3NW7A

Crystal structure of insulin-like growth factor 1 receptor (igf-1r-wt) complex with a carbon-linked proline isostere inhibitor (34)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
297
Chain Sequence
YVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor 1 receptor
publication title Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 297
sequence length 300
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nw7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nw7A01
1VYZA 3COMA 4A9SA 5GZ8A 4D1XA 1ZZ2A 2R3FA 4UXQA 1XQZA 2R5TA 2XUUA 4WHZA 2P55A 2WTKB 5LCKA 2YM6A 3UO6A 3FMHA 4R1YA 3FDNA 4FV3A 2VWUA 4U40A 4JRVA 3OS3A 3IW5A 2ITNA 4R3PA 3C4EA 4CKJA 3OY3A 5FM2A 1ZY5A 2A27A 2F2CB 3C9WA 5ANKA 3WZKA 5AV1A 3SDJA 5FBNC 1H1WA 3F66A 2CJMA 4RGJA 2CNVA 5F95A 2R2PA 4WUAA 1WVXA 3QRTA 5L6WL 3ZFXA 5I3OA 2X2MA 5TKDA 4BDAA 4BCQA 1I09A 3KVXA 4J95A 4EHZA 2UZNA 1K3AA 3TWJA 5JFSA 1BLXA 4XUFA 4O91A 3VN9A 4DFLA 2WEVA 3RMFA 5FXSA 3ZZWA 1GJOA 3I60A 3PJ3A 3IG7A 5D41A 3UMWA 4E6QA 4I1ZA 1QPCA 4N6YA 3I1AA 4A06A 4M3QA 3CS9A 3TI1A 4EOOA 1OUKA 3ZUTA 2NNWB 4FT7A 4FSQA 2PVYA 1H4LA 4MCVA 4O1OA 4GT5A 4D28A 1YOJA 4NT4A 4V01A 4B7TA 2IN6A 4KIPA 5FP5A 4JDKA 3V3VA 3DJ7A 3HL7A 4DEEA 4ZAUA 4EH3A 3MFTA 1TVOA 2VGPA 4FR4A 2NP8A 5CTPA 3ZC6A 4XHKB 3BQRA 5HEZA 1CM8A 1H07A 3BPRA 1FPUA 3QKMA 4O7LA 3FZTA 5BVDA 2VTMA 4YZCA 5BUJA 2GNGA 3IO7A 4AU8A 3BHTA 1ZOHA 2XK6A 3EN5A 3FV8A 3P5KA 4IADA 3SG9A 3R71A 5L2WA 2VRXA 2VWXA 3CY3A 3FC1X 5AEPA 3P7AA 4BCFA 5ANJA 1YDSE 5JK3A 2CN5A 3V6SA 3GEQA 5EHLA 2UZUE 3BX5A 5IU2A 4I23A 2BPMA 3RHKA 5EW9A 4IANA 5E8YA 5FDXA 4PX6A 5CENA 4IEBA 5LWMA 1URWA 4AWIA 5JN2A 3KVWA 2ITXA 3R7GA 4M69B 3FLNC 5I5ZA 5TE0A 1JKKA 1B39A 4ZEGA 3Q2JA 3CQWA 3MN3A 4HOKA 1TKIA 2R3KA 2YWPA 4KSQA 4YZ9A 3F6XA 3SOCA 3UIMA 3L9NA 5CEOA 5G6VA 3FMJA 4MAOA 1UU8A 3QD4A 1K9AA 2BFYA 2WTDA 4PF4A 3FMNA 3WF7A 2BRBA 3CXWA 3W33A 2C68A 5IUHA 1J1CA 4Z7HA 3NAYA 3BLHA 3R21A 5EOLA 3G6GA 4EJ7A 4QRCA 3R9RA 5CAUA 3TKHA 1GIIA 3L9LA 1NT2A 2YCQA 2YERA 4G6NA 4F7SA 1UU7A 5CEQA 3JY9A 3VWAA 2WMAA 3GXLA 3QUEA 5E1SA 5J9ZA 1WMKA 2YCFA 4HCVA 4U9AA 4FVPA 4YZBA 3JS2A 4IH8A 5EHYA 4BCOA 4G2FA 4BN1A 3LMHA 1RE8A 3QALE 4APCA 4M0ZA 5DN3A 1M2RA 4OBOA 2C3JA 5CAOA 5LARA 4ENXA 4C2WA 4EK8A 4FSUA 5HO8A 3GCPA 4YGAA 3UG1A 3R2BA 2FVDA 3OUNB 4WRGA 4ZSGA 2ONLA 4OTFA 1PXIA 3LCKA 4R5SA 3TT0A 5IQFA 4L3LA 3R01A 2R3GA 3ID6C 5IH6A 4GH2A 1FBNA 4CNHA 4DFNA 2W06A 2F4JA 4H1MA 2XEYA 2OF2A 3HP2A 4NKAA 3EQCA 4QP7A 4MNEB 1REKA 4YTHA 3EN9A 2CLXA 5AAEA 2BRHA 2WHBA 1H00A 1XBCA 3VF8A 2OH0E 4FV4A 4D9UA 3BWJA 5CEKA 4DAWA 2DS1A 3IPHA 2UZWE 5CQUA 5M53A 3UG2A 4M8TA 3QU0A 5TO8A 4LRMA 1YWNA 4GKIA 2BRNA 3DB8A 1JWHA 2Z7LA 3IECA 3L8VA 5CLPA 4WT6A 3ZDUA 3NS9A 4UEUA 5JKGA 4F1OA 4EWQA 5CEPA 4E73A 3SLSA 1WBOA 3VBTA 3VJOA 4ITJA 5HLWA 4PMMA 1PYXA 2C3KA 4D4YA 2ZYBA 4FL3A 4ARKA 2P4IA 2ETMA 3V8SA 4F9AA 2ESMA 4I24A 5KMKA 5EDRA 5DT3A 4PWNA 4C35A 2GNJA 3PWYA 3BEGA 4XJ0A 2XIZA 4O22A 2XM9A 5AA9A 4G16A 1FGKA 3TL8A 4IW0A 4HNIA 5CNNA 3WZUA 2OI4X 3QBNA 3VULA 1IRKA 2UW0A 3MJ1A 3ANQA 2UW5A 4NM7A 4NU1A 5CSHA 1E1VA 3ZM4A 4C4GA 3JUHA 2VWZA 1JAMA 2HXQA 1P14A 5D7AA 4CD0A 5E92A 4EONA 3A7IA 2PULA 1Q24A 3OWJA 2WQBA 3LFSA 4QYFA 3VS0A 4ZZOA 4OUCA 4PPCA 1SMHA 3EQBA 1R78A 4BDIA 3HRCA 2JBOA 4MWIA 4EK3A 3R30A 3V5TA 4IB5A 2ITTA 4J7BA 5KUPA 2ETKA 3D7TA 4FSMA 4CZTA 3VRZA 3UZTA 5LMKC 4L53A 5E7RA 5IQBA 3M42A 4QNAA 4GCJA 4DEAA 4L67A 4JQEA 3QCXA 3LFAA 3N4UA 3QQFA 5JFXA 4CMTA 1YOLA 4UMQA 3EFLA 3H9RA 4AA0A 4J53A 4E6AA 2W5HA 1ZOGA 5EI2A 3ZO4A 4AN3A 4FGBA 5AV4A 4IM3A 5C8NA 2QVSE 4IMYA 3E63A 4Q2AA 4XP0A 2SRCA 3AT2A 2XIRA 4WG5A 5LVMA 5M4FA 4ERWA 4RLKA 1Y6BA 5CQWA 3B2TA 4C36A 4I5MA 4JNWA 3AGLA 4X6QC 2XJ1A 1Q97A 4LGDA 4PDOA 5M06A 4L3JA 2EXEA 2UZBA 5AP3A 2EB3A 2HW6A 2XZSA 1XH9A 4NFMA 4FTOA 4YC6A 4CG8A 4DFZE 4N70A 1W7HA 2V7AA 3BYUA 5EW8A 4JS8A 5TOZA 4X21A 3TCPA 4I22A 3FSKA 5EKNA 4IAFA 4P4CA 2BRMA 2QONA 3EB0A 2LGCA 1J7IA 3UOKA 2VO0A 2V22A 4GG7A 2WMQA 3AQVA 4QP3A 1GZ8A 3C1XA 4MEDA 4ENYA 3HZTA 3TV4A 5CANA 4GJ2A 4TYEA 4WUNA 1O9UA 2ZM4A 4YHTA 2OGVA 3W2QA 1YHVA 4G9CA 4O86A 2OG8A 5CASA 2WMSA 4TT7A 5IEXA 3ZS5A 3OCBA 4ZTNA 2G2IA 3KA0A 1Q5KA 2FGIA 2GFCA 2Y6MA 3NUNA 2HYYA 3W10A 3ZSHA 4FEUA 3QQJA 2ZAZA 4NWMA 5DOSA 3KQ7A 5HNGA 5D1JA 2WTKC 3R8LA 4C33A 4BCMA 3AC1A 4DT9A 1LP4A 4JDHA 3ZXZA 5I9UA 4R5YA 3Q6WA 4IWPA 4V0GB 3FMDA 5FRIA 2GTNA 5LVNA 2PL0A 4JJRA 3WF6A 3ZZEA 4FIJA 4WNPA 2XKCA 3B8RA 2RKUA 5J87A 5EYMA 4ASDA 3KEXA 3LCDA 5I3RA 5DGZA 2J7TA 2R3JA 3BV3A 3F2NA 4ZJVA 4EOMA 4LMUA 2W4JA 2YIWA 5FD2A 4M14A 4LRKA 2WMUA 1X8BA 3FXWA 5CY3A 4G9RA 2BZHB 3R00A 4M84A 2PVFA 2VTTA 4YO6A 1YXXA 3PG3A 3HMOA 2YM3A 3MS9A 2JDRA 2W4OA 4YHFA 5E8XA 2C69A 3UPZA 2XKFA 1PXLA 3BIZA 4JL9A 1BL6A 3R7OA 3BLRA 4U7ZA 4YBKA 5FUTA 1OIRA 2QQ7A 2WMVA 3DQWA 1FMOE 3PUPA 4J52A 4OTGA 5F1ZA 3NUXA 4MD7E 4WBBB 4D5KA 3S1HA 1DAWA 3CE3A 1A48A 3FLQA 4EL9A 3MW1A 1FOTA 1PXPA 3MIAA 2C6TA 3MB7A 4XLVA 4FODA 4IVCA 3UP7A 3VUHA 4JG7A 4ASXA 3TJDA 4F9BA 4IAAA 4CCUA 3BELA 2J5FA 3K5VA 3PIZA 4ZJJA 1JSUA 3PLAE 2FH9A 2WB8A 3OC1A 2QR8A 3S2PA 3PYYA 2O5KA 4X3JA 3GGFA 3G2FA 4UB7A 