1CMKE

Crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the myristylated catalytic subunit of cAMP-dependent protein kinase reveal open and closed conformations.
pubmed rcsb
source organism Sus scrofa
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
total genus 105
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1cmkE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1cmkE02
2ZM4A 2O2UA 3KXNA 3LFDA 4E1ZA 3UO6A 3VULA 1Q4LA 4LL5A 3EFJA 4FEUA 3MVLA 4RA5A 3EHAA 2Y8OA 2YWVA 4X2FA 4FSWA 4J99A 4PWNA 3UMWA 3V04A 3P5KA 5E9EA 5FTGA 3O2MA 3AG9A 3CQUA 5H8GA 5HCYA 4CQGA 4KAOA 2OKRA 3V5JA 1OIQA 4C0TA 5KKRB 1ZZLA 5IA5A 4MBJA 3PXRA 1MQBA 1QPEA 5DOSA 3HA8A 4FKVA 5J87A 4BDEA 3AQVA 3SKCA 2CPKE 2G2IA 3QTZA 2PVHA 4NIFB 3R7EA 3LCDA 4HYSA 4BWXA 2W1DA 3MESA 3R8VA 4KKEA 3PLAE 2HCKA 4G5JA 5CVFA 4M0YA 4YC8A 2PWLA 3MPMA 3QD3A 4EC9A 5ANOA 4ZIMA 4QD6A 1VZOA 5EW8A 4YHTA 4Q5HA 4RJ5A 4E73A 4FKUA 4R1VA 4I4FA 4X3FC 3FXXA 4PNKA 4CV8A 2ITZA 5J5TA 3PVWA 3FI2A 2PZRA 2R0UA 2ZDTA 2PMLX 4J96A 4JJRA 4GJ3A 4KUJA 3ORMA 1H1QA 4XP0A 1RDQE 3R2YA 1WBNA 3QQHA 2WTIA 4FSQA 3MTFA 1W84A 3ZEPA 4IM0A 3W18A 1W7HA 1FVRA 1W82A 3L8SA 5CVHA 4DTAA 5EKOA 3UP7A 4M13A 5EHOA 1R39A 2F7ZE 2QURA 5IQFA 4QMVA 2XYNA 2R3KA 4A4OA 2PZYA 2X2MA 3EH9A 4F7NA 3N9XA 2CGVA 4TPTA 2JDTA 4BC6A 3GT8A 4S33A 3AC4A 3O7LB 3AOXA 5ETIA 5JT2A 3U6IA 5TE0A 5L2QA 4QPSA 3ET7A 2WMWA 3SXFA 4NW6A 4FMQA 4II5A 3TXOA 3ODZX 2BAKA 4PL3A 3R9HA 5JGBA 5KZIA 2ZMCA 3WE4A 2YWPA 3RAWA 2B53A 5CEMA 3LQ5A 4CZUA 2VWIA 3BYOA 3EYGA 1PKDA 3UP2A 4ALVA 5AUTA 4FSNA 2G1TA 3F3TA 3Q4TA 2DS1A 5IA0A 2C0TA 4FF8A 3PZHA 3LZBA 2J90A 3I7BA 4KS8A 4RRVA 2R64A 5FBOA 4ZTRA 5IA1A 4K1BA 3FYKX 3A7IA 2J51A 1DI9A 4C4EA 2J9MA 4YJPA 4ZTQA 3WOWA 1CKPA 4EL9A 5CLPA 3OMVA 4JRNA 3AC1A 5IDNA 4H3QA 5CU4A 4IIRA 5AIRA 5ETFA 1Z5MA 4EZ7A 4JX7A 5H2UA 3Q9ZA 4TY1A 3SX9A 1SVHA 3MVJA 3R0TA 4RBLA 3VQUA 1PXNA 3NAXA 4QT1A 1QPCA 4P4CA 4JR7A 2W06A 3JVSA 3ALOA 1GNGA 3IK3A 2QO2A 3OW3A 4I6FA 3SDJA 4DFZE 4EK6A 5BNJA 3IDCA 4DFNA 2Y6MA 4FVPA 1DAYA 2UW4A 2OZAA 5KMNA 1ND4A 3UO4A 4FKIA 4QMLA 5M51A 2BRBA 2GSFA 4JIAA 5HOAA 1SNUA 5BMSA 2AYPA 3NCZA 4KIKA 3SLSA 3V01A 3ZM9A 3COMA 3OEZA 1RE8A 4U80A 4XLIA 3UG2A 3P08A 5HBEA 3SC1A 4DLIA 2W5HA 4W4XA 4BR3A 1H07A 2UW9A 1H27A 2XIXA 3ORLA 4NTTA 4S2ZA 3HV7A 3U9NA 5KCVA 3CY3A 4MCVA 4ANOA 4XG4A 4YLLA 5A4CA 3F5GA 2BR1A 3GU5A 4BTMA 3I5NA 1H1RA 3BLRA 3NDMA 2W1CA 1JKSA 5CAVA 4NUSA 4R7BA 3OCTA 4NJ3A 4G9CA 4PUZA 4EZ5A 4IBMA 4X6RA 3R8PA 1YHVA 1WBSA 1KE7A 1MQ4A 3H10A 4FIIA 4LQMA 4YLJA 3W2CA 4C38A 1H26A 4RWJA 4O84A 1P14A 2R5TA 3RINA 4ITHA 4L7SA 1XWSA 3IW5A 3ZYAA 2XNOA 4L68A 3L8PA 1E9HA 4EOQA 1L8TA 4E93A 2QOHA 2YHVA 3DU8A 1ZMVA 2R3FA 2F9GA 3G6GA 2FGIA 5CEKA 4ACDA 3K5UA 4O6EA 3ITZA 4X3FB 4XOZA 4F4PA 4LV5A 4AU8A 3KKVA 2BDJA 3I1AA 3UZPA 1YWVA 4DEHA 2QOBA 4RPVA 1J1CA 4BKJA 1ZARA 1H0WA 2VWYA 3FSFA 2OF4A 3R1SA 2QOCA 3LCSA 4QP1A 3HZTA 3C13A 4RMZA 4BDFA 2R0IA 5I9WA 3M2WA 4ZMFA 3GU7A 4RZWA 4BCJA 5LOHA 4EK8A 4O96A 4QP4A 4JDKA 2BZIB 1JVPP 2EVAA 4AT3A 3KRXA 4XEYA 3ACKA 1MRUA 3MH2A 4QP6A 4XBRA 3LXLA 2H96A 4HYUA 2FO0A 5L2SA 2F2UA 3IOPA 2WB8A 4PRJA 4G3CA 1URCA 5CS6A 4A9UA 3V5QA 2CHLA 5LWNA 3QGWA 4L8MA 4BTFA 3COIA 5AA9A 4LUDA 1PMEA 2ACXA 4F63A 4D4YA 4BCIA 2OJFE 5L6OA 4D4VA 4DEDA 4CD0A 1ZAOA 2R3GA 2W4OA 4YBJA 3VS3A 2C68A 4UWYA 4XRJA 5CI7A 4ZZMA 3FMLA 4M69B 2EB2A 2OSCA 4YNOA 3E3PA 5HIDA 2WKMA 3ZRMA 4AA5A 4EWQA 4HVHA 4KABA 5AP5A 4CYJA 2CNUA 4FZAB 5KMKA 3BPRA 4J8MA 2QR8A 3I4BA 2X8EA 3DB6A 5H8EA 4CNHA 1R3CA 3KF4A 5FTOA 4QOXA 2BVAA 3HV3A 3C5IA 4C33A 3KEXA 3ORXA 1JWHA 3MPTA 4PF4A 5IQBA 3COKA 5AX9A 4BYIA 3DZQA 5EQEA 4FKLA 3C4ZA 5HE0A 4ANQA 4USDA 4X2JA 2VTQA 3MGYA 2GHGA 1FPUA 4AS0A 2OFUA 3U6HA 5ICPA 3R73A 3EN5A 3PA5A 5F9EA 1A48A 4K33A 3QX4A 3OXIA 3BLQA 2B9JA 4DFXE 2HY0A 4U43A 2CCIA 2PVKA 3IONA 4ZSEA 2V62A 3FLWA 3UIUA 1FGKA 2YEXA 4A06A 3LM0A 4HNFA 2O63A 5F20A 4YTCA 5K0XA 2J0KA 1OIYA 4FKSA 1WVYA 3ZSGA 4C57A 4C02A 5KKRC 3LHJA 4FV8A 2PU8A 1J3HA 4M3QA 3QXPA 4RIWB 3OOGA 2YCRA 2VO6A 4BDCA 3ATSA 4NTSA 4BBEA 4BDAA 4GW8A 4G6NA 4XOYA 3WF9A 4IZ7A 4D1ZA 1YW2A 2OH4A 4O7TA 3BGZA 4P7EA 4O82A 1IASA 4ACHA 1SVGA 4DGOA 4PMPA 3UZRA 3DY7A 3FXZA 4I94A 3LQ8A 2PL0A 4KIOA 4RJ7A 2O64A 3NZ0A 2ERZE 2VTHA 3VS2A 4GS6A 4F6WA 4FIGA 5HO6A 3L9MA 4OTRA 4N6YA 4XNEA 4IB3A 5F1ZA 5J79A 2BALA 3PTGA 4RIYA 4QQJA 1KUTA 4NCTA 1LP4A 1ZLTA 5L3AA 4OTHA 3LOKA 4Y73A 4MBLA 2GQRA 2ZB1A 3LCTA 2B1PA 4EWHA 1LEWA 2BROA 4PNIA 4FEWA 4CMTA 3AGLA 4HPTE 4M67A 3EMGA 5HZNA 3V6RA 1ZXEA 3FMDA 1APME 4I5PA 2WXVA 3FY2A 4M0ZA 5DI1A 5DPVA 1Q61A 3CIKA 2R3JA 2XBAA 3QQKA 4E7WA 4EZ3A 5EYKA 1M17A 1G3NA 3LVPA 2UW7A 3UODA 3OWLA 4F9BA 3PG1A 4LOOA 3THBA 4X3JA 4GCJA 2QOLA 5DT3A 1GZOA 5HNGA 1OPKA 2A27A 4RX8A 4C3PA 5LARA 4DN5A 5CAUA 2O5KA 4V04A 3CJGA 2BZKB 3O50A 3QTIA 4AOTA 3QCYA 4EC8A 2QU5A 2FUMA 2SRCA 3Q6WA 1H25A 3GB2A 4TWOA 3LFCA 5EI2A 3ROCA 4ALUA 3TUBA 3CKWA 4L3JA 2E2BA 4Z9LA 5BYZA 3SRVA 4YJRA 3W1FA 4J53A 4MF0A 4AZTA 4MX9A 5D9HA 2XRUA 4O7ZA 3MIAA 1WBPA 4LI5A 4UV0A 5JSMA 3OTVA 3ZLXA 3R7VA 4I4EA 3FY0A 4XG6A 4NJDA 4XG3A 2V7OA 2RFEA 5DYJA 5FTQA 