3S3IA

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel triazolopyridylbenzamides as potent and selective p38 alpha inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
total genus 104
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3s3iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3s3iA01
3HZTA 2XNEA 3AC1A 4O83A 2XRWA 4GVAA 3LVPA 4U40A 3UOJA 3QCYA 4OLIA 3TNQB 5JKGA 1M7NA 3ZLWA 1MRYA 3W2QA 4NM5A 1P2AA 2XKEA 3Q5IA 2UW4A 2IPXA 2WMQA 4UMPA 5T68A 3Q6WA 2WMWA 1VYWA 3OW3A 4F9YA 5K4JA 3ROCA 4NIFB 4IHPA 4ZXTA 1W98A 4DYMA 3FPQA 4DH8A 5KZ0A 4BDBA 3EQHA 1B38A 2HELA 4DG2E 4YU2A 1AD5A 4AAAA 3MV5A 4IEBA 3DNDA 3K3IA 4QYGA 4EC9A 2VWVA 1FMOE 3E8NA 3P1AA 3U9CA 1LUFA 1YHVA 3OCBA 4AOIA 4YUQA 3RVGA 2R7IA 3R8VA 2YLFA 2ZV2A 4GFOA 4M66A 4I92A 1F3MC 4P2KA 2OJFE 3OCTA 3GBZA 2CGVA 5AIRA 3S00A 5E8VA 2O3PA 3IS5A 4W8DA 4ZTSA 3Q2MA 5EHOA 4B8LA 3KK8A 3UZRA 2F7EE 2ITOA 4D2TA 4QMWA 5J9LA 4PTEA 2X9FA 1KWPA 2B9IA 3RHKA 4XX9A 4BIEA 2JDRA 4IANA 3WE4A 2QO2A 4NTSA 4L6QA 4GFMA 4UMTA 4O0VA 4YLLA 5EW3A 4FEVA 2OO8X 3W2SA 4M0YA 3HYHA 4OGRA 1Y6AA 4YJUA 5KMOA 3R7OA 4LG4A 4AE9A 2OF4A 1ZWSA 5CASA 3P7BA 3MA3A 4MF0A 2GNLA 3DAEA 3TV6A 2ZV8A 5M57A 5CEMA 4XG8A 4AS0A 1PXKA 3EQCA 3TV4A 3EKKA 3LCTA 4N57A 1BUHA 3I0OA 1H1SA 2E2BA 3UODA 4ANOA 4NW5A 3BV2A 3OC1A 4BCMA 4GG5A 5EM7A 3EFJA 4C4JA 5AM7A 3IW8A 5KKRC 2WMBA 3HMIA 4GT5A 3UG1A 4FV1A 3CIKA 5C8MA 2GMXA 3ACJA 3QTZA 3TZ8A 4GFGA 5HIDA 1JKTA 4IAAA 4E7WA 3G9LX 4F7JA 4F6SA 4X3FB 3BV3A 5JQ8A 4X6QC 4A7CA 4QD6A 3R9RA 1JPAA 3ELJA 2QHNA 4JDJA 1H0VA 5CVGA 5DA3A 2IN6A 4XP2A 2PSQA 4E6QA 3VO3A 3RBWA 2C69A 2WELA 1IG1A 4BL1A 3SW4A 4AZSA 4QMTA 3LM0A 2YM6A 3ZONA 5JQ5A 5IQIA 3B2TA 1GIIA 2YJRA 3F66A 4KRCA 4IAZA 4HYHA 4NFNA 2V22A 2W17A 4AGDA 1WBSA 4XRJA 2X2MA 2HCKA 3L9LA 5IISA 3BE2A 3CY2A 2C30A 2ACXA 3G5DA 4YZNA 4NIFA 5K0KA 2ETKA 4MD7E 5K3YA 3UOHA 3GEQA 5EDQA 4NEUA 5ITAA 2VX1A 3D4QA 3CJFA 1BI8A 2OH0E 2F2CB 4A07A 3VUIA 4DEGA 4I5HA 2PMNX 3R8UA 2WO6A 4TWNA 4LOOA 4FV3A 4GYGA 4E8AA 