M0ZA 3UOKA 1WVYA 4USEA 3UZTA 4HYHA 3ZTXA 1OIUA 4D2VA 4DFXE 4R3PA 1K3AA 4CQGA 4JXFA 1SM2A 5D1JA 3KKVA 2QOBA 2W1DA 1YHWA 3ULZA 3E8CA 2O64A 4DEGA 4K2RA 3AC4A 1Q3DA 3ZO4A 3OROA 1YQJA 3UG1A 4BDCA 4HCVA 2OIDA 5D12A 3BQCA 2WTIA 5K0KA 4R6VA 3ZLXA 3Q96A 2WU6A 2B52A 3SC1A 5C9CA 4V04A 4E26A 2UW9A 5HICA 3ZLSA 3ANQA 1OIRA 3FLZA 4L67A 5E1SA 5AP5A 5BX0A 4IZYA 4DFZE 2VTTA 3NYOA 5EM8A 1LPUA 5CEKA 3PPJA 3SW4A 2W5BA 4HZSA 3QCQA 4UMRA 2IN6A 3DPKA 4IWOA 4MXOA 4FZ7A 2YDKA 2BAJA 4TRLA 1ZYLA 4RWLA 3AT2A 4G2FA 3QCYA 3NIEA 1W84A 1Q8UA 4GMYA 1S9JA 2QOOA 3ZZWA 4BY9E 5CQWA 4F63A 4N57A 3OTVA 3W8LA 4GUEA 1MQBA 4JL9A 4JQ8A 5F1ZA 4Z3VA 2WMVA 3F7WA 2YZAA 3HA8A 4EYJA 4GVJA 1OECA 5L2WA 2EUFB 4I5CA 3B8QA 2YACA 3ANRA 4M67A 4JNWA 4YTCA 3UVPA 5BVDA 4AACA 4Z55A 4MXAA 4CFFA 1CKJA 3E5AA 4GU9A 4CKRA 1BL7A 3KMMA 4K1BA 3QQJA 4F7NA 5A14A 3ZRKA 1NA7A 3HRCA 3IKAA 3DK3A 2FH9A 2HXQA 3NYXA 5D11A 5BVEA 5TT7A 5DR6A 2BAQA 5KKRB 4LL5A 1XQZA 4O27B 2JDOA 4O81A 2OIBA 3VUGA 3HRFA 3S4QA 3TG1A 4IM0A 2YLFA 2V62A 2YZLA 1NY3A 4W9XA 5HE1A 3LXNA 3I0OA 3LM5A 4I94A 3QD0A 2RSVA 2J0LA 1CM8A 4QP9A 3HECA 5HIEA 2R3IA 3FUPA 3TKUA 3MB7A 3TNIA 4RG0A 3UIMA 3QUDA 5M56A 3I1AA 3G2FA 3NUUA 5M44A 1YI4A 1Q41A 2EXEA 2WQBA 2WTCA 2Y8OA 1JSUA 5M57A 4XOYA 5JH6A 2HOGA 5HZNA 3D2KA 3MJ2A 5J7BA 2F57A 3KRJA 3TV6A 4HVDA 3UO5A 2HZIA 3W2RA 3WF9A 2Z02A 2Q0BA 3JVSA 3PXFA 2ETRA 1E9HA 3W16A 3BBWA 3E3PA 1QCFA 3OT8A 4NUSA 5J79A 3WYYA 1G5SA 1UNLA 3QXPA 5ANKA 3JVRA 2RFSA 1BYGA 4FBXA 3BI6A 4FZDB 4E73A 2B0QA 1GIJA 2XM9A 4C58A 4U3YA 4GK2A 3RPOA 3UE4A 2W1GA 1H1WA 4FG8A 4NJ3A 3FC2A 5LQFA 1OVEA 3U6JA 4L7SA 4O7LA 4MXXA 2GFSA 4AW2A 1KE7A 2ZOQA 2OXYA 4GVAA 2YN8A 2UV2A 2VX0A 4ZSJA 4Q5HA 4QQTA 2I7QA 5M4CA 4D2WA 4ZS4A 3LFFA 4FKPA 5HG5A 4CMTA 4HVSA 5AP7A 4AZEA 3EL8A 1GZOA 3MBLA 4B7TA 4F7SA 3QZGA 5EM7A 4C57A 4C61A 2WMUA 3C4CA 3BLHA 3KCKA 4IVAA 2G2FA 5G6VA 3DJ7A 3U4WA 4MD9E 2YIXA 2E9UA 2WGJA 3FYJX 4AX8A 3AC5A 4AZWA 3A4OX 3FHIA 4JAIA 5IISA 4JI9A 3CQWA 4QO9A 2JGZA 3MFTA 4NJDA 2ITXA 3Q04A 3F82A 1GNGA 4W8EA 3OHTA 3DV3A 3KQ7A 4FEQA 4UZHA 5M51A 4M12A 4PTGA 2Z7SA 5L6PA 3UPZA 2H96A 2C6EA 3ZEPA 4G9RA 3NPCA 5IU2A 4IANA 5BYYA 5AEPA 3DOGA 2YM8A 5HLWA 3ZMMA 4C4JA 3WF7A 4IAFA 3UQCA 3F3TA 2JDRA 3UG2A 4L45A 4FKOA 4H05A 3N9XA 3OCBA 2GHLA 4OTPA 2GTMA 3MH1A 4JDHA 5HD7A 2XYUA 3H0ZA 4L44A 2C69A 1M2PA 4FK6A 4DEAA 3R2BA 2HENA 3OCSA 4D4VA 2XEYA 3C4XA 2I1MA 5KX8A 4OLIA 3FKLA 2YDJA 2GQGA 3WF6A 4FKQA 3C0IA 5BUJA 1MQ4A 3OBGA 4OTIA 4ZTQA 4RX9A 1IAJA 4KS8A 2X2KA 5DMZA 2B53A 4RA4A 5AA9A 4HPUE 3LMHA 5CXZA 4RIXB 5ANGA 4YJNA 5TOZA 4MWHA 3MPAA 3FLSA 4DA5A 4IQ6A 3FJQE 3OXZA 2XIXA 1HCLA 4FNYA 4FYOA 2C0IA 4O6EA 5AUYA 2YISA 3VNTA 1XJDA 3NVKI 1MP8A 1H27A 3MY0A 3QRIA 4YBKA 5D7AA 2H9VA 4XV3A 4DITA 4YR8A 3NDMA 4FG9A 3K2LA 4U7ZA 2PWLA 3FC1X 4GS6A 4OT6A 5F4NA 3CSVA 1KWPA 3KMWA 4YBJA 4WHZA 2P33A 3NW7A 3JR1A 4KUJA 3UMXA 3CR0A 3FZPA 2HCKA 3OVVA 2BDJA 3TNHA 3KN5A 3ALOA 3TIYA 4DFLA 4ENYA 4YJQA 3AOXA 1J7IA 3QQFA 2C3KA 5I4NA 4DEIA 3RK7A 2GU8A 3G9NA 4ALVA 4XG2A 3VUTA 2X4FA 2A2AA 4FOBA 4E5BA 5I9YA 2PVMA 2BIKB 5B2LA 3RZBA 1T46A 2XJ0A 3OY1A 4AU8A 2ZB0A 5ANIA 2B9HA 2WFYA 4O7SA 3LFBA 4BTFA 3VUKA 4S32A 2W1CA 5CU4A 3ORXA 1QPJA 4ZLOA 3VS5A 3EQFA 4J97A 3SQQA 3U54A 1IEPA 3OXIA 3RHXA 4OBQA 1REKA 4YJVA 2XNOA 4G1WA 1PRYA 5EHYA 3HEGA 5HVJA 3PSCA 3O2MA 3QL8A 3VS6A 1W98A 2Y6OA 2RKUA 1NVSA 2GPHA 4NCTC 5KMJA 2PUIA 5AP2A 3WZKA 4FSMA 4QNAA 2OZAB 3EQCA 3R02A 4JBOA 4NW5A 1UA2A 3UZPA 2A4LA 4M69B 4XNEA 4E6CA 1TKIA 5IKWA 4P90A 2CLQA 3QHRA 4YJTA 5M4UA 4CG8A 5E8WA 3QRKA 5LMAA 5CLPA 2WNTA 3MFUA 2X9EA 5AX9A 1FMKA 1OL2A 5FD2A 4QMSA 5AR2A 5HBJA 1OMWA 3DQXA 1ZZLA 4YJUA 4EOMA 4ANQA 3VS4A 2OJ9A 1PMEA 5LVNA 4U8ZA 2VTAA 3QLFA 4RIWB 4GEOA 4XG4A 2RFDA 3NW5A 2DUVA 4X7QA 4A9SA 3JXWA 2F2CB 3E63A 3DA6A 2IPXA 2WMSA 3BPRA 2C6DA 3N4UA 1YWRA 3RM6A 3TUDA 2QD9A 4NM0A 4LOOA 4G3CA 4K33A 2Q83A 2QOHA 2VNYA 3AD4A 4PPAA 2ETMA 4BDGA 5B2MA 5HEZA 4D4SA 1DS5A 3QGYA 4NSTA 4D2SA 1XR1A 3G6GA 2UW7A 3FY2A 2XRWA 2VO7A 