3EN6A 1XHAA 3C4XA 4QMQA 1OKWA 5EYDA 4GIHA 3AC4A 4RA5A 3QTRA 4YMJA 3KRJA 3QZGA 3VW6A 4BDGA 4EQCA 2PY3A 5JRQA 2X7GA 2BDFA 4TW9A 3UOJA 3E7VA 3C7QA 3KC3A 5IQAA 2JITA 3N51A 4QQCA 4KAOA 2GQGA 3H9OA 4BICA 3GFEA 5HE2A 3ZXTA 5L2IA 1H25A 4XG6A 1PXKA 1VR2A 3VVHA 2ITVA 4D58A 1ZARA 4ZY6A 4CYIA 4EZ7A 5GINE 3DGKA 4O0WA 4CQEA 3QL8A 4YC8A 3W2OA 3Q5IA 4AOJA 4PP9A 3U6IA 2J0LA 2BCJA 3A8WA 3EFKA 2IVTA 1QMZA 5AR3A 3PJ8A 3QWKA 4UYAA 4WOVA 2OJ9A 3DJ6A 3G6HA 3NX8A 1WVYA 4YZNA 5JRSA 3DK6A 4PPBA 1UWJA 3RCDA 4BDBA 4DG2E 3NW5A 2R0IA 4EH9A 2OF4A 3LM5A 1A06A 5JQ5A 4JX7A 3HAVA 4RIYB 3NVKI 4XMOA 2CMWA 4HCUA 3ZFMA 2RG5A 3CQUA 3IGOA 3K2LA 3BBWA 2R4BA 3O8PA 4O0UA 4RPVA 4XP3A 2BILB 4DBNA 5J9LA 3D14A 3LXNA 1JKSA 4E4LA 5FEQA 1F0QA 1PMNA 4LOPA 2BAQA 1ZYCA 2OZAA 4KABA 4I4FA 5E91A 3A8XA 3WIKA 3I7CA 4D2VA 4ACDA 4XG2A 5KMIA 4OAVB 2RIOA 4IZ7A 2I40A 3HV7A 4DH5A 4FI1A 3W8QA 2QOFA 5DH3A 4NTSA 5F20A 3RWPA 5CAVA 2O64A 4YJUA 3A7GA 4MXAA 4YC3A 3VS5A 3PXFA 2W1DA 4QP2A 4L8MA 4EKLA 4UN0C 3OD6X 3VS4A 3OP5A 3WYYA 3GU6A 3GB2A 2PVJA 1ZY4A 3DQXA 4CLJA 4XG4A 3NNVA 4AE9A 3PE1A 3PY0A 1IA9A 1KOAA 2R3MA 3FPMA 3L8PA 4XS2A 1E9HA 1YXVA 2QOKA 3DCVA 3DXNA 1WBVA 3IW8A 3PTGA 3F2RA 3O50A 3ORZA 4QYHA 3E64A 5J7BA 4AF3A 4EH8A 3G51A 3LPBA 4EC9A 4D2SA 1RW8A 1REJA 3BHYA 4XLIA 4GU6A 5EFQA 5JQ8A 3MTFA 3V01A 3NNWA 2VX1A 3DFCB 3DKOA 5BQ0A 3NLBA 4RFMA 4DH7A 2J2IB 3OFMA 3L9PA 1OVEA 2VWIA 3PSDA 5GZAA 4X2JA 4LUEA 4DH3A 5T68A 2X4FA 5AX3A 5GNKA 2O65A 3HRFA 3V04A 4CLIA 3PJ1A 3SVVA 2C5XA 3MH2A 2WMRA 3KY2A 4AFJA 3LMIA 2WQEA 5LXMA 4IZYA 4KBCA 4FT0A 4KWPA 4ZTQA 1FQ1B 3DLZA 4QMNA 3KF7A 1CKIA 2YDJA 3UODA 3EQRA 5L8JA 3GBZA 4ANBA 3TZ9A 1Q4LA 5ICPA 4BL1A 4RX7A 4FZ7A 3MV5A 5BMSA 5M08A 3JYAA 5EM8A 2XCKA 1JOWB 4AT3A 1PW2A 3E92A 3E93A 5KMOA 4U6RA 4QYGA 3ROYA 4CMOA 4IC8A 3SGCA 3FLSA 3PWDA 3FLWA 4DINA 5B0XA 3UIBA 4R3CA 2PE0A 3MESA 4F09A 3CTJA 5KMMA 2YIRA 3HV3A 3KXZA 2F7ZE 5A54A 2JDVA 3C50A 4DFYA 3KCFA 4BBFA 1KE8A 3EQIA 1QPJA 4P7EA 4EQMA 3O8UA 3EWHA 4I0TA 3R83A 5M44A 4F4PA 2RF9A 1YXUA 2IW6A 4C02A 2IZUA 4JVGA 3UNZA 4S30A 3VBQA 5JZJA 1OPJA 3ORIA 4B99A 2YJRA 2FSMX 2PE1A 3AC3A 4FV7A 4JQ7A 5AR4A 4F9YA 3CSVA 2G01A 2X9EA 4M12A 4KIKB 2FA2A 5HG7A 5M07A 2DQ7X 4IVBA 4Q5HA 3BRBA 4IZAA 1ERKA 4ZS0A 4S2ZA 3D5VA 2XJ2A 2C6LA 4RWIA 2JIVA 4DH1A 2AC3A 4YNOA 5IQEA 4M68A 2EXCX 3SX9A 2VTIA 3FZPA 5A4LA 3D5WA 1GZOA 4HVSA 2UVXA 4XX9A 5L3AA 3OEZA 4EK6A 4EYMA 2WIHA 4ZTRA 3BHVA 3MFRA 1J1BA 3R1NA 4FICA 3FKOA 5DVRA 4DTBA 4FKOA 5D11A 3I0QA 4XV3A 1PJKA 1Q99A 1KE6A 1OZ1A 4A4LA 5JMSA 5HIDA 4CV8A 1DI8A 3ZHPC 2IZSA 4WSYA 2ZB0A 4MVFA 4F0IA 4O27B 4TTHB 2ZDTA 3W18A 4M67A 5K5XA 1MRVA 2DUVA 1GOLA 3BYSA 1OITA 3LHJA 4LG4A 4RJ4A 5IA2A 1GZNA 4FKVA 4BCJA 2PK9A 2WEIA 1UWHA 3TUBA 1ZXEA 1AGWA 3UZPA 3UOHA 5KHWA 1WBSA 3JVRA 4C59A 5GJDA 3K5UA 2BKZA 3U6JA 5C4LA 4JXFA 2UW3A 3FQEA 1H0VA 4PMPA 4ALWA 3VJNA 2FSOX 4ASZA 2P2HA 4FV1A 1U4DA 2O2UA 4USDA 4UXLA 1U5QA 5KNJA 4YPSA 4ACHA 3RM7A 4BF2A 2XBJA 2HZNA 4XP2A 2V0DA 4ZK5A 1YDRE 3UPXA 2X9FA 3RWQA 4W4XA 4RIXB 3A7FA 2VO3A 2XNPA 3QCQA 4GUBA 3COHA 4OT6A 3PIYA 4I6FA 5CS6A 3BHUA 5DNRA 3DXQA 1OM1A 5DRDA 3FI4A 1SNXA 3GCSA 4HPTE 4DEIA 4FIFA 5IA5A 1NVQA 1ZOEA 3ZLWA 4RT7A 4O6EA 2GS7A 3JVSA 3LE6A 3NNXA 3WF8A 4AQCA 4F0FA 4J96A 3U4UA 4QP1A 1JSTA 3N4VA 3T9IA 2BFXA 2OWBA 5EI8A 3KULA 1LPUA 3MB6A 4XG8A 4XNEA 5DLSA 2IG7A 4FEVA 1O6KA 1B38A 1PKGA 4YTIA 3SQQA 5LMAA 4EH7A 3I4BA 4WSQA 3S00A 5L2TA 3CBLA 3FKLA 1KE9A 2RFDA 2Z7RA 5HCYA 3JXWA 1HOWA 2C6EA 2I1MA 4EYJA 2CNUA 2QOBA 3EN7A 4P5QA 5HIEA 3V5JA 4M97A 4JOAA 4MD8E 3ZO1A 4IHPA 4O82A 5L6PA 1Z9XA 5KMJA 5CSPA 3O23A 5HKMA 1PXNA 5HOAA 3BCEA 4QMVA 4IWDA 2VTRA 3NYXA 2XRUA 4J71A 3MSSA 4DHFA 4RJ6A 4WA9A 3G0EA 4FV8A 2JGZA 3FPQA 3MWUA 5A6NA 3OOMA 4AUAA 4IDVA 3R7VA 3FC2A 1H26A 4AZTA 5HBEA 2KULA 4CRLA 4HCTA 3H4JA 4ITHA 1OPLA 3V51A 4QYEA 4CFNA 5IG1A 2QU6A 3HRBA 3QA8A 1RDQE 2PVHA 3IDPA 3TNIA 3VUIA 2QU5A 1V1KA 4C61A 3NUAA 1OUYA 2VTSA 5IUIA 3ZC5A 5IUGA 3WZEA 3F82A 4F08A 5LMBA 4MXZA 4F1MA 2BZJA 5BVOA 4IX6A 4C8BA 3LFCA 3RK5A 3QD2B 4YPDA 1URCA 4PP7A 4E7WA 3SRVB 3KL8A 1M2PA 2XK9A 2Z7QA 4CT2A 3GQLA 2BUJA 1WCCA 5AUTA 3FZOA 4A7CA 4BWXA 2YN8A 3O8TA 3G9NA 3H0ZA 1KSWA 3FUPA 3TZ7A 2VX3A 3HDNA 4PTGA 3NSZA 1IG1A 4B6LA 3LKMA 4J99A 1CTPE 3I5NA 4JBPA 4D1ZA 4FIIA 4KBKA 1GNGA 5KMLA 5BX0A 4J8NA 2Y4IB 5L2QA 3RZFA 1SVGA 3IW7A 2P3GX 5A3XA 4MK0A 4O0XA 1W8CA 4ZSJA 4H3BA 3C0IA 4E4MA 2R64A 4FYNA 5AJQA 2ERZE 3ZFYA 5M56A 3V6RA 2QO9A 4X3FB 2JD5A 4RX8A 3G15A 2HY81 4NKSA 4F99A 2C5NA 4NFNA 1P4FA 2A0CX 2OH4A 4FKUA 4PRJA 3I6WA 1ZZLA 3H10A 2JAVA 2WU7A 4DLIA 3GC0A 2YM8A 5IZFA 2J0KA 2ITQA 5HD7A 3W32A 1W98A 1PXOA 2I0VA 5AADA 4EBVA 1WBPA 3DJ5A 3RPSA 3LZBA 4RQVA 1AQ1A 4MBJA 3S3IA 4KKEA 5CU6A 2FO0A 4JQ8A 3HA8A 2I7QA 2XS0A 5F4NA 2CKEA 4RJ5A 5HVJA 3TZMA 4C7TA 3UVRA 3L8XA 5BVEA 3ZCLA 4AOIA 4KBAA 2HENA 4QP8A 5K0XA 4FKWA 4NEUA 5DG5A 2BR1A 5AUVA 3RAHA 4HW7A 3EH9A 2RSVA 3EZVA 3AXWA 3ITZA 2P0CA 3OUKA 2J9MA 3ZO3A 4OLIA 4DGLC 5HZNA 2IZRA 4U42A 1KE5A 2ZV7A 2O3PA 3CPBA 3MDYA 4BYIA 2E2BA 3C4WA 5FGKA 4BI0A 3R1QA 1XJDA 3FZSA 4GL9A 5DEWA 5KHXA 1BKXA 3ZSIA 4A4OA 2Y4PA 3R04A 3PXKA 4FL2A 2VTAA 