3C4WA 2UW3A 4I6BA 5HGIA 4FA2A 5KBRA 4FV3A 4XH6A 5LWMA 2QOOA 3A62A 2LGCA 3G6HA 4YJOA 2I6LA 4CYIA 2YIXA 3P78A 4YU2A 3IG7A 4U45A 5B2MA 1VEBA 1PMUA 2EXMA 1MRVA 2W1IA 4FK6A 4O0VA 5C01A 3KULA 4DGNA 3B2TA 3DJ6A 3JY0A 2OWBA 3KVXA 5DG5A 3UQGA 2OXXA 4EH3A 3GI3A 1Q97A 4GU6A 4O0XA 1H0VA 2PVRA 4RX9A 4BL1A 3CSVA 2FSTX 3ZEWA 4IZ5A 5H9BA 3Q04A 5B2KA 2RL5A 3RP9A 5JGAA 2JBOA 2ESMA 3OHTA 4QMWA 3DJ5A 3FI3A 4TYIA 4V0GB 3OZ6A 4M69A 1BYGA 2YABA 4ALWA 1SYKA 4IFCA 3D9VA 4I6QA 4GUEA 3C4FA 3NCGA 1R0EA 4FKJA 4RC4A 4Y5QA 2B4SB 1ATPE 5DT4A 3BRBA 1QPDA 2C69A 3QYZA 1P4FA 5DEYA 4UBAA 5KUPA 4DE4A 4KNBA 4TZRA 4CLIA 4BDIA 4AN3A 4AGUA 1JNKA 4IVDA 3NEWA 3ZHPC 5HQ0A 5CZHA 5I9VA 4U44A 1OIUA 4Y46A 2J7TA 3W33A 2WTVA 4OUCA 2HELA 3PSBA 1ERKA 4JRVA 3ZSIA 5JGDA 3N4TA 2VWWA 3ORIA 2XIZA 3IKAA 3PY1A 4TRLA 3UQFA 4O7VA 3ZXTA 2JIVA 1O6LA 4PMTA 1WFCA 3BHYA 2Z7SA 2WOTA 2WU6A 4ASXA 3GC0A 1SM2A 1UU8A 5E7RA 5E8SA 3QKMA 3OWKA 5FXQA 2WOUA 5D10A 1PYXA 3TZ7A 1WBTA 3MJ1A 3ZS5A 5HG9A 2GNJA 3C4XA 5L2TA 1Q24A 4CQEA 3I81A 4S34A 1F0QA 5A4LA 4HYIA 4RVMA 4AGCA 2X8IA 4L00A 3E7VA 2RSVA 2CKOA 4MQ1A 5LQFA 5HX6A 4MNFA 4G9RA 4R3PA 2BUJA 2VX1A 4ERWA 3QWKA 4ZP5A 4EOMA 4F6UA 2QKWB 4EOIA 1YXVA 2G2FA 2OJIA 2FVDA 3TZ8A 3UOKA 5HG8A 3BU6A 2C5OA 5JK3A 2W1GA 4D9TA 4F9WA 1XH9A 3VBVA 2OG8A 2ZM1A 3EN4A 2WQOA 3CJFA 5AR7A 2AC5A 4YJTA 3LXPA 2W4KA 3F2NA 3IGOA 4WUNA 3U4UA 4AG8A 2ZOQA 3MBLA 4EBWA 3RHKA 2EXCX 4IE9A 4R5YA 3UIMA 2PVFA 1PXOA 1BX6A 4RJ3A 4RLLA 4E4XA 4FSUA 1YVJA 3P23A 3CTJA 5CXHA 2UZDA 2VX3A 3MSSA 3R7YA 5GZ8A 2J0IA 3CKXA 3MJ2A 4B99A 4BCNA 1UV5A 5HU9A 3E93A 3ALNA 2CN8A 3ZH8A 4BKZA 3HUBA 3E62A 4BGHA 3BWFA 2E9UA 4YSJA 3EL7A 2ETMA 3WI6A 5HE1A 3MFRA 3BU5A 4EEVA 4FTKA 4KKGA 5HX8A 2CN5A 2WEVA 2X4FA 2OJGA 4L01A 1G5SA 4FX3A 5HLPA 2RFDA 4WSQA 3PDTA 4IHPA 5A14A 2GU8A 4IH8A 4Q5EA 3EQDA 3FYJX 4PQNA 3QRUA 4CCBA 5JFSA 4JDHA 5IQEA 2I0YA 5AMNA 2GMXA 1U54A 3BEAA 3JR1A 4F0IA 3OROA 2WD1A 4Z55A 3PRIA 5CNNA 1Q8ZA 3MFSA 1L3RE 4GH2A 3PLSA 4F64A 5CSHA 3EQGA 2XZSA 4EKKA 1PJKA 5HNBA 4CFMA 2IWIA 2PY3A 3E7OA 3OFMA 4YZCA 5E1SA 4EI4A 4DH1A 3DBEA 2Y4IB 4FGRA 3AC3A 5FGKA 2PVMA 3F82A 2R3NA 5A4TA 5GJDA 1R0PA 3QUEA 1UNLA 4BICA 1A06A 4DF3A 2C5NA 1XH4A 1Q8UA 3FUPA 4DG0E 4M84A 3AC2A 4GIHA 3Q6UA 1REJA 5M06A 3FQHA 2J0MB 5BUJA 3TV4A 3PP0A 2X4ZA 4TWNA 4E6DA 4PP9A 4ERKA 2CGXA 3H0ZA 4ZJIA 3KXXA 4NFNA 5CQWA 4O2PA 2V7AA 3HYHA 4NU1A 3UVQA 3R30A 4AN9A 4G3EA 2ITYA 4K77A 2GTMA 2NP8A 3GQLA 4FIFA 3OVVA 3PUPA 4P90A 4F99A 5LMBA 2OGVA 1ZYCA 3VWAA 4DHFA 3R9DA 2YN8A 1J1BA 3FKOA 3VF9A 3NUNA 2DYLA 4PX6A 5G6VA 5BVKA 3ZDIA 2QONA 2VWVA 4S32A 3QTSA 4UYNA 5EOLA 2F7EE 3KL8A 2PVJA 4KINA 2QI8A 3I6WA 4W9WA 4CMOA 2VN9A 4QP3A 2YIRA 2ONLC 3A7HA 4FTJA 3R7OA 4F1TA 5KMMA 3G2FA 3OOMA 1JLUE 4K11A 5CI6A 4R8QA 5HESA 5HG5A 3FC1X 1YWRA 3QBNA 4FKGA 4IW0A 3NNXA 4F08A 4FTNA 4QMPA 3SD0A 3T8OA 1OB3A 3D5UA 3VBQA 3TT0A 4D5HA 3CPCA 3GOKA 3GU6A 4DGGA 2VGOA 4KWPA 2IJMA 3ORKA 3RAIA 1UWJA 4FSZA 4FKPA 4Y95A 4FUXA 5DNRA 3ULZA 3ZC5A 1JOWB 4DCAA 5CF8A 3TDWA 1PXIA 1PYEA 2BIYA 5ETAA 3BI6A 4B0GA 1BI8A 2QHMA 2W0JA 3ZBXA 4D2TA 1Q3WA 3OC1A 3CY2A 4HCTA 4FGBA 3LFEA 2VTPA 2WMSA 3LJ2A 3SV0A 4XX9A 4DFUA 4OW8A 1OL1A 5AV2A 4FIHA 5IQHA 3P1AA 2HAKA 2CKQA 4JQEA 4IWOA 1SMHA 1Z57A 5HU3A 2W05A 3RPSA 5J9ZA 5EM8A 5DEWA 3CTQA 3EN7A 1O6KA 4KD1A 1WBVA 3A8WA 4N70A 5CSWA 4QNAA 3GC8A 4HZSA 4UMPA 2WTCA 2WTKB 4ASDA 3ZXZA 4C34A 2Q0BA 3EKKA 2WMBA 4R6VA 5JN2A 1DI8A 4FOCA 4CTCA 1H28A 4BTJA 5J1WA 3KMWA 3E88A 3L8XA 5E8WA 2XK3A 5DHJA 2OXDA 3RZBA 4B8LA 2X9FA 3OT3A 4FG9A 1OZ1A 2XJ1A 2YM6A 4IADA 4TWPA 4W4WA 3F5PA 4BDHA 2JLDA 2CKPA 3DJ7A 5E8VA 3Q9WA 5JKGA 2OO8X 4K9YA 4FE2A 1XO2B 1YDTE 3RNYA 3EQIA 5FDPA 3VRZA 3SVVA 1Q3DA 2C5VA 4QYYA 5M44A 2W5AA 3K3JA 5AWMA 3QQJA 5ETCA 4FT5A 5BVWA 4BCQA 1YXTA 4RIXA 3U54A 3RI1A 2G15A 3LFFA 3FXWA 1NXKA 4AA0A 3GC7A 5E4HA 2X7FA 3QU0A 5C4KA 4FKOA 3KU2A 3VVHA 2B55A 4O6LA 2C1BA 3MYGA 4YZMA 1U4DA 4DEIA 4NM3A 1QMZA 4BFMA 4FI1A 1XBAA 4OTDA 4DBNA 1UKIA 2WQNA 4CG9A 4I5HA 4IWQA 4GRBA 4XLVA 4YJSA 4HYHA 4D2PA 3RK5A 4OTGA 1U54B 1MUOA 2ETKA 4FV2A 3SA0A 3SRVB 4FTMA 5DRDA 4MD7E 2IVUA 3KK9A 4E4LA 2ITXA 5IG1A 4O81A 4XS2A 4QYGA 2H9VA 4X2KA 2VRXA 1PXLA 1Y8YA 3FI8A 4U7ZA 2WEIA 4O91A 2YZLA 3PJ8A 2ONLA 4E6CA 4ZZOA 1ZZ2A 4I24A 4ZLOA 5BVNA 3MVHA 5E91A 1ZRZA 1YXSA 4GIIA 1WBWA 4FNYA 4U3ZA 4X2NA 3U87A 3NVMB 4NZWB 3FPQA 3HRCA 4YR8A 5GHVA 3W16A 4TL0A 3VS0A 4ENXA 4CGAA 2C6DA 1O9UA 4FSRA 2XKEA 3LCKA 3U9CA 2XNNA 5CF6A 3G5DA 4FTAA 1NVRA 4EQUA 3QRJA 1I44A 2WFYA 3FZ1A 2UZLA 3WZJA 4FNWA 1I09A 4L46A 4WBBB 4YO6A 3WIKA 4BDDA 4GKHA 5M09A 3DFCB 3HRBA 5EDRA 4HVIA 5FP6A 4JLCA 4H3BA 3BWJA 4N57A 3MA6A 3NUUA 3OCGA 3EZVA 5GZAA 4LOQA 2UV2A 5BQ0A 2JIUA 2RFSA 4KS7A 5CU6A 2XH5A 3PJ1A 1ZYDA 3VRYA 1NW1A 1VYWA 2IPXA 4BY9E 4FSYA 3U4WA 3F69A 4BB4A 4EH6A 3UGCA 3WYYA 2Z7QA 1E1XA 1REKA 2ERKA 3CS9A 4WG5A 2R3OA 3LFAA 2VNYA 3EQBA 5ANJA 3W32A 4DINA 4OR5A 1XH7A 2R3IA 4FV1A 3OXTA 2Z7LA 2Z02A 4EUTA 4CVAA 5HNIX 3C9WA 5EM7A 5EQPA 1KE5A 2IVTA 5KHXA 4EOSA 1Q8WA 3OEFX 3TKHA 2QOIA 4F70A 3FL4A 1G8SA 3G15A 2ITOA 2J0JA 4DTBA 1OBGA 2XNBA 2YIYA 2YZAA 2E9OA 5E8YA 1Y57A 