2EXMA 1UWJA 3Q6WA 3HKOA 2XJ2A 2P3GX 4JQEA 5DOSA 5HO6A 5ACKA 4H3BA 3GC0A 4LGGA 2QG7A 4HW7A 3C51A 4QMXA 5BMMA 5EI2A 4FE2A 5H8EA 1BX6A 1DAYA 1Q97A 2VWZA 2VRXA 4FIIA 2WPAA 1UKIA 2VTLA 2EXCX 4IHPA 3LFNA 3R7YA 1RQQA 5EI6A 5J1VA 2OIQA 2W9ZB 2PK9A 1ZYSA 4G3EA 4C8BA 1REJA 2YERA 2J9MA 2UUEA 4QP2A 1VR2A 3LXLA 5KMLA 1XH7A 4TTHB 5DHJA 3WZUA 2JKKA 3K5UA 3D14A 4IJPA 4BN1A 4C4GA 3TKIA 4O86A 4S33A 4GYIA 2BKZA 4EH3A 4QP4A 5CZHA 4RX5A 5I3OA 2R0IA 5FTQA 4FUXA 1OPJA 4GG5A 4TWPA 3U9CA 5CAVA 4I5MA 3MY1A 1VEBA 3VC4A 1U59A 2C3JA 3WYXA 3ORZA 3NUXA 3GCVA 4MBLA 1TQPA 1PHKA 2HW6A 1JSVA 4F09A 3NIZA 3S0OA 2XIYA 5HE0A 2X8IA 3CY3A 4IAAA 3SW7A 3DK6A 3DQWA 1JKLA 2W1HA 4BKYA 4C35A 2JKMA 1YDSE 2BR1A 4PDOA 2IG7A 3VO3A 4P4CA 1SNXA 3PSBA 4FEWA 4UWYA 4FEVA 1ZARA 4ZY5A 4TNBA 3VN9A 3A7IA 2CKEA 2YA9A 4L8MA 5E8TA 4DT9A 3D83A 4RPVA 1BLXA 4K8AA 4BIDA 1KSWA 3JPVA 2O8YA 2YJRA 3H0YA 3HAMA 3KB7A 5ETFA 2EB2A 4LGHA 3UNJA 5AJQA 3TEIA 2IVTA 1J91A 4EKKA 2VTQA 5AR3A 3N4TA 4G3DA 4LQMA 2VGPA 3OW3A 3FDNA 4BCNA 3F9NA 3L8SA 3CS9A 4XX9A 2R3LA 3FMLA 3TZ9A 5CAQA 1DM2A 1PXPA 4LUEA 3BELA 4IEBA 3CC6A 4CMOA 4PQNA 3LFDA 1H1PA 3CEKA 3AGMA 3PIZA 1SYKA 3ZXTA 3D15A 3OXTA 4QPSA 2VUWA 2W17A 4J8NA 5HBHA 2XEZA 1I44A 3K3JA 4DEEA 2DQ7X 3QZFA 3VVHA 4ZY4A 4BWKA 2JIIA 3O8PA 5AM7A 4EI4A 3KREA 4A07A 2WQOA 3QUPA 4E6AA 4UYAA 2XNPA 3MA6A 4XV1A 3QAME 5LOHA 2GS6A 3V5WA 1OGUA 3IECA 3HAVA 2CGWA 5CSWA 3UP7A 1O6YA 2Y7JA 3EFKA 2F7XE 2X2LA 4F6UA 3ID6C 3LMIA 2AYPA 2XIKA 4YC3A 4ZSAA 4Q5EA 4MBIA 4BCQA 2XRUA 2F49A 4ZP5A 1LEZA 2CCIA 2YCQA 4U9AA 2ZM3A 5HU9A 3VS7A 1Z57A 4FT0A 2UZLA 2OKRA 4Z7GA 5BMSA 2F7EE 5CZIA 4QP6A 3UQGA 2PMLX 3ZLYA 1YXVA 3FZSA 4DFNA 4EOOA 4NM5A 4CNHA 3DBCA 3UNZA 3ZC5A 4N4SA 3BGPA 3V5JA 4YLJA 2BHHA 3OEFX 3ZSIA 4F0FA 4TYIA 3NUYA 4ZZMA 4W4YA 4D0WA 5I9VA 2WD1A 4O7WA 2WMTA 4RLKA 4LI5A 3FI3A 2BZHB 5H8GA 3RP9A 3G6HA 2P0CA 1HOWA 4MHAA 4OAVB 3E7VA 1KV1A 4KINA 1PMNA 3QQUA 4YNOA 4O22A 3F5GA 2G2HA 2X7OA 5H8BA 3RZFA 2W4JA 2PVJA 3R9HA 4U80A 4G6LA 3NWWA 2C6OA 2QOIA 4HCTA 4QYGA 4BCPA 5TE0A 3IOPA 3KEXA 1JKSA 4YHTA 3MN3A 5AAFA 3IQ7A 3Q3BA 2EVAA 1MRUA 5EDRA 3R8MA 3U6HA 4RQKA 5ETAA 3OUKA 4LOPA 5GHVA 4EQCA 4IJ9A 3LXKA 2XKDA 3NZ0A 3R8LA 4AN2A 4DHFA 4ERWA 1S9IA 2GSFA 1F0QA 5L4QA 1G8AA 4YZBA 4PDYA 2J5FA 5LMBA 3KXHA 1XO2B 2X7GA 3QHWA 3IGOA 5I0BA 5ANJA 4XBRA 4AGDA 4OGRA 2I6LA 3DCVA 1QPDA 3MPTA 3HV5A 4EOSA 3GFEA 5C26A 2BROA 2ONLC 3MESA 4QOXA 4YC8A 1OL7A 3GENA 1A06A 4BC6A 3JYAA 3A99A 3PPKA 4N6ZA 4I4EA 4BI2A 1OKVA 3QX4A 4K0YA 5CQUA 4DN5A 3HMOA 4ACMA 4CLJA 4KIPA 4YZCA 2C6TA 3BHHA 2XZSA 4BCHA 4O83A 4UV0A 3CQUA 3DNDA 4FSUA 3ZFXA 4QMQA 3F7ZA 4WA9A 3FQHA 3MA3A 2OZOA 3P79A 3TUCA 4JBQA 5E7RA 1H25A 4W9WA 4FL1A 2YITA 4ANOA 2QVSE 1CDKA 3UO4A 4AF3A 3PIXA 4D9UA 3WILA 2GS7A 2XNMA 3BGZA 4HOKA 4MF1A 4TYEA 1WFCA 4IX6A 3D94A 5AIKA 3S3IA 3V5LA 5IA2A 2ERKA 4AOTA 4E4LA 4BCOA 3O7LD 1YHSA 5DT0A 2GMXA 3AMAA 3MIAA 3VS1A 4G16A 4L68A 4OTGA 4RFZA 4RJ7A 4YO6A 1Q8WA 1OITA 4U97A 4X2JA 1XBBA 4N70A 4PTCA 4J53A 4C59A 1BKXA 2XK9A 5BYLA 5CXHA 5HHWA 4OW8A 5CU0A 3WI6A 3CXWA 4O91A 4LG4A 2PMNX 5KBRA 3LOKA 3ORMA 3C13A 4PV0A 2Y4IC 4WNKA 3LFQA 4KRCA 2O3PA 3KU2A 3BCEA 2H8HA 4FV0A 1PYXA 3Q4ZA 3R8ZA 1YOMA 3C0HA 3BYVA 3V5TA 3E87A 4UMQA 3SVVA 4O7NA 4BIBA 5AX3A 3PY0A 1OPLA 3BYOA 2NNWB 1ZOEA 2QG5A 4F9BA 4NW6A 4BRXA 3FZ1A 5JN2A 3FY0A 1B39A 2HYYA 1GY3A 3QQHA 3GB2A 3ZO1A 4UN0C 2WU7A 2FYSA 3EQHA 3R1NA 2WZJA 4ZLYA 1JWHA 3NAXA 2GHMA 1FPUA 3WZDA 5KZ0A 3H4JA 2RG5A 3PE1A 3QUEA 4YC6A 3DBFA 4M13A 3KA0A 2PUPA 5F9EA 2YFXA 2OI4X 2WQNA 4B9DA 3Q52A 4F9CA 4F7JA 2X6EA 4QT1A 4K11A 3CD8A 3OP5A 2CPKE 2YCRA 4UWBA 2C5VA 1YXUA 4PNIA 4EJNA 2VTNA 3DFCB 3UPXA 5JFXA 4O0YA 3ZO3A 5CSXA 4IZAA 3IGGA 3IW4A 5DRBA 3SOAA 3UYTA 4FTCA 4BCMA 5JFSA 3G15A 4FKLA 2OWBA 2X8DA 3LCSA 4PRJA 2C5XA 3OD6X 4WBBB 2XF0A 2ZM4A 4C4HA 4CZYB 2IW6A 3R00A 2C68A 2WELA 4Y5HA 5EFQA 3C5IA 3RJCA 4O1OA 4D1XA 1W0XC 2DYLA 2J90A 2PUUA 5DR9A 3FE3A 4BDIA 2PVRA 3F6XA 4X2NA 5AR5A 1L8TA 1ZYDA 4DH7A 2CKQA 4BCFA 1PXOA 