3NW7A

Crystal structure of insulin-like growth factor 1 receptor (igf-1r-wt) complex with a carbon-linked proline isostere inhibitor (34)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
297
Chain Sequence
YVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
total genus 96
structure length 297
sequence length 300
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nw7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nw7A01
4G3DA 4MTAA 4AXAA 4YTCA 3DU8A 5CAUA 1OB3A 2BHEA 3BU5A 4RIXB 2H6DA 4BCMA 4ZTLA 4AZTA 3PWDA 4PMSA 4YJSA 3K3JA 5DYJA 3OWJA 5CANA 2PVRA 4KIOA 4ZTMA 2GNHA 3RBWA 3DJ6A 4HYUA 3ORTA 3NNXA 1MP8A 4EH5A 2QO2A 1F0QA 4Y8DA 5ANEA 4FSTA 3VBTA 2V5QA 4M12A 4EORA 1F3MC 4QP2A 1OUYA 3HDMA 3KULB 4MK0A 4Z7HA 4ZJVA 4C0TA 4DGNA 3ENMA 2JIUA 4C4IA 1U5RA 5JZJA 4O7RA 3W2QA 2ITZA 2R5TA 4K0YA 4GRBA 3V51A 3ZOSA 1AD5A 5C8KA 2BALA 4BCIA 2VRXA 4NFMA 3ZRLA 3TUBA 1LEWA 4H05A 4I3ZA 3E64A 3JYAA 3CY3A 3EQBA 3QTXA 4I0SA 2G1TA 3D7ZA 5AUZA 2PMOX 4G2FA 3TEIA 5GZ8A 2YCFA 5H2UA 3LCOA 2PMLX 5M57A 2I1MA 1H1WA 3LFQA 2F2CB 3BGQA 5L4QA 3DV3A 4HGLA 4CSVA 3BEGA 4IVCA 3FZSA 3EN5A 3R1SA 4QYHA 4YC3A 2YA9A 5IEXA 5EQPA 4IFCA 3TNQB 1JNKA 3PIXA 3O8UA 2R9SA 3ANQA 3P9JA 4OBPA 2H8HA 4FGRA 3FKNA 3QQUA 3FUPA 4ZS4A 5EDQA 3W10A 1SVHA 4A4XA 5D9HA 3ZO3A 4OTHA 3R7YA 5I3RA 1CSNA 3EQCA 3TUDA 4MXOA 4E6QA 3PPKA 1DI8A 5D41A 3ZSIA 1VYWA 3UVRA 2Y6MA 2QI8A 4QYYA 3VHEA 3I7BA 4GK4A 3WIGA 5C26A 4HGSA 3V5LA 2X7GA 3EN7A 5HKMA 4JDKA 3C51A 3E7OA 3KMUA 4CLJA 3HA6A 2KTYA 3QCXA 4JAIA 3I5NA 2V7OA 5A4CA 5K3YA 3WI6A 4L7SA 2F2UA 3PXRA 4O84A 4YHFA 5L6PA 5HNIX 3OW3A 2C5OA 3NCZA 4BI1A 3DNEA 3UNKA 2ZV7A 4BDIA 5HG8A 3GBZA 3VS3A 3PJ2A 3F69A 2YDIA 4LL5A 5A3XA 5M55A 4HPTE 4E20A 5HLNA 1H1QA 2I0HA 2J7TA 2J9MA 1R78A 2QVSE 3DB8A 3DAKA 3FPMA 3R7OA 4UN0C 3SLSA 2FYSA 3LPBA 4GKHA 4MWHA 4JQ7A 4FKRA 5ANOA 3O8PA 3ZDUA 1PMVA 2Y4PA 4GFOA 4IZAA 5JRQA 3BCEA 3SXSA 2AYPA 4TYEA 1STCE 4IB1A 2PULA 4RX5A 3KMMA 5CU4A 1WBPA 2CKEA 4NKAA 3R8ZA 4XV9A 2HZ4A 1NVRA 5DGZA 5G1XA 5AUVA 4C8BA 2Z8CA 3HV4A 4PWNA 3VRZA 4FT3A 2G01A 3H9OA 1J91A 2XNBA 4ZEGA 4F1TA 4GK2A 1ZXEA 5I4NA 2WHBA 1M17A 3OCTA 4GU9A 3VJNA 3FI8A 2OWBA 2ZJWA 1SM2A 3GFEA 4J1RA 5M51A 3HA8A 4K11A 5F1ZA 3KXMA 3TUCA 3FE3A 5EYKA 3QTUA 3P08A 1PMEA 4USDA 4FTKA 4D0XA 3UOJA 3CPCA 2XMYA 4F65A 4GH2A 4WBBB 2R7IA 4UZHA 4DT8A 3P86A 1G8AA 4NT4A 2HELA 2HXQA 3DAJA 4Q9ZA 2W1HA 1XBBA 3FJQE 2UW0A 1E1VA 3BV2A 1OL7A 3BU3A 3KCFA 4YJRA 3V5QA 3JPVA 3Q9ZA 2OKRA 3C5IA 3R1NA 5A4LA 3FYKX 4F9BA 4OLIA 5EHYA 3R28A 4O81A 4PP9A 4HGTA 3I81A 4CMOA 2FH9A 4FZ6A 3BI6A 5EOBA 2C3LA 3NAYA 5CNOA 3DQXA 3QYZA 2ZDTA 4XV3A 1UWHA 2PVHA 2A19B 3ATTA 3UYTA 2X6EA 3CR0A 2BUJA 3TIYA 4HNFA 3TL8A 2WPAA 3WBLA 2J50A 2YIRA 4TKSA 3BBWA 2QLQA 5AR3A 3KREA 2VTOA 2XVDA 4XG4A 4CYJA 2F49A 4QMSA 4D58A 4R5YA 1EH4A 3NDMA 3GEQA 5L2WA 3OY1A 2ITUA 2UZDA 5IMEA 3A7HA 3G2FA 4FKIA 3BYUA 2YJSA 4QP6A 5CU0A 2YM6A 3R7IA 3W2OA 1APME 4MD8E 2P33A 3MH2A 4FBXA 4D55A 3QXOA 2ITVA 1ZY5A 5C27A 3HRFA 4RJ8A 1HCLA 3LJ0A 3BHYA 1UVRA 4A9RA 3EN9A 4D0WA 3DBEA 2R3PA 4F0FA 3EN4A 3ZDIA 4GG5A 3KL8A 3DFCB 2ZV9A 3UTOA 2I7QA 2X2MA 5FEEA 2ITNA 4KS8A 4IACA 4Q5HA 3UODA 2R3NA 3BQRA 3ZBFA 2P4IA 4AZEA 4HW7A 4DEEA 4Z16A 4RWIA 1TQPA 4GEOA 5HTBA 5K0KA 5C8MA 5LVNA 1YDTE 4BCNA 5AV0A 4R7HA 4CTBA 4K9YA 3HRCA 4BDJA 4ERWA 3MTLA 4AW2A 3POZA 4AAAA 3MH3A 2NRUA 2X7FA 3ULIA 1Q61A 1T46A 2VO7A 3HP2A 5CX9A 4EH7A 4KIKB 4DFLA 1FOTA 3WF8A 4CGAA 3EQDA 2R2PA 2UZBA 1YXVA 5LMAA 4EK6A 4QMUA 2QOIA 4C34A 4Y46A 3LKMA 4LOPA 3PRIA 4IX4A 4YZDA 5AADA 5J9LA 1AGWA 2W4KA 3E8CA 3MDYA 1FPUA 2XZSA 3ETAA 1WAKA 4DITA 3SVVA 4RVTA 5IA0A 3BELA 3GOPA 3NUNA 5JRSA 4BCJA 5K4IA 2VTPA 3UGCA 2GTNA 5CEOA 4QP7A 1OM1A 2C3KA 2VV9A 4QTAA 1KOAA 5EM7A 1GY3A 5I9UA 4AF3A 2C1BA 3OS3A 3BQCA 2WFYA 4H58A 4MH7A 1Q62A 3KXHA 4FTQA 2P55A 3A8WA 4FL2A 3F3WA 5HIEA 5D11A 4UMTA 1UV5A 3AOXA 4NH1A 4E6AA 3NUPA 4R77A 4XRLA 4BCOA 5GHVA 2ZV2A 3LLAA 2PUUA 3OXIA 3GXLA 4ALWA 3AMAA 2GQGA 3D9VA 4MXYA 5KE0A 5CF6A 3GU6A 4L01A 4NJDA 3WYXA 1WBNA 4AW5A 2WEIA 3DZQA 3DKOA 3LCKA 5EQYA 5HZNA 4RIXA 3Q4ZA 3QTRA 4GU6A 5E8WA 2PPQA 1LP4A 3PVUA 4ZXTA 3T3VA 4D2SA 3L9MA 5DT3A 2XUUA 4DAWA 4DHFA 5IQAA 4DA5A 3OW4A 4ASDA 5A9UA 5AV3A 3WZDA 4EH8A 3DFAA 5M53A 3NWWA 4D5KA 4E4NA 2EU9A 4YHTA 5A4QA 4DFUA 1YWRA 3MPTA 4FIIA 3HX4A 5CNNA 1JSTA 3KRLA 3QZHA 4FVQA 3ZFXA 4RGJA 4XV1A 1VR2A 1IAHA 2WOUA 2PWLA 4GFGA 4KBKA 4ZS0A 3DK6A 3VF9A 1MQBA 3HMPA 4RX7A 4JL9A 5E8YA 4UALA 4H3QA 1ZMVA 5FD2A 3C4ZA 3Q6WA 4J8NA 3ORNA 4I1ZA 5CAQA 4FKOA 4FVPA 3QKLA 5FEQA 1AQ1A 3L9PA 3ZFMA 4Y72A 4HYHA 1ZZLA 3OBGA 3RZFA 2C6DA 4EJNA 4EZ5A 3MB6A 3BLHA 5DWRA 3KEXA 3MIYA 4F63A 3II5A 2XNPA 3Q4UA 4M69A 3N4TA 2YM4A 5CXHA 1NT2A 1JSUA 1H8FA 1H4LA 3CY2A 3ORXA 3FC1X 1ZYJA 4XG2A 4YTHA 1NVQA 3IKAA 3WYYA 2VX1A 3EQGA 4GT4A 2PTKA 2HK5A 4YZBA 3PSCA 5CU3A 3KXNA 4XP3A 5CENA 4NM3A 2J0KA 2OXDA 4ZY4A 5HICA 2VWVA 2IW6A 1ZZ2A 4FV9A 2QOBA 4ZIMA 3E62A 3ORLA 4MD7E 3WF9A 2VWXA 2OLCA 4FL1A 5HE1A 2PVMA 2SRCA 2XEYA 3KA0A 5BVNA 4RVMA 3RNIA 2WTIA 1YQJA 3D83A 3TZ9A 3ZTXA 4MF1A 4AU8A 2DWBA 4FT5A 1QPEA 3DAEA 5FP6A 3DZOA 4G1WA 3R1YA 3VQHA 2QHNA 