3AMAA 4YZDA 5CALA 5TF9A 4OBPA 4TYHB 4CFFA 3NW7A 4PQNA 3UYSA 2RGPA 4OGRA 4WRSA 4LUDA 5IF1A 3ZU7A 5KX8A 1PRYA 4AW2A 2B53A 5A4CA 2WELA 4ANOA 4YUQA 5M4UA 4M7IA 1VEBA 1F5QA 2XVDA 3A4PA 3ZLYA 4H1JA 3IK3A 4PPAA 3EYGA 3TKUA 4UY9A 1Q3DA 2PYWA 3D83A 5HQ0A 2XIKA 1FGIA 3Q96A 1P5EA 1YXTA 2J51A 4RIWB 2GCDA 4YR8A 3GCQA 1FINA 2YLFA 2R3OA 1CDKA 4Z3VA 2I0YA 2YM7A 3RNIA 3SD0A 4Z16A 3UOLA 3S0OA 5CF6A 4EOIA 3AMBA 2RG6A 4IJPA 4O2ZA 2ITUA 4RG0A 1BYGA 2YABA 4YTCA 2W4KA 3O51A 3VO3A 2O8YA 3HP5A 4AAAA 4BGGA 2WO6A 2X7OA 4EBWA 5M09A 1YWVA 3KXXA 4I4EA 4RVMA 4U43A 2BRGA 3QRKA 1PHKA 3C0HA 1UV5A 4AGWA 4YU2A 4O96A 3UQCA 4AG8A 4GW8A 3M11A 4K6ZA 2HELA 5FXRA 3LXLA 3PZEA 4ACMA 3LFNA 4FSZA 1KV2A 4NIFB 4K18A 4CXAA 2ERKA 3ZM9A 4BWPA 2YHVA 3HECA 4NUSA 1ATPE 5B2KA 4EEVA 4NL0A 2QKWB 3OBGA 4CV9A 3AGMA 1BUHA 3U9CA 1GIJA 3ORNA 2W5AA 5DHJA 5ANDA 2XRWA 3F3UA 3NR9A 4CCBA 1U46A 1BX6A 3QTUA 5DPVA 3UGCA 3QQHA 3ZLSA 5BPYA 4X2FA 3V5QA 3F9NA 3R9OA 5IQDA 3CC6A 1PMEA 1WZYA 3HEGA 3RNYA 2ETRA 4LMNA 4IFGA 3A62A 3K3JA 2VX0A 1YKRA 2WU6A 3Q32A 4IBMA 2W96B 5AM7A 3SW4A 2C6OA 2V62A 3EKKA 5EDPA 1QL6A 2H9VA 5M51A 5HU9A 5IMXA 1OL6A 3DS6A 2Z8CA 3GUBA 1XR1A 2CGUA 3W16A 4GG5A 3K3IA 4FSTA 4QMUA 5DRBA 1XH8A 5G1XA 4L3PA 4QP4A 4TN6A 3RK9A 3OCTA 5E9EA 2ZM1A 5GJGA 4C37A 5C1QB 3AD5A 2OIQA 2XNNA 2W9ZB 3LXKA 3NDMA 4EH4A 5KCVA 3FMMA 1SM2A 2E9NA 3MVHA 3QTIA 4O0RA 3ZOSA 2GMXA 4UZDA 5DBXA 4E8AA 3PP0A 4KIQA 4G34A 3TKIA 2W99B 2WQNA 3PXQA 3UYTA 4BWKA 4X0MA 3LMGA 1LEWA 1OIYA 3OT8A 4IVDA 2BALA 3DV3A 4UV0A 3KRRA 5ANIA 4OTPA 2BKKA 3C13A 3EOCA 3WOWA 1NY3A 2UZVA 4C34A 4EK5A 3CIKA 2E9VA 4I94A 2W1ZA 3IQ7A 3MH3A 2W1GA 2H6DA 4N0SA 1H0WA 2HZ0A 2WXVA 5HX8A 5BYZA 4C2VA 5LOHA 2R0UA 3ENMA 3G33A 4PL5A 5IPJA 4FK3A 5AM6A 5FQDC 4ZZNA 5FBOA 3DBCA 5FDPA 2X8EA 2YIYA 3RCJA 2WOUA 3DK7A 1TQMA 4FKPA 4W4VA 4EOSA 4X2NA 4BTJA 5J9YA 1GZKA 3PJ2A 5E1EA 4D9TA 4C58A 5IH5A 4FKQA 3DNDA 4XV9A 4KS7A 4WNMA 1IASA 4U81A 3GC8A 4RWLA 4IIRA 2GFSA 3RZBA 4C57A 4RSSA 3U87A 3AT3A 3UO5A 4QQJA 2Z2WA 3VW8A 5JEBA 3TDVA 3MFUA 5AFVA 3AC5A 2G15A 3Q9YA 5AX9A 5C03A 5CU3A 3MH1A 1U5RA 4CFWA 4BGHA 5A4QA 4Y73A 2C0TA 2QD9A 4H3PA 2PE2A 4IC7A 2Q0BA 4U8ZA 2BAJA 2NRUA 3OXIA 1OBDA 2GQSA 3OWPA 3P7BA 3RALA 2BIKB 2XMYA 4FEWA 3KMMA 2J5EA 1HCLA 3ORLA 5CAPA 3KN5A 4A9RA 1WVWA 2P2IA 1BI7A 4FC0A 1JNKA 3R7EA 3QLGA 2X1NA 4PMTA 4CYJA 4JR7A 4TKSA 4I93A 1MQBA 4W8EA 4ANSA 2W1FA 3BWFA 5JGBA 2BDWA 5DR2A 4NK9A 5D7VA 2IPXA 3FMLA 3GCUA 2ITZA 2OKRA 4KB8A 4RJ8A 4TWCA 5GHVA 4FTNA 4DEDA 4FTIA 3NVMB 3UC4A 3SA0A 4O2PA 4DEBA 3HGKA 4A9TA 3EQDA 5L8KA 2E9UA 3PG1A 5EQYA 4NYEA 3FSFA 4CKIA 1L8TA 3QUPA 3THBA 4EH2A 2VNYA 1L3RE 1VJYA 3FQSA 1M17A 3O71A 4WKQA 5CU4A 5J8IA 4AW0A 4GKHA 4RJ7A 4UWYA 2EWAA 5HVKA 3FEGA 1YWRA 1B6CB 1FVRA 2YIQA 5KBRA 3GOPA 3FKNA 1S9JA 2QR7A 3R1YA 4DLJA 5CU0A 4PDPA 5B7VA 5JH6A 2NPQA 5HE3A 4D0WA 3TTJA 2B9HA 5C27A 2W1EA 4IAKA 2CNQA 3VS7A 2DWBA 2OK1A 2VNWA 4YTFA 2J0MB 5JGAA 4GV1A 4L42A 2GS2A 5IQHA 4ALUA 3D9VA 2Y4IC 3R28A 3PXYA 5HCXA 5JSMA 5J7HA 3PVGA 3FI3A 2XB7A 3BYMA 4FK6A 3DOGA 1KOBA 4L01A 4MXOA 3ZRKA 3VC4A 1DAYA 2WTVA 3DFAA 3BV2A 5AR2A 3CGFA 5J5SA 5LCJA 3CJFA 4X3FC 4PL4A 5EW3A 3R8VA 2HAKA 4WO5A 4P5ZA 4IE9A 4DG0E 4UMUA 2Y8OA 3QXPA 4JRNA 4PDYA 5CXHA 4W9XA 4LGHA 4XG9A 3BU5A 4C3PA 4S32A 2FYSA 5E8WA 5E90A 5GZ9A 5DR6A 1YHWA 4NM0A 3WARA 3Q3BA 2HWPA 3COKA 3FZ1A 4UWBA 5FEDA 5LWNA 3UE4A 4BDJA 1RQQA 1UVRA 3NUYA 1EH4A 3LCSA 5HIBA 4AN2A 4E1ZA 3RINA 3PDTA 2PPQA 2XEZA 4XCUA 1Q41A 3VBWA 4K77A 1U59A 3GU5A 4K8AA 5JZNA 4NM3A 2HWOA 4EWHA 1H1PA 3NYVA 4YLJA 2GHGA 1Y8GA 5A46A 2YEXA 2YISA 1IA8A 4I6QA 4MH7A 4DCAA 2VU3A 2WZJA 3A60A 1YI3A 3CY2A 3PVBA 4JBVA 2VTLA 5AV0A 3QZHA 1M2QA 2GDOA 2A4LA 5IISA 3TDWA 4RFYA 2R7BA 3TXOA 5HORA 2VN9A 4BY9E 4CQGA 5LQFA 4EZ3A 5IDPA 2B7AA 5E8ZA 2I0HA 2BZKB 1H28A 4AZWA 5HE1A 4RC4A 3GP0A 3E87A 4D4SA 4ID7A 4G6LA 4HGLA 3OY1A 3WE8A 1ZRZA 3KK9A 4DC2A 4FNYA 3LFEA 4MF1A 4PMSA 4HYHA 4TXCA 5IA1A 3UNJA 2C5VA 3KGAA 4IX4A 2X2KA 3MVJA 3QC4A 1U54A 4LV8A 5AR8A 1W83A 1R3CA 3ZBFA 4IM2A 2PZIA 5HVYA 3QZFA 4ERKA 2R3HA 3DAJA 3KMUA 3FLZA 3O0GA 3DU8A 3EQHA 2OJGA 3D7ZA 3QLFA 1VZOA 4G3FA 3EQPA 4UMTA 5FTQA 4BDFA 4YSJA 4XBRA 4F7LA 3LQ5A 4ZMFA 1I44A 4RZWA 3KK8A 5AIRA 4BCPA 3BI6A 3RVGA 2UVYA 2XK4A 2QOCA 3DKFA 3LM0A 2CGVA 1YW2A 2GQRA 4HYIA 2CLQA 5HICA 2C30A 3AD4A 2WMWA 3PVUA 3MI9A 2P33A 3FLYA 5ETCA 1JPAA 4CZUA 2XK7A 4JLCA 4D4VA 3MGYA 4BTFA 2CSNA 2H8HA 3DAEA 4OR5A 2IZTA 5HNIX 3FXZA 3R63A 4U0IA 3G5DA 3LLTA 3FYJX 4ITIA 2WOTA 3AC2A 4R7HA 4YHJA 3EHAA 4HVHA 2E9PA 2GNIA 1FVTA 5CVHA 5HI2A 4AGDA 3FI8A 4K2RA 3BHHA 2V55A 2KTYA 3D4QA 3R1SA 2W0JA 3TIZA 2ITWA 2PVKA 3U6HA 3VRYA 4A9UA 2C6KA 2UZTA 4MD9E 2WQMA 4S33A 3TNPC 3OWKA 4I0SA 2OLCA 4LOOA 1JKTA 2XIYA 1ZYJA 3QF9A 4JIKA 3BE2A 3UVPA 2C0OA 2CKOA 4XOZA 2B55A 4E5WA 2PU8A 5CXZA 3TNHA 4OBQA 2GNHA 4NCTC 3CTHA 3OF0A 3AOXA 3HV6A 2ZB1A 1JVPP 5ETFA 4J98A 5AP5A 3POZA 2PVMA 2X8IA 2X8DA 4ANMA 4DEGA 4EUTA 5ANGA 5I9VA 1SVHA 2OICA 3RAIA 3HAMA 1GIHA 2BROA 4BZNA 3OROA 3ZTXA 2YZAA 4P2KA 3OT3A 4BHNA 3AG9A 3DTWA 4ZP5A 2B9FA 1J7LA 1W84A 4GYIA 2C1BA 2O63A 3QTWA 5DYJA 3E62A 4O7RA 3RHXA 2ZDUA 2GTMA 5IDNA 1O6YA 