4FEQA 4GFMA 5AP4A 3ZDUA 5DA3A 4BKYA 5AP3A 4IXPA 4YC3A 5ANIA 4F9YA 5CF4A 3O23A 4Y72A 3GENA 2XM8A 4IB5A 2ITTA 4WIHA 4BN1A 3EYHA 4CFUA 4DLJA 2B9HA 4MAOA 5EYCA 3ZFXA 3F61A 4O0WA 5EK7A 2QR7A 3SOAA 4BBMA 5EKNA 2F2CB 4JNWA 4KBAA 5GNKA 3FZPA 3WZDA 3UIXA 5C4LA 3Q2MA 4R5SA 3QUPA 3D5WA 4IVAA 1XH8A 2ZMDA 1OM1A 2WELA 4ANBA 4YPSA 3QX2A 4IJPA 2UW8A 2BAQA 3Q3BA 3QA8A 3BGQA 3QWJA 4J52A 4C62A 3RBWA 2XEYA 2QG7A 2GFCA 2O3PA 4PPAA 3DCVA 4BHZA 3BQCA 4EH4A 3DKCA 3W2RA 2JEDA 3NUXA 5GIPE 3D4QA 4A9SA 1GZKA 2ZDUA 3UTOA 4EUUA 3OTUA 2GPHA 4I23A 1ZY5A 4NT4A 3R02A 4C2VA 1AD5A 3MW1A 4BIDA 3R8LA 3UE4A 4W8EA 4YZNA 5A6OA 1W8CA 2P4IA 4L9IA 5C8MA 4BCOA 4DH7A 4ZSAA 3F6XA 3FLSA 2C3KA 4I1ZA 4RC3A 3RCJA 4O7WA 4P2KA 3UPZA 3DK3A 3LM5A 2Y9QA 4HPUE 2WMXA 4ZTHA 3R9RA 3H3CA 3A2CA 4WUAA 3CD8A 4AACA 2OIBA 3WZEA 2BDFA 4ZZNA 1XBCA 3TV7A 4CXAA 2BHHA 3L9NA 2JDRA 4KB8A 4YHJA 1QCFA 3DZOA 4X7QA 2WMAA 3DDQA 3KXZA 3QRKA 4FOBA 4E20A 5J95A 3W2QA 4DH5A 3MH0A 4M7IA 3HMNA 3KREA 3C50A 2B9IA 2BILB 5K4IA 1QPJA 3R28A 4ASEA 3PSCA 4KIPA 4UB7A 1Z9XA 3G90X 4NEUA 3DNEA 4YNEA 5JFVA 3RHXA 4AT4A 5JRSA 5A46A 4ZS4A 5M08A 1RJBA 2REIA 5J5SA 3N4VA 4HVSA 1JKLA 5EI8A 4XP2A 3MY0A 1FMKA 4MH7A 1BKXA 1YKRA 1GJOA 3R00A 2VTJA 2VTLA 3E3BX 3PWYA 5AV4A 3AMYA 4KIQA 2HZNA 4RWLA 3BLHA 4FK3A 4C4HA 4QMQA 4LV8A 1FVTA 4E5WA 1BLXA 3HDNA 5LCJA 5AX3A 2YCFA 4BI1A 3HMPA 4QP7A 5DH3A 5HVJA 2ITUA 4LM5A 5IH5A 3VW8A 1GIIA 4C35A 4ENYA 4JDIA 2YM7A 1KE8A 5I9ZA 2WQBA 1TQPA 3CTHA 3TKIA 1ZWSA 3EIDA 4QMTA 3FMMA 4YGAA 4ZAUA 2BAJA 2WTWA 3VUTA 3W10A 4FYOA 4R1YA 3ZCLA 4ANNA 2VX0A 3ZBFA 3EJ1A 1Q41A 4TYEA 4YC6A 3EWHA 4TYGA 3IQ7A 2C3JA 5C9CA 2XK8A 4H39A 3UNKA 3KRLA 3EN6A 2E9NA 3IOKA 4X2GA 3HEGA 3L9LA 1M2RA 2YACA 5CVGA 5JZJA 3HA6A 3QTWA 4I0SA 4I93A 4C61A 2BZJA 2PVYA 2XK7A 3OY1A 3QGYA 4O1OA 4RVLA 3ZUTA 5LVNA 4ACCA 5CQUA 1UA2A 1W98A 3A8XA 1Y91A 4QMYA 3RM7A 3FMNA 3RMFA 5KO1A 1YOMA 3OUKA 2UZOA 3JXWA 3FHRA 4QRCA 5HG7A 2PHKA 4EH7A 3DBCA 2C0OA 2OFVA 3EFKA 4HGEA 4UMQA 1H01A 3P9JA 3R71A 4AWIA 3Q4CA 2UVYA 3BGPA 4ACGA 3CD3A 3NAYA 5EYMA 2C6LA 2P3GX 2R3QA 4NW5A 3QKLA 3N4UA 1OI9A 4I21A 4M8TA 1Q8YA 2PZ5A 4FL1A 4XRLA 2IVSA 5AR5A 3ZLSA 2C47A 5AUVA 3BV3A 5HICA 5L6WL 3KULB 5K0KA 3GBZA 1OL2A 2QCSA 5E8XA 3A7JA 2UVZA 1ZOGA 3G51A 3UOLA 2OJ9A 3F2AA 3F7ZA 4QTEA 4A4XA 2YJSA 4U81A 4YO4A 3MFTA 3HP2A 3RAHA 4ASZA 4V0GA 2XNEA 2X8DA 1TQMA 3BHHA 3ZONA 2ZB0A 3OBGA 2C0IA 5DN3A 3Q60A 2WTJA 3OP5A 5L4QA 2J6MA 1UKHA 3UOHA 2CNQA 3LMHA 3JPVA 4ZTNA 3G33A 3NUPA 3BX5A 5LVOA 4GYIA 2PMNX 4NH1A 1H08A 3A60A 3VIDA 2XUUA 3UO5A 3F7WA 3VS4A 2XS0A 3VNTA 4AT5A 3BKBA 5C8NA 3EQRA 4DT9A 4TTHB 3TNIA 1Y8GA 2HYYA 2XIYA 2NO3A 3RM6A 1YXXA 3AD5A 4F1OA 5I9XA 5D7VA 1TQIA 4EH2A 3PJCA 2GTNA 4MKCA 3HKOA 3LXKA 4LMNA 4F7JA 2YCQA 5CU2A 3VUGA 1CDKA 4DT8A 3GCVA 4CLJA 5DR2A 1NT2A 3NUYA 1IEPA 1T45A 3LFSA 1BMKA 4OTQA 5CSPA 3OBJA 3PXKA 4A07A 3IDPA 2B9FA 5LVPA 5FEQA 3Q2JA 3MH1A 4O22A 4JBQA 4WA9A 2ZJWA 3ELJA 5AP2A 4EJ7A 5HD4A 3NPCA 3WF7A 3A7GA 3D15A 1IR3A 4PTEA 5AUYA 4FUYA 3MY5A 3QHWA 4E3CA 3DLSA 4C3FA 2GQSA 1LPUA 3MA3A 4ARKA 3DAJA 4S31A 5HTCA 4GFGA 1V0OA 2X6DA 5IMEA 4ZY4A 4LGDA 4J95A 2XNPA 5IF1A 5EG3A 3UYTA 4LRJA 4QMNA 5IQAA 4YTFA 2X2KA 3DKOA 4IAAA 4FKTA 2BTSA 2IO6A 4AP7A 2G2HA 4EK3A 5IZFA 3H0YA 4TN6A 4XCUA 5AUWA 3R83A 4B4LA 5GIOE 3VBXA 4LRMA 2VWBA 3LFBA 2A2AA 5HE2A 2J50A 4CSVA 4ZTMA 4USEA 3DQXA 2BKZA 3ZRKA 3NR9A 3PY0A 5ANEA 2GS6A 4RIYB 4B7TA 3EFLA 3I5ZA 3ZZEA 4MD8E 3NYXA 5FP5A 3WZKA 5KZ0A 2ZV8A 4DC2A 2R7BA 2FB8A 3P4KA 3LW0A 2EWAA 4DH8A 2JAVA 4IC8A 1STCE 2CLQA 3KGAA 4FTRA 4IX6A 1YRPA 4KSPA 4QTBA 3TV6A 3BCEA 5KMOA 3EZRA 3QZFA 1GOLA 2OIQA 2G01A 3OY3A 3D94A 1OL7A 2QODA 3BELA 3FI4A 3G0FA 3GP0A 3P7CA 4TKSA 4L7FA 3HP5A 3ZLWA 3D83A 5HHWA 3F5UA 5FXSA 3E8NA 5CSVA 5AA8A 2QU6A 3DA6A 2X39A 2YISA 2E9VA 4RVTA 4LGGA 3AXWA 2HW6A 5TO8A 2F57A 3IPHA 4O0RA 5JRQA 3RK9A 5J7BA 1CM8A 2OJJA 3C0GA 4U3YA 5H8BA 1FOTA 5I9UA 2IZRA 4UMRA 4UZDA 4G2FA 2UW5A 4RQVA 3NWWA 5L6PA 4H1JA 4UX9A 4G3GA 3BHUA 3RNIA 2HZ0A 2J2IB 4RZVA 2ZAZA 4IZAA 3QTUA 4JOAA 5T6KA 4EQMA 5BUEA 4C4GA 5KNJA 5HO8A 4CMUA 4IMYA 3WILA 4TNDA 3KXGA 4JG8A 5ANDA 2R3LA 1F5QA 5KX8A 1WZYA 3C1XA 4PL4A 3WBLA 3VUIA 1YHSA 4U40A 3EKNA 3QD4A 3EL8A 3R7IA 4BGGA 3C0HA 4GT5A 3VAPA 1HOWA 2I7QA 4L43A 5I3RA 3K5VA 4ID7A 1YI3A 4JG7A 3PP1A 4FZ7A 4O27B 4UZHA 1UWHA 3QALE 3PWDA 1PXMA 1V0PA 5FEEA 5CEQA 3D7TB 3ROYA 2XKDA 3KQ7A 3TZMA 3VS1A 2Z2WA 3V3VA 4DFYA 4NL0A 1GZNA 3DXQA 1OKVA 2YFXA 3DDPA 4FT3A 5AIKA 4EOLA 2XJ2A 4OAUC 3CGFA 2W4JA 3LAUA 2CSNA 4C7TA 3I6UA 4EOOA 4BWPA 4KBCA 3PPKA 4IJ9A 5CNOA 3VJOA 3ZO2A 4C37A 4FODA 3UNJA 5HBHA 4FT0A 3PFQA 1GZ8A 5A4EA 3TIZA 5C1QB 2W9ZB 3S2PA 3QZHA 4MWIA 3FAAA 2PUIA 1M7QA 3PPJA 1R78A 4MXZA 5M53A 5CEIA 3CPBA 5CAQA 2OIDA 5CASA 3LIJA 3WIGA 3NNWA 3DKGA 3MIYA 2UZVA 4BF2A 3UQCA 2FH9A 4WKQA 1NA7A 5H3QA 3R01A 3WARA 3L1SA 1K2PA 2HXQA 2QC6A 5CENA 5BVFA 1CTPE 2CNVA 4HJOA 4K8AA 2RKUA 3RKBA 3BIZA 1B6CB 5HIEA 4MNEB 3O7LD 4M15A 3M1SA 2QLQA 3LFNA 2KTYA 4D2WA 3SG8A 1UVRA 2ZV7A 4BDJA 3NMUF 3KMUA 4ZSLA 3CQWA 3U6JA 2RGPA 3B2WA 3F5XA 5JH6A 2W99B 3QRIA 5AADA 1M7NA 2XK6A 3FDNA 4TYJA 2C6MA 3D7ZA 