1Y8GA 2OJFE 4XP2A 2J0JA 4QNYA 4RFYA 4UX9A 5CY3A 4XNEA 3A99A 3WOWA 3QFVA 3SC1A 2YDKA 1GNGA 1NXKA 3G15A 3FLQA 1W84A 3D4QA 5ETCA 5I9WA 5AJQA 3M11A 4DLIA 4X6QC 2I0VA 5LARA 5EW3A 3ZH8A 4BDBA 2IZSA 5FM3A 2R3KA 4OTGA 1IA9A 3D0EA 2RG6A 4WD5A 3MFTA 2GU8A 3IDPA 5HG7A 4DG0E 5C03A 4CFWA 4L6QA 4NCTC 3PDTA 2RG5A 4EC8A 3PY0A 2NP8A 3N9XA 4H3PA 2B55A 2CNVA 3A2CA 4RBLA 4XOZA 5HOAA 5HE0A 3KQ7A 4YO6A 1TKIA 1PRYA 3KC3A 1H08A 2WIPA 3LFDA 4KS7A 3SGCA 2UW8A 5AUUA 3EIDA 3RTPA 2X8EA 2XIZA 3UZPA 2JIVA 3ZZEA 4B4LA 4EBVA 3BBTB 1JKLA 3TZ7A 4FUYA 4PNIA 4XBRA 1OBGA 2Z60A 2BDJA 4A9YA 1R3CA 1ZMWA 5HTIA 5M4FA 4G16A 2F9GA 5EI8A 5HHWA 2OG8A 4FV8A 1Y6AA 4JT3A 2IW9A 5FP5A 4E5WA 4I4EA 3BHHA 5LCKA 2CCHA 2XS0A 2YIYA 4GIHA 2QNJA 3FSFA 2ZVAA 4L67A 2HCKA 3V8TA 2GHGA 2C4GA 5JK3A 4I93A 3P7CA 1SYKA 1WCCA 3Q6UA 3SV0A 5IA3A 4RIOA 4M66A 3MFUA 4IAAA 4YP8A 4EH9A 2IVUA 3ELJA 4QYGA 4BBMA 3TDVA 3CPBA 3N4VA 4WSQA 2UZWE 5E9EA 5AV2A 4KD1A 3PJ8A 5CWZA 3AMBA 1M2PA 3LLTA 5M4UA 1YDSE 2OK1A 4M13A 4L45A 4EOIA 2DYLA 2H96A 3MPMA 3MVHA 3UO6A 3UMXA 3HDNA 3RHXA 4G5PA 3ERKA 3NW6A 3ZRKA 3DLZA 3GNIB 1QL6A 1SNXA 4PNKA 2ITOA 4QMXA 4LGDA 1I44A 5FBOA 4C7TA 4RLKA 3R7VA 5AP0A 5EM6A 4NYEA 3KXGA 4YC8A 1U46A 3QTIA 4QPMA 1Y91A 3LM5A 4UMPA 3LIJA 2I0EA 5EFQA 4G6OA 4L8MA 4C02A 2H9VA 2GNFA 4GIIA 3HUCA 3I0QA 4NTTA 4CQGA 4OR5A 3T8OA 4OAVB 4I41A 2BFXA 4AGUA 4BVUA 3ZUTA 1YWVA 4FKTA 3TNWA 5IUGA 2F7XE 5H8BA 2VWUA 3VUIA 2W06A 3ORPA 4D4YA 2BZHB 2ETKA 2VTSA 4YJOA 5AP2A 4BBFA 3QU0A 4ZJIA 4JBVA 2UZTA 3AD6A 4EOPA 1WBWA 3UDBA 1Q8YA 2VWYA 3C5UA 5IA5A 3R01A 3CD8A 3G0FA 1XKKA 3BLQA 4HCVA 1NVSA 2XIXA 4TPTA 3MESA 4MBJA 5AAGA 3P23A 4P90A 4DH7A 3E3BX 5IQFA 4FGBA 5EYDA 3V5JA 1XJDA 2GFCA 4CV8A 5AR4A 5D1JA 4ZZMA 1LPUA 3PIYA 5AP3A 4CT1A 2VX0A 4AFEA 2PMIA 2OZOA 4RC4A 3GQLA 4B6LA 4TT7A 4LOOA 4PDPA 4YZMA 3AMYA 3FLSA 3IQ7A 4FTCA 3FZTA 2IWIA 3PP1A 4RRVA 1H1RA 2C69A 2V7AA 5CAVA 1PXKA 3HAMA 2OZAA 3JVSA 3Q96A 4FF8A 4WNKA 4X2GA 3V5TA 4P5QA 4K33A 4L3PA 3PRFA 4G9RA 5K5NA 4IEBA 3IW4A 3EJ1A 3UIXA 3DBFA 4GT3A 3LQ8A 3L8XA 3WF7A 2GTMA 4N57A 4HGEA 2OF4A 4BDCA 3WIKA 4X6RA 4LUDA 5J95A 3IDCA 2QG5A 2XYUA 2GQRA 2VWBA 4XUFA 4G17A 4B7TA 3OEFX 2QOQA 4JRNA 4M84A 4UB7A 3FBVA 4UMRA 3NX8A 2WXVA 4FV0A 4BDHA 2YAKA 4G3GA 4CCBA 1V0OA 1M7QA 3MFSA 4GJ3A 3U6JA 4YR8A 3GU5A 4IFGA 4UV0A 1E1XA 4JDHA 5JFVA 3EZRA 3GCQA 4BIDA 2ZMCA 4S30A 2B9HA 1UWJA 3P79A 4RJ5A 4EHEA 3EQRA 3PA3A 5GIOE 3RP9A 3F5PA 4EWHA 5LWNA 4O38A 5AR5A 3OFMA 4JBPA 5HCYA 4ZAUA 5DR2A 2XIRA 3IGGA 5GJGA 3SQQA 2PUIA 3A61A 5HVYA 5BVEA 1CKPA 4MNEA 2OXXA 4U42A 2YM5A 3S3IA 3SRVA 1REJA 4V01A 3UJGA 2WQMA 4BCGA 4CQEA 4QYEA 4F9YA 4ANLA 3B2TA 1U4DA 5IQHA 5HX8A 1J7UA 4D4RA 4YU2A 2PL0A 4V0GB 2YWVA 4RIYA 5ACKA 3PE2A 2BZIB 3ZEWA 2B9JA 2DQ7X 4UXQA 5AR2A 5AUYA 4EZ3A 3W16A 5CF4A 4YTIA 4YLJA 1PKGA 2O64A 2F7EE 3COHA 4G6NA 5CSPA 1G8SA 3EOCA 4AP7A 2PVJA 2QR7A 4UMUA 4EJ7A 5LVOA 3Q3BA 1F5QA 2EXCX 2NRYA 2XRUA 4XV2A 5FBNC 4ACHA 3DXNA 3CE3A 3EB0A 4J71A 4EUTA 5A54A 1XH4A 2JAVA 2PZIA 1A48A 4K1BA 2RFEA 5L2TA 2PUNA 3EMGA 5AP7A 4U6RA 2PE2A 2RFSA 3RGFA 4NM5A 3BZ3A 4PMMA 4RX9A 4JAJA 3F2AA 2VU3A 2BPMA 4KBCA 4QTEA 5B2LA 2C1AA 3OD6X 5FDPA 2X2LA 4ALVA 5AAEA 3MSSA 4IHPA 4YHJA 4L52A 3ZM4A 3ZLXA 4CTCA 5GZAA 3RVGA 4ZLZA 4KNBA 4C2WA 1RDQE 5HNGA 2YZAA 3BHUA 3O0GA 3R9DA 2BKKA 2CNQA 5E7RA 2J51A 4L00A 3G33A 3RK5A 3EZVA 3O96A 4UBAA 3EFWA 3DPKA 3G6GA 2JD5A 3GGFA 4E5BA 2C6IA 4ERKA 4GCJA 4YURA 1JPAA 4FMQA 4CCUA 4EC9A 5HLWA 4J99A 3BIZA 3TT0A 2PY3A 4XH6A 3SD0A 1YXTA 1NA7A 1K9AA 5FXQA 3R22A 2OO8X 4F7LA 3BPRA 4I5MA 5HU9A 3ZHPC 4ZY6A 2G2IA 1BL7A 4YNOA 4ZSGA 5BYZA 3QRIA 5CZHA 3E88A 3MBLA 4FZDB 4L68A 4D1SA 5HO7A 2PZ5A 4J8MA 4DH5A 2OW3A 5BUJA 2YIXA 2W1EA 5E90A 4XYFA 5FTQA 2VTMA 2XKCA 4CG8A 2JITA 4PUZA 3RMFA 5CU6A 4ANQA 2PYWA 3GC7A 3ZLSA 2GMXA 2R0UA 1LEZA 3U4WA 5F94A 3IOKA 1ERKA 2C6KA 4EWQA 5FXSA 2WMTA 2CN5A 3EHAA 4KA3A 2RL5A 2CKOA 3NSZA 3VS0A 5BVDA 3FLYA 2J6MA 1WVWA 2UW6A 2XNOA 5K4JA 4PY1A 3H30A 1T45A 3CKXA 4FV2A 4HZRA 3TV4A 1Y57A 4W4WA 1JBPE 3BYOA 2IZTA 2CJMA 3CCNA 3JY9A 4FSMA 3QQHA 1ZYDA 1OI9A 4H39A 5HQ0A 4L9IA 4MF0A 4CZYB 4S33A 5M56A 4C3FA 1BL6A 5B0XA 3CSVA 2XJ1A 4QP4A 4D2TA 4IWPA 3IW5A 4IX6A 2IZRA 3FAAA 3FWQA 3KVWA 3OCSA 4GT5A 5DR6A 5EHLA 2IW8A 3WE8A 4DINA 4EZ7A 5J7BA 5EM5A 2JKMA 3AC8A 3ZXTA 5FDXA 4FICA 2X7OA 5FXRA 2YABA 4X2JA 4HVDA 3EKKA 4M68A 4M14A 3VW8A 3VUMA 3C4FA 1V0PA 5AV4A 2J0LA 4R7BA 4AZSA 4QTDA 3TXOA 4Z55A 5IUIA 1OMWA 2QO7A 3VC4A 3R04A 4O0RA 2PZYA 3LJ1A 4UWBA 5M44A 3QQJA 4C37A 3AC4A 2AC5A 3VJOA 3I79A 3WE4A 2ITYA 2W9FB 4IM0A 2YM7A 3QC9A 4QMVA 1U54B 5CEMA 4ZSLA 2UW3A 1YOJA 4MXAA 1GIHA 3AD5A 3FMNA 4IB0A 4QPAA 5JGBA 3QHRA 4FI1A 4FZFB 4GYGA 4BTKA 3NAXA 3UOKA 3O51A 2VWZA 2OH4A 5HO6A 1J3HA 4F4PA 2IVSA 4JR7A 5EM8A 3EKNA 2BFYA 3QTSA 4KKGA 4HJOA 3A7IA 2Y4IC 4EHZA 3BGZA 3ZXZA 5JFWA 3UMWA 5JFXA 3DXPA 4KKHA 4WBOA 4WOVA 5J1WA 4WO5A 3FQEA 4GG7A 5L8LA 1ZYSA 3P1AA 2WKMA 2A27A 1UU8A 5C9CA 3BHVA 3K5VA 3NIZA 5CSWA 3F66A 3TACA 3VF8A 2IG7A 4UYAA 3D7TB 2YIWA 3ORIA 3RINA 3FXWA 3RPVA 1O6YA 3Q52A 5TR6A 1VYZA 2R64A 3OXTA 2WMUA 1ZARA 3HECA 1J7LA 4BDEA 4USEA 1OUKA 4TWPA 3U9NA 2GFSA 