1OBGA 5CSVA 3WIGA 3LQ3A 3E5AA 4BDDA 2Q83A 3D7TB 3I7BA 2UZDA 2QO2A 1DM2A 2QI8A 4MWHA 4YNEA 2WNTA 5B2MA 4L46A 3PRIA 4OTIA 1OL2A 3IW6A 1H1SA 4IJ9A 3DNEA 3VBXA 3H3CA 4E4XA 5L2SA 3DBFA 2CKPA 3E8DA 3NYNA 4JDIA 4F7NA 4GFMA 5BUEA 5KKRB 2FSLX 3MPMA 1IAHA 2UZEA 1Q61A 2V7OA 3KF4A 5T3QA 2W9FB 4B9DA 4G31A 3PA3A 4D2PA 1XH7A 4JG6A 4JR3A 1E1XA 4TY1A 3OTVA 2CCHA 5K3YA 3PLSA 3OXZA 4AZVA 4BCKA 4DGNA 3R2YA 4C0TA 4DBXA 2BAKA 2W5BA 4V05A 3EL7A 3ZBXA 3PA5A 3FHIA 3E3PA 4GUEA 4AX8A 4P90A 4ZOGA 1QPEA 5DWRA 3W2PA 3MFSA 4WNOA 2XNEA 4GS6A 2UUEA 4NZWB 5C26A 1H8FA 5M55A 5CF8A 2B0QA 3LFFA 3UQFA 5EM6A 4I3ZA 3TM0A 3B8QA 4EKKA 3IONA 2VWWA 3KRXA 4FKSA 4RIOA 4UBAA 5H8EA 3MPTA 2XA4A 4Y5HA 4L44A 4ACCA 4QMTA 4M69A 4G5PA 2QKRA 3AMYA 4EOKA 1JLUE 4D4RA 4L6QA 4NW5A 4AXAA 3CEKA 5I4NA 5JT2A 3EQGA 4FTJA 3PPZA 4BDHA 4GFOA 3FWQA 4GVJA 3V8WA 4K33A 4FYOA 4Y8DA 3C0GA 3WF5A 4DG3E 5BUIA 4FNWA 4X2GA 4YJPA 2FB8A 2PVRA 1XH4A 1PMVA 2PUUA 5H2UA 4EH5A 4L00A 3DT1A 5L4QA 1KV1A 3T9TA 3DTCA 2UW6A 3BU3A 4PDSA 4BDCA 2YJSA 5DIAA 3Q4CA 4W4YA 4PTEA 3CKWA 5HBHA 4FA2A 4BBEA 2R3IA 3TTIA 1OB3A 1PXJA 4O0SA 1G8AA 4DE4A 3SC1A 5IMEA 3IS5A 3W2SA 3A4OX 4FZAB 4MHAA 3RM6A 5FG8A 4RWKA 2QOLA 5I0BA 4G6OA 1QCFA 3PSBA 3MYGA 3OTUA 4KD1A 3DXPA 2PMLX 4O0TA 4WBOA 5EYKA 4ZJIA 1KWPA 3BE9A 3EN4A 3LCTA 2CN8A 4FL1A 4IWOA 1MRYA 4QQ5A 3R8MA 2OJJA 3RTPA 3F3ZA 3UJGA 2OJFE 4J8MA 3G90X 3TZ8A 5KBQA 2GNFA 2EB2A 4MXCA 2PUIA 1DS5A 2HK5A 2AYPA 3KCKA 4ZTLA 4MNEA 4RVTA 4NH1A 3Q4TA 4KRDA 4G3EA 4FTRA 4TL0A 4I20A 3QFVA 3IDBA 2W7XA 1R0PA 3CCNA 4MYGA 2I6LA 4GIIA 5CNOA 1ND4A 2BMCA 4X2KA 4YSMA 3GNIB 3BZ3A 3NUUA 5IEYA 2XNGA 3RKBA 3OCGA 3NYOA 3BKBA 1OECA 3NCZA 5ETAA 4RWJA 2QO7A 4MBIA 2UW8A 4IAYA 4OT5A 1NVSA 2X39A 3A61A 3VNTA 4E6CA 2X7FA 3PPKA 3TNQB 4I5PA 3ZSGA 5C8KA 3BQCA 4IAIA 5HG5A 1J7UA 2QLQA 4ACGA 3JR1A 3GOKA 3Q4UA 3DZOA 4C3FA 4CTBA 3QHRA 2EUFB 4ZLZA 4U79A 2C0IA 1Q8ZA 5ANOA 3F5GA 2JKMA 4TNBA 4EJNA 2PZRA 1XH6A 3QTSA 4LL5A 4MF0A 5FTOA 3VQHA 4XG3A 3D5XA 3SKCA 4L68A 5HESA 3RPOA 3GQIA 5M4IA 5AUUA 2G2HA 2WD1A 3FQHA 5H3QA 5HLPA 2PTKA 3BLQA 3OG7A 4QMMA 3ZONA 3W8LA 4FIGA 2PZYA 4B8MA 3ROCA 4B4LA 2CHLA 2BHHA 1Y8YA 4XYFA 3R0TA 4QTEA 4F1TA 2YCSA 5GJFA 1ZAOA 1OL1A 4FT3A 4RC3A 3P23A 2H34A 3QCSA 2VTNA 3ZEPA 3OEFX 4I5HA 4AGCA 4PY1A 2OFVA 3EYHA 3GC7A 4AT5A 4CMUA 4FOCA 2IW9A 5EHOA 1NVRA 5EQPA 4KRCA 4AOTA 3R8PA 3HMMA 5EK7A 2Z02A 3HYHA 3LAUA 2WTJA 5CF5A 2ZMDA 3PZHA 2ZMCA 4FTKA 5EOBA 2OXDA 3DKCA 3SAYA 3QRUA 3VS3A 5DI1A 4L9IA 2VTPA 3OWLA 4F64A 2OZAB 3F3TA 4DA5A 3LCOA 3UO4A 2HIWA 3Q60A 4BCNA 2WTIA 3T3VA 5HO7A 4FUYA 4FMQA 1STCE 4H05A 3E88A 4AGUA 4KKGA 4N6ZA 5E8SA 5HCZA 1FVVA 4EOJA 3WZDA 3F2AA 3QQLA 4YO4A 3W2RA 4O81A 2VO7A 2ONLC 5AWMA 4RMZA 1OMWA 3ORPA 1PY5A 4MBLA 4FTQA 4FKIA 2C6IA 4O21A 4L43A 2Y6OA 3QX4A 3GVUA 3RP9A 3D0EA 2UV2A 1OL7A 3OXTA 1XBAA 3EL8A 5JFVA 2EVAA 5EKOA 2VWYA 1Q8TA 4M0YA 3PIXA 1JSVA 5AAFA 4FV6A 3R7YA 1JQHA 1J3HA 4FZFB 4RBLA 5CYIA 4YURA 3M1SA 5AV2A 1ZMWA 4Y85A 3W1FA 3SG8A 3R7UA 4FEXA 4UWCA 3E7OA 3SXRA 4D5HA 5AIKA 4BIDA 4FKTA 4AA5A 2F49A 3MY5A 1Z5MA 3RPYA 2VTHA 4TYJA 3F3VA 4E5BA 5L6OA 1BL7A 1YI4A 4QYYA 3BGPA 4R78A 3DA6A 4K1BA 4AW1A 4DT8A 2F7XE 3BBTB 4FX3A 1YVJA 4II5A 3VHKA 2IWIA 4BR3A 4DTAA 1ZYLA 1CSNA 2QNJA 3KKVA 4DTKA 5FLFA 3PFQA 5AUZA 2WTCA 3EMGA 3ZMMA 4CVAA 1OKZA 3SV0A 3WZJA 4G3DA 3NIEA 5DMZA 1ZMVA 4OTQA 3QQKA 3TEIA 4V0GA 4BIEA 4U44A 4UZHA 4ZTHA 5C4KA 1YHSA 2YM4A 3RPRA 2A1AB 4F6WA 5AP0A 2BTSA 4PNKA 5LVPA 3ODZX 1V0OA 2WFYA 2YDIA 3A99A 3RJCA 4IVAA 3PVWA 2UW9A 2QODA 3ANRA 4K0YA 4IB3A 3VUGA 3RAKA 3RBWA 4RVKA 1ZWSA 4K9YA 3QYZA 4JAJA 4I41A 4G3CA 3ZLXA 4BZOA 3D2IA 4E5AX 1BI8A 3BYOA 4HYUA 4B8LA 5HGIA 3KRLA 3ATTA 3VBVA 4NSTA 4DGMA 4S31A 3DLSA 2X81A 5B2LA 3HA6A 5D9HA 4QQTA 2CKQA 2C47A 3LJ2A 2AC5A 4O6LA 3UZRA 2ZM3A 3LFQA 2PWLA 5CT0A 5F94A 2Z60A 1SZMA 1Y6AA 3PJCA 3QXOA 1OGUA 1R1WA 3KN6A 2QHMA 4GK3A 2YIXA 2HZ4A 3V5PA 2C6DA 4AN9A 4QO9A 5KKRC 3LVPA 3SHEA 5EG3A 1ZYSA 2RL5A 4S34A 3HVCA 5A4EA 2GNLA 4LOQA 3KREA 4L7SA 1Z57A 3I79A 2HXLA 4M15A 4GFGA 2C3IB 4USEA 4OW8A 4MXYA 3R8ZA 2UZOA 4H39A 4NJ3A 4TRLA 3L9MA 3S4QA 4ZSLA 1OPKA 4ZXTA 2Q0NA 5HE0A 3BU6A 4FTCA 4Z9LA 3DDQA 2LAVA 4O7ZA 4BTMA 1MUOA 3F7ZA 4AT4A 4FG7A 4W8DA 5CI6A 2OIDA 3MTLA 4O0VA 4FZDB 4M66A 3HNGA 1KE7A 4D2WA 3CR0A 5BVFA 3UMXA 3VS2A 4CTCA 2QOHA 4HPUE 1M7QA 3MVLA 4PL3A 3ZEWA 4C62A 1ZYDA 3LLAA 4QPMA 4PNIA 3FZRA 3Q5ZA 4F9CA 4QMPA 2X2LA 2GHLA 3V8TA 1XKKA 2B9JA 1A9UA 4GJ3A 3EQFA 4FSWA 3F69A 1M52A 2RFSA 4AW5A 4EHVA 4ZY5A 4O7YA 3ENHA 2XYNA 3SOAA 4EOQA 2QHNA 1NW1A 5J1WA 4O7WA 1OL5A 3I6UA 4BI1A 3T3UA 3ACJA 1PMUA 3C4ZA 3PSCA 4YJNA 1H24A 3HV4A 2XM8A 5DR9A 3UQGA 3KXHA 4QMOA 4U97A 2GU8A 4WNKA 4YP8A 3FI2A 2R3PA 3FL4A 3F7WA 3O17A 4GEOA 4ZIMA 2A19B 1UKHA 3D5UA 4RIYA 4EC8A 3OW3A 4U41A 3A2CA 2ZV8A 3IGGA 5EM7A 3H0YA 5K9IA 4TWOA 5LJJA 3QCYA 4U5JA 2HOGA 2VTQA 3MY0A 4RC2A 5FM3A 5IQCA 1WFCA 5F9EA 3ORMA 5CEIA 4ZSAA 4FIEA 4XRJA 2ACXA 3QYWA 4I5CA 3C51A 5KMNA 4PV0A 3WE4A 1YI6A 5FXQA 4D0XA 4F0GA 3R73A 5AUXA 2X6DA 4XG7A 4C38A 3F88A 4ZTMA 3NAXA 4BVUA 4BCGA 3ALNA 5EI6A 4ASEA 4ZLYA 3NRMA 4QTAA 1PYEA 3WBLA 4FTTA 2XYUA 1XO2B 4U3ZA 4RZVA 2IJMA 