4O7RA 4WRSA 5FUTA 3E8CA 3ZUVA 4ZS0A 4NM5A 4W9XA 3KF7A 2YCSA 4JIKA 4WHZA 5TOZA 2VTNA 3AD4A 1JKKA 2XCHA 3KN5A 3UVPA 2WQEA 1X8BA 3NRMA 5CX9A 5FM3A 4I3ZA 3GU8A 4J1RA 2FSMX 3GOPA 3E5AA 3FKNA 3V5WA 3PXYA 4LL0A 2BRNA 2DWBA 4RWKA 1H1PA 1OL6A 2VWUA 5EFQA 4AA4A 2QLUA 1J7IA 3OG7A 5CT7A 4C4FA 1JAMA 4QO9A 5HE3A 3QC9A 3FZRA 2Y0AA 5IKWA 5IEXA 5FD2A 1XHAA 5CANA 3DB8A 3UZTA 3OUNB 4Y83A 4J97A 3ID6C 4AW1A 2XBJA 4UY9A 1YI4A 4E8AA 3DBDA 3NW6A 4AGDA 1PY5A 4USFA 3AT2A 2ITVA 4FKWA 3QYWA 2J5FA 1VYZA 2YDIA 4E6QA 2YDJA 1FGIA 2FA2A 2GCDA 3EOCA 2UZBA 2W9FB 2VU3A 5KMLA 4FV7A 4QPAA 1VR2A 2BFYA 1FVVA 2HK5A 3OCBA 4BZDA 3PJ2A 5A9UA 1PF8A 3LFQA 3PSDA 3BYUA 5DVRA 2UW0A 2VWZA 3UG1A 4DEGA 5ACBC 3BBTB 3B8QA 5D1JA 3KXMA 4UN0C 1YDSE 4ZTLA 3T9TA 4ZLZA 3D5XA 1OKZA 4GU9A 1YQJA 1LUFA 2R3RA 4BVUA 4CT2A 5DMZA 4NM0A 4BZNA 3E8EA 4FVRA 1IG1A 2EU9A 2YIQA 4YJUA 3ZO4A 4YSMA 4H1MA 2WIPA 4RFYA 2CLXA 5L8JA 3RZFA 2F4JA 1AGWA 4AOIA 1O6YA 2YLFA 4L42A 3ORZA 4HVGA 4AQCA 2NRYA 2PZIA 2X7OA 4D1XA 5I0BA 5IQIA 4FT9A 5C27A 3VS7A 2UW6A 3OWJA 1XJDA 3CLYA 3LCOA 3HECA 4FV0A 1PHKA 2CCHA 3AC5A 3ZMMA 3MDYA 2PZPA 3NW7A 4GVAA 4RT7A 2IW9A 2OZAB 3O8TA 4IDTA 5EM6A 2UZWE 3DQWA 5CXZA 3R8UA 1YI6A 3HLLA 1BI7A 1YOLA 4KIKB 1J7LA 4PDYA 4JI9A 4AW2A 2OW3A 1H1WA 3QAME 4WBOA 5AR8A 1OMWA 3MPAA 4C4JA 3VN9A 2WMRA 4TYHA 3WF8A 4FTUA 4WG4A 3HRFA 1Q62A 3K54A 3SGCA 4FTQA 1H8FA 4LFIA 5D7AA 3PXZA 4HZRA 5BVEA 3PXFA 5IUGA 4GVJA 5LVLA 5A4QA 4B6LA 2QO7A 4O0SA 4QMMA 2WHBA 1XBBA 3R22A 5TT7A 2W7XA 5ACKA 4ZEGA 4Q2AA 5AV1A 5F95A 3DFAA 4BDKA 3LQ3A 2XVDA 4BWKA 5FLFA 3VC4A 3D2KA 2YM5A 5CT0A 2JGZA 3KB7A 3F2RA 4L52A 4X3FA 4H36A 5HCZA 3PIYA 4KA3A 5G1XA 3A61A 5IH4A 4RFMA 5E1EA 1R1WA 3GQIA 4XBUA 3DK7A 4W8DA 4GJ2A 2Y6OA 1B38A 2QNJA 5CYIA 4J7BA 2WO6A 1TVOA 4AZSA 5IDPA 5KMJA 4C8BA 4LGHA 1WVWA 2P33A 4M12A 5L2IA 3DV3A 4QNYA 1XH6A 4FIJA 5DT0A 1JBPE 3QCQA 4CTBA 3HAVA 5AV0A 5AAEA 5I3OA 4O0TA 3QZIA 4IVCA 4QTDA 4P5QA 5HIBA 3DT1A 2RIOA 4I41A 3QLGA 2RF9A 5J8IA 3E64A 3R7UA 3M11A 4XV9A 4QQTA 2VV9A 3FMHA 1FINA 5HCXA 4D2RA 5CF5A 3KA0A 4HGTA 4FV9A 4DGMA 2BCJA 4I0RA 4OTFA 3IO7A 5KMIA 2IW6A 5I9YA 2XKCA 5BVOA 1M52A 4Z7HA 3PA3A 3PRFA 4YHFA 2C3LA 3R8ZA 3ULIA 4P5ZA 5JQ8A 3FV8A 2QG5A 2WMUA 4WO5A 3A7FA 5BPYA 2GFSA 2WQMA 3TM0A 2ZV9A 1CKJA 5D12A 3ZM4A 2Y4PA 4KBKA 4IX3A 3OCSA 4NCTC 3ZUUA 1WVXA 5DE2A 4D4SA 4YURA 3KRJA 3ZTXA 4PP7A 4ONAA 1B39A 5TF9A 2R4BA 1UU7A 1YDRE 5IEVA 2H6DA 3PYYA 4YMJA 3TKUA 2X6EA 1WAKA 4R77A 2R2PA 4CZYB 5IMXA 5M4FA 2BFXA 2VTMA 4CRLA 3ORNA 3K3IA 4N0SA 3SAYA 3FPMA 4IM2A 1JSVA 3TDVA 2I1MA 4YP8A 2NRUA 4IEBA 2H8HA 2VTIA 3S95A 4IAZA 2W1EA 3FSKA 2BZHB 1H24A 3R9OA 2HY81 5GINE 3IDBA 4FEVA 1MRYA 1XR1A 4TT7A 5CSXA 2C6OA 3V5PA 2OK1A 5IQGA 4QMUA 4RIXB 4ANMA 4EJNA 3T3UA 5A6NA 3O51A 2VGPA 2I0VA 4Q9SA 4DG2E 4PPBA 2PSQA 3FBVA 2FYSA 4WNOA 2CMWA 1JPAA 1V1KA 4NIFA 1P2AA 4PMSA 2JDSA 3GFWA 4MXOA 2W1HA 3VBYA 1GIHA 4OTPA 4G3FA 1J91A 4EK5A 3NSZA 4J98A 1PRYA 2I40A 2ZM3A 3RAKA 3BYVA 4U0IA 4G1WA 4YZBA 1U5QA 3C0IA 2OU7A 4CFNA 5JFWA 3AMAA 4GG5A 3FLQA 3T9IA 4F65A 5CALA 2OZOA 3PIZA 5M4UA 4R3CA 4FKQA 4PDPA 4MEDA 4LG4A 3SXSA 5LVMA 2VTSA 4IWDA 3KCKA 2CJMA 3AGMA 4JBPA 5DWRA 4PV0A 4IZYA 4I92A 3GUBA 2YAKA 2HWPA 2JFLA 3C5UA 3DOGA 3F3WA 3RVGA 3W2OA 2XF0A 3OS3A 4W4VA 3D7TA 4D1SA 2R3MA 4DG3E 3ZFYA 3NLBA 3UC4A 4O7NA 1YOJA 4HGLA 4KSQA 4OT5A 4YJNA 2PE0A 4N4SA 3AT3A 4A4LA 3TUDA 4I6HA 5BX0A 2XA4A 4R78A 5FEDA 3DAEA 1HCKA 3I7CA 4C3RA 4FV4A 4OBOA 4L3LA 4X21A 3RK7A 1XH5A 3DAKA 5E8TA 1Q99A 2OH0E 4BCKA 1FBNA 4GKIA 2YAAA 5LMAA 4F9AA 4BCFA 4O38A 4QTCA 4BCPA 3AC8A 3NIEA 3BHTA 5C8KA 3ATTA 4GG7A 5IQCA 2Z7RA 3I79A 4ZJJA 4UMUA 5K4JA 4E5BA 5L8LA 4K0YA 3R1QA 3PIXA 3CCNA 3D14A 3H9FA 4CZTA 3S1HA 3FQEA 2PULA 4MK0A 4GK3A 1IAHA 1SZMA 5CU3A 4GFOA 4G34A 5JQ5A 3CQEA 4MNEA 4D2VA 4EONA 4FICA 3O96A 3V8SA 5AP1A 2XK9A 3NUAA 2VTTA 5HO7A 3O8PA 3KCFA 3FWQA 2WTDA 3ORTA 3TIYA 2ITWA 2QKRA 4EH8A 3C4CA 4F0FA 3KRRA 3BE2A 3Q5IA 4XV1A 2B0QA 1BL6A 5L2WA 4O2ZA 2Y4IC 5AP6A 3HV6A 1M2PA 4XG8A 2BRHA 4EQCA 1M2QA 2ETRA 3KRWA 2ZV2A 4EHZA 4F7SA 2LAVA 4Y8DA 2YIWA 3C51A 4NSTA 1UU9A 2W1FA 3BYMA 3HNGA 4C59A 4CFXA 3H4JA 4U8ZA 4RLKA 4BIEA 2OBJA 4FTCA 2VO7A 5TKDA 2OI4X 4FC0A 4UYAA 2GNLA 3NYNA 4BCGA 4QYHA 4CFWA 4BGQA 5BYLA 4HCUA 4H3PA 3NVKI 2UUEA 4O7LA 3CGOA 2GNGA 2G9XA 5EDQA 2PYWA 2OICA 2Z8CA 4JT3A 4L3PA 4CT1A 5AR3A 1IAJA 4IC7A 3DTWA 2YM4A 2QVSE 2X2LA 3SW7A 4GUBA 2XJ0A 4IAYA 3UJGA 1NVQA 2V0DA 4U79A 4XJ0A 3QLFA 4RG0A 3TTIA 4FNZA 4HGSA 2C6TA 4R3RA 5AV3A 2IZSA 4CKIA 3I0OA 3LXNA 4LOPA 1XKKA 1LR4A 2FSOX 4JXFA 3D0EA 2Z60A 4AUAA 3QXOA 3V5TA 3LKMA 5M4CA 3F3ZA 2C6EA 4G31A 4MXXA 5IH6A 2JKOA 3S0OA 5IEYA 1OUYA 2HZIA 5AFVA 5K9IA 4UWBA 4F09A 3D2IA 3DS6A 5FM2A 4FTOA 4YJQA 5T68A 2DUVA 2GNIA 4BI2A 3EN9A 3FC2A 3DGKA 3G9NA 3FE3A 1OL5A 1PXPA 4IDVA 2O8YA 3H9RA 3TJCA 2WPAA 3GXLA 4OTIA 3QTQA 3O71A 4DA5A 2F7XE 3EQFA 5T3QA 4APCA 4F1MA 4G5PA 1IA9A 4LRKA 2VZ6A 4JR3A 4QMOA 4RFZA 5F94A 5CAPA 1KSWA 1CKIA 2UZNA 4QP8A 4PPCA 4MYGA 3POZA 3T3VA 4F0GA 5HEZA 5FXRA 4EH5A 1Q8TA 3I0QA 2QO9A 4AZEA 1JKTA 2NPQA 4C4IA 4WD5A 5LXMA 3ETAA 4CKRA 4GSBA 4NKAA 4QMXA 2R9SA 5J1VA 