4AE6A 5HO8A 5IEVA 1Q24A 5AR7A 5DI1A 4F0GA 4M0ZA 4CEGA 3RI1A 5LVPA 5CVFA 2FB8A 2XJ0A 2YERA 4AQCA 3SW7A 4FTNA 5J9ZA 1WFCA 2QQ7A 4IH8A 4U0IA 5M09A 3OTVA 5E4HA 3OWKA 4YC6A 4O27B 5BNJA 2BTRA 4TWCA 2BROA 2PU8A 1XR1A 3QGYA 3C13A 4WHZA 3CBLA 3QRTA 5AM6A 1KWPA 2AUHA 2RFNA 5TKDA 3UO4A 3VN9A 3QCQA 1SVEA 3HV7A 5DA3A 2UZOA 2XA4A 4IWQA 5TT7A 4CLIA 5B7VA 1W82A 3BE9A 3HMMA 2W1FA 3KCKA 4AN2A 4BTJA 5BMSA 1M52A 3QQFA 4O91A 3RWQA 5JN2A 5C01A 2XM9A 3RWPA 3MYGA 3QA0A 3HEGA 1WBOA 4ITIA 3ZRMA 1MRVA 2GCDA 2GHMA 4N6YA 5CAOA 1RE8A 4L43A 3F9NA 1UKIA 3E8EA 4Q5EA 2B52A 2HZ0A 5KKRC 2BIYA 4DEGA 4PP7A 3R7GA 4AX8A 3R73A 3PPJA 5KNJA 4U80A 5H8EA 4YZNA 3G0EA 4CFVA 2C6LA 3SDJA 2YIQA 4DFXE 3U55A 1OECA 2J90A 4ZOGA 1TQIA 5BVWA 5ITAA 2OGVA 5I9ZA 3GU8A 4BRXA 1YHVA 2BILB 1YOLA 3OF0A 3HMIA 2R3JA 2ZAZA 3R9OA 4KUJA 3L8PA 4KRDA 4DGLC 5KMJA 1WBVA 4FUXA 2VAGA 1ZOGA 3F3UA 4FV3A 4FYOA 4TZRA 3QZGA 2ZM1A 2P3GX 4U41A 2I0YA 5BVKA 3TDWA 2IJMA 4RA5A 2WTKC 2WTKB 3C4CA 4IADA 1IR3A 4PMTA 4CVAA 4DTAA 3ZO4A 4HCUA 1FVTA 4FR4A 5C8NA 2JKKA 2Z7RA 5CSVA 4FEWA 5M08A 4BYIA 5K5XA 3VS1A 4NW6A 3MJ1A 3I5ZA 4DH8A 1JKKA 5JEBA 4W4YA 2EWAA 1GZ8A 3C9WA 3FI2A 5DVRA 3O23A 5E92A 5C4KA 3GB2A 2Q0NA 3PY1A 4EOMA 3VS4A 3FDNA 5E8TA 5CVHA 3S4QA 1FQ1B 3QTWA 1L3RE 5EK7A 5CEIA 3HKOA 4N4SA 3VHKA 3O7LB 2GSFA 5AP1A 3RZBA 4Z7GA 3ID6C 4FTJA 4V05A 4ALUA 4UZDA 4XOYA 2W1DA 3H0ZA 1KE5A 3HGKA 5E8VA 4L53A 2Y9QA 3OROA 4FTLA 4H1MA 3RJCA 2VTNA 3OY3A 5J87A 4TW9A 3Q5ZA 3ZC5A 3DBQA 1UNLA 4D2RA 5FTGA 2BAJA 2IN6A 3Q5IA 4AUAA 1VZOA 3C0HA 4JX3A 5HLPA 4CNHA 1XWSA 4NKSA 5EYMA 2H34A 1PMUA 3A62A 2EXMA 4IDTA 3ZONA 4CZUA 4FIGA 5D10A 4BI0A 3S0OA 4R6VA 4FOCA 3D5UA 4DG2E 4EUUA 3S00A 5LVLA 3OWLA 4AN9A 5IMXA 5AM7A 2QU5A 3GT8A 4AA0A 5HCXA 4AW0A 2B9FA 5BVOA 4OTRA 4OBOA 3V5PA 4M7IA 1JSVA 1ZOEA 3KRXA 5J8IA 2OH0E 4BF2A 5JH6A 3CGFA 3ZEPA 3CQWA 3DJ7A 3R63A 2W5BA 3A7FA 4L46A 3DKCA 4I21A 5EYCA 2XEZA 4C61A 3PA4A 3QUPA 1P2AA 1R39A 2Z7SA 3TI1A 3V04A 2XK7A 3ZU7A 4BDAA 2NO3A 2VO6A 4O2ZA 3ENHA 3D5WA 4EONA 4FYNA 2B4SB 1OPJA 2GNJA 3C0IA 3PXYA 3QL8A 4PDOA 4QP8A 3FMEA 4QP1A 2OXYA 4B0GA 4OGRA 4ZLYA 1ZOHA 4O86A 2OU7A 1LR4A 4IM3A 4FV4A 5ANJA 3QX4A 3SG9A 4RJ6A 3GVUA 1JVPP 2GQSA 5GJDA 1ZLTA 1WZYA 5LMBA 3K3IA 4IX5A 4QMLA 4NM7A 4UWCA 3R8UA 5IH4A 3W2RA 3KRWA 4BR3A 4F9WA 1Q8TA 3MVJA 1W98A 3RAKA 2O65A 3IPHA 4O22A 5BYYA 2XKEA 3AQVA 3TIZA 5H3QA 2YCQA 1XO2B 2Z02A 3DLSA 4RG0A 3ROCA 3TKIA 4UY9A 4K6ZA 3C1XA 4RC3A 5AIKA 3NVKI 3PSDA 1MQ4A 4LG4A 3OOGA 3MGYA 3BV3A 4BL1A 4U8ZA 3SX9A 2YLFA 1Z5MA 3ZCLA 3T9TA 5A6OA 4ANBA 4FKQA 3E7VA 4K2RA 3AG9A 5CT0A 4BDFA 5HTCA 3QZFA 4U9AA 4XG9A 5I9VA 3IOPA 4II5A 3Q32A 4JS8A 3HZTA 2ITWA 4WNPA 4YTFA 1FGKA 2QOCA 2RSVA 4USFA 3MB7A 3E5AA 3CEKA 3GUBA 4I94A 4F7NA 4IVAA 4FIJA 3MH0A 1HCKA 4X2FA 1VJYA 3EL7A 3FL4A 4E73A 3O7LD 3MVLA 3R1QA 4EH4A 5HD7A 4O7YA 5J7HA 3O17A 2HOGA 3O50A 3TNHA 2EXEA 1BX6A 5HI2A 5F20A 4I6QA 1TQMA 5HBEA 2R3RA 3ZO1A 4ANNA 4C4FA 3GQIA 4B9DA 4N70A 5E8ZA 3VULA 1Q99A 1A06A 2C5VA 5CVGA 4ZTSA 4BIEA 3BWJA 4C4GA 4EK8A 3FLZA 3COKA 4QRCA 4O7VA 4H3BA 3MI9A 3OG7A 4RVLA 3W33A 4HNIA 2RFDA 4ZP5A 5E91A 4ACMA 2ITTA 2PSQA 2YHVA 3LZBA 4C4EA 4BCQA 3F7WA 3FC2A 2WMWA 4EQCA 3UYSA 4GJ2A 4BCPA 4K18A 4X21A 5KZ0A 1U59A 4DEIA 1CKJA 4Y73A 2C5XA 5JT2A 4MNEB 2OJIA 5H8GA 3UQCA 1PY5A 2ZV8A 5CQUA 4BKZA 2ETRA 3KVXA 4O7SA 2P2IA 4FKPA 3M42A 3L9NA 2VO0A 3VIDA 4G9CA 4NUSA 3MA6A 4FE2A 2WMSA 1Q8UA 4FZAB 1I09A 5DOSA 5CSHA 2C6EA 5D7VA 4BWXA 4EH6A 5FEDA 5CXZA 3VBYA 5KX8A 2CKQA 1PXNA 4IIRA 3R9HA 4EYJA 4RPVA 2BHHA 3LFAA 2HZNA 4YPDA 4F1OA 3HV3A 5EG3A 2ITXA 2WQBA 4GK3A 4BCHA 4FSYA 4F6UA 2F4JA 4YJVA 3F5GA 3AXWA 5I0BA 1XH6A 3UG1A 2LAVA 3RPSA 4O7NA 3B8QA 4PPBA 3FY0A 4IC7A 4L7FA 3UIUA 3W55A 2C0IA 4FTTA 1WVXA 4ZMFA 4AA4A 4RIWB 2ZMDA 3B8RA 3FZPA 3E3PA 3QD2B 4LI5A 1Q41A 5J9YA 3I1AA 4O0XA 3FMHA 2JKOA 3IW7A 4UXLA 4F64A 4CFFA 2CSNA 5ETAA 3HRBA 3OT8A 1Y8YA 3WZKA 4WSYA 4FEVA 4XLVA 4IXPA 2OJJA 4JJRA 4E4MA 4YJPA 5CSXA 4BZOA 2WTWA 3ZLYA 1YOMA 4DYMA 4I6HA 4JG6A 3W8LA 4IDVA 2X9FA 4U45A 4IE9A 3R30A 4BTMA 4AOTA 1G3NA 2AC3A 4F09A 2Q0BA 4NIFA 2R3FA 4JVGA 3OWPA 3U87A 4F6WA 4IANA 4CRLA 4NL0A 3WF6A 4LMNA 4FSUA 3CXWA 2CNUA 3HLLA 3GU7A 4WKQA 4UEUA 4FK3A 4IZYA 4M97A 3KF4A 3TN8A 1P14A 2BRGA 1YDRE 5CU2A 2FUMA 4DGMA 4FSQA 3JR1A 1KSWA 4I6FA 5JMSA 2F7ZE 3FSKA 5IDPA 3QKKA 3GFWA 1JQHA 5FQDC 1REKA 4GS6A 1CKIA 3VWAA 3WILA 3RKBA 1JWHA 1Z9XA 4ENYA 4ZSAA 4NWMA 5EOLA 3KK9A 4O0TA 4J98A 5M4IA 4IAYA 5CTPA 1XH8A 2Y7JA 3ZLWA 2GNLA 1L8TA 3LW0A 4EK3A 4JBQA 4BFMA 2IPXA 2W17A 2R4BA 4MEDA 4F9CA 4DFNA 4K8AA 3R8VA 3ZZWA 4YO4A 1PF8A 3ORZA 4C2VA 4CV9A 3Q53A 4YBJA 5F9EA 3RCJA 5KCVA 1ZMUA 3NNVA 3AD4A 4KB8A 1CMKE 2WU7A 4WG3A 4O2PA 2UVZA 3R7UA 3TV6A 2VGPA 4S31A 4KSPA 3ALNA 4ZSEA 4O7LA 2JDSA 3LXNA 3QBNA 3PZEA 5F4NA 4Q9SA 3ACJA 5TO8A 4BIBA 4AGCA 4R1VA 3VS5A 2VO3A 3Q9WA 4RZWA 4OTFA 2NPQA 4HZSA 3Q04A 4QMOA 2QR8A 3RM7A 2C6MA 2XNEA 5BX0A 1XH7A 3ACKA 3C0GA 4PQNA 5JSMA 2QOKA 2VTAA 2VX3A 2XBJA 4ZY5A 3PSBA 2BAQA 5B2MA 2Z7LA 4ORKA 3ZBXA 3CGOA 3EYHA 4F7JA 3F3VA 4ANSA 4RQVA 2UW7A 3PYYA 3Q9YA 3H9RA 3QA8A 4O0VA 5HVJA 3NEWA 3QD3A 4BCFA 4GMYA 2CMWA 4P7EA 3UQFA 