4A4XA 4QMWA 4CFXA 2YAAA 2WAJA 2V5QA 4LGGA 2JKKA 4O84A 3POOA 3L8SA 2OJIA 4YJQA 3B2WA 5EYCA 3R9NA 3QZIA 2ITYA 5A14A 3TG1A 4G3GA 2EU9A 1PKDA 2XKEA 4Y46A 5AR7A 4OTRA 2OW3A 1W82A 4UALA 3DY7A 3D2KA 4FTLA 4EK4A 1GY3A 2G9XA 2PZPA 3KULB 4BFMA 2CGXA 3QQGA 2J0IA 4F70A 1YOMA 3DBEA 3R8UA 1CKPA 2C5YA 2Y9QA 3LJ1A 1SYKA 3ETAA 4XV1A 1LEZA 5C9CA 4QP6A 4YBJA 4F9WA 2FSTX 4CFMA 5J1VA 3IDCA 3UNKA 4BKZA 4RX9A 3QGYA 4ANNA 4RA4A 3FMKA 3H9FA 3GI3A 3Q4ZA 3BGQA 5H8GA 2REIA 5BVKA 4RJ3A 4F6SA 4AZFA 3EKNA 4HGSA 3ATSA 1XBBA 3DB6A 5AP4A 5FP6A 2ZV9A 3ORTA 4AP7A 4EORA 2OXYA 3FMEA 3ODYX 4KA3A 1YDTE 4E3CA 5IA3A 3PXRA 4I0RA 4DH8A 3PXZA 3NIZA 4KKHA 4QPSA 3AT4A 3PY1A 4FTAA 4FV5A 1UKIA 4GK4A 5KZ0A 4BYJA 4TWNA 4YJSA 3K54A 4NJDA 4EQUA 5CSWA 3LFBA 5M4CA 4G5JA 4CKRA 4DGOA 1R39A 2R3NA 2YLEA 5ACBC 3D15A 2ITPA 2VO6A 4D1SA 2B52A 3UBDA 5HLNA 4OTWA 1IR3A 4IXPA 3TUCA 2F2UA 2J6MA 2JFMA 2W1IA 4R8QA 1OIQA 2GPHA 4R6VA 3KXGA 4ZZMA 3DZQA 4DFXE 3HMIA 4BI2A 2JKOA 2OBJA 3P0MA 3R22A 3IW4A 5AP7A 3Q9ZA 5CI7A 5CWZA 5AP1A 3AC8A 3RPVA 4AACA 3NPCA 4H3QA 4AE6A 3AD6A 4FT9A 4CT1A 3LJ0A 4TWPA 4IACA 3QGWA 4FV0A 5ACKA 4MNFA 2YFXA 2WPAA 4I21A 3QA0A 3PY3A 3PPJA 5DE2A 2F9GA 3ULZA 4O7TA 3FJQE 4QNYA 2JKQA 2OU7A 3NEWA 5HHWA 2DYLA 4IQ6A 3ZUUA 4E20A 5HTCA 3EIDA 4G1WA 3FYKX 4KIKA 2XBAA 5BNJA 5C01A 4QTDA 3TIYA 4EOPA 2JLDA 4LI5A 3GENA 1F3MC 3QWJA 4FEQA 1YQJA 2VTJA 3CKXA 3F3WA 2VWBA 3F5XA 4KIOA 3GC9A 3EFWA 4N4SA 3RK7A 5HNBA 4JBQA 4R7IA 2X0GA 3JPVA 2NO3A 4BDEA 2R3RA 5AMNA 5H8BA 3TV7A 1G3NA 1P2AA 3ZH8A 2YM5A 3MA6A 5IKWA 1M7NA 5T6KA 2YWVA 4QTCA 4USFA 5J95A 2UZLA 4G17A 2B1PA 2F57A 4FKLA 3HUBA 4AZSA 1YXSA 2WTWA 3A7HA 3VAPA 4KSPA 3C5UA 3JY0A 2NRYA 2WMXA 3MVMA 5TT7A 4C4IA 3OOGA 4I6HA 4Z7GA 2OFUA 2I0EA 4E26A 3LOKA 2PMNX 4HVIA 4O7NA 3OW4A 3QX2A 4TZRA 3V5LA 3CP9A 3HUCA 1VYWA 4ANLA 1Q62A 3HDMA 1YRPA 2YA9A 3NCGA 4XH6A 3LQ8A 4HVGA 2IW8A 4RFZA 4ONAA 4YJOA 2J4ZA 3EJ1A 4MXXA 2B54A 4O1PA 2BTRA 4FVQA 4YJTA 2W1HA 3GU8A 4CRSA 4DN5A 3KXNA 3OBJA 2VZ6A 4MQ2A 5C8MA 4JDJA 4MX9A 4BZDA 1OIUA 3SXSA 1DI9A 2WGJA 4IDTA 3F5UA 1XH5A 4XV2A 4Q5EA 5HG8A 1O6LA 3P9JA 5JFWA 4KNBA 4DCEA 3NWWA 2XIXA 2BIYA 2QC6A 4IX5A 2XKDA 5E8UA 2C3LA 2BVAA 4CFUA 4Z55A 5HTBA 3VF9A 4FKGA 2WQOA 3ERKA 2ITOA 4H36A 4UYNA 3ZRLA 3HLLA 4GT3A 4RIXA 2R3QA 3CTQA 4BB4A 4QMSA 1TQPA 4FIHA 3OCSA 2O0UA 4IZ5A 4HYSA 1WBNA 4BC6A 2X4ZA 4ALVA 5I9WA 3ZRMA 4GSBA 5IA4A 5LMKA 4BTKA 2XNMA 5HBJA 4AA4A 4TNDA 1J91A 4JG8A 1T46A 1MP8A 3Q9WA 4BKJA 4E4NA 3TJCA 3NW6A 3CD3A 1UU9A 2GSFA 3LIJA 4HJOA 4K11A 3W55A 3WILA 5LVOA 1OKYA 4XRLA 4R77A 2CPKE 4C4FA 2C1AA 4I6BA 2JAMA 2ZJWA 5I9YA 1ZLTA 4JBOA 1G5SA 1H1QA 2H96A 4EH6A 3CD8A 3ORKA 3ZUVA 4XEYA 4BCHA 4IB0A 3F5PA 2Y7JA 2YITA 1XWSA 3ALOA 1LR4A 4CFVA 2Z7SA 2XNOA 1Y57A 1WAKA 2E9OA 5HO6A 4CSVA 3R02A 1P4OA 4ZSEA 4IX3A 4GYGA 3E8EA 4QT1A 2HZIA 3ELJA 4FF8A 2QLUA 3PA4A 4R3RA 2XK3A 5AV3A 3UP2A 4YJVA 3MA3A 3VUMA 4F7JA 3QTZA 4LRJA 2GHMA 4BGQA 3FBVA 5HU3A 4WIHA 5HG9A 4OTHA 4BRXA 4OAUC 4C4JA 4Q9SA 5BVWA 3KFAA 3WF9A 3II5A 3TUDA 3DAKA 3QKLA 5TR6A 4DGGA 4QP9A 3GCVA 4O38A 3H30A 3UVQA 4CG9A 3QKKA 3QUDA 5AUWA 3N4TA 2RFNA 4Y72A 2A2AA 3SXFA 1MRUA 4BKYA 4EUUA 4Q9ZA 5HX6A 4MQ1A 1Q8UA 3EZRA 3QTQA 4GT4A 5ANEA 3U9NA 2PHKA 1Q8WA 3R6XA 3E3BX 5CF4A 5IA0A 3QC9A 3NUPA 1IEPA 2VGOA 3QRIA 4O0YA 5AR5A 4GU9A 3P1AA 2CCIA 4FGRA 3E8CA 4JIAA 3KB7A 3O7LD 4BIBA 4DYMA 2JC6A 3A7JA 3CJGA 5DT0A 1GAGA 4EHGA 2B4SB 3QHWA 2PZ5A 1JBPE 2QG7A 3VS1A 1FMKA 2PMOX 3SRVA 4E93A 2BHEA 5H9BA 5LVLA 3BYVA 3O2MA 3MIYA 4IB1A 3HKOA 2JFLA 4W4WA 2AUHA 4AFEA 3KMWA 2PSQA 2JIIA 4MTAA 3P78A 5DA3A 5AP6A 3MPAA 3N9XA 3Q04A 3P79A 3CLYA 4IM0A 2Y0AA 5DEYA 5CZHA 1IAJA 3G0FA 3I5ZA 3OHTA 3VHEA 4CZYB 3U54A 5EH0A 3FAAA 5E8VA 2C4GA 3HMNA 4YJRA 1WBTA 4X3FA 5CZIA 4B0GA 4M13A 5HTIA 2QOQA 4IFCA 4N57A 3TN8A 1UNHA 5FTGA 3MBLA 5GIOE 3P7CA 3FE3A 1BMKA 2J0JA 5E4HA 5EQEA 3UC3A 1SVEA 4HZSA 2QOIA 4ZMEA 4WD5A 4D2TA 4O83A 2C6MA 2R7IA 3FY2A 3T8OA 4FV9A 4HGTA 4JT3A 2OZOA 2PMIA 4FVRA 3UIXA 4CGAA 4TYIA 5M57A 4GK2A 2BZIB 3I0OA 4MKCA 5A9UA 4WG3A 2VV9A 5KZIA 4R1VA 1W0XC 3NUSA 1T45A 1WBWA 3UDBA 3ULIA 4D55A 1SNUA 5L8LA 3QD3A 2XH5A 2WMTA 3NNUA 5DT4A 3U8WA 3FHRA 5CEMA 1KUTA 3C4FA 3VUKA 4LM5A 2EXMA 2IVUA 2XK8A 3DPKA 1OI9A 2J90A 1K2PA 3NZ0A 4TYGA 4FSRA 2WIPA 3TACA 1JKLA 5K4JA 5KO1A 4DFBA 5D10A 4ORKA 3ZO2A 4BHZA 3UTOA 2UW7A 2IVSA 3WYXA 3NGAA 2JIUA 4FKRA 2VUWA 3CGOA 1UNLA 5EM5A 3FXXA 4V04A 3PP1A 3DKGA 4PTCA 4U80A 5I9ZA 5K4IA 5BMMA 3OZ6A 3FL5A 5FWKK 2C5OA 5E8TA 2G2FA 4O7SA 3L1SA 4FV2A 5IEVA 1APME 4TYHA 1UU3A 4RLLA 5CVFA 2QURA 3P86A 4CEGA 1H01A 3V5WA 2PVLA 2X6EA 3KRWA 2XF0A 3WI6A 3O96A 4L45A 3ZYAA 2XJ0A 4LFIA 3NMUF 5AP2A 3GU4A 5A6OA 3R9HA 4FT5A 3DK3A 3M2WA 3IKAA 1HCKA 5IH4A 2QCSA 4DF3A 1AD5A 4FNZA 3ORXA 5K5NA 2YZLA 4D2RA 3Q2MA 4KINA 1PF8A 4I92A 4RIWA 2OO8X 2QG5A 2YCRA 4J1RA 5I9XA 3W2CA 3QQUA 1MQ4A 2VAGA 1H1RA 2F7EE 2R3LA 1NXKA 1PXMA 1G8SA 2CDZA 3OMVA 3C4CA 3CPCA 3ET7A 4JX3A 4OTDA 1V0BA 5AUYA 5EDQA 3VQUA 5D12A 3TNWA 2J50A 1QPDA 1RJBA 4EI4A 4FKJA 3LW0A 4HZRA 4F6UA 4O7VA 2VD5A 4A07A 4EZ5A 4ZTSA 4FG9A 4GMYA 4RVLA 5DFPA 4QMXA 4ZY4A 3Q9XA 4F63A 4BDKA 2G1TA 4UX9A 3HMPA 3PE2A 5CX9A 