3FMKA 2FO0A 4U79A 4UXLA 3QX2A 3QKKA 3BHTA 4DE4A 4UWCA 4FA2A 2J51A 2Y4PA 2ITPA 3HL7A 4FKUA 5GZ8A 1W8CA 4U6RA 5E8UA 4DGGA 4DG3E 4HZRA 3WIKA 3UZRA 5FXSA 1VZOA 3GU4A 3MDYA 4FTQA 5GJGA 1LUFA 4FV2A 1GZ8A 4HYIA 2PUNA 4O7VA 1YOJA 3BGQA 3KMUA 5ACBC 3NCZA 2VD5A 3KXZA 4KRDA 4O6LA 2I0VA 4PMSA 4APPA 4PDSA 4XP0A 2BAKA 2OH4A 2V7OA 3R7IA 5EQYA 1YI3A 3R7VA 1ZRZA 3VUMA 2C4GA 4FTLA 3WARA 3A4PA 1B6CB 3FL5A 4ZY6A 4XRLA 4CV9A 5KO1A 3EFJA 3ORKA 4RC3A 1U5QA 3FMNA 3KXMA 5KHWA 4EJ7A 1G3NA 2PHKA 2XNNA 4M3QA 4BYJA 4FVRA 4G34A 4F7LA 4D0XA 4X3FA 5KKRC 4DTAA 3TUBA 2WHBA 2XVDA 2UZOA 4MEDA 3VBXA 3BU3A 1JBPE 4YTHA 3E92A 3KL8A 1Y57A 2BCJA 4R8QA 4RZVA 4ZK5A 4XMOA 4EUUA 4GL9A 4QYEA 4TYHB 3SGCA 4FGBA 2XYNA 3V51A 1ZMUA 1NW1A 4O1PA 3P23A 1FGIA 3OF0A 4K6ZA 4F99A 3A8WA 4I22A 3CTJA 3HMIA 2A19B 5JQ8A 1ZZ2A 4RQVA 2XIZA 1PXJA 3GQLA 2BIYA 3LJ0A 2VTJA 2VWUA 2BDFA 2WTKB 3EQRA 5AR8A 5E8SA 2WMBA 4O96A 2W96B 3ZLWA 4J95A 4EYMA 3BU5A 4LYNA 4MNEA 5FP5A 3HLLA 3LAUA 2WMWA 2R3GA 4NEUA 4DEHA 3BV3A 2JIUA 2W5AA 4ZTLA 3PG3A 2WEVA 4YZNA 3ROCA 3KK9A 5BYZA 4FTMA 5BVWA 3ETAA 2HELA 4PF4A 4E1ZA 4E3CA 4FNXA 2PSQA 3L9LA 3QD3A 3QALE 1PY5A 2JBPA 3IONA 4ONAA 3KCFA 4FF8A 2C6IA 3LJ1A 4PMTA 4XV2A 3RI1A 5KUPA 4KABA 4XYFA 4HGTA 4F4PA 1NT2A 5L6WL 4M15A 4FI1A 3VBVA 4QMPA 5CEQA 4LFIA 4DCAA 4O7RA 2XK3A 4OR5A 4RVMA 3A7GA 4JBPA 3I6UA 1Q3WA 4KKHA 4AGWA 4USFA 4APCA 5EQEA 2PVNA 4R7HA 4RZWA 4UXQA 4BWPA 3CKXA 3UTOA 3NNXA 1GAGA 3DBDA 3LQ5A 4W4WA 5AP6A 5A6NA 2YM3A 5AP0A 3FMMA 3LFSA 5I9XA 3RCJA 2PZPA 2IW8A 1H07A 4UY9A 2WTJA 2ITWA 3V3VA 3DDQA 5C8NA 3F61A 3CD3A 5IQHA 4A9TA 2I0YA 2P55A 3DXPA 3NUNA 1JNKA 1WZYA 2QU5A 3CP9A 3G51A 2JFLA 3MH3A 4R5SA 4U40A 4YJPA 5DIAA 4BZNA 4AE9A 3HUBA 2VTIA 4U41A 5HCZA 3WOWA 2UZWE 1PXMA 1YOLA 4R7IA 1H1SA 3E8EA 5CT7A 4BCIA 4CFMA 1STCE 3I81A 4NM7A 2ZYBA 1H00A 2FA2A 4MNEB 1NVRA 4H3QA 4ID7A 4AT4A 2JC6A 3VWAA 5IMXA 1WMKA 2OJGA 4IAZA 5TKDA 5KHXA 4CV8A 4FX3A 3F66A 2ZB1A 2XK4A 2XK6A 4MTAA 3ORNA 2PMOX 3ENHA 3OWKA 4FV7A 4FODA 4V05A 5EYCA 5IA3A 4R77A 4NFNA 2FSMX 2C5OA 5C4LA 2QI8A 3O23A 3Q9XA 4V01A 2W06A 4UEUA 4IIRA 3ZEWA 1DI8A 4CFNA 3UMWA 5HX6A 1NVQA 4D55A 2PL0A 2ZMCA 5T68A 2YM5A 3KXGA 1YRPA 4JR7A 1FINA 3EL7A 2GS2A 4FVPA 4O0UA 5CF5A 1YI6A 3DTCA 4QMWA 3L8VA 4HGEA 3RBWA 1RW8A 4AGCA 3DU8A 4FV4A 4RBLA 4KIQA 3U4UA 4OTFA 3WZJA 1YWNA 5M4IA 4B4LA 4D2PA 4D5KA 4IW0A 4I93A 2XJ1A 2ERZE 2PY3A 1R1WA 2NRUA 1OI9A 5CF4A 3M1SA 5LWMA 1UVRA 4FZFB 4DC2A 3RCDA 4JJRA 5FLFA 4EH2A 1ZWSA 3UO6A 2XM8A 3QRJA 2ESMA 1U54A 2BTRA 5HORA 3UQFA 4FV9A 3DKOA 4RX7A 3RMFA 4BBMA 4EZ5A 4JX3A 5L2SA 1IA8A 3R9DA 5IDPA 1XBAA 1APME 3P7CA 3H9RA 4UZDA 5A4CA 2PPQA 2Z60A 3TL8A 3NNVA 2FSOX 3MW1A 3QKLA 4OT5A 2ZJWA 3REPA 4I4FA 2C6LA 3H10A 5AV1A 4JAJA 1M52A 1H28A 4G6OA 5AWMA 3BU6A 1FBNA 4IAYA 1E1VA 4A7CA 5FEEA 2WB8A 3F5PA 4PPBA 4KSPA 3BE2A 2UZNA 4TNDA 3VF8A 4RIOA 4RLLA 1EH4A 4LRKA 1M7NA 3W2CA 3CGOA 1V0BA 4J8MA 4H36A 4Y8DA 2R3KA 2YJSA 2HY0A 1F3MC 3OC1A 3W33A 4F6WA 3P86A 2XA4A 4QMZA 4ZTHA 4EH9A 3WZEA 1FOTA 4YUQA 5D41A 3IK3A 2F4JA 4WG4A 3SXRA 3DXNA 3WBLA 4AE6A 2JFMA 4A9RA 2QR8A 2Q0NA 2RFNA 3LVPA 5DA3A 4WG3A 3T8OA 2W1IA 3H3CA 2BMCA 4O0RA 3FKNA 4C2WA 2C3IB 3I4BA 4KBAA 4L3LA 3TKHA 4M68A 4TN6A 5KMNA 3NLBA 5A4TA 3R6XA 4J52A 3TJCA 4P7EA 1ZLTA 4C7TA 3B8RA 3ET7A 1JAMA 2QCSA 5C8MA 4AA0A 4JS8A 4RJ8A 4S31A 5LWNA 5IQGA 3DLSA 2X0GA 5EKOA 3S1HA 1XWSA 1K9AA 4X2KA 2O2UA 2GNFA 5CU6A 2ZMDA 2CSNA 1U54B 4F9AA 4CEGA 4EWHA 2QURA 4L7FA 3VBTA 2CKOA 4F0IA 5JGBA 4KB8A 3ATTA 3QKMA 5H2UA 1J1BA 2R3HA 2V0DA 4WBOA 3UIUA 3GQIA 4BB4A 5AAEA 4FNWA 5A9UA 2HZ0A 2QLUA 2UW3A 3R2YA 2G15A 4XP2A 5F95A 3EN7A 2W7XA 5EI8A 4GFGA 1YW2A 3LFCA 2YAAA 3ENMA 3MJ1A 3IW8A 2WMRA 3FEGA 3M11A 1VYZA 4IZ5A 5IQFA 3VHEA 1FQ1B 1UU3A 4KD1A 4EHVA 2B1PA 3GU5A 3EWHA 3R1SA 3GNIB 5CVHA 3AGLA 1O6KA 2OO8X 2VNWA 4TXCA 3ZZEA 5CSPA 2W4OA 1FMOE 3PLSA 4WRGA 3UDBA 5JEBA 3DB6A 5M06A 3M2WA 4CVAA 4OTDA 1TQMA 2LAVA 3PVGA 5FRIA 4QTBA 3S00A 4KKEA 2XB7A 1V0OA 3AMYA 4XLVA 4QQCA 1JVPP 5HE3A 2YDIA 4G5PA 