2XK4A 3KN6A 4GV1A 2CLQA 1SMHA 3R8PA 4DEDA 1FVVA 5E8XA 3N51A 1GJOA 1QPDA 3UOLA 5IDNA 1BI7A 3F7ZA 1H26A 1W8CA 4BY9E 5A14A 3KXZA 5A4TA 4WNMA 1JLUE 4CFMA 2BKZA 2ZM3A 4TYGA 5DN3A 4O1PA 1IG1A 2CGUA 5T68A 2ERZE 2VTTA 5LVMA 1UKHA 5AMNA 5AUWA 1PYXA 4RJ3A 4AOJA 1Q4LA 2JDVA 1XH5A 3EQIA 2XP2A 3DGKA 3FL5A 3QC4A 1PXOA 1CTPE 5JZNA 3V8SA 4DBXA 2QG7A 3A60A 4G6LA 3FMMA 4PL4A 4UMQA 4WUAA 4EL9A 3MY5A 1NY3A 5AR8A 4FKGA 4O7ZA 1RW8A 3KMWA 2X9EA 3UVQA 1YHWA 3RHKA 4F0IA 2QO9A 4HVSA 3Q60A 4W4XA 4RJ7A 2WELA 3P78A 4Y95A 5KMOA 3BHTA 3R6XA 5TOZA 4P5ZA 3ITZA 4D9UA 5M07A 4YBKA 3ZUVA 4MQ1A 3L1SA 2R0IA 1FMOE 2QKRA 3H3CA 3AGMA 5ETFA 4GUEA 3DOGA 4FC0A 2VNYA 4DGOA 3A8XA 2Y6OA 1TVOA 2RF9A 2C5YA 5E8SA 2X2KA 3VRYA 3R7EA 3EL8A 4UWYA 2C6OA 4M67A 3PVWA 5DFPA 5DPVA 4JG8A 2ETMA 1OBDA 3K54A 2NNWB 4FNWA 4C4JA 3Q2JA 4L42A 5GINE 4HCTA 4KABA 1YKRA 4DTBA 1U5QA 1UU3A 2QD9A 4TRLA 4FVRA 5J5SA 4FKWA 3PXKA 3AGLA 3A7GA 1OPLA 3U4UA 4R3CA 3EFLA 4I24A 4AOIA 4O82A 3RK7A 4QMZA 3W2SA 2GNIA 3OEZA 1J7IA 4WG5A 4LL0A 3K5UA 4IZ7A 5AV1A 3UC3A 3DBDA 4R3PA 3HV6A 4G34A 1GZKA 3FXXA 4MKCA 4GSBA 4IWDA 4PV0A 4DN5A 1WBTA 4JDIA 3UG2A 4EHVA 5KMNA 4Y83A 3P0MA 3PE1A 2OFVA 1OPKA 2QU6A 2R3HA 4RT7A 5BVFA 3EQHA 3NVMB 4Y85A 3QCYA 1PXMA 2YDJA 4GYIA 5CEKA 5LJJA 1QPJA 1UU9A 4LUEA 4U3ZA 5M06A 3AC3A 2XNNA 3QX2A 3FQSA 4RVKA 3TTJA 3KK8A 2J2IB 4O7WA 2JIIA 4MXXA 4BBEA 4CKJA 2ONLC 4AGDA 4RWLA 5CASA 2WMBA 5DMZA 2R3IA 4TNDA 2REIA 4E6CA 4IAZA 4KAOA 3KY2A 5IQGA 3EFKA 4ZTNA 4HVIA 2G2FA 2YFXA 4EOLA 4D4SA 4PF4A 2UZVA 3QUDA 4XG3A 5HIDA 2HYYA 3SKCA 2YCSA 4RJ4A 2X39A 5L2QA 3FI3A 2C3JA 3WARA 4FIHA 2QOOA 3HVCA 1O9UA 2XH5A 3G51A 4TYHB 4R7IA 4YMJA 5JGDA 4C58A 4EBWA 3G6HA 3SA0A 4XG6A 3V6SA 4BGGA 4CMUA 2G9XA 3GC0A 4KWPA 2FO0A 3P4KA 3N4UA 2XIKA 2A2AA 2WMQA 2ZOQA 2XNMA 1B6CB 5L8KA 3TJCA 1Q8ZA 4Z9LA 2BTSA 3O2MA 3SOAA 2PHKA 3Q2MA 1V0BA 1H1SA 4A7CA 5DEYA 4MWIA 3QQGA 3S95A 3VS2A 1ND4A 1H28A 3GC9A 2WAJA 3SRVB 5HNBA 2YCRA 4CG9A 2UZNA 1KOBA 2QKWB 3QD0A 4FT0A 3KU2A 4BZNA 5BQ0A 2YAAA 3E8DA 3W18A 5I9YA 1S9JA 3AC2A 1MUOA 4JQ8A 3FV8A 4C59A 2E9OA 2XM8A 5CF5A 3DCVA 4YNEA 2CCIA 4FSRA 4QPSA 4W4VA 3BKBA 3F5XA 4PTEA 1KE6A 2JKQA 2PVKA 2WB8A 2GHLA 2ZM4A 3UNZA 4CMTA 3PJ1A 5IA2A 4OTWA 3EH9A 3EFJA 4BHZA 5ANGA 1OKWA 4R1YA 3CJFA 3H9FA 5HEZA 1YI6A 3REPA 2VTHA 4LRMA 3UIBA 3NIEA 4EKLA 2ESMA 2X0GA 3AT2A 3OCBA 5FTOA 3F6XA 2XNGA 1SVGA 3LCDA 2QODA 3D7TA 2X4FA 3A4PA 1ATPE 2VTIA 4C4HA 4FKVA 4FX3A 3I6WA 4O6LA 3PZHA 4RFZA 4M69B 4DEBA 2UW5A 4LFIA 2A1AB 3ANRA 1H07A 1P4FA 4HVGA 1H00A 3FQHA 3FMJA 5JKGA 2UZLA 2JBOA 3IG7A 3LJ2A 2R3OA 3G9NA 2OICA 3P5KA 4YLKA 2YITA 4DC2A 3U54A 4QMTA 2O0UA 5IKWA 3KGAA 3SHEA 1M7NA 4QTBA 3GCVA 4DEHA 2PVFA 3BU6A 3VUTA 3DDQA 5DHJA 2OJ9A 4TWNA 4YLLA 5B2KA 3PXZA 4EQUA 2VN9A 2WZJA 4WA9A 5HESA 4B99A 1R1WA 2B9IA 2IVVA 1JOWB 3SXRA 2W5HA 3FY2A 3UIMA 2YZLA 4ASEA 4EOKA 3E93A 2HWPA 2RIOA 5IPJA 3IECA 4C33A 4WT6A 4NJ3A 4IZ5A 3R0TA 2B54A 4FTRA 3TG1A 3UOHA 3LMIA 3LXLA 4CFNA 4PX6A 3VO3A 3QRKA 1GIJA 3OTUA 4KBAA 4TY1A 3U51A 4BICA 4EI4A 4I22A 3U6HA 4AACA 3UP7A 3NPCA 3KF7A 4FZ7A 2WTVA 3DBCA 5E1SA 4QMYA 4YZ9A 5KO1A 4G31A 4FT9A 4FL3A 4FV6A 4YZCA 1O6KA 4D2VA 3GCSA 3MW1A 4EH3A 1K2PA 4FIFA 5DG5A 4W8EA 3UC4A 2CDZA 2CPKE 4I0RA 4HPUE 4NZWB 3EQPA 1YWNA 4FA2A 5KUPA 3F5UA 3E92A 4QQJA 2W9ZB 3NUSA 2ZDUA 4G5JA 5T3QA 5IQEA 3DY7A 2OIQA 4OTIA 4BGHA 1RJBA 4E3CA 3DA6A 1DM2A 3OVVA 4M3QA 2B7AA 2XKDA 3TZ8A 3HMOA 3DKGA 4Y5HA 3F2NA 4H36A 3DXQA 4FSWA 4RX8A 2E2BA 2OF2A 1OVEA 3VBXA 2VTQA 4AZVA 2XK6A 5AA8A 4U81A 2O5KA 1BYGA 1A9UA 3SOCA 3VS6A 5KBRA 1DS5A 2BDFA 3UO5A 3MY1A 4DCAA 4DH3A 5BPYA 5CAPA 1YXUA 5D12A 4ASXA 5CYIA 4IWOA 3GCUA 4JQEA 4EYMA 4HYIA 2Z2WA 4NM0A 4AZFA 2GNGA 4RQKA 1WVYA 2UW4A 4WRSA 5EQEA 3NZ0A 3FZ1A 3PA5A 4A9TA 4D1XA 3QLGA 3HMNA 3MVMA 4OAUC 3HL7A 3F3TA 3COIA 4CFUA 4DG3E 5CI6A 5ICPA 4MVFA 4AN3A 4MNFA 1RQQA 5ANDA 4U79A 2XK8A 3W2CA 5L2IA 4U44A 5CALA 1J1CA 3QAME 4FIEA 1V1KA 3ODYX 1SZMA 5C4LA 1URCA 4IMYA 4PDSA 4D1ZA 3MJ2A 1BLXA 1X8BA 2JDRA 3D5XA 4ZZOA 4BZDA 5GZ9A 4EOOA 3V01A 3DS6A 4NCTA 2DS1A 3VUHA 3ATSA 4IAKA 1GOLA 4EK5A 4I23A 3U9CA 1OKVA 3HYHA 3RPYA 3OXZA 4ITHA 3JXWA 3R83A 3TKHA 5IQDA 4D9TA 4FOBA 3LCSA 3PJ3A 4JRVA 3WF5A 3WZUA 4LQMA 1O6LA 2W7XA 2WEVA 2X6DA 5ANKA 2QHMA 5AX9A 3RPRA 4ACDA 2C3IB 2QOHA 4X0MA 3OBJA 2OI4X 4E93A 1FBNA 3TWJA 1YXXA 3HV5A 2R7BA 2PUPA 4XG7A 2XYNA 4H1JA 4IQ6A 3JY0A 2JDTA 4RFMA 2C5NA 2Y0AA 2VTJA 2QOFA 2X81A 4PPAA 5EDPA 3VNTA 3CKWA 4YUQA 1MRYA 5HORA 4TYHA 5AP5A 4C3RA 3FEGA 2PVNA 2W1IA 2HWOA 3E8NA 2PE0A 3TKUA 1JKSA 1S9IA 2BIKB 2V0DA 4RC2A 3V8WA 4QMPA 3OMVA 2Z7QA 3ZYAA 3WZEA 5EW8A 2UVYA 4AWIA 3GI3A 4FNZA 3DK3A 3C4WA 2BRBA 2QCSA 3E63A 3GOKA 1PMNA 3R21A 3IGOA 1OL6A 4XP0A 4R78A 1J1BA 4KSQA 2CGVA 4QQ5A 5HX6A 4BKJA 1E9HA 1GZNA 4QD6A 5EW9A 3B2WA 1QMZA 1UNHA 2XCKA 4BDKA 3NYXA 4PPCA 4OTPA 3HNGA 3RNYA 5GIPE 4WG4A 2VWWA 4IC8A 5JGAA 4XEYA 2B1PA 4YPSA 4OT5A 3IS5A 4EHGA 2CGXA 3GP0A 5J1VA 1IAJA 2EVAA 5LCJA 4AT3A 1YVJA 2A0CX 1DI9A 3PLAE 4B8LA 2LGCA 4DE4A 5KMLA 2ACXA 1GIIA 3UPZA 5FG8A 2OIBA 2XF0A 4PL3A 2PVYA 2QC6A 4P2KA 5IEYA 3V6RA 1ZYCA 3AT3A 5AP4A 3U6IA 2F57A 2YWPA 3CJGA 3GCPA 3RAWA 