2Y7JA 1K3AA 5BUIA 3NUSA 3RJCA 1H1SA 3TWJA 3W8LA 4F6SA 4CFVA 4ZJVA 2YERA 4TYHB 1PXJA 3SQQA 4M14A 2VD5A 3WZUA 2JDOA 2XP2A 3RPVA 3FJQE 3Q4UA 4GT3A 3L8VA 2P55A 1ZMUA 4GL9A 4XV2A 4K6ZA 5K5NA 4XG9A 2VTRA 3VUMA 2XB7A 4OTWA 2BPMA 1ZYLA 3TUCA 3O8UA 2FSLX 3QQFA 4G6LA 1WCCA 3GCQA 3DBQA 5IUHA 3MB6A 4RSSA 4MF1A 3R9NA 3NX8A 4PTCA 4DGLC 2C6KA 2CGWA 4OT6A 2GHLA 3EQHA 3TTJA 3PVBA 1YWNA 2IN6A 4NWMA 4XP3A 3II5A 3TJDA 3CE3A 3V6SA 3HAMA 2YA9A 1UU3A 2YLEA 3W55A 5HTIA 2BKKA 4C36A 5DFPA 1PW2A 5HTBA 4MD9E 4AFJA 4I5MA 4IB1A 3HMMA 3NNVA 5CEOA 1KV1A 3FZTA 3TI1A 3PVGA 4AE9A 1DS5A 3CEKA 3O17A 4IB0A 4K18A 4A9TA 3R2BA 5IU2A 3MI9A 2JFMA 1JSUA 3AT4A 3BU3A 3NIZA 4GV1A 4LMUA 4EOJA 1U46A 2R7IA 3UYSA 3BBWA 4YUQA 5HORA 3VUDA 3FKLA 3PA4A 3CXWA 3GEQA 2UZUE 4FT7A 2X9EA 5CU0A 4IAFA 5M55A 3FMKA 4EHGA 5KHWA 5LJJA 4PDSA 2VUWA 3PG3A 3VUHA 4JAJA 1TKIA 3VQHA 4JL9A 2J4ZA 4JX3A 5FG8A 3MN3A 3ZC6A 3TNQB 4YBKA 1Q5KA 5HLNA 4XV3A 4NKSA 1KOBA 2B7AA 3U55A 4Y85A 5F4NA 2A0CX 1Y6BA 3ORPA 3REPA 5AEPA 3Q9XA 4R7HA 4TXCA 4OLIA 5EDPA 3NW5A 3MB7A 4CG8A 4FL2A 4CRSA 2V5QA 1ZOHA 1ZOEA 2HIWA 4M66A 5E8UA 3PY3A 2C6IA 2QOQA 2WU7A 4U9AA 2R3HA 5JEBA 5BVDA 2ITQA 4UXLA 3KN6A 1HCLA 1PMNA 2OLCA 4APPA 4AW5A 2E9PA 1WMKA 5EHYA 3RTPA 3WF6A 4Z7GA 5M56A 4ZY5A 4CCUA 5FBNC 3KMMA 3UC3A 4ZSJA 1U59A 5DRBA 4EOKA 3G9LX 5AAGA 1LEZA 3HVCA 3W8QA 1DAWA 5GJFA 3G0EA 2YITA 3QC4A 2VTAA 4IVBA 3UMXA 4JQ8A 2IG7A 2GNFA 5AR2A 4EH9A 4O83A 4AE6A 4WNKA 4H58A 1KE9A 4YTIA 4OGRA 4O7YA 3TL8A 4RJ6A 3MTLA 4FIEA 4GT4A 4BRXA 4CEGA 3ANRA 5CEPA 4DH3A 4E5AX 5ITAA 4EYMA 1RW8A 3QKKA 4NFMA 2JKKA 3CR0A 3V8TA 4WSYA 3S4QA 4RWIA 4GK2A 3MVMA 3R21A 3TEIA 5JFXA 3OW4A 3QF9A 2JD5A 2ITPA 5HD7A 3EB0A 4IANA 4L6QA 1KWPA 1XQZA 3W2PA 2QQ7A 4ZOGA 2XMYA 3V51A 5IQDA 3Q53A 2VNWA 2B54A 4O21A 1H00A 3LMGA 4XUFA 5GJGA 3GCUA 5KBQA 4FTIA 2O0UA 2PUUA 3VJNA 4AZFA 4HCVA 3DKFA 3GCSA 1FMOE 3FHIA 4FZ6A 2BRMA 2XNMA 2PPQA 1RQQA 4FKRA 3P79A 1KE6A 4Y5HA 3DK6A 1CSNA 4S30A 3SHEA 5DLSA 3TNPC 3JYAA 4F9CA 4BTKA 3AD6A 3UNZA 4U42A 3LMIA 2HXLA 1G8AA 3FMJA 4OBQA 4BIBA 4J8NA 2WTKC 2DQ7X 2XEZA 4QQ5A 4XHKB 2QOFA 4D55A 5EW3A 1YXUA 2ITNA 4U5JA 5K3YA 2B52A 3RCDA 1OIRA 2C5YA 4ITJA 3FMEA 3IS5A 3IGGA 3UDBA 4MBIA 2IW8A 4IX5A 3ZOSA 2XM9A 5IISA 3OT8A 2PUNA 3L9PA 4MXYA 2IZTA 2YM8A 3MH3A 4DEBA 4DEEA 5HVKA 4D9UA 5FWKK 5IA2A 2GHMA 1BUHA 2PMOX 3LLTA 5EM5A 2V55A 2X81A 3CBLA 4YPDA 3DNDA 3PE1A 3ZZWA 1UNGA 4ACMA 1EH4A 3QHRA 2QD9A 1QL6A 2WZJA 3DPKA 3PJ3A 4FG7A 4A7CA 2JAMA 4YZDA 4FZFB 2GS2A 5DR6A 5ANGA 2P0CA 4UWCA 3K2LA 1IRKA 5TR6A 1S9IA 5LCKA 5IUIA 2IZUA 3HMOA 4ZXTA 4KRCA 2QOKA 4JG6A 5ANKA 4KRDA 3A99A 5LMKC 4D2SA 4Z16A 3KVWA 2UZTA 4ZK5A 4JBVA 1H4LA 4QTAA 2PVNA 3F88A 4E4MA 4F7LA 3F66A 2ZVAA 4MXCA 4RQKA 3HUCA 3QD0A 5JZNA 3V8WA 4TNBA 3TNHA 2W5BA 4YZ9A 2P2IA 2PTKA 2BMCA 3N51A 3QD2B 4AXAA 3SW4A 5I4NA 2BDWA 3IECA 4QMZA 4ZY6A 5JMSA 4IACA 4WNPA 5B7VA 2JITA 4D0XA 5AM6A 3TG1A 2JKMA 5AUXA 5CWZA 2EB3A 2EXEA 3S00A 3WE8A 5M4IA 2HW7A 2YM3A 3KXHA 2BHEA 2PUPA 4MVFA 4U97A 1A9UA 3S3IA 4IQ6A 1P5EA 4MQ2A 2VAGA 4DBXA 2XCKA 5A3XA 4IM3A 4RGJA 3VS5A 4D0WA 3SOCA 4YTHA 4DAWA 4G6OA 5B2LA 4ANSA 3DTCA 2JIIA 4I5CA 2IVVA 2AC3A 3TCPA 3O0GA 2VTOA 3IW4A 4PL5A 3HDMA 4ITIA 4MWHA 3WF5A 2JBPA 2ZYBA 4FTLA 5C26A 3LJ0A 4BDBA 3COHA 4XMOA 3QQGA 2XRWA 2J5EA 5B0XA 4FG8A 5L8KA 5DGZA 4FBXA 1SVEA 3I60A 4GK4A 2W17A 2OXYA 4D5KA 2GS7A 2GNHA 1WBOA 2X7GA 3PZEA 5EW9A 2W96B 4EKLA 4RJ8A 3GGFA 4NM7A 2XNGA 4L45A 4CKJA 1OITA 2CDZA 3DLZA 4UMTA 5EHLA 4L67A 4TW9A 4A9RA 3BQRA 4ANLA 1URWA 3QRTA 3R7GA 4PMMA 4I22A 2GQGA 4BI0A 5CAOA 3DXPA 1KOAA 3RWQA 3FZOA 4E26A 2C1AA 3Q96A 4WRGA 5IA3A 1W83A 3ANQA 3ZU7A 4WT6A 4YJVA 3VBWA 3NYOA 3FLZA 1AQ1A 1Y6AA 3OF0A 3PE2A 3QTRA 4BCMA 5E8ZA 4OBPA 4GMYA 4AGWA 3SXRA 1PXKA 2C3IB 3RALA 3KK8A 3EQCA 3ZRLA 3R1NA 2YDKA 2PK9A 3R63A 4U6RA 4ZSGA 2I0HA 2XIKA 3MWUA 4ZTSA 2WIHA 3NS9A 3FL5A 5EH0A 4Z3VA 2C30A 3A4OX 4DTKA 2KULA 5DBXA 3BE9A 5EOBA 1K9AA 3P7AA 3HGKA 2VO3A 2RG6A 4FNXA 4RIOA 4BDGA 4HVDA 3VF8A 4IAIA 5DIAA 4B8MA 4I0TA 1NVSA 2BRGA 4AFEA 3JVRA 1U5RA 2XK4A 3EFWA 3QCXA 1ZYSA 4NK9A 4QPMA 4AF3A 2F49A 3P0MA 1S9JA 1ZMWA 3OD6X 3FQSA 3UIBA 5D41A 3U8WA 3D5VA 3ENHA 4XG2A 2HOGA 4JBOA 5HLWA 4J71A 1NY3A 3TACA 2X1NA 3FZSA 2Q0NA 4FL3A 4IX4A 4RVKA 5CY3A 4E6AA 1OUKA 3QTXA 3RPYA 4B9DA 3F3VA 4ZLYA 3UVRA 3QA0A 5AJQA 4EHEA 3CC6A 4FTTA 5AM7A 3GVUA 3JUHA 3VS6A 5EQYA 4QQCA 3M42A 1OECA 4K2RA 4JDJA 4R7IA 5IPJA 5M07A 1PKGA 2RG5A 1OVEA 1YHWA 3Q4ZA 4RX7A 1ZY4A 2PE1A 2YJRA 5BYYA 2CKEA 4XYFA 1OBDA 2A19B 5K5XA 2PVLA 5AUUA 4O1PA 3R6XA 4FVQA 3Q52A 4ORKA 3LJ1A 3MY1A 3TZ9A 4W4YA 4O7SA 1F3MC 3P86A 3H9OA 5IA4A 5GZ9A 4M97A 1W0XC 3HV4A 3NNUA 4G17A 2O65A 5LMKA 4G16A 4LUEA 3EQPA 4O86A 4TWCA 2BTRA 5CTPA 3MS9A 4HW7A 4O0YA 2PMIA 4L53A 5AP7A 3C4EA 4DYMA 4H05A 3R1YA 3E92A 3ERKA 5M57A 1JQHA 3IW8A 3HMIA 3QL8A 2XIRA 2R3PA 4O0UA 3RPRA 4AZVA 2P2HA 4PDOA 5HI2A 3KY2A 4LYNA 3BHVA 3HV5A 4DITA 3BYSA 4L44A 3P7BA 2XYUA 4EOPA 4BZOA 3IW6A 3PXQA 3A4PA 3ZLYA 3B8RA 3QQUA 4GYGA 2GDOA 2JDVA 3QCSA 3RPOA 3VBTA 4CFFA 5KE0A 3E63A 4U41A 3MFUA 4N6ZA 4RC2A 3W2SA 4HOKA 1E1VA 4IFGA 3Q32A 3UBDA 3IW7A 3VW6A 4BHNA 