1JKLA 4IJ9A 3E8DA 3QZFA 4ZOGA 4MQ1A 2I40A 3PA5A 3ZC5A 4R78A 4G6NA 1OVEA 4FEWA 3T3VA 1JSVA 5ETFA 4RVLA 5CT0A 1P14A 2HW6A 3REPA 3QQFA 4H1MA 1OKWA 4XOZA 2P2HA 2PVFA 1Q24A 2BDWA 4YJTA 3V5QA 4EUTA 3FMLA 4FT9A 4DLJA 2C0IA 3FE3A 4E5AX 4J8MA 4QMNA 3I7CA 2VN9A 3QALE 4IE9A 2XIZA 4E6AA 2BR1A 4M69B 2E9UA 5TE0A 3GB2A 3UO5A 3QHWA 4QQTA 1BI7A 4ZZOA 4IFGA 4V0GB 4NM3A 2YERA 5A4QA 1H1RA 5D41A 3RZFA 5CSVA 3NVMB 5E90A 5AR7A 1JNKA 3U9NA 2PE2A 4DH3A 4I22A 3QKLA 2GTMA 4PPCA 4RWJA 5DH3A 3R9HA 5EW8A 4YZCA 3VUMA 4BCPA 2YHVA 4DFYA 3DBQA 2HENA 3PPZA 4LRJA 3AD4A 2BILB 2PZPA 2J5EA 2CPKE 1XH5A 4NW6A 3QD0A 5IA0A 3FJQE 2A19B 3BI6A 5DEYA 4KBCA 3ZEWA 4KSPA 1KE7A 4FV9A 4UYAA 5CEPA 2CDZA 5AUTA 4DA5A 5CAUA 2GPHA 3MI9A 2GTNA 1K3AA 4NKSA 3WZEA 2F9GA 2G2FA 3DOGA 4RX8A 2IVSA 2XJ1A 5CYIA 5I9WA 3LFSA 5GZAA 2CCHA 2YEXA 4G9RA 3BHUA 4KRDA 2YACA 1ZYDA 4PPAA 3LFBA 4J1RA 4EKKA 1RE8A 4AXAA 2EXMA 2UW8A 4EH6A 5A3XA 3FC1X 3SXSA 2W5HA 3TTJA 3IECA 3LXKA 2FVDA 2XEYA 4A4XA 3Q32A 5JMSA 2W4KA 4O2PA 4LOPA 5M53A 3ATTA 4KSQA 4YHJA 5FTQA 3C5IA 5M4IA 3BGQA 1PXIA 4AG8A 3BYVA 2QOFA 5F95A 4HYUA 3WF6A 4C4FA 2W1HA 5EDRA 4FTUA 3C4EA 4RJ5A 3VAPA 5GIPE 2DWBA 3O17A 4DN5A 4BRXA 3EMGA 3SA0A 2GU8A 4FSWA 3JS2A 4RPVA 2CN5A 5AX3A 4K33A 2XIRA 3CR0A 4LFIA 3OEZA 2GNHA 5HG7A 5HICA 3DBEA 4QP8A 4DT8A 2JLDA 2E9OA 2YCFA 3MW1A 4QP2A 4A9TA 3OXZA 4D4SA 4FSZA 4O96A 3KY2A 4HVSA 4W4WA 4H05A 3EN7A 4C3FA 2C6MA 4RT7A 4EHZA 3LLAA 4N6ZA 2V5QA 3G33A 4OTQA 3O71A 2YM5A 4IWPA 2XNNA 1JLUE 1LEWA 5AEPA 1WFCA 1J1CA 4Y5QA 3KU2A 3GNIB 1UNGA 1YQJA 4O0WA 4M8TA 5BMMA 3UOKA 3A60A 4C3RA 3E5AA 4X2FA 1S9JA 5FWKK 3IGGA 3EL7A 4QP6A 5M4FA 4MXYA 1YXUA 5ETIA 3N4TA 3F7ZA 4HVIA 4CSVA 3SLSA 1SYKA 4IZ5A 1H25A 4Q2AA 2LAVA 3V6SA 3ZSHA 4S30A 4D58A 3SG8A 2JIIA 3EZVA 5BVOA 3ZTXA 4XG4A 1KV1A 2NP8A 4CT2A 2I0EA 2QOKA 3AC8A 4LM5A 4JL9A 3UP2A 1KOAA 4UB7A 4G3EA 4ANMA 1QMZA 4FZ7A 3QTRA 2EU9A 3KXHA 2QURA 4LL5A 3SG9A 5FLFA 1PF8A 1Q99A 4GUEA 3ZSIA 4CV8A 3OUKA 1U4DA 4FKPA 4FKUA 4FZ6A 4XOYA 2Z8CA 3W32A 