1PYEA 3FZRA 3UYSA 1UU7A 3ORPA 2OG8A 5CI7A 4X6QC 4FK3A 2YM7A 1OZ1A 4FKGA 4NWMA 5HTIA 1OL1A 2WIPA 4QPMA 4CFUA 5HGIA 3O17A 4FTRA 3VULA 3GOPA 5LVOA 5DYJA 3OOGA 3H9OA 5EHOA 3LZBA 5CU2A 4GCJA 3ORTA 2IZUA 3KN6A 4CCUA 5KCVA 2YCSA 3MYGA 5AV2A 3LLAA 4GT4A 3QTXA 3EOCA 4FTAA 2VTSA 4KWPA 2ITVA 4QMVA 4CG9A 4C37A 2IWIA 2E9PA 5H9BA 5B2KA 4BZOA 4F65A 3OUNB 4FIFA 2VO3A 4DF3A 2CNVA 4Y83A 2WTWA 3QTZA 3E7OA 3A2CA 3PA3A 3LFEA 4BWXA 3MB6A 4DEDA 5IMEA 4CXAA 1W82A 4TYGA 4A4LA 4YP8A 4MKCA 3DJ5A 3CJFA 1J7UA 3F2AA 3G33A 2JITA 4RFYA 2X4ZA 4QMNA 1ND4A 2ITNA 5IA5A 4U45A 3E3BX 2BZKB 5FTOA 3FQEA 2X9FA 4RJ6A 4UMTA 4EEVA 1R0PA 3HNGA 3UNKA 3QQKA 4IC7A 4RVKA 4BI1A 3LFAA 4C33A 4DG2E 3E8NA 4XLIA 4ZTMA 4RX8A 2FVDA 4KNBA 3FLNC 3ORLA 4QMTA 3UC4A 1UU9A 4RIYA 3MY5A 3FLYA 2WXVA 4I24A 3CTHA 3VS0A 3EN5A 1H24A 4RC4A 3ZM9A 1WAKA 3RNIA 2R5TA 1ZYCA 3GI3A 4NCTA 4WOVA 4ALWA 4EH5A 3PUPA 4H1JA 1XH4A 4G6NA 3V04A 4L01A 4J1RA 2FUMA 3QGWA 4EL9A 1OBGA 5EDPA 2X6DA 3PP1A 2YM4A 3RAHA 2VWBA 3ZH8A 5J9LA 4MK0A 4GV1A 3KK8A 3HYHA 5DFPA 2YLEA 5A4EA 3Q5ZA 3KF7A 2OJIA 5HKMA 3F5UA 5LVPA 3ZU7A 4CT2A 5LXMA 3VBQA 4JRVA 3U8WA 4B8MA 3QA8A 3VHKA 1Q4LA 3L8PA 4RWJA 4BHNA 4DBXA 2W99B 1OL5A 1GZNA 4IX5A 2VWIA 1UKHA 4M8TA 3MWUA 3PLAE 3SG9A 4R3RA 2ZAZA 4IB3A 4JVGA 3QBNA 5L2QA 1PF8A 2QOLA 5HVKA 3PY1A 2OFVA 1PKDA 2J0IA 4Q2AA 5TF9A 5G1XA 4CKIA 5EQPA 4G5JA 3ZSHA 5CY3A 4CZTA 2I0EA 5FQDC 3HRBA 4O84A 1OM1A 2QO2A 3P7AA 4ITHA 4NKAA 5LVLA 5C1QB 3VBWA 3QU0A 3CKWA 1YXXA 3R7GA 3HV6A 3TNQB 5CX9A 3GXLA 4FYNA 5HTBA 4ASEA 5LMKC 5DVRA 2R2PA 3TN8A 5M09A 3DBEA 4EBVA 4QD6A 4FIHA 2GDOA 3TJDA 3L9PA 3EZVA 3W2PA 2C1AA 4DFYA 1A9UA 3AC8A 3VF9A 1P14A 2A1AB 4CRLA 5IQBA 5IEYA 2IZSA 3D7TA 3ZBFA 4N6YA 4EBWA 4ZIMA 4YTFA 4EH8A 2CJMA 3BWJA 4KIKA 2BRHA 3AC3A 3VS2A 2XH5A 3F3ZA 3PG1A 2RF9A 3PYYA 3DKGA 4YURA 3T3UA 3LCTA 3NS9A 4D4RA 2C30A 4QP3A 3CQEA 4QTAA 4EWQA 1XH5A 5FG8A 4FSNA 2C0OA 3C9WA 2YIQA 3MSSA 3NYNA 3I6WA 4ZOGA 2A27A 1YWVA 4IXPA 4ZZNA 3CJGA 4MWIA 3Q5IA 4EK5A 4O7YA 5CT0A 4JDKA 2RIOA 4R3CA 4QMMA 4V0GA 3UVRA 3W18A 3DT1A 3KRWA 3MVMA 4Q9ZA 3MFSA 2X2MA 4XV9A 3NMUF 4EC9A 2FSTX 3TIZA 1UNHA 1PKGA 2REIA 2QOFA 4ZJIA 1UV5A 4CMUA 4EC8A 4YHFA 5D10A 3DBQA 4DH1A 3DLZA 4K18A 3BIZA 4YJSA 1PXNA 2PZYA 2PMIA 3R7EA 2J5EA 4F70A 4NL0A 4FVQA 5C03A 3LKMA 4BBFA 4ACHA 1GZKA 3MH2A 2W4KA 3PDTA 1J3HA 3GCUA 4UMPA 4ZMEA 3HDNA 4JLCA 5IQAA 3PJ3A 4FKJA 2JD5A 4J71A 3R8UA 5LVMA 3ZC6A 1GJOA 3FWQA 5IQEA 2KULA 3BZ3A 2XBJA 3EQGA 3HV4A 4AOIA 2XCHA 2XKEA 1V1KA 4UYNA 4BYIA 4HVIA 3VQHA 5CNOA 3Q32A 4YNEA 5FM3A 4MBJA 1XH8A 3OCGA 4PL3A 1XH9A 4X21A 3S95A 2X7FA 4CGAA 4BZDA 2BRGA 3PSDA 4AT3A 4IDVA 3P08A 1PJKA 4OBPA 4FKIA 3TTIA 5A6OA 4QNYA 1LP4A 3DK7A 5IF1A 3DAEA 3HP2A 3F3VA 2F9GA 4KIKB 2BZJA 4OTHA 5C8KA 3L1SA 4FUYA 4QPAA 2BFYA 4QP8A 3VJOA 5HCYA 4NM3A 4BDEA 3KC3A 1R3CA 2J4ZA 3R71A 4FOCA 4XH6A 5HQ0A 4FSRA 1BL6A 3Q6UA 4PWNA 3GC9A 3QCSA 4GK3A 3RPVA 3FYKX 4YLLA 5IEVA 5HIDA 3R9NA 3BBTB 2Y6MA 4AZSA 3AG9A 4IFCA 3LJ2A 2QOCA 4V0GB 4QQ5A 5J5TA 4NFMA 4B99A 1UWHA 3PZEA 5I9UA 3TI1A 5AP3A 1O9UA 4NZWB 3Q4UA 3NUSA 2QO7A 3P4KA 1J7LA 5CF8A 4M66A 4PX6A 4C36A 1IAHA 2IVVA 2Z2WA 3GBZA 4DEBA 3D5UA 3QTIA 3OT3A 4ZSGA 5ANEA 3DKCA 3CY2A 2CKPA 4AQCA 5LCJA 3U6IA 4ASXA 3DB8A 3KRLA 5HE2A 1BMKA 5JFWA 1KUTA 5IUHA 4ANMA 3FI2A 3RHKA 3FAAA 3ATSA 4U81A 3M42A 3MVHA 5DEWA 4DLJA 2GNLA 5CWZA 3KF4A 4GJ3A 3C4ZA 2BVAA 3KRRA 3AC1A 3MVJA 4PUZA 4C3FA 2OXXA 2R9SA 4DFUA 2NRYA 1IG1A 3OG7A 4P2KA 5J87A 4F9YA 1I09A 2OGVA 3TT0A 3CIKA 4RT7A 5ICPA 4RJ4A 4Y85A 5E1EA 3DZQA 5BUIA 5HNGA 4IADA 3LLTA 1JKTA 5K0XA 4QMUA 4N0SA 3DNEA 3QQLA 4X6RA 5F20A 5HG9A 2JLDA 5CASA 3S2PA 1MRYA 3R9OA 5J9YA 2DWBA 4O0XA 1YDRE 1UNGA 2EB3A 4FL2A 3UOHA 2OBJA 3BV2A 5FTGA 5LJJA 3LQ3A 1JSTA 3D5VA 3HA6A 2B9FA 1ATPE 5JMSA 2H6DA 2IZTA 2C0TA 4JOAA 3R0TA 4FT9A 2VGOA 4HCUA 3COMA 4WG5A 5K3YA 4MD8E 4ARKA 4S2ZA 3PRFA 4GRBA 4NYEA 2R3PA 3UODA 3SX9A 5DT3A 2JDTA 3F3UA 3CPCA 4I23A 4DINA 4AOJA 3ELJA 1GIHA 2PULA 1H4LA 3B2TA 2BPMA 1ZY5A 3LCDA 2ONLA 3BLQA 