5E92A 4EYJA 4RA4A 4UALA 2WMTA 4WG3A 3ZO3A 1PMVA 2A1AB 4JS8A 1UNHA 5FRIA 4AW0A 1OKWA 4FSMA 4C2WA 3JY9A 1MP8A 1OPJA 5FQDC 2VWXA 3PVUA 5E90A 2CGUA 3H30A 3QFVA 2Q83A 3VO3A 4NYEA 3Q9YA 4V01A 1FQ1B 3BEGA 2V22A 4AZWA 4FV6A 4D58A 3JS2A 4AN2A 4A9YA 1JSTA 1SNXA 2HENA 3POOA 3Q5ZA 4IAKA 4PTGA 4QYFA 4WNMA 3ODYX 4QP9A 3ZFMA 1VJYA 4CV9A 3NGAA 4BCHA 5FDXA 4RX5A 4EK4A 2C4GA 4V05A 3NYVA 4IWPA 2C5XA 4FZDB 5BMMA 5I5ZA 2WNTA 4DCEA 1IA8A 3BV2A 3GNIB 4Q9ZA 3UOJA 2WMVA 4HNIA 3CP9A 1GIJA 3F3UA 1OKYA 1T46A 2WGJA 3QUDA 4YLKA 5HBJA 4PY1A 4UEUA 3GC9A 4BYJA 2HWOA 4X0MA 3GFEA 5J9LA 4UXQA 3OXZA 2VO0A 2PE2A 2XKFA 3R04A 1P4OA 2UZEA 4I20A 5AUZA 4JQ7A 2I0EA 3TN8A 2A4LA 3KC3A 4FR4A 4MTAA 3VHEA 4RJ4A 4C58A 3BZ3A 2HZ4A 5CZIA 4D28A 3ZSHA 4FV5A 4E4NA 3SG9A 2AUHA 4JVGA 4FYNA 4ZMEA 3KFAA 5AR4A 5D11A 5HVYA 3OWPA 2RFNA 3RWPA 2QHNA 4AOJA 4WOVA 4RIWA 3VHKA 2EUFB 4AX8A 1OPLA 5EYDA 3FLNC 3LLAA 2BIKB 3R8MA 4QMSA 3HL7A 1GY3A 4KKHA 5EI6A 2JKQA 3AMBA 3UPXA 1M14A 1KV2A 1V0BA 2JC6A 2WMQA 4EHVA 4QYEA 3LE6A 1J7UA 3FEGA 3PPZA 4EBVA 3HX4A 2J0LA 5A54A 4M68A 3LPBA 4BBFA 4G3DA 4XG7A 4OAVB 4JAIA 3QZGA 1BL7A 4DEAA 3MV5A 5C03A 4MXAA 4EORA 4DFBA 2OF2A 1GAGA 2UVXA 2W1ZA 3GCPA 5J9YA 3RGFA 3ACJA 4D4RA 3U51A 4GEOA 3FLYA 2WAJA 3E8DA 3TNWA 3GU4A 3V5LA 3DXNA 5J7HA 5DR9A 5HKMA 4MHAA 3ZO1A 1CMKE 1DM2A 2X0GA 2H34A 1OGUA 4DFLA 4FEXA 4X6QC 1ZYJA 4FSTA 3VUKA 3F9NA 5AP0A 2NNWB 5AAFA 3WYXA 4AAAA 3DBFA 4QP2A 3E87A 3C7QA 3QQLA 3ENMA
chains in the Genus database with same CATH superfamily
2ZM4A 2O2UA 3KXNA 3LFDA 4E1ZA 3UO6A 3VULA 1Q4LA 4LL5A 3EFJA 4FEUA 3MVLA 4RA5A 3EHAA 2Y8OA 2YWVA 4X2FA 4FSWA 4J99A 4PWNA 3UMWA 3V04A 3P5KA 5E9EA 5FTGA 3O2MA 3AG9A 3CQUA 5H8GA 5HCYA 4CQGA 1OGYA 4KAOA 2OKRA 3V5JA 1OIQA 4C0TA 5KKRB 1ZZLA 5IA5A 4MBJA 3PXRA 1MQBA 1QPEA 5DOSA 3HA8A 4FKVA 5J87A 4BDEA 3AQVA 3SKCA 2CPKE 2G2IA 3QTZA 2PVHA 4NIFB 3R7EA 3LCDA 4HYSA 4BWXA 2W1DA 3MESA 3R8VA 4KKEA 3PLAE 2HCKA 4G5JA 5CVFA 4M0YA 4YC8A 2PWLA 3MPMA 3QD3A 4EC9A 5ANOA 4ZIMA 4QD6A 1VZOA 5EW8A 4YHTA 4Q5HA 4RJ5A 4E73A 4FKUA 4R1VA 4I4FA 4X3FC 3FXXA 4PNKA 4CV8A 2ITZA 5J5TA 3PVWA 3FI2A 2PZRA 2R0UA 2ZDTA 2PMLX 4J96A 4JJRA 4GJ3A 4KUJA 3ORMA 1H1QA 4XP0A 1RDQE 3R2YA 1WBNA 3QQHA 2WTIA 4FSQA 3MTFA 1W84A 3ZEPA 4IM0A 3W18A 1W7HA 1FVRA 1W82A 3L8SA 5CVHA 4DTAA 5EKOA 3UP7A 4M13A 5EHOA 1R39A 2F7ZE 2QURA 5IQFA 4QMVA 2XYNA 2R3KA 4A4OA 2PZYA 2X2MA 3EH9A 4F7NA 3N9XA 2CGVA 4TPTA 2JDTA 4BC6A 3GT8A 4S33A 3AC4A 3O7LB 3AOXA 5ETIA 5JT2A 3U6IA 5TE0A 5L2QA 4QPSA 3ET7A 2WMWA 3SXFA 4NW6A 4FMQA 4II5A 3TXOA 3ODZX 2BAKA 4PL3A 3R9HA 5JGBA 5KZIA 2ZMCA 3WE4A 2YWPA 3RAWA 2B53A 5CEMA 3LQ5A 4CZUA 2VWIA 3BYOA 3EYGA 1PKDA 3UP2A 4ALVA 5AUTA 4FSNA 2G1TA 3F3TA 3Q4TA 2DS1A 5IA0A 2C0TA 4FF8A 3PZHA 3LZBA 2J90A 3I7BA 4KS8A 4RRVA 2R64A 5FBOA 4ZTRA 5IA1A 4K1BA 3FYKX 3A7IA 2J51A 1DI9A 4C4EA 2J9MA 4YJPA 4ZTQA 3WOWA 1CKPA 4EL9A 5CLPA 3OMVA 4JRNA 3AC1A 5IDNA 4H3QA 5CU4A 4IIRA 5AIRA 5ETFA 1Z5MA 4EZ7A 4JX7A 5H2UA 3Q9ZA 4TY1A 3SX9A 1SVHA 3MVJA 3R0TA 4RBLA 3VQUA 1PXNA 3NAXA 4QT1A 1QPCA 4P4CA 4JR7A 2W06A 3JVSA 3ALOA 1GNGA 3IK3A 2QO2A 3OW3A 4I6FA 3SDJA 4DFZE 4EK6A 5BNJA 3IDCA 4DFNA 2Y6MA 4FVPA 1DAYA 2UW4A 2OZAA 5KMNA 1ND4A 3UO4A 4FKIA 4QMLA 5M51A 2BRBA 2GSFA 4JIAA 5HOAA 1SNUA 5BMSA 2AYPA 3NCZA 4KIKA 3SLSA 3V01A 3ZM9A 3COMA 3OEZA 1RE8A 4U80A 4XLIA 3UG2A 3P08A 5HBEA 3SC1A 4DLIA 2W5HA 4W4XA 4BR3A 1H07A 2UW9A 1H27A 2XIXA 3ORLA 4NTTA 4S2ZA 3HV7A 3U9NA 5KCVA 3CY3A 4MCVA 4ANOA 4XG4A 4YLLA 5A4CA 3F5GA 2BR1A 3GU5A 4BTMA 3I5NA 1H1RA 3BLRA 3NDMA 2W1CA 1JKSA 5CAVA 4NUSA 4R7BA 3OCTA 4NJ3A 4G9CA 4PUZA 4EZ5A 4IBMA 4X6RA 3R8PA 1YHVA 1WBSA 1KE7A 1MQ4A 3H10A 4FIIA 4LQMA 4YLJA 3W2CA 4C38A 1H26A 4RWJA 4O84A 1P14A 2R5TA 3RINA 4ITHA 4L7SA 1XWSA 3IW5A 3ZYAA 2XNOA 4L68A 3L8PA 1E9HA 4EOQA 1L8TA 4E93A 2QOHA 2YHVA 3DU8A 1ZMVA 2R3FA 2F9GA 3G6GA 2FGIA 5CEKA 4ACDA 3K5UA 4O6EA 3ITZA 4X3FB 4XOZA 4F4PA 4LV5A 4AU8A 3KKVA 2BDJA 3I1AA 3UZPA 1YWVA 4DEHA 2QOBA 4RPVA 1J1CA 4BKJA 1ZARA 1H0WA 2VWYA 3FSFA 2OF4A 3R1SA 2QOCA 3LCSA 4QP1A 3HZTA 3C13A 4RMZA 4BDFA 2R0IA 5I9WA 3M2WA 4ZMFA 3GU7A 4RZWA 4BCJA 5LOHA 4EK8A 4O96A 4QP4A 4JDKA 2BZIB 1JVPP 2EVAA 4AT3A 3KRXA 4XEYA 3ACKA 1MRUA 3MH2A 4QP6A 4XBRA 3LXLA 2H96A 4HYUA 2FO0A 5L2SA 2F2UA 3IOPA 2WB8A 4PRJA 1ST4A 3UDSA 3W0MA 4G3CA 1URCA 5CS6A 4A9UA 3V5QA 2CHLA 5LWNA 3QGWA 4L8MA 4BTFA 3COIA 5AA9A 4LUDA 1PMEA 2ACXA 4F63A 4D4YA 4BCIA 2OJFE 5L6OA 4D4VA 4DEDA 4CD0A 1ZAOA 2R3GA 2W4OA 4YBJA 3VS3A 2C68A 4UWYA 4XRJA 5CI7A 4ZZMA 3FMLA 4M69B 2EB2A 2OSCA 4YNOA 3E3PA 5HIDA 2WKMA 3ZRMA 4AA5A 4EWQA 4HVHA 4KABA 5AP5A 4CYJA 2CNUA 4FZAB 5KMKA 3BPRA 4J8MA 2QR8A 3I4BA 2X8EA 3DB6A 5H8EA 4CNHA 1R3CA 3KF4A 5FTOA 4QOXA 2BVAA 3HV3A 3C5IA 4C33A 3KEXA 3ORXA 1JWHA 3MPTA 4PF4A 5IQBA 3COKA 5AX9A 4BYIA 3DZQA 5EQEA 4FKLA 3C4ZA 5HE0A 4ANQA 4USDA 4X2JA 2VTQA 3MGYA 2GHGA 1FPUA 4AS0A 2OFUA 3U6HA 5ICPA 3R73A 3EN5A 3PA5A 5F9EA 1A48A 4K33A 3QX4A 3OXIA 3BLQA 2B9JA 4DFXE 2HY0A 4U43A 2CCIA 2PVKA 3IONA 4ZSEA 2V62A 3FLWA 3UIUA 1FGKA 2YEXA 4A06A 3LM0A 4HNFA 2O63A 4BJJA 5F20A 4YTCA 5K0XA 2J0KA 1OIYA 4FKSA 1WVYA 3ZSGA 4C57A 4C02A 5KKRC 