3VUGA 4CZTA 4F70A 4LGHA 1QPCA 3UP2A 4ID7A 4U3YA 3RK9A 3LXPA 4JIAA 3UPXA 4A4LA 1H24A 1OIQA 2QONA 3QTZA 4FG9A 5FLFA 3V3VA 3QRJA 3LE6A 2HAKA 2C0TA 4AA5A 2PMNX 4F7SA 3MN3A 4CKIA 4F1MA 3R9RA 3TTIA 2YLEA 4DFYA 3M2WA 4OUCA 4F6SA 3UZRA 3NNWA 1UNGA 2CHLA 5AP6A 2XCHA 4EOQA 2XRWA 3OT3A 3QCSA 2R3QA 2A4LA 1PKDA 1M2QA 3POOA 2W5AA 3CQEA 3QWKA 3CD3A 4WRGA 4IAIA 2HZIA 5CZIA 1UA2A 2I6LA 4O6EA 4C62A 4IBMA 2XIYA 5I9XA 2VNWA 3RAHA 4AG8A 1PW2A 5IG1A 3HP5A 2QURA 4C57A 2CN8A 2RKUA 4J7BA 2OZAB 5L6OA 4BN1A 4X3FB 2YM3A 4X3FC 1OIRA 4TN6A 2W4JA 4RA4A 3AT4A 4QT1A 4V0GA 2ZB0A 4O1OA 2GDOA 3EYGA 4RSSA 5EI2A 3CP9A 3S1HA 3KRJA 1KE7A 3C4EA 4RIWA 3OP5A 4FV5A 2W1ZA 1IA8A 3UE4A 3LM0A 5L8JA 2ERKA 4ZZNA 4ASZA 3QRUA 4C3PA 3D15A 4U7ZA 4HOKA 1BMKA 1UU7A 4NK9A 5HU3A 1P4OA 3FMKA 4GVJA 5FM2A 5J5TA 2JFLA 1MRUA 3FI4A 3RALA 2WOTA 3MWUA 1XBAA 3FMLA 5A46A 4XMOA 3EN6A 3ZC6A 2WGJA 3SXFA 4QQTA 4YSJA 4GW8A 4EOJA 2BRHA 3C50A 5IU2A 4ANOA 4QMMA 2BVAA 2WMXA 1Q3WA 2R3LA 2W0JA 4ENXA 4G3FA 2J0MB 5BMMA 1FGIA 3CTHA 3BE2A 3NUYA 3ZO2A 1YW2A 3OUKA 3V5WA 4Z3VA 1W0XC 2UVXA 5HE2A 3G9LX 2OSCA 3NNUA 4X2KA 4I4FA 3ZFYA 4MBLA 4FODA 3UNJA 3BX5A 4J95A 5LXMA 4LGGA 3C7QA 4KRCA 4DLJA 5HD4A 4AT4A 1IRKA 1B38A 3R00A 2XK3A 3QALE 4JBOA 4BWPA 1PXPA 3NMUF 1ZYLA 3QHWA 4Y5QA 3W8QA 3NUUA 4ZTHA 4JNWA 2WTCA 5DR9A 5L6WL 1ZWSA 4YJQA 5FUTA 2FVDA 2VD5A 5DLSA 3QQLA 2E9PA 3QYWA 4WNOA 4E4XA 4XCUA 2C47A 2X4ZA 4LV8A 5I3OA 4F08A 2V55A 5KBQA 1OKYA 5ANIA 4BCKA 1KUTA 3MFRA 4NW5A 5DT4A 2Q83A 2E9VA 5EKNA 3FZRA 4MXCA 5IQBA 1W7HA 2RGPA 4FNYA 4A9SA 3CS9A 4BB4A 5AUTA 3FHRA 1H25A 4FTMA 3JVRA 3VBWA 4E8AA 4D28A 5HIBA 4BI2A 5CQWA 4TYJA 4BC6A 3QD4A 3OOMA 5H9BA 3QWJA 2JLDA 2W4OA 5DEWA 4ZSJA 4W8DA 1KV1A 1XBCA 3DT1A 4MQ2A 3IONA 3KXXA 3ZUUA 4I92A 4I5CA 4AS0A 4ZTRA 4FK6A 3T3UA 4BKYA 4QYFA 2J4ZA 3OC1A 2UZEA 1M2RA 4IB3A 5KHXA 4TL0A 3NGAA 4IJPA 3GC8A 4J52A 4ZMEA 3FKOA 2YACA 5FGKA 1Q97A 3LMHA 1HOWA 3AC5A 4OW8A 4MBIA 3ODZX 5FWKK 4I5PA 3QUEA 3NYVA 2B0QA 5GNKA 2VWIA 4TNBA 2O8YA 3DDPA 4U40A 3A4OX 1OIYA 3DTWA 4NEUA 4B8MA 2BDWA 3GENA 3TJDA 4J53A 4J97A 3S2PA 3ZM9A 4W9XA 4D2PA 2VTLA 4S32A 3PWYA 2HIWA 4FNXA 4DH1A 3FYJX 2WO6A 3KN5A 1BI8A 3LFEA 3P7AA 5LWMA 2R3MA 1NW1A 4KIKA 5DT0A 3TZMA 2FSTX 4IB5A 2ITQA 5EKOA 4BDDA 1DAYA 1OKZA 3I4BA 2ZB1A 1DAWA 4EKKA 3FKLA 3QQKA 3QXPA 5BUEA 2C6TA 4IM2A 4DEAA 3ALOA 3QTQA 3TNPC 4FEXA 3F2RA 2E9UA 4LYNA 4CD0A 3DKFA 4DFZE 2GS7A 3MH1A 3LFCA 2VGOA 1PXLA 4JI9A 4FV7A 2VUWA 3EQFA 2UW9A 2WTDA 3EWHA 5C1QB 4O96A 4IW0A 3PLSA 2BMCA 2DUVA 4NTSA 4P4CA 4AGWA 3R8MA 1Q5KA 4A06A 5K0XA 4O0WA 4UYNA 3QF9A 5CI7A 4N0SA 5FRIA 1R0PA 3NW5A 3IDBA 3OCGA 4C38A 3D5VA 4AZWA 5KHWA 5HG9A 2EB2A 4DFBA 3UBDA 3QZIA 3F61A 4CKRA 3ZSGA 4PL5A 3SG8A 3OZ6A 4DGGA 2C0OA 3DK7A 4ZLOA 2HY0A 2HW6A 4FEQA 3L8SA 4GFMA 1URWA 1GZOA 5LMKC 3LXKA 5J79A 1VEBA 1H1PA 1ZAOA 1G5SA 2JC6A 4PRJA 3PG1A 5IH6A 4AFJA 4PMPA 4FKUA 4PDYA 2WQNA 2PZRA 1FINA 3F88A 2P0CA 3MV5A 4QP3A 3GU4A 4ZJJA 4IVDA 3VBVA 4CFXA 1U54A 5IA1A 2X1NA 2PVLA 3LFBA 2V62A 4X3FA 3BWFA 3WZJA 4E6DA 2C30A 3E87A 3PY3A 2ONLA 2W1CA 4MAOA 1PXIA 4FG8A 1XQZA 5LOHA 3ZMMA 3VW6A 3BEAA 4PTGA 4OT6A 4XLIA 4FTOA 1OL1A 2J5FA 2W99B 4FKJA 5KMIA 2OIDA 2HXLA 4EK4A 4ARKA 1WBSA 2I40A 1IASA 1PHKA 4NU1A 3UVPA 5L2SA 2IO6A 1XH9A 2FSOX 4E4LA 1IEPA 4TWOA 4U43A 5HG5A 4LRJA 4HYSA 2X8IA 5BYLA 4CRSA 5I5ZA 3DJ5A 2YEXA 3O8TA 4TYIA 3MIAA 1YHSA 2J5EA 2XKFA 4FTIA 3I7CA 1R0EA 3PXQA 3H10A 4N6ZA 2UZUE 3PP0A 1YI3A 4RWJA 2BAKA 2QLUA 2XJ2A 5DIAA 5TF9A 4BDGA 4WUNA 4LM5A 3TV7A 4MCVA 5T6KA 3IK3A 2IVTA 1KE9A 3NLBA 4XJ0A 3T9IA 4F99A 3I6UA 3BYSA 5AUXA 4EH2A 4E5AX 5HVKA 2X8DA 2PE1A 1K3AA 2E9NA 3JS2A 3R02A 2Y4IB 2JGZA 3R2YA 3SAYA 3MPAA 2UUEA 4QOXA 4YJTA 3ZS5A 4O7TA 4X2NA 4DTKA 4F9AA 2FSLX 3CIKA 2C68A 5CT7A 4O0SA 4QQCA 1PYEA 1P5EA 5AWMA 3RM6A 3UZTA 4GUBA 2CGWA 3HUBA 5A6NA 2JAMA 1YXSA 3RPOA 4QMQA 2UV2A 3VS7A 3TM0A 3CLYA 5CS6A 4YSMA 2WU6A 4LOQA 4TTHB 4DBNA 4FTAA 3BYVA 4O0UA 3O71A 3PTGA 4DCEA 5KKRB 2WTJA 3DQWA 3VAPA 1PJKA 2OJGA 2YM8A 4XG8A 4AT5A 3FPQA 2BRMA 4QMNA 5IQIA 4I0TA 3LFSA 3W1FA 3W32A 4RZVA 5IISA 2HY81 3OHTA 2EUFB 5IZFA 2G15A 4S2ZA 5K9IA 5KMMA 1Y6BA 2O2UA 1JAMA 4LV5A 5IF1A 3VVHA 1OZ1A 5E8UA 1KE8A 4EOSA 3I60A 1SNUA 4CT2A 3IO7A 3R2BA 2WMRA 5KZIA 4FT7A 1B39A 4YJUA 3SW4A 1H27A 4XBUA 2BR1A 4FTUA 2OFUA 4BWKA 5AAFA 5HBJA 4JOAA 4QP9A 4IX3A 4M8TA 4JG7A 1FVRA 3PFQA 2O63A 4L3JA 3MS9A 3PVGA 2CKPA 5HCZA 4IAFA 5AA9A 1ZY4A 5AIRA 3LAUA 4DT9A 4FKSA 5DRBA 3FMDA 4W9WA 3BYMA 3D2IA 3DNDA 1Q8WA 2EB3A 2B53A 1XHAA 4FSNA 5CEPA 5JQ8A 2YJRA 5D7AA 1PXJA 3LOKA 2W05A 3IW8A 2GS6A 3PXFA 4HVHA 3MY0A 3NR9A 4IVBA 3CTQA 4AW1A 5LQFA 4DF3A 4APCA 4EEVA 1H0VA 2XBAA 2VZ6A 3KULA 3ORMA 3G5DA 4G3CA 3VUKA 2J0IA 3COMA 4MXZA 3RCDA 4KINA 2JDOA 4K77A 2FSMX 4JDJA 4A07A 4BYJA 4E1ZA 4E26A 3ZSHA 5HBHA 4D2WA 4OBQA 3D2KA 4JR3A 3NUAA 4C35A 3THBA 4ANMA 4ITJA 2ZYBA 4KIPA 4O21A 4LRKA 3P7BA 3LQ3A 3TCPA 3NUXA 4BTFA 2BZJA 5HGIA 3PVBA 3PG3A 4QMWA 3BRBA 4MHAA 2ITPA 4CXAA 2KULA 3U8WA 3UQGA 4X7QA 4ZTQA 4O0YA 4ACGA 5CF8A 2YISA 2W96B 4XS2A 4GVAA 5G6VA 2XK9A 1H01A 2BCJA 4TXCA 5HE3A 4APPA 1LUFA 1JKTA 1BKXA 2W1GA 1CM8A 1OL5A 4GL9A 4U5JA 4V04A 