4L52A 3ZDIA 4WG4A 5J79A 4QD6A 3Q53A 5KE0A 5BVNA 5CAQA 3QRJA 4NIFA 4AS0A 4PUZA 3KXMA 3REPA 4AZEA 3DDPA 4QPAA 4XOYA 2XNBA 3S95A 5AA8A 2WKMA 5J5TA 3C5IA 3G9LX 4HGEA 4Y95A 2B9IA 2OIBA 3DBQA 1TQIA 3BEAA 4FTMA 4LL0A 4FSYA 1LUFA 4NCTA 5ETIA 5JGDA 2JDSA 3GT8A 2W1CA 4F65A 3QAME 5CT7A 4QMLA 3LFDA 4FG8A 4RQKA 1CMKE 3VS6A 3ACKA 4FOBA 5IQIA 2ZV2A 3RAWA 2ZVAA 2OSCA 4IAZA 3EFJA 5CU2A 3QTXA 3F61A 3P4KA 2YDKA 4FZ6A 5FEEA 4RX5A 4FE2A 2W17A 1Q8YA 4BBMA 3VUTA 2WMBA 2ZOQA 1H08A 4H58A 3O7LB 2QOOA 2XP2A 3RGFA 1ZMUA 3UIUA 4BCIA 4LQMA 1V0PA 2UVZA 4ZLOA 4X7QA 1M14A 4UMPA 5CSXA 4X6RA 2YACA 3TV6A 5ITAA 4LYNA 3KU2A 2UW4A 2OXXA 2VWVA 4FNXA 3P08A 1U54B 4QMZA 4KS8A 3OVVA 4YLKA 4GRBA 5CVGA 3R7IA 4UMRA 2BDJA 4TPTA 4R7BA 1Q3WA 1S9IA 2IO6A 2JDOA 3DBDA 4HNFA 3GFWA 4XBUA 4W9WA 4QTBA 4C4HA 4DEHA 4Y83A 3E8NA 5K0KA 4EHEA 4NM5A 5BYYA 3HV5A 2HCKA 4QMYA 5IQGA 1R0EA 3VUDA 4ZS4A 3QD0A 3RI1A 2YAKA 4IWQA 4U45A 4C4EA 4RRVA 4KUJA 3MY1A 5BYLA 4FBXA 4FTUA 2VTOA 3U4WA 3U51A 1Y91A 2GS6A 4A9YA 1H27A 2XCHA 2W05A 2FUMA 2HW7A 4QOXA 2RFEA 2CGWA 3U55A 4DITA 4FSNA 4J97A 4GVAA 3COIA 3BGZA 3Q6UA 4APPA 4ANQA 5GIPE 2IVVA 3SW7A 4C3RA 4HVDA 2R9SA 3CQEA 4NW6A 1UA2A 5AAGA 5HD4A 4EOLA 2PUNA 2JBPA 4JI9A 4U3YA 1OKVA 3FY0A 3Q52A 4YZMA 4E6DA 3VBYA 3VIDA 3IOPA 3I81A 3PRFA 3LXPA 2PVNA 3MJ2A 4JAIA 1UNGA 4YLLA 4Y5QA 1CKJA 3MH0A 5A4TA 2PUPA 2HY0A 4FUXA 4DFUA 4L7FA 3R9DA 1NA7A 2JDTA 3IOKA 3D94A 4NTTA 3GU7A 3HX4A 2JEDA 4LV5A
chains in the Genus database with same CATH superfamily
4O4EA 1VYZA 3COMA 4A9SA 5GZ8A 4D1XA 1ZZ2A 2R3FA 4UXQA 1XQZA 2R5TA 2XUUA 4WHZA 2P55A 2WTKB 5LCKA 2YM6A 3UO6A 3FMHA 4R1YA 3FDNA 4FV3A 2VWUA 4U40A 4JRVA 3OS3A 3IW5A 2ITNA 4R3PA 3C4EA 4CKJA 2XAMA 3OY3A 5FM2A 1ZY5A 2A27A 2F2CB 3C9WA 5ANKA 3WZKA 5AV1A 3SDJA 5FBNC 1H1WA 3F66A 2CJMA 4RGJA 2CNVA 5F95A 2R2PA 4WUAA 1WVXA 3QRTA 5L6WL 3ZFXA 5I3OA 2X2MA 5TKDA 4BDAA 4BCQA 1I09A 3KVXA 4J95A 4EHZA 2UZNA 1K3AA 3TWJA 5JFSA 1BLXA 4XUFA 4O91A 3VN9A 4DFLA 2WEVA 3RMFA 5FXSA 3ZZWA 1GJOA 3I60A 3PJ3A 3IG7A 5D41A 3UMWA 4E6QA 4I1ZA 1QPCA 4N6YA 3I1AA 4A06A 4M3QA 3CS9A 3TI1A 4EOOA 1OUKA 3ZUTA 2NNWB 4FT7A 4FSQA 2PVYA 1H4LA 3P5JC 4MCVA 4O1OA 4GT5A 4D28A 1YOJA 4NT4A 4V01A 4B7TA 2IN6A 4KIPA 5FP5A 4JDKA 3V3VA 3DJ7A 3HL7A 4DEEA 4ZAUA 4EH3A 3MFTA 1TVOA 2VGPA 4FR4A 2NP8A 5CTPA 3ZC6A 4XHKB 3BQRA 5HEZA 1CM8A 1H07A 3BPRA 1FPUA 3QKMA 4O7LA 2NYAA 3FZTA 5BVDA 2VTMA 4YZCA 5BUJA 2GNGA 3IO7A 4FRFA 3BHTA 1ZOHA 2XK6A 3EN5A 3FV8A 3P5KA 4IADA 4AU8A 3R71A 5L2WA 3SG9A 2VRXA 2VWXA 3CY3A 3FC1X 5AEPA 3P7AA 4BCFA 5ANJA 1YDSE 5JK3A 2CN5A 3TMOA 3V6SA 3NFFB 3GEQA 5EHLA 2UZUE 3BX5A 5IU2A 4I23A 2BPMA 3RHKA 5EW9A 4IANA 5E8YA 5FDXA 4PX6A 5CENA 4IEBA 5LWMA 1URWA 4AWIA 5JN2A 3KVWA 2ITXA 3R7GA 4M69B 3FLNC 5I5ZA 5TE0A 1JKKA 1B39A 4ZEGA 3Q2JA 3CQWA 3MN3A 4HOKA 1TKIA 2R3KA 2YWPA 4KSQA 4YZ9A 3F6XA 3SOCA 3UIMA 3L9NA 5CEOA 5G6VA 3FMJA 4MAOA 1UU8A 3QD4A 1K9AA 2BFYA 2WTDA 4PF4A 3FMNA 3WF7A 2BRBA 3CXWA 3W33A 2C68A 5IUHA 3W0OA 1J1CA 4Z7HA 3NAYA 3BLHA 3R21A 5EOLA 3G6GA 4EJ7A 4QRCA 3R9RA 5CAUA 3TKHA 1GIIA 3L9LA 1NT2A 2YCQA 2YERA 4G6NA 4F7SA 1UU7A 5CEQA 3JY9A 3VWAA 2WMAA 3GXLA 3QUEA 5E1SA 5J9ZA 1WMKA 2YCFA 4HCVA 4U9AA 4FVPA 4YZBA 3JS2A 4IH8A 5EHYA 4BCOA 4G2FA 4BN1A 3LMHA 1RE8A 3QALE 4APCA 4M0ZA 5DN3A 1M2RA 4OBOA 2C3JA 5CAOA 5LARA 4ENXA 4C2WA 4EK8A 4FSUA 5HO8A 3GCPA 4YGAA 3UG1A 3R2BA 2FVDA 3OUNB 1ST4A 4WRGA 4ZSGA 2ONLA 4OTFA 1PXIA 3LCKA 4R5SA 3TT0A 5IQFA 4L3LA 3R01A 2R3GA 3ID6C 5IH6A 4GH2A 1FBNA 4CNHA 4DFNA 2W06A 2F4JA 4H1MA 2XEYA 2OF2A 3HP2A 4NKAA 3EQCA 4QP7A 4MNEB 1REKA 4YTHA 4QDVA 3EN9A 2CLXA 5AAEA 2BRHA 2WHBA 1H00A 1XBCA 3VF8A 2OH0E 4FV4A 4D9UA 3BWJA 1G8JA 5CEKA 4DAWA 2DS1A 3IPHA 2UZWE 5CQUA 5M53A 4AQKA 3UG2A 4M8TA 3QU0A 5TO8A 4LRMA 1YWNA 4GKIA 2BRNA 3DB8A 1JWHA 2Z7LA 3IECA 3L8VA 5CLPA 4WT6A 3ZDUA 3NS9A 4UEUA 5JKGA 4F1OA 4EWQA 5CEPA 4E73A 3SLSA 1WBOA 3VBTA 3VJOA 4ITJA 5HLWA 4PMMA 1PYXA 2C3KA 4D4YA 2ZYBA 4FL3A 4ARKA 2P4IA 2ETMA 3V8SA 4F9AA 2ESMA 4I24A 5KMKA 5EDRA 5DT3A 4PWNA 4C35A 2GNJA 3PWYA 3BEGA 4XJ0A 2XIZA 4O22A 2XM9A 4O4CA 5AA9A 4G16A 1FGKA 3TL8A 4IW0A 4HNIA 5CNNA 3WZUA 3PUFC 2OI4X 3QBNA 3VULA 1IRKA 2UW0A 3MJ1A 3ANQA 2UW5A 4NM7A 4NU1A 5CSHA 1E1VA 3ZM4A 4C4GA 3JUHA 2VWZA 1JAMA 2HXQA 1P14A 5D7AA 4CD0A 5E92A 4EONA 3A7IA 2PULA 1Q24A 3OWJA 2WQBA 3LFSA 4QYFA 3VS0A 4ZZOA 4OUCA 4PPCA 1SMHA 3EQBA 1R78A 4BDIA 3HRCA 2JBOA 4MWIA 4EK3A 3R30A 3V5TA 4IB5A 2ITTA 4J7BA 5KUPA 2ETKA 3D7TA 4FSMA 4CZTA 3VRZA 3UZTA 5LMKC 4L53A 5E7RA 5IQBA 3M42A 4QNAA 4GCJA 4DEAA 4L67A 4JQEA 3QCXA 3LFAA 3N4UA 3QQFA 5JFXA 4CMTA 1YOLA 4UMQA 3AKKA 3EFLA 3H9RA 4AA0A 4J53A 4E6AA 2W5HA 1ZOGA 5EI2A 3ZO4A 4AN3A 4FGBA 5AV4A 4IM3A 5C8NA 2QVSE 4IMYA 3E63A 4Q2AA 4XP0A 2SRCA 3AT2A 2XIRA 4WG5A 5LVMA 5M4FA 4ERWA 4RLKA 1Y6BA 5CQWA 3B2TA 4C36A 4I5MA 4JNWA 3AGLA 4X6QC 2XJ1A 1Q97A 4LGDA 4PDOA 5M06A 4L3JA 2EXEA 2UZBA 5AP3A 2EB3A 2HW6A 2XZSA 1XH9A 4NFMA 4FTOA 4YC6A 4CG8A 4DFZE 4N70A 1W7HA 2V7AA 3BYUA 5EW8A 4JS8A 5TOZA 4X21A 3TCPA 4I22A 3FSKA 5EKNA 4IAFA 4P4CA 2BRMA 2QONA 3EB0A 2LGCA 1J7IA 3UOKA 2VO0A 2V22A 4GG7A 2WMQA 3AQVA 4QP3A 1GZ8A 3C1XA 4MEDA 4ENYA 3HZTA 3TV4A 