5HOAA 4YO4A 3BHYA 3HX4A 4G9CA 4TWOA 2VX1A 4FC0A 3W2SA 5BVKA 1OBDA 5HIBA 3LMGA 3NCGA 1LEWA 4RVTA 4AA4A 2PTKA 5AM6A 2QOQA 5L8KA 3FMDA 5AA8A 4I20A 3MV5A 2BTSA 3Q9YA 4L43A 3DY7A 3OOMA 3F3WA 1H8FA 4FMQA 4NKSA 2OXDA 4HVHA 2PVLA 2HXLA 2YIRA 4NTSA 2P4IA 5EW8A 5CALA 5I5ZA 3NUAA 4MXZA 2R3FA 2Z7RA 1ZOHA 4ZSLA 5BVNA 3W2OA 4XCUA 2GNHA 3PXKA 4ERKA 2E9VA 5HO7A 4LOQA 5KNJA 1M7QA 4I6BA 2WTKC 1YHVA 2R3MA 3O8TA 4HYUA 4AFJA 3MTFA 4LV8A 4C3RA 4Z7HA 3ZFYA 5K5NA 5CAOA 3LCKA 1URWA 4TT7A 3GC7A 3BRBA 4EHEA 3Q2JA 4E20A 4EONA 3PIYA 2HWOA 3R8PA 4G3GA 3VIDA 3ZSGA 3DAJA 4TWNA 5E91A 4QMYA 3N4VA 3PPZA 4D2RA 4I1ZA 4GKHA 1M14A 4MAOA 2UW5A 1U5RA 3R21A 4FNZA 3CE3A 2O0UA 5F94A 3HGKA 2W9FB 3PJCA 2BRNA 5FUTA 1M2RA 4E4NA 4MVFA 1Q62A 4DAWA 3VW8A 4OTRA 2WIHA 3FKOA 3ZUVA 2GNJA 4ANSA 3DDPA 5AV3A 5CSHA 4CYIA 4U44A 2JIVA 2J0MB 3LPBA 3SLSA 3VUDA 3WIGA 4FT7A 5D7VA 4GUBA 3IDCA 3BLRA 4CTCA 4CQEA 4J96A 4FSYA 5GZAA 3IG7A 4MD7E 4WO5A 4CTBA 4P5ZA 4YU2A 4LV5A 3EJ1A 4G17A 4GIHA 2OLCA 1WBPA 3AT3A 2CGUA 4YSMA 4PL4A 2JKOA 2AUHA 2QHMA 2BILB 4EK8A 3RPYA 4HNFA 5C01A 4BGQA 5EYMA 2BHEA 1UU8A 3W8QA 1Y8GA 2ITQA 4XEYA 3GUBA 2ZV7A 1QMZA 5J9ZA 4H3PA 4DCEA 3ZO2A 3H9FA 5FDXA 3E93A 3SXFA 3ZCLA 2QO9A 2WMAA 4M97A 3BYMA 3ZRMA 4L42A 1OUYA 3RALA 3A7HA 2J0JA 2R3RA 1SVEA 2WEIA 2PE1A 3EKNA 3IPHA 4EHGA 5JRSA 5M4FA 1ZY4A 4O0WA 3QTUA 3VJNA 4F1OA 3FI8A 4PPCA 5A46A 3MPMA 4GFOA 4U5JA 4ZZOA 2IJMA 2X39A 2YWPA 4H39A 1WCCA 1Y6BA 2GCDA 3LIJA 4UB7A 5IDNA 4AN9A 5J5SA 4XS2A 3PWYA 4O82A 3Q4CA 4L46A 1P2AA 2O5KA 4FKVA 2PE0A 2X8EA 3DJ6A 2B55A 4TKSA 5CSVA 1H1QA 3R73A 4Y73A 2BFXA 4KBCA 3PWDA 2V22A 3TZ8A 3E88A 1AD5A 5EYKA 4LRJA 5JK3A 2VTOA 3R22A 1WVWA 1DI9A 1XHAA 4C34A 4CKJA 2GNIA 2Y0AA 4NTTA 4O2PA 5DT4A 4CRSA 1KE6A 3ALNA 4CFVA 2UZUE 3DFAA 3I79A 2XIRA 1DAWA 4GK4A 1IR3A 4JIAA 4MCVA 5GJFA 3VBYA 3QLGA 4AZFA 3NRMA 4BDHA 4QP1A 4A9UA 4YZDA 3OFMA 3PTGA 3TZMA 4Z16A 5T6KA 3UIXA 2O63A 3V6SA 4DYMA 4E93A 3GU7A 3P9JA 5EM5A 4WNOA 3QTQA 3V6RA 3KVWA 2ITOA 4CFXA 4C4IA 4EK4A 1GIIA 4USDA 4WNMA 4HGSA 5FXQA 5CAPA 3U87A 3R04A 2C6MA 4AN3A 2UZDA 4DGMA 5IH6A 1WVXA 5AR4A 2G2IA 4FKSA 5AADA 1WBSA
chains in the Genus database with same CATH superfamily
3EN9A 1ST0A 5CTPA 2I40A 4WKQA 2NO3A 3E62A 2VU3A 3I7BA 4FKTA 4X3FB 5CENA 2UZVA 2AC5A 4D2TA 2QC6A 4NH1A 3NW6A 3OWJA 3GU8A 1W83A 3QYWA 3FI4A 4AFEA 5J7HA 1FVTA 1PMUA 1IASA 4ACCA 4YSJA 3OWPA 4O0SA 4E5WA 4O0VA 4XG9A 4GT3A 4L6QA 3ZM4A 5EG3A 2ITYA 3NEWA 4FTTA 4ZTNA 4L00A 3ZUTA 5HLNA 2RG6A 5K5XA 3QQGA 4IDTA 2IZRA 5L2TA 3L8XA 5E8YA 4ACGA 3D5XA 3UVQA 5FDPA 4FR4A 4WRSA 4AXDA 3Q9ZA 4P5QA 4W8DA 1MUOA 1AQ1A 2VWWA 3C4WA 5ETCA 5HO8A 3LXPA 3VRZA 4IM3A 1Y6AA 3C50A 3OEZA 4TPTA 5E90A 4ITIA 4IB1A 4RMZA 2ZV9A 5DE2A 4JG6A 4L3PA 4BCGA 3ML1A 4QYFA 3TTJA 3II5A 3V01A 3U51A 4I21A 3MI9A 1KE9A 3ZS5A 3WF8A 2C1BA 1W2FA 5CEIA 1RJBA 3ZRLA 5EOLA 2XAOA 3SA0A 2YCFA 4O4CA 3VRYA 4FSTA 3V5PA 4FSZA 2XCKA 4E4MA 1ZYJA 3UGCA 5IUGA 3TDVA 3HZTA 1E1XA 2G1TA 2CNQA 2UVZA 2WTVA 3OW4A 3PXZA 4PP7A 3D0EA 3AC2A 3QF9A 4DH5A 4ANNA 1PXIA 4KA3A 2W1EA 4BICA 3IW5A 3UC3A 3GEQA 4WT6A 1BI7A 4U42A 2PVYA 3KY2A 4AT5A 4R1YA 4DH3A 4BDDA 3C1XA 3RINA 2Z7LA 3MGYA 4II5A 5IQCA 3HV3A 4QYYA 2CDZA 5GIPE 2WAJA 4E8AA 5IUIA 1M2QA 5IQDA 3NX8A 1URCA 5KMMA 5E4HA 4I0SA 3QZHA 3VUIA 5LARA 4LV7A 1OPKA 4KS7A 1AGWA 3DKFA 3PFYA 3ZDUA 1ZAOA 3AT4A 3IDBA 4IFGA 4QQJA 5I9WA 2J0KA 2NPQA 3RWQA 3TWJA 2HY81 5FGKA 5JT2A 3W0QA 4AWIA 2OF4A 2UVYA 4M14A 3R1YA 2CGXA 3KFAA 2CGVA 3F69A 3GGFA 3EQPA 4BDBA 4E5AX 3NSZA 3RK5A 5M07A 3ULIA 4A4OA 3IS5A 3EB0A 2B54A 5AUUA 2ETKA 2YEXA 1P4OA 5EKNA 4I0RA 4GJ2A 5HESA 3TXOA 4O7ZA 1SVHA 4D58A 4JIKA 3U9NA 3LW0A 1ZOGA 3IO7A 3IOKA 4Y46A 3OY3A 2J6MA 4XG6A 5J1WA 4F9WA 3ZYAA 2W05A 3EKKA 4RIXA 5EHLA 5HX8A 5K9IA 3FXWA 2B7AA 2YIYA 2UW8A 4MH7A 3R30A 4MX9A 3P7BA 2XMYA 3L9NA 2I0HA 5AUTA 4ZS0A 3KULA 4W4VA 5AUZA 3POZA 4F1TA 4HYSA 1OKZA 3D9VA 4AG8A 4IAKA 1KOBA 2PZ5A 1Z5MA 3C0GA 3O8UA 3NUPA 4AXFA 3WF5A 1P5EA 2QKRA 4NIFA 3A62A 2IVUA 5IZFA 4QYHA 3RPRA 