5CLPA 3QKMA 4GKIA 5DBXA 4BHNA 3LHJA 5F95A 5JQ5A 1M14A 2WIHA 3F3ZA 2QOLA 3ULZA 3NRMA 4YJNA 3R9NA 2P2HA 4C36A 2FA2A 3M1SA 3DB6A 3MA3A 3F82A 5IH5A 3D14A 3FLWA 4JLCA 1BUHA 3PIZA 4QO9A 4A4OA 1GAGA 5DRDA 4S34A 5DH3A 2Y8OA 4XX9A 4E7WA 3PUPA 2HENA 4YGAA 1Z57A 3BLRA 4MD9E 5TE0A 5GJFA 4I5HA 2BRNA 3D94A 4NFNA 4U97A 5L3AA 4FSZA 4IJ9A 2VTRA 5AX3A 4D4VA 4R8QA 4FV1A 4XHKB 4RIYB 4JX7A 4L3LA 3L9LA 3DTCA 4J96A 3FLNC 2WD1A 1W83A 3K2LA 1OL2A 3PJCA 4NSTA 2JBPA 3AC1A 4FKLA 4A9UA 3LFFA 5EH0A 3NW7A 4M15A 5LMKA 3ROYA 5A4EA 5EI6A 5DE2A 2WMVA 3NCGA 4OTQA 4ACCA 2O3PA 2GS2A 4JIKA 4Q2AA 3FHIA 3G90X 1OGUA 4L44A 4M0YA 4OTDA 3FXZA 2JFMA 2PZPA 4QTCA 3H4JA 3IW6A 5ACBC 4WIHA 3VUDA 2HW7A 3W2PA 3VQUA 3HAVA 5IQCA 2IZUA 3NS9A 3CQUA 2GPHA 5IUHA 3PPZA 3LCTA 3Q4CA 4I6BA 4BGQA 2WQEA 3RAIA 4ZK5A 4D5HA 4QNAA 2YN8A 3L8VA 3KB7A 4X3JA 4AE9A 3OUNB 3KFAA 5EHOA 1ZRZA 5AEPA 4LMUA 3LFNA 2R3GA 3H0YA 4R5SA 4FEUA 3LVPA 3NYNA 1H0WA 4ONAA 2JEDA 1KV2A 5EDRA 5M4CA 1WMKA 3TNIA 3KKVA 4RLLA 5ETIA 2FGIA 1Q3DA 2XB7A 4I20A 1FMKA 3MTFA 3LMGA 3Q4TA 3C4XA 3A7JA 3CTJA 4RMZA 5E1EA 3I0OA 3R8LA 5BUIA 3Q9XA 4EQMA 3ORKA 5CEQA 1QCFA 4O83A 3JUHA 4G3EA 5DNRA 4FG7A 4MYGA 2WNTA 4NIFB 4JXFA 3BGPA 4R3RA 2CLXA 3VBQA 3R71A 3LQ5A 5IA4A 3FZOA 1OIUA 3KRRA 3CC6A 3QLFA 4MX9A 5JFSA 1YRPA 2WQOA 5KMKA 1YI4A 4KKEA 1OITA 2WMAA 3QGWA 2G2HA 5AFVA 2V22A 4CYIA 2BZKB 3ET7A 3NYOA 4RWKA 4PTCA 4XRJA 2PK9A 1CDKA 2OBJA 4KIQA
chains in the Genus database with same CATH superfamily
4G3DA 4MTAA 4AXAA 4YTCA 3DU8A 5CAUA 1OB3A 2BHEA 3BU5A 4RIXB 2H6DA 4BCMA 4ZTLA 4AZTA 3PWDA 4PMSA 4YJSA 3K3JA 5DYJA 3OWJA 5CANA 2PVRA 4KIOA 4ZTMA 2GNHA 3RBWA 3DJ6A 4HYUA 3ORTA 3NNXA 1MP8A 4EH5A 4JMQA 2QO2A 1F0QA 4Y8DA 5ANEA 4FSTA 3VBTA 2V5QA 4M12A 4EORA 1F3MC 4QP2A 4LV7A 1OUYA 3HDMA 3KULB 4MK0A 4Z7HA 4ZJVA 4C0TA 4DGNA 4BJJA 3ENMA 2JIUA 4C4IA 1U5RA 5JZJA 4O7RA 3W2QA 2ITZA 2R5TA 4K0YA 4GRBA 3V51A 3ZOSA 1AD5A 5C8KA 2BALA 4BCIA 2VRXA 4NFMA 3ZRLA 3TUBA 1LEWA 4H05A 4I3ZA 3E64A 3JYAA 3CY3A 3EQBA 3QTXA 4I0SA 2G1TA 3D7ZA 5AUZA 2PMOX 4G2FA 3TEIA 5GZ8A 2YCFA 5H2UA 3LCOA 2PMLX 5M57A 2I1MA 1H1WA 3LFQA 2F2CB 3BGQA 5L4QA 3DV3A 4HGLA 4CSVA 3BEGA 4IVCA 3FZSA 3EN5A 3R1SA 4QYHA 4YC3A 2YA9A 5IEXA 5EQPA 4IFCA 3TNQB 1JNKA 3PIXA 3O8UA 2R9SA 3ANQA 3P9JA 4OBPA 2H8HA 4FGRA 3FKNA 3QQUA 3FUPA 4ZS4A 5EDQA 3W10A 1SVHA 1W2FA 5D9HA 3ZO3A 4OTHA 3R7YA 4A4XA 1CSNA 3EQCA 3TUDA 4MXOA 4E6QA 3PPKA 1DI8A 5D41A 3ZSIA 1VYWA 3UVRA 2Y6MA 2QI8A 4QYYA 3VHEA 3I7BA 4GK4A 3WIGA 5C26A 4HGSA 3V5LA 2X7GA 3EN7A 5HKMA 4JDKA 3C51A 3E7OA 3KMUA 4CLJA 3HA6A 2KTYA 3QCXA 4JAIA 3I5NA 2V7OA 5A4CA 5K3YA 3WI6A 4L7SA 2F2UA 3PXRA 4O84A 4YHFA 5L6PA 5HNIX 3OW3A 2C5OA 3NCZA 4BI1A 3DNEA 3UNKA 2ZV7A 4BDIA 5HG8A 3GBZA 3VS3A 3PJ2A 3F69A 2YDIA 4LL5A 5A3XA 5M55A 4HPTE 4E20A 5HLNA 1H1QA 2I0HA 2J7TA 2J9MA 1R78A 2QVSE 3DB8A 3DAKA 3FPMA 3R7OA 4UN0C 3SLSA 2FYSA 3LPBA 4GKHA 4MWHA 4JQ7A 4FKRA 5ANOA 3O8PA 3ZDUA 1PMVA 2Y4PA 2X0QA 4GFOA 4IZAA 5JRQA 3BCEA 3SXSA 2AYPA 4TYEA 1STCE 4IB1A 2PULA 4RX5A 3KMMA 5CU4A 1G8JA 1WBPA 2CKEA 4NKAA 3R8ZA 4XV9A 2HZ4A 1NVRA 5DGZA 5G1XA 5AUVA 4C8BA 2Z8CA 3HV4A 4PWNA 3VRZA 4FT3A 2G01A 3H9OA 1J91A 2XNBA 4ZEGA 4F1TA 4GK2A 1ZXEA 5I4NA 2WHBA 1M17A 3OCTA 4GU9A 3VJNA 3FI8A 2OWBA 2ZJWA 1SM2A 3GFEA 4J1RA 5M51A 3HA8A 4K11A 5F1ZA 3KXMA 3TUCA 3FE3A 5EYKA 3QTUA 3P08A 1PMEA 4USDA 4FTKA 4D0XA 3UOJA 3CPCA 2XMYA 4F65A 4GH2A 4WBBB 3NFGB 2R7IA 4UZHA 4DT8A 3P86A 1G8AA 4NT4A 2HELA 2HXQA 3DAJA 4Q9ZA 2W1HA 1XBBA 3FJQE 2UW0A 1E1VA 3BV2A 1OL7A 3BU3A 3KCFA 4YJRA 3V5QA 3JPVA 3Q9ZA 2OKRA 3C5IA 3R1NA 5A4LA 3FYKX 4F9BA 4OLIA 5EHYA 3R28A 4O81A 4PP9A 4HGTA 3I81A 4CMOA 2FH9A 4FZ6A 3BI6A 5EOBA 2C3LA 3NAYA 5CNOA 3DQXA 3QYZA 2ZDTA 4XV3A 1UWHA 2PVHA 2A19B 3ATTA 3UYTA 2X6EA 3CR0A 2BUJA 3TIYA 4HNFA 3TL8A 2WPAA 3WBLA 2J50A 2YIRA 4F78A 4TKSA 3BBWA 2QLQA 5AR3A 3KREA 2VTOA 2XVDA 4XG4A 4CYJA 2F49A 4QMSA 4D58A 4R5YA 1EH4A 3NDMA 3GEQA 5L2WA 3OY1A 2ITUA 2UZDA 5IMEA 3A7HA 3G2FA 4FKIA 3BYUA 2YJSA 4QP6A 5CU0A 2YM6A 3R7IA 3W2OA 1APME 4MD8E 2P33A 3MH2A 4FBXA 4D55A 3QXOA 2ITVA 1ZY5A 5C27A 3HRFA 4RJ8A 1HCLA 3LJ0A 3BHYA 1UVRA 4A9RA 3EN9A 4D0WA 3DBEA 2R3PA 4F0FA 3EN4A 3ZDIA 4GG5A 3KL8A 3DFCB 2ZV9A 3UTOA 2I7QA 2X2MA 5FEEA 2ITNA 4KS8A 4IACA 4Q5HA 3UODA 2R3NA 3BQRA 3ZBFA 2P4IA 4AZEA 4HW7A 4DEEA 4Z16A 4RWIA 1TQPA 4GEOA 5HTBA 5K0KA 5C8MA 5LVNA 1YDTE 4BCNA 5AV0A 4R7HA 4CTBA 4K9YA 3HRCA 4BDJA 4ERWA 3MTLA 4AW2A 3POZA 4AAAA 3MH3A 2NRUA 2X7FA 3ULIA 1Q61A 1T46A 2VO7A 3HP2A 5CX9A 4EH7A 4KIKB 4DFLA 1FOTA 3WF8A 4CGAA 3EQDA 2R2PA 2UZBA 1YXVA 5LMAA 4EK6A 4QMUA 2QOIA 4C34A 4Y46A 3LKMA 4LOPA 3PRIA 4IX4A 4YZDA 5AADA 5J9LA 1AGWA 2W4KA 3E8CA 3MDYA 1FPUA 2XZSA 3ETAA 1WAKA 4DITA 3SVVA 4RVTA 5IA0A 3BELA 3GOPA 3NUNA 5JRSA 4BCJA 5K4IA 2VTPA 3UGCA 2GTNA 5CEOA 4QP7A 1OM1A 2C3KA 2VV9A 4QTAA 1KOAA 5EM7A 1GY3A 5I9UA 4AF3A 2C1BA 3OS3A 3BQCA 2WFYA 4H58A 4MH7A 1Q62A 3KXHA 4FTQA 2P55A 3A8WA 4FL2A 3F3WA 5HIEA 5D11A 4UMTA 1UV5A 3AOXA 4NH1A 2A98A 4E6AA 3NUPA 4R77A 4XRLA 4BCOA 5GHVA 2ZV2A 3LLAA 2PUUA 3OXIA 3GXLA 4ALWA 3AMAA 2GQGA 3D9VA 4MXYA 5KE0A 5CF6A 3GU6A 4L01A 4NJDA 3WYXA 1WBNA 4AW5A 2WEIA 3DZQA 