5CANA 4GJ2A 4TYEA 4WUNA 1O9UA 2ZM4A 2X0PA 4YHTA 2OGVA 3W2QA 1YHVA 4G9CA 1XMLA 4O86A 2OG8A 5CASA 2WMSA 4TT7A 5IEXA 3ZS5A 3OCBA 4ZTNA 2G2IA 3KA0A 1Q5KA 2FGIA 2GFCA 2Y6MA 3NUNA 2HYYA 3W10A 3ZSHA 4FEUA 3QQJA 2ZAZA 4NWMA 5DOSA 3KQ7A 5HNGA 5D1JA 2WTKC 3R8LA 4C33A 4BCMA 3AC1A 4DT9A 1LP4A 4JDHA 3ZXZA 5I9UA 4R5YA 3Q6WA 4IWPA 4V0GB 3FMDA 5FRIA 2GTNA 5LVNA 2PL0A 4JJRA 3WF6A 3ZZEA 4FIJA 4WNPA 2XKCA 3B8RA 2RKUA 5J87A 5EYMA 4ASDA 3KEXA 3LCDA 5I3RA 5DGZA 2J7TA 2R3JA 3BV3A 3F2NA 4ZJVA 4EOMA 4LMUA 2W4JA 2YIWA 5FD2A 4M14A 4LRKA 2WMUA 1X8BA 3FXWA 5CY3A 4G9RA 2BZHB 3R00A 4M84A 2PVFA 2VTTA 4YO6A 1YXXA 3PG3A 3HMOA 2YM3A 3MS9A 2JDRA 2W4OA 4YHFA 5E8XA 2C69A 3UPZA 2XKFA 1PXLA 3BIZA 4JL9A 1BL6A 3R7OA 3BLRA 4U7ZA 4YBKA 5FUTA 1OIRA 2QQ7A 2WMVA 3DQWA 1FMOE 3PUPA 4J52A 4OTGA 5F1ZA 3NUXA 4MD7E 4WBBB 4D5KA 3S1HA 1DAWA 3CE3A 1A48A 3FLQA 4EL9A 3MW1A 1FOTA 1PXPA 3MIAA 2C6TA 3MB7A 4XLVA 4FODA 4IVCA 3UP7A 3VUHA 4JG7A 4ASXA 3TJDA 4F9BA 4IAAA 4CCUA 2XARA 3BELA 2J5FA 3K5VA 3PIZA 4ZJJA 1JSUA 3PLAE 2FH9A 2WB8A 3OC1A 2QR8A 3S2PA 3PYYA 2O5KA 4X3JA 3GGFA 3G2FA 4UB7A 3EN6A 1XHAA 3C4XA 4QMQA 1OKWA 5EYDA 4GIHA 3AC4A 4RA5A 3QTRA 4YMJA 3KRJA 3QZGA 3VW6A 4BDGA 4EQCA 2PY3A 5JRQA 2X7GA 2BDFA 4TW9A 3UOJA 3E7VA 3C7QA 3KC3A 5IQAA 2JITA 3N51A 4QQCA 4KAOA 2GQGA 3H9OA 4BICA 3GFEA 5HE2A 3ZXTA 5L2IA 1H25A 4XG6A 1PXKA 1VR2A 3VVHA 2ITVA 4D58A 1ZARA 4ZY6A 4CYIA 4EZ7A 5GINE 3DGKA 4O0WA 4CQEA 3QL8A 4YC8A 3W2OA 3Q5IA 4AOJA 4PP9A 3U6IA 2J0LA 2BCJA 3A8WA 3EFKA 2IVTA 1QMZA 5AR3A 3PJ8A 3QWKA 4UYAA 4WOVA 2OJ9A 3DJ6A 3G6HA 3NX8A 1WVYA 4YZNA 5JRSA 3DK6A 4PPBA 1UWJA 3RCDA 4BDBA 4DG2E 3NW5A 2R0IA 4EH9A 2OF4A 3LM5A 1A06A 5JQ5A 2AQXA 4JX7A 3HAVA 4RIYB 3NVKI 4XMOA 2CMWA 4HCUA 3ZFMA 2RG5A 3CQUA 3IGOA 3K2LA 3BBWA 2R4BA 3O8PA 4O0UA 4RPVA 4XP3A 2BILB 4DBNA 5J9LA 4LV7A 3D14A 3LXNA 1JKSA 4E4LA 5FEQA 1F0QA 1PMNA 4LOPA 2BAQA 1ZYCA 2OZAA 4KABA 4I4FA 5E91A 3A8XA 3WIKA 3I7CA 4D2VA 4ACDA 4XG2A 5KMIA 4OAVB 2RIOA 4IZ7A 2I40A 3HV7A 4DH5A 4FI1A 3W8QA 2QOFA 5DH3A 4NTSA 5F20A 3RWPA 5CAVA 2O64A 4YJUA 3A7GA 4MXAA 4YC3A 3VS5A 3PXFA 2W1DA 4QP2A 4L8MA 4EKLA 4UN0C 3OD6X 3VS4A 3OP5A 3WYYA 3GU6A 4DHJA 3GB2A 2PVJA 1ZY4A 3DQXA 4CLJA 4XG4A 3NNVA 4AE9A 3PE1A 3PY0A 1IA9A 1KOAA 2R3MA 3FPMA 3L8PA 4XS2A 1E9HA 1YXVA 2QOKA 3DCVA 3DXNA 1WBVA 3IW8A 3PTGA 3F2RA 3O50A 3ORZA 4QYHA 3E64A 5J7BA 4AF3A 4EH8A 3G51A 3LPBA 4EC9A 4D2SA 1RW8A 1REJA 3BHYA 4XLIA 4GU6A 5EFQA 5JQ8A 3MTFA 3V01A 3NNWA 3KIOC 2VX1A 3DFCB 3DKOA 5BQ0A 3NLBA 4RFMA 4DH7A 2J2IB 3OFMA 3L9PA 1OVEA 2VWIA 3PSDA 5GZAA 4X2JA 4LUEA 4DH3A 5T68A 2X4FA 5AX3A 5GNKA 2O65A 3HRFA 3V04A 4CLIA 3PJ1A 3SVVA 2C5XA 3MH2A 2WMRA 3KY2A 4AFJA 3LMIA 2WQEA 5LXMA 4IZYA 4KBCA 4FT0A 4KWPA 4ZTQA 1FQ1B 3DLZA 4QMNA 3KF7A 1CKIA 2YDJA 3UODA 3EQRA 2X0QA 5L8JA 3GBZA 4ANBA 3TZ9A 1Q4LA 5ICPA 4BL1A 4RX7A 4FZ7A 3MV5A 5BMSA 5M08A 3JYAA 5EM8A 2XCKA 1JOWB 4AT3A 1PW2A 3E92A 3E93A 5KMOA 4U6RA 4QYGA 3ROYA 4CMOA 4IC8A 3SGCA 3FLSA 3PWDA 3FLWA 4DINA 5B0XA 3UIBA 4R3CA 2PE0A 3MESA 4F09A 3CTJA 5KMMA 2YIRA 3HV3A 3KXZA 2F7ZE 5A54A 2JDVA 3C50A 4DFYA 3KCFA 4BBFA 1KE8A 3EQIA 1QPJA 4P7EA 4EQMA 3O8UA 3EWHA 4I0TA 3R83A 5M44A 4F4PA 2RF9A 1YXUA 2IW6A 4C02A 2IZUA 4JVGA 3UNZA 4S30A 3VBQA 5JZJA 1OPJA 3ORIA 4B99A 2YJRA 2FSMX 2PE1A 3AC3A 4FV7A 4JQ7A 5AR4A 4F9YA 3CSVA 2G01A 2X9EA 4M12A 4KIKB 2FA2A 5HG7A 5M07A 2DQ7X 4IVBA 4Q5HA 3BRBA 4IZAA 1ERKA 4ZS0A 4S2ZA 3D5VA 2XJ2A 2C6LA 4RWIA 2JIVA 4DH1A 2AC3A 4YNOA 5IQEA 4M68A 2EXCX 3SX9A 2VTIA 3FZPA 5A4LA 3D5WA 1GZOA 4HVSA 2UVXA 4XX9A 5L3AA 3OEZA 4EK6A 4EYMA 2WIHA 4ZTRA 3BHVA 3MFRA 1J1BA 3R1NA 4FICA 3FKOA 5DVRA 4DTBA 4FKOA 5D11A 3I0QA 4XV3A 1PJKA 1Q99A 1KE6A 1OZ1A 4A4LA 5JMSA 5HIDA 4CV8A 1DI8A 3ZHPC 2IZSA 4WSYA 2ZB0A 4MVFA 4F0IA 4O27B 4TTHB 2ZDTA 3W18A 4M67A 5K5XA 1MRVA 2DUVA 1GOLA 3BYSA 1OITA 3LHJA 4LG4A 4RJ4A 5IA2A 1GZNA 4FKVA 4BCJA 2PK9A 2WEIA 1UWHA 3TUBA 1ZXEA 1AGWA 3UZPA 3UOHA 5KHWA 1WBSA 3JVRA 4C59A 5GJDA 3K5UA 2BKZA 3U6JA 5C4LA 4JXFA 2UW3A 3FQEA 1H0VA 4PMPA 4ALWA 3VJNA 2FSOX 4ASZA 2P2HA 4FV1A 1U4DA 2O2UA 4USDA 4UXLA 1U5QA 5KNJA 4YPSA 4DDGA 4ACHA 3RM7A 4BF2A 2XBJA 2HZNA 4XP2A 2V0DA 4ZK5A 1YDRE 3UPXA 2X9FA 3RWQA 4W4XA 4RIXB 3A7FA 2VO3A 2XNPA 3QCQA 4GUBA 3COHA 4OT6A 3BL9A 3PIYA 4I6FA 5CS6A 3BHUA 5DNRA 3DXQA 1OM1A 5DRDA 3FI4A 1SNXA 3GCSA 4HPTE 4DEIA 4FIFA 5IA5A 1NVQA 1ZOEA 3ZLWA 4RT7A 4O6EA 2GS7A 3JVSA 3LE6A 3NNXA 3WF8A 4AQCA 4F0FA 4J96A 3U4UA 4QP1A 1JSTA 3N4VA 3T9IA 2BFXA 2OWBA 5EI8A 3KULA 1LPUA 3MB6A 4XG8A 4XNEA 5DLSA 2IG7A 4FEVA 1O6KA 1B38A 1PKGA 4YTIA 3SQQA 5LMAA 4EH7A 3I4BA 4WSQA 3S00A 5L2TA 3CBLA 3FKLA 1KE9A 2RFDA 2Z7RA 5HCYA 3JXWA 1HOWA 2C6EA 2I1MA 4EYJA 2CNUA 2QOBA 3EN7A 4P5QA 5HIEA 3V5JA 4M97A 4JOAA 4MD8E 3ZO1A 4IHPA 4O82A 5L6PA 1Z9XA 5KMJA 5CSPA 3O23A 5HKMA 1PXNA 5HOAA 3BCEA 4QMVA 4IWDA 2VTRA 3NYXA 2XRUA 4J71A 3MSSA 4DHFA 4RJ6A 4WA9A 3G0EA 4FV8A 2JGZA 3FPQA 3MWUA 5A6NA 3OOMA 4AUAA 4IDVA 3R7VA 3FC2A 1H26A 4AZTA 5HBEA 2KULA 4CRLA 4HCTA 3H4JA 4ITHA 1OPLA 3V51A 4QYEA 4CFNA 5IG1A 2QU6A 3HRBA 3QA8A 1RDQE 2PVHA 3IDPA 3TNIA 3VUIA 2QU5A 1V1KA 4C61A 3NUAA 1OUYA 2VTSA 5IUIA 3ZC5A 5IUGA 3WZEA 3F82A 4F08A 5LMBA 