3LHJA 4FV8A 2PU8A 1J3HA 4M3QA 3QXPA 4RIWB 3OOGA 2YCRA 2VO6A 4BDCA 3ATSA 4NTSA 4BBEA 4BDAA 4GW8A 4G6NA 4XOYA 3WF9A 4IZ7A 4D1ZA 1YW2A 2OH4A 4O7TA 3BGZA 4P7EA 4O82A 1IASA 4ACHA 1SVGA 4DGOA 4PMPA 3UZRA 3DY7A 3FXZA 4I94A 3LQ8A 2PL0A 4KIOA 4RJ7A 2O64A 3NZ0A 2ERZE 2VTHA 3VS2A 4GS6A 4F6WA 4FIGA 5HO6A 3L9MA 4OTRA 4N6YA 4XNEA 4IB3A 5F1ZA 5J79A 2BALA 3PTGA 4RIYA 4QQJA 1KUTA 4NCTA 1LP4A 1ZLTA 5L3AA 4OTHA 3LOKA 4Y73A 4MBLA 2GQRA 2ZB1A 3LCTA 2B1PA 4EWHA 1LEWA 2BROA 4PNIA 4FEWA 4CMTA 3AGLA 4HPTE 4M67A 3EMGA 5HZNA 3V6RA 1ZXEA 3FMDA 1APME 4I5PA 2WXVA 3FY2A 4M0ZA 5DI1A 5DPVA 1Q61A 3CIKA 2R3JA 2XBAA 3QQKA 4E7WA 4EZ3A 5EYKA 1M17A 1G3NA 3LVPA 2UW7A 3UODA 3OWLA 4F9BA 3PG1A 4LOOA 3THBA 4X3JA 4GCJA 2QOLA 5DT3A 1GZOA 5HNGA 1OPKA 2A27A 4RX8A 4C3PA 5LARA 4DN5A 5CAUA 2O5KA 4V04A 3CJGA 2BZKB 3O50A 3QTIA 4AOTA 3QCYA 4EC8A 2QU5A 2FUMA 2SRCA 3Q6WA 1H25A 3GB2A 4TWOA 3LFCA 5EI2A 3ROCA 4ALUA 3TUBA 3CKWA 4L3JA 2E2BA 4Z9LA 5BYZA 3SRVA 4YJRA 3W1FA 4J53A 4MF0A 4AZTA 4MX9A 5D9HA 2XRUA 4O7ZA 3MIAA 1WBPA 4LI5A 4UV0A 5JSMA 3OTVA 4DHJA 3ZLXA 3R7VA 4I4EA 3FY0A 4XG6A 4NJDA 4XG3A 2V7OA 2RFEA 5DYJA 5FTQA 3C4WA 2UW3A 4I6BA 5HGIA 4FA2A 5KBRA 4FV3A 4XH6A 5LWMA 2QOOA 3A62A 2LGCA 3G6HA 4YJOA 2I6LA 4CYIA 2YIXA 3P78A 4YU2A 3IG7A 4U45A 5B2MA 1VEBA 1PMUA 2EXMA 1MRVA 2W1IA 4FK6A 4O0VA 5C01A 3KULA 4DGNA 3PFYA 3B2TA 3DJ6A 3JY0A 2OWBA 3KVXA 5DG5A 3UQGA 2OXXA 4EH3A 3GI3A 1Q97A 4GU6A 4O0XA 1H0VA 2PVRA 4RX9A 4BL1A 3CSVA 2FSTX 3ZEWA 4IZ5A 5H9BA 3Q04A 5B2KA 2RL5A 3RP9A 5JGAA 2JBOA 2ESMA 3OHTA 4QMWA 3DJ5A 3FI3A 4TYIA 4V0GB 3OZ6A 4M69A 1BYGA 2YABA 4ALWA 1SYKA 4IFCA 3D9VA 4I6QA 4GUEA 3C4FA 3NCGA 1R0EA 4FKJA 4RC4A 4Y5QA 2B4SB 1ATPE 5DT4A 3BRBA 1QPDA 2C69A 3QYZA 1P4FA 5DEYA 4UBAA 5KUPA 4DE4A 4KNBA 4TZRA 3AKJA 4CLIA 4BDIA 4AN3A 4AGUA 1JNKA 4IVDA 3NEWA 3ZHPC 5HQ0A 5CZHA 5I9VA 4U44A 1OIUA 4Y46A 2J7TA 3W33A 2WTVA 4OUCA 2HELA 3PSBA 1ERKA 4JRVA 3ZSIA 5JGDA 3N4TA 2VWWA 3ORIA 2XIZA 3IKAA 3PY1A 4TRLA 3UQFA 4O7VA 2X0OA 3ZXTA 2JIVA 1O6LA 4PMTA 1WFCA 3BHYA 2Z7SA 2WOTA 2WU6A 4ASXA 3GC0A 1SM2A 1UU8A 5E7RA 5E8SA 3QKMA 3OWKA 5FXQA 2WOUA 5D10A 1PYXA 3TZ7A 1WBTA 3MJ1A 3ZS5A 5HG9A 2GNJA 3C4XA 5L2TA 1Q24A 4CQEA 3I81A 4S34A 1F0QA 5A4LA 4HYIA 4RVMA 4AGCA 2X8IA 4L00A 3E7VA 2RSVA 2CKOA 4MQ1A 5LQFA 5HX6A 4MNFA 4G9RA 4R3PA 2BUJA 2VX1A 4ERWA 3QWKA 4ZP5A 4EOMA 4F6UA 2QKWB 4EOIA 1YXVA 2G2FA 2OJIA 2FVDA 3TZ8A 3UOKA 5HG8A 3BU6A 2C5OA 5JK3A 2W1GA 4D9TA 4F9WA 1XH9A 3VBVA 2OG8A 2ZM1A 3EN4A 2WQOA 4AXCA 3CJFA 5AR7A 2AC5A 4YJTA 3LXPA 2W4KA 3F2NA 3IGOA 4WUNA 3U4UA 4AG8A 2ZOQA 3MBLA 4EBWA 3RHKA 2EXCX 4IE9A 4R5YA 3UIMA 2PVFA 1PXOA 1BX6A 4RJ3A 4RLLA 4E4XA 4FSUA 1YVJA 3P23A 3CTJA 5CXHA 2UZDA 2VX3A 3MSSA 3R7YA 5GZ8A 2J0IA 3CKXA 3MJ2A 4B99A 4BCNA 1UV5A 5HU9A 3E93A 3ALNA 2CN8A 3ZH8A 4BKZA 3HUBA 3E62A 4BGHA 3BWFA 2E9UA 4YSJA 3EL7A 2ETMA 3WI6A 5HE1A 3MFRA 3BU5A 4EEVA 4FTKA 4KKGA 5HX8A 2CN5A 2WEVA 2X4FA 2OJGA 4L01A 1G5SA 4FX3A 5HLPA 2RFDA 4WSQA 3PDTA 4IHPA 5A14A 2GU8A 4IH8A 4Q5EA 3EQDA 3FYJX 4PQNA 3QRUA 4CCBA 5JFSA 4JDHA 5IQEA 2I0YA 5AMNA 2GMXA 1U54A 3BEAA 3JR1A 4F0IA 4LDTA 3OROA 2WD1A 4Z55A 3PRIA 5CNNA 1Q8ZA 3MFSA 1L3RE 4GH2A 3PLSA 4F64A 5CSHA 3EQGA 2XZSA 4EKKA 1PJKA 5HNBA 4CFMA 2IWIA 2PY3A 3E7OA 3OFMA 4YZCA 5E1SA 4EI4A 4DH1A 3DBEA 2Y4IB 4FGRA 3AC3A 5FGKA 2PVMA 3F82A 4FRFA 2R3NA 5A4TA 5GJDA 1R0PA 3QUEA 1UNLA 4BICA 1A06A 4JMQA 4DF3A 2C5NA 4AAYA 1XH4A 1Q8UA 3FUPA 4DG0E 4M84A 3AC2A 4GIHA 3Q6UA 1REJA 5M06A 3FQHA 2J0MB 5BUJA 3TV4A 3PP0A 2X4ZA 4TWNA 4E6DA 4PP9A 4ERKA 2CGXA 3H0ZA 4ZJIA 3KXXA 4NFNA 5CQWA 4O2PA 2V7AA 3HYHA 4NU1A 3UVQA 3R30A 4AN9A 4G3EA 2ITYA 4K77A 2GTMA 2NP8A 3GQLA 4FIFA 3OVVA 3PUPA 4P90A 4F99A 5LMBA 2OGVA 1ZYCA 3VWAA 4DHFA 3R9DA 2YN8A 1J1BA 3FKOA 3VF9A 3NUNA 2DYLA 4PX6A 5G6VA 5BVKA 3ZDIA 2QONA 2VWVA 4S32A 3QTSA 4UYNA 5EOLA 2F7EE 3KL8A 2PVJA 4KINA 2QI8A 3I6WA 4W9WA 4CMOA 2VN9A 4QP3A 2YIRA 2ONLC 3A7HA 4FTJA 3R7OA 4F1TA 5KMMA 3G2FA 3OOMA 1JLUE 4K11A 5CI6A 4R8QA 5HESA 5HG5A 3FC1X 1YWRA 3QBNA 4FKGA 4IW0A 3NNXA 4F08A 4FTNA 4QMPA 3SD0A 3T8OA 1OB3A 3D5UA 3VBQA 3TT0A 4D5HA 3CPCA 3GOKA 3GU6A 4DGGA 2VGOA 4KWPA 2IJMA 3ORKA 3RAIA 1UWJA 4FSZA 4FKPA 4Y95A 4FUXA 5DNRA 3ULZA 3ZC5A 1JOWB 4DCAA 5CF8A 3TDWA 1PXIA 4BJJB 1PYEA 2BIYA 3KIOC 5ETAA 3BI6A 4B0GA 1BI8A 2QHMA 2W0JA 3ZBXA 4D2TA 1Q3WA 3OC1A 3CY2A 4HCTA 4FGBA 3LFEA 2VTPA 2WMSA 3BL9A 3LJ2A 3SV0A 4XX9A 4DFUA 4OW8A 1OL1A 5AV2A 4FIHA 5IQHA 3P1AA 2HAKA 2CKQA 4JQEA 4IWOA 1SMHA 1Z57A 5HU3A 2W05A 3RPSA 5J9ZA 5EM8A 5DEWA 3CTQA 3EN7A 1O6KA 4KD1A 1WBVA 3A8WA 4N70A 5CSWA 4QNAA 4F78A 3GC8A 4HZSA 4UMPA 2WTCA 2WTKB 4ASDA 3ZXZA 4C34A 2Q0BA 3EKKA 2WMBA 4R6VA 5JN2A 1G8JA 1DI8A 4FOCA 4CTCA 1H28A 4BTJA 5J1WA 3KMWA 3E88A 3L8XA 5E8WA 2XK3A 5DHJA 2OXDA 3RZBA 4B8LA 2X9FA 3OT3A 4FG9A 1OZ1A 2XJ1A 2YM6A 4IADA 4TWPA 4W4WA 3F5PA 4BDHA 2XAOA 2JLDA 2CKPA 3DJ7A 5E8VA 3Q9WA 5JKGA 2OO8X 4K9YA 4FE2A 1XO2B 1YDTE 3RNYA 3EQIA 5FDPA 3VRZA 3SVVA 1Q3DA 2C5VA 4QYYA 5M44A 2W5AA 3K3JA 5AWMA 3QQJA 5ETCA 4FT5A 5BVWA 4BCQA 1YXTA 4RIXA 3U54A 3RI1A 2G15A 3LFFA 3FXWA 1NXKA 4AA0A 3GC7A 5E4HA 2X7FA 3QU0A 5C4KA 4FKOA 3KU2A 3VVHA 2B55A 