3DKOA 3LCKA 5EQYA 5HZNA 4RIXA 3Q4ZA 3QTRA 4GU6A 5E8WA 2PPQA 1LP4A 3PVUA 4ZXTA 3T3VA 4D2SA 3L9MA 5DT3A 2XUUA 4DAWA 4DHFA 5IQAA 4DA5A 3OW4A 4ASDA 5A9UA 5AV3A 3WZDA 4EH8A 3DFAA 5M53A 3NWWA 4D5KA 4E4NA 2EU9A 5BV3A 4YHTA 5A4QA 4DFUA 1YWRA 3MPTA 4FIIA 3HX4A 5CNNA 1JSTA 3KRLA 3QZHA 4FVQA 3ZFXA 4RGJA 4XV1A 1VR2A 1IAHA 2WOUA 2PWLA 4GFGA 4KBKA 4ZS0A 3DK6A 3VF9A 1MQBA 3HMPA 4RX7A 4JL9A 5E8YA 4UALA 4H3QA 1ZMVA 5FD2A 3C4ZA 3Q6WA 4J8NA 3ORNA 4I1ZA 5CAQA 4FKOA 4FVPA 3QKLA 5FEQA 1AQ1A 3L9PA 3ZFMA 4Y72A 4HYHA 1ZZLA 3OBGA 3RZFA 2C6DA 4EJNA 4EZ5A 3MB6A 3BLHA 5DWRA 3KEXA 3MIYA 4F63A 3II5A 2XNPA 3Q4UA 4M69A 3N4TA 2YM4A 5CXHA 1NT2A 1JSUA 1H8FA 1H4LA 3CY2A 3ORXA 3FC1X 1ZYJA 4XG2A 4YTHA 1NVQA 3IKAA 3WYYA 2VX1A 3EQGA 4GT4A 2PTKA 2HK5A 4YZBA 3PSCA 5CU3A 3KXNA 4XP3A 5CENA 4NM3A 2J0KA 2OXDA 4ZY4A 5HICA 2VWVA 2IW6A 1ZZ2A 4FV9A 2QOBA 4ZIMA 3E62A 3ORLA 4MD7E 3WF9A 3AKKA 3BL9A 2VWXA 2OLCA 4I6LA 4FL1A 5HE1A 2PVMA 2SRCA 2XEYA 3KA0A 5BVNA 4RVMA 3RNIA 2WTIA 1YQJA 3D83A 3TZ9A 3ZTXA 4MF1A 4AU8A 2DWBA 4FT5A 1QPEA 3DAEA 5FP6A 3DZOA 4G1WA 3R1YA 3VQHA 2QHNA 1Y8GA 2OJFE 4XP2A 2J0JA 4QNYA 4RFYA 4UX9A 5CY3A 4XNEA 3A99A 3WOWA 3QFVA 3SC1A 2YDKA 1GNGA 1NXKA 1ST0A 3G15A 3FLQA 1W84A 3D4QA 5ETCA 5I9WA 5AJQA 3M11A 4DLIA 4X6QC 2I0VA 3W0PA 5LARA 5EW3A 3ZH8A 4BDBA 2IZSA 5FM3A 2R3KA 4OTGA 1IA9A 3D0EA 2RG6A 4WD5A 3MFTA 2GU8A 3IDPA 5HG7A 4DG0E 5C03A 4CFWA 4L6QA 4NCTC 3PDTA 2RG5A 4EC8A 3PY0A 2NP8A 3N9XA 4H3PA 2B55A 2CNVA 3A2CA 4RBLA 4XOZA 5HOAA 5HE0A 4FRFA 3KQ7A 4YO6A 1TKIA 4O4FA 1PRYA 3KC3A 1H08A 2WIPA 3LFDA 4KS7A 3SGCA 2UW8A 5AUUA 3EIDA 3RTPA 2X8EA 2XIZA 3UZPA 2JIVA 3ZZEA 4B4LA 4EBVA 3BBTB 1JKLA 3TZ7A 4FUYA 4PNIA 4XBRA 1OBGA 2Z60A 2BDJA 1ST4A 4A9YA 1R3CA 1ZMWA 5HTIA 5M4FA 4G16A 2F9GA 5EI8A 5HHWA 2OG8A 4FV8A 1Y6AA 4JT3A 2IW9A 5FP5A 4E5WA 4I4EA 3BHHA 5LCKA 2CCHA 2XS0A 2YIYA 4GIHA 2QNJA 3FSFA 2ZVAA 4L67A 2HCKA 3V8TA 2GHGA 2C4GA 5JK3A 4I93A 3P7CA 1SYKA 4AXEA 1WCCA 3Q6UA 3SV0A 5IA3A 4RIOA 4M66A 3MFUA 4IAAA 4YP8A 4EH9A 2IVUA 3ELJA 1W2DA 4QYGA 4BBMA 3TDVA 3CPBA 3N4VA 4WSQA 2UZWE 1TFFA 1XMMA 5AV2A 5E9EA 4KD1A 3PJ8A 5CWZA 3AMBA 3W0SA 1M2PA 3LLTA 5M4UA 1YDSE 2OK1A 4M13A 4L45A 4EOIA 2DYLA 2H96A 3MPMA 3MVHA 3UO6A 3W0OA 3UMXA 3HDNA 3RHXA 4G5PA 3ERKA 3NW6A 3ZRKA 3DLZA 3GNIB 1QL6A 1SNXA 4PNKA 2ITOA 4QMXA 4LGDA 1I44A 5FBOA 4C7TA 4RLKA 3R7VA 5AP0A 5EM6A 4NYEA 3KXGA 4YC8A 1U46A 3QTIA 4QPMA 1Y91A 3LM5A 4UMPA 3LIJA 2I0EA 5EFQA 4G6OA 4L8MA 4C02A 2H9VA 2GNFA 4GIIA 3HUCA 3I0QA 4NTTA 4CQGA 4OR5A 3T8OA 4OAVB 4I41A 2BFXA 4AGUA 4BVUA 3ZUTA 1YWVA 4FKTA 3TNWA 5IUGA 2F7XE 5H8BA 2VWUA 3VUIA 2W06A 3ORPA 4D4YA 2BZHB 2ETKA 2VTSA 4YJOA 5AP2A 4BBFA 3QU0A 4ZJIA 4JBVA 2UZTA 3AD6A 4EOPA 1WBWA 3UDBA 1Q8YA 2VWYA 3C5UA 5IA5A 3R01A 3CD8A 3G0FA 1XKKA 3BLQA 4HCVA 1NVSA 2XIXA 4TPTA 3MESA 4MBJA 5AAGA 3P23A 4P90A 4DH7A 3E3BX 5IQFA 4FGBA 5EYDA 3V5JA 1XJDA 2GFCA 4CV8A 5AR4A 5D1JA 4ZZMA 1LPUA 3PIYA 5AP3A 4CT1A 2VX0A 4AFEA 2PMIA 2OZOA 4RC4A 3GQLA 4B6LA 4TT7A 4LOOA 4PDPA 4YZMA 3AMYA 3FLSA 3IQ7A 4FTCA 3FZTA 2IWIA 3PP1A 4RRVA 1H1RA 2C69A 2V7AA 5CAVA 1PXKA 3HAMA 2OZAA 3JVSA 3Q96A 4FF8A 4WNKA 4X2GA 3V5TA 4P5QA 4K33A 4L3PA 3PRFA 4G9RA 5K5NA 4IEBA 3IW4A 3EJ1A 3UIXA 3DBFA 4GT3A 3LQ8A 3W0QA 3L8XA 3WF7A 2GTMA 4N57A 4HGEA 2OF4A 4BDCA 3WIKA 4X6RA 4LUDA 5J95A 3IDCA 2QG5A 2XYUA 2GQRA 2VWBA 4XUFA 4G17A 4B7TA 3OEFX 2QOQA 4JRNA 4M84A 4UB7A 3FBVA 4UMRA 3NX8A 2WXVA 4FV0A 4BDHA 2YAKA 4G3GA 4CCBA 4AXDA 1V0OA 1M7QA 3MFSA 4GJ3A 3U6JA 4YR8A 3GU5A 4IFGA 4UV0A 1E1XA 4JDHA 4O4EA 5JFVA 3EZRA 3GCQA 4BIDA 2ZMCA 4S30A 2B9HA 1UWJA 3P79A 4RJ5A 4EHEA 3EQRA 3PA3A 5GIOE 3RP9A 3F5PA 3BLAA 4EWHA 5LWNA 4O38A 5AR5A 3OFMA 4JBPA 5HCYA 4ZAUA 5DR2A 2XIRA 3IGGA 5GJGA 3SQQA 2PUIA 3A61A 5HVYA 5BVEA 1CKPA 4MNEA 2OXXA 4U42A 2YM5A 3S3IA 3SRVA 1REJA 4V01A 3UJGA 2WQMA 4BCGA 4CQEA 4QYEA 4F9YA 4ANLA 3B2TA 1U4DA 5IQHA 5HX8A 1J7UA 4D4RA 4YU2A 2PL0A 4V0GB 2YWVA 4RIYA 5ACKA 3PE2A 2BZIB 3ZEWA 2B9JA 2DQ7X 4UXQA 5AR2A 5AUYA 4EZ3A 3W16A 5CF4A 4YTIA 4YLJA 1PKGA 2O64A 2F7EE 3COHA 4G6NA 5CSPA 1G8SA 3EOCA 4AP7A 2PVJA 2QR7A 4UMUA 4EJ7A 5LVOA 3Q3BA 1F5QA 2EXCX 2NRYA 2XRUA 4XV2A 5FBNC 4ACHA 3DXNA 3CE3A 3EB0A 4J71A 4EUTA 5A54A 1XH4A 2JAVA 2PZIA 1A48A 4K1BA 2RFEA 5L2TA 2PUNA 3EMGA 5AP7A 4U6RA 2PE2A 2RFSA 3RGFA 4NM5A 3BZ3A 4PMMA 4RX9A 4JAJA 3F2AA 2VU3A 2BPMA 4KBCA 4QTEA 5B2LA 2C1AA 3OD6X 5FDPA 2X2LA 4ALVA 5AAEA 3MSSA 4IHPA 4YHJA 4L52A 3ZM4A 3ZLXA 4CTCA 5GZAA 3RVGA 4ZLZA 4KNBA 4C2WA 1RDQE 5HNGA 2YZAA 3BHUA 3O0GA 3R9DA 2BKKA 2CNQA 5E7RA 2J51A 4L00A 3G33A 3RK5A 3EZVA 3O96A 4UBAA 3EFWA 3DPKA 3G6GA 2IEWA 2JD5A 3GGFA 4E5BA 2C6IA 4ERKA 4GCJA 4O4BB 4YURA 1JPAA 4FMQA 4CCUA 4EC9A 5HLWA 4J99A 3BIZA 3TT0A 2PY3A 4XH6A 3SD0A 1YXTA 1NA7A 1K9AA 5FXQA 3R22A 2OO8X 4F7LA 3BPRA 4I5MA 1TZDA 5HU9A 3ZHPC 4ZY6A 2G2IA 1BL7A 4YNOA 4ZSGA 5BYZA 3QRIA 5CZHA 3E88A 3MBLA 4FZDB 4L68A 4D1SA 5HO7A 2XAMA 2PZ5A 4J8MA 4DH5A 2OW3A 2NYAA 3AKJA 5BUJA 2YIXA 2W1EA 5E90A 4XYFA 5FTQA 2VTMA 2XKCA 4CG8A 2JITA 4PUZA 3RMFA 5CU6A 4ANQA 2PYWA 3GC7A 3ZLSA 2GMXA 2R0UA 1LEZA 3U4WA 5F94A 3IOKA 1ERKA 2C6KA 4EWQA 5FXSA 3W0MA 2WMTA 2CN5A 3EHAA 4KA3A 2RL5A 