4MXZA 4F1MA 2BZJA 5BVOA 4IX6A 4C8BA 3LFCA 3RK5A 3QD2B 4YPDA 1URCA 4PP7A 4E7WA 3SRVB 3KL8A 1M2PA 2XK9A 2Z7QA 4CT2A 3GQLA 2BUJA 1WCCA 5AUTA 3FZOA 4A7CA 4BWXA 2YN8A 3O8TA 3G9NA 3H0ZA 1KSWA 3FUPA 3TZ7A 2VX3A 3HDNA 4PTGA 3NSZA 1IG1A 4B6LA 3LKMA 4J99A 1CTPE 3I5NA 4JBPA 4D1ZA 4FIIA 4KBKA 1GNGA 5KMLA 5BX0A 4J8NA 2Y4IB 5L2QA 3RZFA 1SVGA 3IW7A 2P3GX 5A3XA 4MK0A 4O0XA 1W8CA 4AXDA 4ZSJA 4H3BA 3C0IA 4E4MA 2R64A 4FYNA 5AJQA 2ERZE 3ZFYA 5M56A 3V6RA 4BJJB 2QO9A 4X3FB 2JD5A 4RX8A 3G15A 2HY81 4NKSA 4F99A 2C5NA 4NFNA 1P4FA 2A0CX 2OH4A 4FKUA 4PRJA 3I6WA 1ZZLA 3H10A 2JAVA 2WU7A 4DLIA 4AXFA 3GC0A 2YM8A 5IZFA 2J0KA 2ITQA 5HD7A 3W32A 1W98A 1PXOA 2I0VA 5AADA 4EBVA 1WBPA 3DJ5A 3RPSA 3LZBA 4RQVA 1AQ1A 4MBJA 3S3IA 4KKEA 5CU6A 2FO0A 4JQ8A 3HA8A 2I7QA 2XS0A 5F4NA 2CKEA 4RJ5A 5HVJA 3TZMA 4C7TA 3UVRA 4LDTA 3L8XA 5BVEA 3ZCLA 4AOIA 4JMQA 4KBAA 2HENA 4QP8A 5K0XA 4FKWA 4NEUA 5DG5A 2BR1A 5AUVA 3RAHA 2XANA 4HW7A 3EH9A 2RSVA 3EZVA 3AXWA 3ITZA 2P0CA 3OUKA 2J9MA 3ZO3A 4OLIA 4DGLC 5HZNA 2IZRA 4U42A 1KE5A 2ZV7A 2O3PA 3CPBA 3MDYA 4BYIA 2E2BA 3C4WA 5FGKA 4BI0A 3R1QA 1XJDA 3FZSA 4GL9A 5DEWA 5KHXA 1BKXA 3ZSIA 4A4OA 2Y4PA 3R04A 3PXKA 4FL2A 2VTAA 3AMAA 4YZDA 5CALA 5TF9A 4OBPA 4TYHB 4CFFA 3NW7A 4PQNA 3UYSA 2RGPA 4OGRA 4WRSA 4LUDA 5IF1A 3ZU7A 5KX8A 1PRYA 4AW2A 2B53A 5A4CA 2WELA 4ANOA 4YUQA 5M4UA 4M7IA 1VEBA 1F5QA 2XVDA 3A4PA 3ZLYA 4H1JA 3IK3A 4PPAA 3EYGA 3TKUA 4UY9A 1Q3DA 2PYWA 3D83A 5HQ0A 2XIKA 1FGIA 3Q96A 1P5EA 1YXTA 2J51A 4RIWB 2GCDA 4YR8A 3GCQA 1FINA 2YLFA 2R3OA 1CDKA 4Z3VA 2I0YA 2YM7A 3RNIA 3SD0A 4Z16A 3UOLA 3S0OA 5CF6A 4EOIA 3AMBA 2RG6A 4IJPA 4O2ZA 2ITUA 4RG0A 1BYGA 2YABA 4YTCA 2W4KA 3O51A 3VO3A 2O8YA 3HP5A 4AAAA 4BGGA 2WO6A 2X7OA 4EBWA 5M09A 1YWVA 3KXXA 4I4EA 4RVMA 4U43A 2BRGA 3QRKA 1PHKA 3C0HA 1UV5A 4AGWA 4YU2A 4O96A 3UQCA 4AG8A 4GW8A 3M11A 4K6ZA 2HELA 5FXRA 3LXLA 3PZEA 4ACMA 3LFNA 4FSZA 1KV2A 4NIFB 4K18A 4CXAA 2ERKA 3ZM9A 4BWPA 2YHVA 3HECA 4NUSA 1ATPE 5B2KA 4EEVA 4NL0A 2QKWB 3OBGA 4CV9A 3AGMA 1BUHA 3U9CA 1GIJA 3ORNA 2W5AA 5DHJA 5ANDA 2XRWA 3F3UA 3NR9A 4CCBA 1U46A 1BX6A 3QTUA 5DPVA 3UGCA 3QQHA 3ZLSA 5BPYA 4X2FA 3V5QA 1G8KA 3F9NA 3R9OA 5IQDA 3CC6A 1PMEA 1WZYA 3HEGA 3RNYA 2ETRA 4LMNA 4IFGA 3A62A 3K3JA 2VX0A 1YKRA 2WU6A 3Q32A 4IBMA 2W96B 5AM7A 3SW4A 2C6OA 2V62A 3EKKA 5EDPA 1QL6A 2H9VA 3ML1A 5M51A 5HU9A 5IMXA 1OL6A 3DS6A 2Z8CA 3GUBA 1XR1A 2CGUA 3W16A 4GG5A 3K3IA 4FSTA 4QMUA 5DRBA 1XH8A 5G1XA 4L3PA 4QP4A 4TN6A 3RK9A 3OCTA 5E9EA 2ZM1A 5GJGA 4C37A 5C1QB 3AD5A 2OIQA 2XNNA 2W9ZB 3LXKA 3NDMA 4EH4A 5KCVA 3FMMA 1SM2A 2E9NA 3MVHA 3QTIA 4O0RA 3ZOSA 2GMXA 4UZDA 5DBXA 2A98A 4E8AA 3PP0A 4KIQA 4G34A 3TKIA 2W99B 2WQNA 3PXQA 3UYTA 4BWKA 4X0MA 3LMGA 1LEWA 1OIYA 3OT8A 4IVDA 2BALA 3DV3A 4UV0A 3TYKA 3KRRA 5ANIA 4OTPA 2BKKA 3C13A 3EOCA 3WOWA 1NY3A 2UZVA 4C34A 4EK5A 3CIKA 2E9VA 4I94A 2W1ZA 3IQ7A 3MH3A 2W1GA 2H6DA 4N0SA 1H0WA 2HZ0A 2WXVA 5HX8A 5BYZA 4C2VA 5LOHA 2R0UA 3ENMA 3G33A 4PL5A 5IPJA 4FK3A 5AM6A 5FQDC 4ZZNA 5FBOA 3DBCA 5FDPA 3PFYA 2X8EA 2YIYA 3RCJA 2WOUA 3DK7A 1TQMA 4FKPA 4W4VA 3W0PA 4EOSA 4X2NA 4BTJA 5J9YA 1GZKA 3PJ2A 5E1EA 4D9TA 4C58A 5IH5A 4FKQA 3DNDA 4XV9A 4KS7A 4WNMA 1IASA 4U81A 3GC8A 4RWLA 4IIRA 2GFSA 3RZBA 4C57A 4RSSA 3U87A 3AT3A 3UO5A 4QQJA 2Z2WA 3VW8A 5JEBA 3TDVA 3MFUA 5AFVA 3AC5A 2G15A 3Q9YA 5AX9A 5C03A 5CU3A 3MH1A 1U5RA 4CFWA 4BGHA 5A4QA 4Y73A 2C0TA 2QD9A 4H3PA 2PE2A 4IC7A 2Q0BA 4U8ZA 2BAJA 2NRUA 3OXIA 1OBDA 2GQSA 3OWPA 3P7BA 3RALA 2BIKB 2XMYA 4FEWA 3KMMA 2J5EA 1HCLA 3ORLA 5CAPA 3KN5A 4A9RA 1WVWA 2P2IA 1BI7A 4FC0A 1JNKA 3R7EA 3QLGA 2X1NA 4PMTA 4CYJA 4JR7A 4TKSA 4I93A 1MQBA 4W8EA 4ANSA 2W1FA 3BWFA 5JGBA 2BDWA 5DR2A 4NK9A 5D7VA 2IPXA 3FMLA 3GCUA 2ITZA 2OKRA 4KB8A 4RJ8A 4TWCA 5GHVA 4FTNA 4DEDA 2XAOA 4FTIA 3NVMB 3UC4A 3SA0A 4O2PA 4DEBA 3HGKA 4A9TA 3EQDA 5L8KA 2E9UA 3PG1A 5EQYA 4NYEA 3FSFA 4CKIA 1L8TA 3QUPA 3THBA 4EH2A 2VNYA 1L3RE 1VJYA 3FQSA 1M17A 3O71A 4WKQA 5CU4A 5J8IA 4AW0A 4GKHA 4RJ7A 4UWYA 2EWAA 5HVKA 3FEGA 1YWRA 1B6CB 1FVRA 2YIQA 5KBRA 3GOPA 3FKNA 1S9JA 2QR7A 3R1YA 4DLJA 5CU0A 4PDPA 5B7VA 5JH6A 2NPQA 2AEGA 5HE3A 4D0WA 3TTJA 2B9HA 5C27A 2W1EA 4O4BB 4IAKA 2CNQA 3VS7A 2DWBA 2OK1A 2VNWA 4YTFA 2J0MB 5JGAA 4GV1A 4L42A 2GS2A 5IQHA 4ALUA 3D9VA 2Y4IC 3R28A 3PXYA 5HCXA 5JSMA 5J7HA 3PVGA 3FI3A 2XB7A 3BYMA 4FK6A 3BLAA 3DOGA 1KOBA 4L01A 4MXOA 3ZRKA 3VC4A 1DAYA 2WTVA 3DFAA 3BV2A 5AR2A 3CGFA 5J5SA 5LCJA 3CJFA 4X3FC 4PL4A 5EW3A 3R8VA 2HAKA 4WO5A 4P5ZA 4IE9A 4DG0E 4UMUA 2Y8OA 3QXPA 4JRNA 4PDYA 5CXHA 4W9XA 4LGHA 4XG9A 3BU5A 4C3PA 4S32A 2FYSA 5E8WA 5E90A 5GZ9A 5DR6A 1YHWA 4NM0A 3WARA 3Q3BA 2HWPA 3COKA 3FZ1A 4UWBA 5FEDA 5LWNA 3UE4A 4BDJA 1RQQA 1UVRA 3NUYA 1EH4A 3LCSA 5HIBA 4AN2A 4E1ZA 3RINA 3PDTA 2PPQA 2XEZA 4XCUA 1Q41A 3VBWA 4K77A 1U59A 3GU5A 4K8AA 5JZNA 4NM3A 2HWOA 4EWHA 1H1PA 3NYVA 4YLJA 2GHGA 1Y8GA 5A46A 2YEXA 2YISA 1IA8A 4I6QA 4MH7A 4DCAA 2VU3A 2WZJA 3A60A 1YI3A 3CY2A 3PVBA 4JBVA 2VTLA 5AV0A 3QZHA 1M2QA 2GDOA 2A4LA 5IISA 3TDWA 4RFYA 2R7BA 3TXOA 5HORA 2VN9A 4BY9E 4CQGA 5LQFA 4EZ3A 5IDPA 4I6LA 2B7AA 5E8ZA 2I0HA 2BZKB 1H28A 4AZWA 5HE1A 4RC4A 3GP0A 3E87A 4D4SA 4ID7A 4G6LA 4HGLA 3OY1A 3WE8A 1ZRZA