4O6LA 2C1BA 3MYGA 4YZMA 1U4DA 4DEIA 4NM3A 1QMZA 4BFMA 4FI1A 1XBAA 4OTDA 4DBNA 1UKIA 2WQNA 4CG9A 4I5HA 4IWQA 4GRBA 4XLVA 4YJSA 4HYHA 4D2PA 3RK5A 4OTGA 1U54B 1MUOA 2ETKA 4FV2A 3SA0A 3SRVB 4FTMA 5DRDA 4MD7E 2IVUA 3KK9A 4E4LA 2ITXA 5IG1A 4O81A 4XS2A 4QYGA 2H9VA 4X2KA 2VRXA 1PXLA 1Y8YA 4O4BB 3FI8A 4U7ZA 2WEIA 4O91A 2YZLA 3PJ8A 2ONLA 4E6CA 4ZZOA 1ZZ2A 4I24A 4ZLOA 5BVNA 3MVHA 5E91A 1ZRZA 1YXSA 4GIIA 1WBWA 4FNYA 4U3ZA 4X2NA 3U87A 3NVMB 4NZWB 3FPQA 3HRCA 4YR8A 5GHVA 3W16A 4TL0A 3VS0A 4ENXA 4CGAA 2C6DA 1O9UA 4FSRA 2XKEA 3LCKA 3U9CA 2XNNA 5CF6A 3G5DA 4FTAA 1NVRA 4EQUA 3QRJA 1I44A 2WFYA 3FZ1A 2UZLA 3WZJA 4FNWA 1I09A 4L46A 4WBBB 4YO6A 3WIKA 4BDDA 5ITAA 4GKHA 5M09A 3DFCB 3HRBA 5EDRA 4HVIA 5FP6A 4JLCA 4H3BA 3BWJA 4N57A 3MA6A 3NUUA 3OCGA 3EZVA 5GZAA 4LOQA 2UV2A 5BQ0A 2JIUA 2RFSA 4KS7A 5CU6A 2XH5A 3PJ1A 1ZYDA 3VRYA 1NW1A 1VYWA 2IPXA 4BY9E 4FSYA 3U4WA 3F69A 4BB4A 4EH6A 3UGCA 3WYYA 2Z7QA 1E1XA 1REKA 2ERKA 3CS9A 4WG5A 2R3OA 3LFAA 2VNYA 3EQBA 5ANJA 3W32A 4DINA 4OR5A 1XH7A 2R3IA 4FV1A 3OXTA 2Z7LA 2Z02A 4EUTA 4CVAA 5HNIX 3C9WA 5EM7A 5EQPA 1KE5A 2IVTA 5KHXA 4EOSA 1Q8WA 3OEFX 3TKHA 2QOIA 4F70A 3FL4A 1G8SA 3G15A 2ITOA 2J0JA 4DTBA 1OBGA 2XNBA 2YIYA 2YZAA 2E9OA 5E8YA 1Y57A 4FEQA 4GFMA 5AP4A 3ZDUA 5DA3A 4BKYA 5AP3A 4IXPA 4YC3A 5ANIA 4LV7A 4F9YA 5CF4A 3O23A 4Y72A 3GENA 2XM8A 4AXFA 4IB5A 2ITTA 4WIHA 4BN1A 3EYHA 4CFUA 4DLJA 2B9HA 4MAOA 5EYCA 3ZFXA 3F61A 4O0WA 5EK7A 2QR7A 3SOAA 4BBMA 5EKNA 2F2CB 4JNWA 4KBAA 5GNKA 3FZPA 3WZDA 3UIXA 2AEGA 5C4LA 3Q2MA 4R5SA 3QUPA 3D5WA 4IVAA 1XH8A 1XMMA 2ZMDA 1OM1A 2WELA 4ANBA 4YPSA 3QX2A 4IJPA 2UW8A 2BAQA 3Q3BA 3QA8A 3BGQA 3QWJA 4J52A 4C62A 3RBWA 2XEYA 2QG7A 2GFCA 2O3PA 4PPAA 4AXDA 3DCVA 4BHZA 3BQCA 4EH4A 3DKCA 3W2RA 2JEDA 3NUXA 5GIPE 3D4QA 4A9SA 1GZKA 2ZDUA 3UTOA 4EUUA 3OTUA 2GPHA 4I23A 1ZY5A 4NT4A 5BV3A 3R02A 4C2VA 1AD5A 3MW1A 4BIDA 3R8LA 3UE4A 4W8EA 4YZNA 5A6OA 1W8CA 2P4IA 4L9IA 5C8MA 4BCOA 4DH7A 4ZSAA 3F6XA 3FLSA 2C3KA 4I1ZA 4RC3A 3RCJA 4O7WA 4P2KA 3UPZA 3DK3A 3LM5A 2Y9QA 4HPUE 2WMXA 4ZTHA 3R9RA 3H3CA 3A2CA 4WUAA 3CD8A 4AACA 2OIBA 3WZEA 2BDFA 4ZZNA 1XBCA 3TV7A 4CXAA 2BHHA 3L9NA 2JDRA 4KB8A 4YHJA 1QCFA 3DZOA 4X7QA 2WMAA 3DDQA 3KXZA 3QRKA 4FOBA 4E20A 3W0NA 5J95A 3W2QA 4DH5A 3MH0A 4M7IA 3HMNA 3KREA 3C50A 2B9IA 2BILB 5K4IA 1QPJA 3R28A 4ASEA 3PSCA 4KIPA 4UB7A 1Z9XA 3G90X 4NEUA 3DNEA 4YNEA 5JFVA 3RHXA 4AT4A 5JRSA 5A46A 4ZS4A 5M08A 1RJBA 2REIA 5J5SA 3N4VA 4HVSA 1JKLA 5EI8A 4XP2A 3MY0A 1FMKA 4MH7A 1BKXA 1YKRA 1GJOA 3R00A 2VTJA 2VTLA 3E3BX 3PWYA 5AV4A 3AMYA 4KIQA 2HZNA 4RWLA 3BLHA 4FK3A 4C4HA 4QMQA 4LV8A 1FVTA 4E5WA 1BLXA 3HDNA 5LCJA 5AX3A 2YCFA 4BI1A 3HMPA 4QP7A 5DH3A 5HVJA 2ITUA 4LM5A 5IH5A 3VW8A 1GIIA 4C35A 4ENYA 4JDIA 2YM7A 1KE8A 5I9ZA 2WQBA 1TQPA 3CTHA 3TKIA 1ZWSA 3EIDA 4QMTA 3FMMA 4YGAA 4ZAUA 2BAJA 2WTWA 3VUTA 3W10A 4FYOA 4R1YA 3ZCLA 4ANNA 2VX0A 3ZBFA 3EJ1A 1Q41A 4TYEA 4YC6A 3EWHA 4TYGA 3IQ7A 2C3JA 5C9CA 2XK8A 4H39A 3UNKA 3KRLA 3EN6A 2E9NA 3IOKA 4X2GA 1VLRA 3HEGA 3L9LA 1M2RA 2YACA 5CVGA 5JZJA 3HA6A 3QTWA 4I0SA 4I93A 4C61A 2BZJA 2PVYA 2XK7A 3OY1A 3QGYA 4O1OA 4RVLA 3ZUTA 5LVNA 4ACCA 5CQUA 1UA2A 1W98A 3A8XA 1Y91A 4QMYA 3RM7A 3FMNA 3RMFA 5KO1A 1YOMA 3OUKA 2UZOA 3JXWA 3FHRA 4QRCA 5HG7A 2PHKA 4EH7A 3DBCA 2C0OA 2OFVA 3EFKA 4HGEA 4UMQA 1H01A 3P9JA 2NYAA 3R71A 4AWIA 3Q4CA 2UVYA 3BGPA 4ACGA 3CD3A 3NAYA 5EYMA 2C6LA 2P3GX 2R3QA 4MUQA 4NW5A 3QKLA 3N4UA 4QEBA 1OI9A 4I21A 4M8TA 1Q8YA 2PZ5A 4FL1A 4XRLA 2IVSA 5AR5A 3ZLSA 2C47A 5AUVA 3BV3A 5HICA 5L6WL 3KULB 5K0KA 3GBZA 1OL2A 2QCSA 5E8XA 3A7JA 2UVZA 1ZOGA 3G51A 3UOLA 2OJ9A 3F2AA 3F7ZA 4QTEA 4A4XA 2YJSA 4U81A 4YO4A 3MFTA 3HP2A 3RAHA 4ASZA 4V0GA 2XNEA 2X8DA 1TQMA 3BHHA 3ZONA 2ZB0A 3OBGA 2C0IA 5DN3A 3Q60A 2WTJA 3OP5A 5L4QA 2J6MA 1UKHA 3UOHA 2CNQA 3LMHA 3JPVA 4ZTNA 3G33A 3NUPA 3BX5A 5LVOA 4GYIA 2PMNX 4NH1A 1H08A 3A60A 3VIDA 2XUUA 3UO5A 3F7WA 3VS4A 2XS0A 3VNTA 4AT5A 3BKBA 5C8NA 3EQRA 4DT9A 4TTHB 3TNIA 1Y8GA 2HYYA 2XIYA 2NO3A 3RM6A 1YXXA 3AD5A 4F1OA 5I9XA 5D7VA 1TQIA 4EH2A 3PJCA 2GTNA 4MKCA 3HKOA 3LXKA 4LMNA 4F7JA 2YCQA 5CU2A 3VUGA 1CDKA 4DT8A 3GCVA 4CLJA 5DR2A 1NT2A 3NUYA 1IEPA 1T45A 3LFSA 1BMKA 4OTQA 5CSPA 3OBJA 3PXKA 4A07A 3IDPA 2B9FA 5LVPA 5FEQA 3Q2JA 3MH1A 4O22A 4JBQA 4WA9A 2ZJWA 3ELJA 5AP2A 4EJ7A 5HD4A 3NPCA 3WF7A 3A7GA 3D15A 1IR3A 4PTEA 5AUYA 4FUYA 3MY5A 3QHWA 4E3CA 3DLSA 4C3FA 2GQSA 1LPUA 3MA3A 3AKKA 4ARKA 3DAJA 4S31A 5HTCA 4GFGA 1V0OA 2X6DA 5IMEA 4ZY4A 4LGDA 4J95A 2XNPA 5IF1A 5EG3A 3UYTA 4LRJA 4QMNA 4QDVA 3TMOA 5IQAA 4YTFA 2X2KA 3DKOA 4IAAA 4FKTA 2BTSA 2IO6A 4AP7A 2G2HA 4EK3A 5IZFA 3H0YA 4TN6A 4XCUA 5AUWA 3R83A 4B4LA 5GIOE 3VBXA 4LRMA 2VWBA 3LFBA 2A2AA 5HE2A 2J50A 4CSVA 4ZTMA 4USEA 3DQXA 2BKZA 3UDTA 3ZRKA 3NR9A 3PY0A 5ANEA 2GS6A 4RIYB 4B7TA 3EFLA 3I5ZA 3ZZEA 4MD8E 3NYXA 5FP5A 3WZKA 5KZ0A 2ZV8A 4DC2A 2R7BA 2FB8A 3P4KA 3LW0A 2EWAA 4DH8A 2JAVA 4IC8A 1STCE 2CLQA 3KGAA 4FTRA 4IX6A 1YRPA 4KSPA 4QTBA 3TV6A 3BCEA 5KMOA 3EZRA 2XAMA 3QZFA 1GOLA 2OIQA 2G01A 3OY3A 3D94A 1OL7A 3NFGB 2QODA 3BELA 3FI4A 3G0FA 3GP0A 3P7CA 4TKSA 4L7FA 3HP5A 3ZLWA 3D83A 5HHWA 3F5UA 5FXSA 3E8NA 5CSVA 5AA8A <