1H01A 4DGNA 4KBKA 5JSMA 5AR7A 3O7LB 5DGZA 2IW9A 2XAMA 4XHKB 3V8WA 3RPSA 2FGIA 4D1SA 3SG8A 2C6KA 1YXTA 3MIYA 1KE5A 2IVSA 4X2FA 4Y72A 5DLSA 4BL1A 4DHJA 4M0YA 2UW0A 2PZIA 3COHA 4EH7A 3TDWA 2VWVA 5CAUA 1X8BA 3ZOSA 4B6LA 2HIWA 4BDAA 4CSVA 4A9YA 2UZTA 4GH2A 2SRCA 4QEBA 5AMNA 3A61A 3HMNA 4LMNA 3TCPA 3I5ZA 1VJYA 3G9LX 5AP1A 5EW3A 5KE0A 3ZUUA 5AAGA 4EORA 4IC8A 3ZXZA 1PMVA 4J7BA 4BGHA 3COIA 1KOAA 3PJ1A 3RNYA 2HAKA 4OUCA 2YWVA 5TR6A 2F2UA 2J2IB 3FL4A 3OWLA 4BIEA 5AV4A 2VTRA 3AMBA 3GU6A 5CF6A 4BVUA 2E9NA 1JLUE 5HG8A 2QODA 5FXRA 3SKCA 2R7IA 4RVLA 3BYUA 4EOPA 4I3ZA 3G5DA 2QU6A 5HG7A 1BI8A 4FTIA 3EQBA 5KMIA 5CEOA 4EOJA 2OK1A 1OIYA 3ODZX 4IZ7A 4XG8A 1BUHA 4XOZA 5L8LA 5E92A 4Y95A 5TO8A 4CLIA 4MYGA 2OZAA 4G3FA 4TL0A 1Y91A 4YJRA 4AW1A 4M69A 1A48A 2ITTA 4LUDA 5HLPA 1SMHA 5I9ZA 5HBEA 2BZIB 4BKZA 4FT5A 3TNPC 4EK3A 4I41A 4YLKA 3PFQA 1PW2A 2VWXA 3QTSA 4FZ6A 2JDSA 3KULB 2WQMA 3VW6A 3RWPA 1CTPE 3JS2A 3A7FA 3SOCA 3FBVA 4FSQA 1RDQE 4FKRA 3Q9WA 1ERKA 1JOWB 4G31A 4BTKA 4C3PA 3P0MA 4NIFB 2YIWA 4RIWA 2EU9A 3Q4TA 5EYDA 3MTLA 4MXYA 4DBNA 3PP0A 2W1FA 3C4EA 4QP7A 4ORKA 5AUWA 4IVDA 2A98A 3FMJA 3RK9A 4O21A 3EH9A 3FSKA 3SRVB 4IMYA 1WBNA 1WBWA 3W1FA 3ZBXA 4K9YA 4OAUC 3GCPA 5E9EA 5BVFA 4AGUA 4JBVA 3F88A 5DEYA 1L3RE 2P2HA 2AC3A 5FEQA 5IG1A 5JKGA 2UZEA 2XKFA 2FB8A 4HPTE 1CKPA 2PZRA 2GQRA 1Q8YA 1JQHA 4R78A 3R9RA 3K3IA 4C02A 4BI0A 4J98A 3EQDA 3HMMA 2P2IA 3NNWA 2C5NA 2UZBA 3LE6A 4ZAUA 1H1RA 2PE2A 3I0QA 4QTDA 2WQEA 3SHEA 3W32A 2GFCA 1CKIA 4D28A 4R7BA 5IEXA 2GTNA 4FV6A 3JY9A 1PXLA 4RRVA 5ANOA 2R3QA 2BRBA 4PY1A 1OKWA 4O7TA 2OF2A 3CPBA 3RTPA 3E64A 5DH3A 3V8TA 5IA1A 2B4SB 5EW9A 2J50A 4BBEA 3D5WA 4FG7A 3PZHA 3QFVA 3TV4A 4I0TA 3ORIA 5CU3A 4DTBA 2R3JA 4RJ3A 4D9TA 4CYJA 2CN8A 3EYGA 3R01A 4CFWA 4YMJA 4IWDA 3NAYA 4HJOA 5HNIX 4ZLZA 3PVBA 3ZFMA 2X81A 3TV7A 4HVGA 4E7WA 4QRCA 4RWIA 4I6HA 3PXYA 3FV8A 3SD0A 3G0FA 2BALA 2VO6A 4OTWA 3K5VA 3BQRA 1WBVA 4NK9A 5AUXA 3RAIA 4PTEA 3PXRA 1QPCA 3MVLA 5JZNA 4EOIA 1R0EA 2JKQA 3QWKA 4XRJA 3WE4A 3TNWA 2VWYA 4CZUA 3QRTA 5DWRA 3AKKA 3DXQA 2C47A 3BE9A 5CS6A 2CCHA 1H26A 4L53A 3W2QA 5KMOA 2VAGA 1OB3A 3FSFA 5LCKA 4IE9A 4JDJA 3B2WA 4R5YA 4ZSEA 3DGKA 4X3JA 3QCXA 5IA0A 3NVMB 5CEPA 4FZAB 2VX3A 1YKRA 2RL5A 4PDPA 4E6DA 3QC9A 3F2RA 4IAIA 3PA4A 5GNKA 3O5AA 3NNUA 4K77A 4AZTA 4EHZA 5BUEA 3C5UA 1RE8A 4XG7A 5EK7A 3FMHA 1W7HA 5AFVA 4FEXA 3R8VA 2UVXA 3IW6A 4ZJJA 4EOLA 3F2NA 3R7UA 5DG5A 4S34A 2VN9A 3JUHA 5HVYA 4BDFA 4JG7A 5EDQA 3O51A 2OICA 1LR4A 2F7ZE 2ITUA 4M84A 1SNUA 3CLYA 4FL3A 2R64A 2JDVA 3TM0A 5JZJA 3SV0A 2XNEA 5T3QA 4EUTA 5B7VA 4DGOA 4EZ3A 1Q8TA 4L52A 2H34A 5GJDA 5H3QA 3NYVA 4RIYB 4GFMA 4O0TA 5E8XA 4H58A 1CSNA 3G0EA 5FEDA 2W5HA 4EOQA 2PVKA 3E8DA 4PMMA 3RKBA 2HW7A 5L8JA 3FHRA 1U4DA 4ZXTA 2JAVA 3EYHA 5GINE 4FTKA 2E2BA 3A7JA 2HWPA 5JGDA 5HU3A 3RM7A 4ENXA 3EHAA 4UX9A 5HTCA 5BNJA 1SVGA 4CT1A 3PE2A 4QMOA 3BHUA 3U55A 4FV8A 3P5JC 4ITJA 3HP5A 1PXKA 2XBAA 3V8SA 2QQ7A 3UP2A 4F0GA 4Q9SA 1IA9A 1J1CA 5DI1A 5DR2A 3RAWA 1WBOA 3N51A 3R63A 5DBXA 3I60A 2BKKA 2YAKA 4WD5A 2XP2A 2CNUA 2WO6A 3CCNA 1R78A 3BX5A 5KMKA 5LMKA 3P78A 4DFBA 1HCKA 2VTPA 3EQIA 4YZ9A 3PA5A 4FGRA 1JPAA 1MRVA 3VAPA 4LL0A 2WTDA 2V55A 3EZRA 4R1VA 2ACXA 4U0IA 1K2PA 4GIIA 4EQUA 2RGPA 4IX4A 3V5QA 1OL6A 4JQ7A 3FXZA 4BCKA 4E6QA 3OS3A 2R3OA 1YVJA 3BEGA 4DLIA 2W0JA 3R7OA 3ZDIA 2ZM1A 5CEMA 1G8SA 1TQIA 5K4IA 1IRKA 4CCBA 4MXCA 2WMQA 2QOKA 4JDIA 5JGAA 5KBQA 4RSSA 4XUFA 2RFEA 1Q8ZA 2LGCA 2J7TA 4PP9A 5AUVA 4FT3A 4OBOA 3NGAA 5AIRA 3TZ7A 2VTHA 4WUAA 2WOTA 4FIJA 3O0GA 3VS3A 4LMUA 2Z8CA 3ROYA 3FPQA 1VYWA 4LM5A 4J99A 5GIOE 3D7TB 5HD4A 4B0GA 5ANDA 5IH4A 5IPJA 3SAYA 3AKLA 5M53A 4W4XA 1P4FA 4ANLA 4C62A 3QYZA 3C4FA 3DAKA 2JEDA 3I7CA 3UJGA 4IB5A 4EQMA 2OW3A 2OSCA 4IVBA 2O65A 4KIOA 1M17A 1U46A 2R0UA 4Y5QA 4AA5A 4EOKA 4F64A 4GYGA 5FWKK 4TYJA 4IB0A 4AZVA 3OBJA 3AD6A 3LCOA 4C0TA 3FLQA 4I5PA 2ZV2A 2GNGA 4FKWA 4GT5A 3JY0A 4KSQA 2PVFA 2R7BA 3FXXA 5ITAA 3L9MA 5BVOA 5ETIA 3SXSA 4F6SA 3TYKA 3POOA 1QPEA 4C4EA 1Y8YA 