2CKOA 2XANA 3NSZA 3VS0A 5BVDA 3FLYA 2J6MA 1WVWA 2UW6A 2XNOA 5K4JA 4PY1A 3H30A 1T45A 3CKXA 3P5JC 4FV2A 4HZRA 3TV4A 1Y57A 4W4WA 1JBPE 3BYOA 2IZTA 2CJMA 3CCNA 3JY9A 4FSMA 3QQHA 1ZYDA 1OI9A 4H39A 5HQ0A 4L9IA 4MF0A 4CZYB 4S33A 5M56A 4C3FA 1BL6A 5B0XA 3CSVA 2XJ1A 4QP4A 4D2TA 4IWPA 3IW5A 4IX6A 2IZRA 3FAAA 3FWQA 3KVWA 3OCSA 4GT5A 5DR6A 5EHLA 2IW8A 3WE8A 4DINA 4EZ7A 5J7BA 5EM5A 2JKMA 3AC8A 3ZXTA 5FDXA 4FICA 2X7OA 5FXRA 2YABA 4X2JA 4HVDA 3EKKA 4M68A 4M14A 3VW8A 3VUMA 3C4FA 1V0PA 5AV4A 2J0LA 4R7BA 4AZSA 4QTDA 3TXOA 4Z55A 5IUIA 1OMWA 2QO7A 3VC4A 3R04A 4DHJA 4O0RA 2PZYA 3LJ1A 4UWBA 5M44A 3QQJA 4C37A 3AC4A 2AC5A 3VJOA 3I79A 3WE4A 2ITYA 2W9FB 4IM0A 2YM7A 3QC9A 4QMVA 1U54B 5CEMA 4ZSLA 2UW3A 1YOJA 4MXAA 1GIHA 3AD5A 3FMNA 4IB0A 4QPAA 5JGBA 3QHRA 4FI1A 4FZFB 4GYGA 4BTKA 3NAXA 3UOKA 3O51A 2VWZA 2OH4A 5HO6A 1J3HA 4F4PA 2IVSA 4JR7A 5EM8A 3EKNA 2BFYA 3QTSA 4KKGA 4HJOA 3A7IA 2Y4IC 4EHZA 3BGZA 3ZXZA 5JFWA 3UMWA 5JFXA 3DXPA 4KKHA 4WBOA 4WOVA 5J1WA 4WO5A 3FQEA 4GG7A 5L8LA 1ZYSA 3P1AA 2WKMA 2A27A 1UU8A 5C9CA 3BHVA 3K5VA 3NIZA 5CSWA 3F66A 3TACA 3VF8A 2IG7A 4UYAA 3D7TB 2YIWA 3ORIA 3RINA 3FXWA 3RPVA 1O6YA 3Q52A 5TR6A 1VYZA 2R64A 3OXTA 2WMUA 1ZARA 3HECA 1J7LA 4BDEA 4USEA 1OUKA 4TWPA 3U9NA 2GFSA 4AE6A 5HO8A 5IEVA 1Q24A 5AR7A 5DI1A 4F0GA 4M0ZA 4CEGA 3RI1A 5LVPA 5CVFA 2FB8A 2XJ0A 2YERA 4AQCA 3SW7A 4FTNA 5J9ZA 1WFCA 2QQ7A 4IH8A 4U0IA 5M09A 3OTVA 5E4HA 3OWKA 4YC6A 4O27B 5BNJA 2BTRA 3BL7A 4O4DA 4TWCA 2BROA 2PU8A 1XR1A 3QGYA 3C13A 4WHZA 3CBLA 3QRTA 5AM6A 1KWPA 2AUHA 2RFNA 5TKDA 3UO4A 3VN9A 3QCQA 4DDGA 1SVEA 3HV7A 5DA3A 2UZOA 2XA4A 4IWQA 5TT7A 4CLIA 5B7VA 1W82A 3BE9A 3HMMA 2W1FA 3KCKA 4AN2A 4BTJA 5BMSA 1M52A 3QQFA 4O91A 3RWQA 5JN2A 5C01A 2XM9A 3RWPA 3MYGA 3QA0A 3HEGA 1WBOA 4ITIA 3ZRMA 1MRVA 2GCDA 2GHMA 4N6YA 5CAOA 1RE8A 4L43A 3F9NA 1UKIA 3E8EA 4Q5EA 2B52A 2HZ0A 5KKRC 2BIYA 4DEGA 4PP7A 3R7GA 4AX8A 3R73A 3PPJA 5KNJA 4U80A 5H8EA 4YZNA 3G0EA 4CFVA 2C6LA 3SDJA 2YIQA 4DFXE 3U55A 1OECA 2J90A 4ZOGA 1TQIA 5BVWA 5ITAA 2OGVA 5I9ZA 3GU8A 4BRXA 1YHVA 2BILB 1YOLA 3OF0A 3HMIA 2R3JA 2ZAZA 3R9OA 4KUJA 3L8PA 4KRDA 4DGLC 5KMJA 1WBVA 4FUXA 2VAGA 1ZOGA 3F3UA 4FV3A 4FYOA 4TZRA 3QZGA 2ZM1A 2P3GX 4U41A 2I0YA 5BVKA 4LDTA 3TDWA 2IJMA 4RA5A 2WTKC 2WTKB 3C4CA 4IADA 1IR3A 4PMTA 4CVAA 4DTAA 3ZO4A 4HCUA 1FVTA 4FR4A 5C8NA 2JKKA 2Z7RA 5CSVA 4FEWA 5M08A 4BYIA 5K5XA 3VS1A 4NW6A 3MJ1A 3I5ZA 4DH8A 1JKKA 5JEBA 4W4YA 2EWAA 1GZ8A 3C9WA 3FI2A 5DVRA 3O23A 5E92A 5C4KA 3GB2A 2Q0NA 3PY1A 4EOMA 3VS4A 3FDNA 5E8TA 5CVHA 3S4QA 1FQ1B 3QTWA 1L3RE 5EK7A 5CEIA 3HKOA 4N4SA 3VHKA 3O7LB 2GSFA 5AP1A 3RZBA 4Z7GA 3ID6C 4FTJA 4V05A 4ALUA 4UZDA 4XOYA 2W1DA 3H0ZA 1KE5A 3HGKA 5E8VA 4L53A 2Y9QA 3OROA 4FTLA 4H1MA 3RJCA 2VTNA 3OY3A 5J87A 4TW9A 3Q5ZA 3ZC5A 3DBQA 1UNLA 4D2RA 5FTGA 2BAJA 2IN6A 3Q5IA 4AUAA 1VZOA 3C0HA 4JX3A 5HLPA 4CNHA 1XWSA 4NKSA 5EYMA 2H34A 1PMUA 3A62A 2EXMA 4IDTA 3ZONA 4CZUA 4FIGA 5D10A 4BI0A 3S0OA 4R6VA 4FOCA 3D5UA 4DG2E 4EUUA 3S00A 5LVLA 3KIOC 3OWLA 4AN9A 5IMXA 5AM7A 2QU5A 3GT8A 4AA0A 5HCXA 4AW0A 2B9FA 5BVOA 4OTRA 4OBOA 3V5PA 4M7IA 1JSVA 1ZOEA 3KRXA 5J8IA 2OH0E 4BF2A 5JH6A 3CGFA 3ZEPA 3CQWA 3DJ7A 3R63A 2W5BA 3A7FA 4L46A 3DKCA 4I21A 2IF8A 5EYCA 2XEZA 4C61A 3PA4A 3QUPA 1P2AA 1R39A 2Z7SA 2X0OA 3TI1A 2XK7A 3V04A 3ZU7A 4BDAA 2NO3A 4QDVA 2VO6A 2AQXA 3ENHA 4O2ZA 3D5WA 4EONA 4FYNA 2B4SB 1OPJA 2GNJA 3C0IA 3PXYA 3QL8A 4PDOA 4QP8A 3FMEA 4QP1A 2OXYA 4B0GA 4OGRA 4ZLYA 1ZOHA 4O86A 2OU7A 1LR4A 4IM3A 4FV4A 5ANJA 3QX4A 3SG9A 4AXFA 4RJ6A 3GVUA 1JVPP 2GQSA 2ZFYA 5GJDA 1ZLTA 1WZYA 5LMBA 3K3IA 4IX5A 4QMLA 4NM7A 4UWCA 3R8UA 5IH4A 3W2RA 3KRWA 4BR3A 4F9WA 1Q8TA 3MVJA 1W98A 3RAKA 2O65A 3IPHA 4O22A 5BYYA 2XKEA 3AQVA 3TIZA 5H3QA 2YCQA 4DDIA 1XO2B 2Z02A 3DLSA 4RG0A 3ROCA 3TKIA 4UY9A 4K6ZA 3C1XA 4RC3A 5AIKA 3NVKI 3PSDA 1MQ4A 4LG4A 3OOGA 3MGYA 3BV3A 4BL1A 4U8ZA 3SX9A 2YLFA 1Z5MA 3ZCLA 3UDSA 3T9TA 5A6OA 4ANBA 4FKQA 3E7VA 4K2RA 3AG9A 5CT0A 4BDFA 5HTCA 3QZFA 4U9AA 4XG9A 5I9VA 3IOPA 4II5A 3Q32A 4JS8A 3HZTA 2ITWA 4WNPA 4YTFA 1FGKA 2QOCA 2RSVA 4USFA 3MB7A 3E5AA 3CEKA 3GUBA 4I94A 4F7NA 4IVAA 4FIJA 3MH0A 1HCKA 4X2FA 1VJYA 3EL7A 3FL4A 4E73A 3O7LD 3MVLA 3R1QA 4EH4A 5HD7A 4O7YA 5J7HA 3O17A 2HOGA 3O50A 3TNHA 3PFYA 2EXEA 1BX6A 5HI2A 5F20A 4I6QA 1TQMA 5HBEA 2R3RA 3ZO1A 4ANNA 4C4FA 3GQIA 4B9DA 4N70A 5E8ZA 3VULA 1Q99A 1A06A 2C5VA 5CVGA 4ZTSA 4BIEA 3BWJA 4C4GA 4EK8A 3FLZA 3COKA 4QRCA 4O7VA 4H3BA 3MI9A 3OG7A 4RVLA 3W33A 4HNIA 2XARA 2RFDA 4ZP5A 5E91A 4ACMA 2ITTA 2PSQA 2YHVA 3LZBA 4C4EA 4BCQA 3F7WA 3FC2A 2WMWA 4EQCA 3UYSA 4GJ2A 4BCPA 4K18A 4X21A 5KZ0A 1U59A 4DEIA 1CKJA 4Y73A 2C5XA 5JT2A 4MNEB 2OJIA 5H8GA 3UQCA 1PY5A 3UDZA 2ZV8A 5CQUA 4BKZA 2ETRA 3KVXA 4O7SA 2P2IA 4FKPA 3M42A 3L9NA 2VO0A 3VIDA 4G9CA 4NUSA 3MA6A 1G8KA 4FE2A 2WMSA 1Q8UA 4FZAB 1I09A 5DOSA 5CSHA 2C6EA 5D7VA 4BWXA 4EH6A 5FEDA 5CXZA 3VBYA 5KX8A 2CKQA 1PXNA 4IIRA 3R9HA 4EYJA 4RPVA 2BHHA 3LFAA 2HZNA 4YPDA 4F1OA 3HV3A 5EG3A 2ITXA 2WQBA 4GK3A 4BCHA 4FSYA 4F6UA 2F4JA 4YJVA 3F5GA 3AXWA 5I0BA 1XH6A 3TYKA 3UG1A 2LAVA 3RPSA 4O7NA 3B8QA 4PPBA 3FY0A 4IC7A 4L7FA 3UIUA 3W55A 2C0IA 4FTTA 1WVXA 4ZMFA 4AA4A 4RIWB