2G01A 3A60A 3GFWA 3MS9A 4WIHA 4FTUA 5EM6A 4IWPA 3RVGA 4D1ZA 4DG0E 3HV7A 3R28A 4C2VA 4BKJA 4QMLA 3UOJA 2Z7QA 3LM0A 3FMEA 1YDTE 3AXWA 2A0CX 3ODYX 4MNFA 5DN3A 2CHLA 3OZ6A 3THBA 4C38A 5FP6A 5L6OA 3P5KA 3QZIA 4HGLA 3FZOA 1JKKA 4L3JA 2GQSA 3EMGA 5HNBA 3EFWA 1YXSA 4MQ2A 4EH4A 4BTJA 2X1NA 4FIGA 3QD2B 4BTMA 4ZTRA 4WNPA 2VZ6A 2Y9QA 3GT8A 4NT4A 4AXAA 2DS1A 4CD0A 5GZ9A 4A4XA 5I3RA 3SDJA 3TACA 4BGGA 2QKWB 2UW6A 3Q2MA 3CGFA 3FLWA 3D2IA 5B0XA 3RGFA 3BEAA 3ITZA 1OIQA 2G9XA 2V5QA 3Q60A 3SRVA 5BPYA 4YPSA 3KXNA 1ZMVA 2QONA 2WMXA 4GU6A 4I92A 3IW7A 3MH0A 4XG3A 4X0MA 2WKMA 3ZONA 2ZDUA 2CLXA 4FV3A 2YHVA 3A8XA 3CTQA 5HI2A 4E4XA 4D4YA 5E8ZA 4MF0A 4ASDA 5C4KA 4YHJA 3FPMA 5CVFA 3LHJA 3KXXA 4ZMFA 3QC4A 2HK5A 3ACJA 2JAMA 3PJ2A 4BF2A 3R83A 2QR7A 4YTIA 4NU1A 3IDPA 3QA0A 4WUNA 4A06A 4F08A 4JR3A 2QLQA 5FBNC 5C27A 1CMKE 4EKLA 4FEUA 3EIDA 5DRDA 4UBAA 1Q5KA 5DPVA 3G90X 3AQVA 4ASZA 4BCJA 1SZMA 4IACA 4D5HA 2OJFE 3AD5A 4KKGA 4U3ZA 4B8LA 4O2ZA 4U43A 4EH6A 3PXQA 1H0VA 3BKBA 4RWKA 4I6QA 3QTWA 3KRXA 3T9IA 5JRQA 4UALA 3C7QA 3RAKA 3QD4A 4JX7A 5CYIA 4IX3A 3ZHPC 4UMUA 3W0PA 2BUJA 4GW8A 1F5QA 3PRIA 4RJ5A 4MQ1A 5D9HA 3GCQA 4H1MA 3KGAA 3BHVA 4TY1A 2OH0E 3Q53A 3QRUA 5AV0A 5FM2A 5M55A 4TW9A 4LGDA 3BYSA 4QDVA 1NXKA 5K4JA 2XK7A 3GC8A 2V7AA 3PY3A 4IH8A 4PNKA 3O71A 2ZFYA 4GKIA 3CBLA 2C3LA 4AW0A 4PL5A 1H08A 3O50A 4YGAA 2VV9A 3FQSA 2XNGA 4ANBA 3EFLA 4XBUA 3FZTA 4RC2A 3GOKA 2HZNA 2ZVAA 5CNNA 3MFRA 2QHNA 3EN4A 4AP7A 4FTNA 3ERKA 4FTOA 5A3XA 4BHZA 2B9JA 4RA5A 2YABA 4DT8A 3OTUA 5CANA 2NP8A 4GG7A 4QTCA 4X2GA 4OTQA 4ALUA 2XKCA 4JG8A 2R4BA 4JRNA 1OUKA 4FV1A 1KV2A 3QWJA 5J95A 4DGLC 4EZ7A 3UIBA 3KVXA 3DZOA 5IA4A 4ZEGA 4BR3A 4KAOA 4Z9LA 5EOBA 3H30A 3NR9A 4L9IA 4S30A 1V0PA 5M08A 5HCXA 2XS0A 4YJOA 3COKA 3QTRA 2UW4A 3BWFA 4I5HA 2ITZA 2PU8A 3P1AA 1Q24A 2GHGA 2R3NA 3DS6A 5EH0A 3EN6A 2EWAA 4WSQA 1WBTA 4XP3A 4AW5A 4RFMA 2PVHA 3T9TA 2YM6A 2B9IA 4TYHA 3WE8A 1XH6A 2XNBA 1XBCA 4DTKA 5L2IA 3UBDA 4YZMA 1ST4A 1Q61A 1FVVA 4TZRA 4PMPA 4AUAA 2OJJA 4YPDA 4JT3A 2PYWA 2BRMA 3PVUA 5FBOA 3PVWA 3W10A 2E9OA 3HVCA 1T45A 4DH8A 4F1MA 1O6LA 5E8VA 5L3AA 2NYAA 2ZDTA 3HMPA 4EK6A 4X3FC 5CVGA 4BFMA 5A4LA 4BDJA 4FSWA 1FVRA 1Z9XA 4TWCA 1R39A 5JQ5A 4AAAA 3ACKA 4IWQA 5JFVA 1TVOA 2BDWA 4FIEA 3DTWA 3VUHA 3O96A 3R1QA 3GCSA 5IQIA 2C5YA 4IVCA 3K54A 2WOUA 2XK8A 4AS0A 4QTEA 5BQ0A 1Q99A 2QNJA 2HZ4A 2KTYA 1QL6A 3D7ZA 4HNIA 4I6FA 4ACDA 4LRMA 5A54A 5IH5A 3W0OA 1H0WA 3D4QA 2XUUA 1ZMWA 2IO6A 2VTMA 1OKYA 2JBOA 2OFUA 3OCTA 3HDMA 5AP4A 5KZIA 2OU7A 4GSBA 3W55A 1B38A 2CMWA 3LQ8A 1GOLA 3VQUA 3HUCA 4ZJVA 5A4QA 4IM2A 3F5XA 3T3VA 2W1ZA 4FTJA 2ZV8A 4C4FA 1ZXEA 4ZTSA 4IBMA 3OMVA 2Y4IB 4FICA 3QXOA 1XKKA 3I5NA 4O4BB 5DNRA 3VONA 4RGJA 3UOLA 2CN5A 4O38A 5CI6A 3GVUA 3PJ8A 2VO0A 2FSLX 4BDKA 4LDTA 4FV5A 5J8IA 4WSYA 3GP0A 4M7IA 1KE8A 4XJ0A 1FGKA 4M0ZA 3UOKA 1WVYA 4USEA 3UZTA 4JMQA 4HYHA 3ZTXA 1OIUA 4D2VA 4DFXE 4R3PA 1K3AA 4CQGA 4JXFA 1SM2A 5D1JA 3KKVA 2QOBA 2W1DA 1YHWA 1TFFA 3ULZA 3E8CA 2O64A 4DEGA 4K2RA 3AC4A 1Q3DA 3ZO4A 3OROA 1YQJA 3UG1A 4BDCA 4HCVA 2OIDA 5D12A 3BQCA 2WTIA 5K0KA 4R6VA 3ZLXA 3Q96A 2WU6A 2B52A 3SC1A 5C9CA 4V04A 4E26A 2UW9A 5HICA 3ZLSA 3ANQA 1OIRA 3FLZA 4L67A 5E1SA 5AP5A 5BX0A 4IZYA 4DFZE 4FJVA 2VTTA 3NYOA 5EM8A 1LPUA 5CEKA 3PPJA 3SW4A 2W5BA 4HZSA 3QCQA 4UMRA 2IN6A 3DPKA 4IWOA 4MXOA 4FZ7A 2YDKA 2BAJA 4TRLA 1ZYLA 4RWLA 3AT2A 4G2FA 3QCYA 3NIEA 1W84A 1Q8UA 4GMYA 1S9JA 2QOOA 3ZZWA 4BY9E 5CQWA 4F63A 4N57A 3OTVA 3W8LA 4GUEA 1MQBA 4JL9A 4JQ8A 5F1ZA 4Z3VA 2WMVA 3F7WA 2YZAA 3HA8A 4EYJA 4GVJA 1OECA 5L2WA 2EUFB 4I5CA 3B8QA 2YACA 3ANRA 2AQXA 4JNWA 4M67A 3UVPA 4YTCA 5BVDA 4AACA 4Z55A 4MXAA 4CFFA 1CKJA 3E5AA 4GU9A 4CKRA 1BL7A 3KMMA 4K1BA 3QQJA 4F7NA 5A14A 3ZRKA 1NA7A 3HRCA 3IKAA 3DK3A 2FH9A 2HXQA 3NYXA 5D11A 5BVEA 5TT7A 5DR6A 2BAQA 5KKRB 4LL5A 1XQZA 4O27B 2JDOA 4O81A 2OIBA 3VUGA 3HRFA 3S4QA 3TG1A 4IM0A 2YLFA 2V62A 2YZLA 1NY3A 4W9XA 5HE1A 3LXNA 3I0OA 3LM5A 4I94A 3QD0A 2RSVA 2J0LA 1CM8A 4QP9A 3HECA 5HIEA 2R3IA 3FUPA 3TKUA 3MB7A 3TNIA 4RG0A 3UIMA 3QUDA 5M56A 3I1AA 3G2FA 3NUUA 5M44A 1YI4A 1Q41A 2EXEA 2WQBA 2WTCA 2Y8OA 1JSUA 5M57A 4XOYA 5JH6A 2HOGA 5HZNA 4AQKA 3D2KA 3MJ2A 5J7BA 2F57A 3KRJA 3TV6A 4HVDA 3UO5A 2HZIA 3W2RA 3WF9A 2Z02A 2Q0BA 3JVSA 3PXFA 2ETRA 1E9HA 3W16A 3BBWA 3E3PA 1QCFA 3OT8A 4NUSA 3KIOC 5J79A 3WYYA 1G5SA 1UNLA 3QXPA 5ANKA 3JVRA 2RFSA 1BYGA 4FBXA 3BI6A 4FZDB 4E73A 2B0QA 1GIJA 2XM9A 4C58A 4U3YA 4GK2A 3RPOA 3UE4A 2W1GA 1H1WA 4FG8A 4NJ3A 3FC2A 5LQFA 1OVEA 3U6JA 4L7SA 4O7LA 4MXXA 2GFSA 4AW2A 1KE7A 2ZOQA 2OXYA 4GVAA 2YN8A 2UV2A 2VX0A 4ZSJA 4Q5HA 4QQTA 2I7QA 5M4CA 4D2WA 4ZS4A 3LFFA 4FKPA 5HG5A 4CMTA 4HVSA 5AP7A 4AZEA 3EL8A 1GZOA 3MBLA 4B7TA 4F7SA 3QZGA 5EM7A 4C57A 4C61A 2WMUA 3C4CA 1XMLA 3BLHA 3KCKA 4IVAA 2G2FA 5G6VA 3DJ7A 3U4WA 4MD9E 2YIXA 2E9UA 2WGJA 3FYJX 4AX8A 3AC5A 4AZWA 3A4OX 3FHIA 4JAIA 5IISA 4DDGA 4JI9A 3CQWA 4QO9A 2JGZA 3MFTA 4NJDA 2ITXA 3Q04A 3F82A 1GNGA 4W8EA 3OHTA 3DV3A 3KQ7A 4FEQA 4UZHA 5M51A 4M12A 4PTGA 2Z7SA 5L6PA 3UPZA 2H96A 2C6EA 3ZEPA 4G9RA 3NPCA 5IU2A 4IANA 5BYYA 5AEPA 3DOGA 2YM8A 5HLWA 3ZMMA 4C4JA 3WF7A 4IAFA 3UQCA 3F3TA 2JDRA 3UG2A 4L45A 4FKOA 4H05A 3N9XA 3OCBA 2GHLA 4OTPA 2GTMA 3MH1A 4I6LA 4JDHA 5HD7A 2XYUA 3H0ZA 4L44A 2C69A 1M2PA 4FK6A 4DEAA 3R2BA 2HENA 3OCSA 4D4VA 2XEYA 3C4XA 2I1MA 5KX8A 4OLIA 3FKLA 2YDJA 2GQGA 3WF6A 4FKQA 3C0IA 5BUJA 1MQ4A 3OBGA 4OTIA 4ZTQA 4RX9A 1IAJA 4KS8A 2X2KA 5DMZA 2B53A 4RA4A 5AA9A 4HPUE 3LMHA 5CXZA 4RIXB 5ANGA 4YJNA 5TOZA 4MWHA 3MPAA 3FLSA 4DA5A 4IQ6A 3FJQE 3OXZA 2XIXA 1HCLA 4FNYA 4FYOA 2C0IA 4O6EA 5AUYA 2YISA 3VNTA 1XJDA 3NVKI 1MP8A 1H27A 3MY0A 3QRIA 4YBKA 5D7AA 2H9VA 4XV3A 4DITA 4YR8A 3NDMA 4FG9A 3K2LA 4U7ZA 2PWLA 3FC1X 4GS6A 4OT6A 5F4NA 3CSVA 1KWPA 3KMWA 4YBJA 4WHZA 2P33A 3NW7A 3JR1A 4KUJA 3UMXA 3CR0A 3FZPA 2HCKA 3OVVA 2BDJA 3TNHA 3KN5A 3ALOA 3TIYA 4DFLA 4ENYA 4YJQA 3AOXA 1J7IA 3QQFA 2C3KA 5I4NA 4DEIA 3RK7A 2GU8A 3G9NA 4ALVA 4XG2A 3VUTA 2X4FA 2A2AA 4FOBA 4E5BA 5I9YA 2PVMA 2BIKB 5B2LA 3RZBA 1T46A 2XJ0A 3OY1A 4AU8A 2ZB0A 5ANIA 2B9HA 2WFYA 4O7SA 3LFBA 4BTFA 3VUKA 4S32A 2W1CA 5CU4A 3ORXA 1QPJA 4ZLOA 3VS5A 3EQFA 4AXCA 4J97A 3SQQA 3U54A 1IEPA 3OXIA 3RHXA 4OBQA 1REKA 4YJVA 2XNOA 4G1WA 1PRYA 5EHYA 3HEGA 5HVJA 3PSCA 3O2MA 3QL8A 3VS6A 1W98A 2Y6OA 2RKUA 1NVSA 2GPHA 4NCTC 5KMJA 2PUIA 5AP2A 3WZKA 4FSMA 3NFFB 3UDZA 4QNAA 2OZAB 3EQCA 3R02A 4JBOA 4NW5A 1UA2A 3UZPA 2A4LA 4M69B 4XNEA 4E6CA 1TKIA 5IKWA 4P90A 2CLQA 3QHRA 4YJTA 5M4UA 4CG8A 5E8WA 3QRKA 5LMAA 5CLPA 2WNTA 3MFUA 2X9EA 5AX9A 1FMKA 1OL2A 5FD2A 4QMSA 5AR2A 5HBJA 1OMWA 3DQXA 1ZZLA 4YJUA 4EOMA 4ANQA 4AAYA 3VS4A 2OJ9A 1PMEA 1W2CA 5LVNA 4U8ZA 2VTAA 3QLFA 4RIWB 4GEOA 4XG4A 2RFDA 3NW5A 2DUVA 4X7QA 4A9SA 3JXWA 2F2CB 3E63A 3DA6A 2IPXA 2WMSA 3BPRA 2C6DA 3N4UA 2IF8A 1YWRA 3RM6A 3TUDA 2QD9A 4NM0A 4LOOA 4G3CA 4K33A 2Q83A 2QOHA 2VNYA 3AD4A 4PPAA 2ETMA 4BDGA 5B2MA 5HEZA 4D4SA 1DS5A 3QGYA 4NSTA 4D2SA 1XR1A 3G6GA 2UW7A 3FY2A 2XRWA 2VO7A 2EXMA 1UWJA 3Q6WA 3HKOA 2XJ2A 2P3GX 4JQEA 5DOSA 5HO6A 5ACKA 4H3BA 3GC0A 4O4EA 4LGGA 2QG7A 4HW7A 3C51A 4QMXA 5BMMA 5EI2A 4FE2A 5H8EA 1BX6A 1DAYA 1Q97A 2VWZA 2VRXA 4FIIA 2WPAA 1UKIA 2VTLA 2EXCX 4IHPA 3LFNA 3R7YA 1RQQA 5EI6A 5J1VA 2OIQA 2W9ZB 2PK9A 1ZYSA 4G3EA 4C8BA 1REJA 2YERA 2J9MA 2UUEA 4QP2A 1VR2A 3LXLA 5KMLA 1XH7A 4TTHB 5DHJA 3WZUA 2JKKA 3K5UA 3D14A 4IJPA 4BN1A 4C4GA 3TKIA 4O86A 4S33A 4GYIA 2BKZA 4EH3A 4QP4A 5CZHA 4RX5A 5I3OA 2R0IA 5FTQA 4BJJA 4FUXA 1OPJA 4GG5A 4TWPA 3U9CA 5CAVA 4I5MA 3MY1A 1VEBA 3VC4A 1U59A 2C3JA 4FRFA 3WYXA 3ORZA 3NUXA 3GCVA 4MBLA 1TQPA 1PHKA 2HW6A 1JSVA 4F09A 3NIZA 3S0OA 2XIYA 5HE0A 2X8IA 3CY3A 4IAAA 3SW7A 3DK6A 3DQWA 1JKLA 2W1HA 4BKYA 4C35A 2JKMA 1YDSE 2BR1A 4PDOA 2IG7A 3VO3A 4P4CA 1SNXA 3PSBA 4FEWA 2X0QA 4UWYA 4FEVA 1ZARA 4ZY5A 4TNBA 3VN9A 3A7IA 2CKEA 2YA9A 4L8MA 5E8TA 4DT9A 3D83A 4RPVA 1BLXA 4K8AA 4BIDA 1KSWA 3JPVA 2O8YA 2YJRA 3H0YA 3HAMA 3KB7A 5ETFA 2EB2A 4LGHA 3UNJA 5AJQA 3TEIA 2IVTA 1J91A 4EKKA 2VTQA 5AR3A 3N4TA 4G3DA 4LQMA 2VGPA 3OW3A 3FDNA 4BCNA 3F9NA 3L8SA 3CS9A