3PXQA 4KKGA 4YMJA 4L44A 2VU3A 3LM5A 3UIBA 3OOMA 2ERZE 4X7QA 2XJ2A 4FICA 4FSYA 3OBGA 3VBVA 4G31A 4U9AA 5DPVA 4HW7A 4K9YA 2X8DA 3FLYA 4BWKA 2EB3A 3ALOA 3MFTA 4KUJA 3UIMA 4C4EA 4XMOA 2R0UA 3DDPA 1GNGA 4LYNA 4W9WA 4G17A 4D1XA 2QKRA 5J1VA 4WOVA 4FZFB 4D2PA 1F5QA 5HO6A 4P5ZA 4UMRA 2QU6A 3FEGA 3ENMA 3PJ1A 3TUCA 2XJ0A 2CGWA 3BYMA 2VWBA 3QKKA 4FKLA 4BN1A 3R71A 2XS0A 5HNIX 4USDA 3U51A 3IG7A 3NYOA 3GCSA 4KAOA 4BWPA 3WILA 5I9YA 1QPJA 1ZYSA 3EYHA 1OPLA 3PXRA 4FF8A 4OTPA 4ALWA 3TIYA 2W1CA 3MH2A 3ZFXA 4U97A 3QWJA 4BKZA 4KB8A 3EKNA 5CLPA 2W7XA 4UEUA 3L8SA 2QOCA 5M07A 3R9NA 2H8HA 2XBJA 1L3RE 5CNOA 2W0JA 4OUCA 3QTSA 3QZHA 4EOLA 5B2LA 5DWRA 5I0BA 5HX8A 4U3YA 2J0LA 5HI2A 1SMHA 3Q9ZA 3AXWA 4FG9A 3HRBA 4XV1A 3ZHPC 4C0TA 5KNJA 4ZAUA 5CU4A 5AR3A 5A4CA 3TUDA 4BKYA 3N4UA 3V3VA 4U8ZA 2B9HA 4MNFA 5TT7A 3RKBA 4R3PA 3VS4A 2Y0AA 4XV2A 1ZARA 2OJ9A 5DFPA 3TEIA 4I3ZA 5KMMA 4OAUC 3LFNA 5HEZA 1QPCA 4U5JA 4EH8A 2ITVA 5JRSA 2E9VA 3MYGA 4HGEA 4EH7A 2OXYA 4QYYA 3ORKA 1GZ8A 1Q8UA 1NVSA 2YFXA 3SDJA 2C5VA 2WAJA 4WRGA 4FTTA 3F69A 4JDKA 3DKCA 4QNAA 3ZRKA 1XJDA 2I1MA 1PMEA 1GIHA 3NUUA 3R7YA 5M08A 4FSNA 4XG7A 4ONAA 4HPUE 5JGDA 5AA8A 2PUIA 4MXAA 4KWPA 3PXKA 3HRFA 3MA6A 4C62A 4MCVA 4E73A 3MFRA 3LXNA 4M84A 4QP7A 2IZUA 4GS6A 4BCQA 5JT2A 4QMVA 4E26A 3MIAA 4XS2A 3UC4A 5L2SA 2VTTA 2IZRA 4E6CA 3O50A 3ITZA 4KKHA 1ZMVA 4W9XA 3L9NA 3TZ9A 3U55A 3O7LD 4ZJVA 2BIYA 2RG6A 1BLXA 1YOLA 5A4TA 3M42A 4L45A 2GHMA 3CTJA 4J7BA 5JK3A 4YZDA 4O7TA 1IEPA 5BYYA 4P4CA 5AUXA 5GIOE 3DCVA 4RG0A 4EH2A 2CN8A 4EWHA 3DXPA 5IH5A 2XIXA 5AV0A 4M0ZA 3R7EA 3RINA 2WMVA 4Z16A 3QA0A 3AC2A 4GK2A 4IX5A 1Q62A 3DK6A 2OJGA 3HMNA 4AZVA 4OTIA 1O6KA 3SXFA 4XNEA 4ZLOA 2UZNA 1Q8YA 3DKOA 4EL9A 2V7AA 1PMUA 2XYNA 4YTCA 2OIQA 2QOBA 4D4RA 3ZDIA 3NLBA 5LARA 2Y4IB 2Y4PA 5E8WA 4USFA 3MJ1A 3UQCA 2I7QA 5KBQA 5J8IA 5E7RA 3MJ2A 4MXXA 5D1JA 4FGBA 2QLQA 4O2ZA 5HGIA 5CSPA 3HAMA 1PXMA 1Q41A 3WZDA 5ANGA 2ONLC 3COHA 3LXLA 3NNUA 5K5NA 4TT7A 4KIOA 5HTIA 1J7LA 2VTAA 3BLRA 4ZTRA 3KXXA 4KS7A 4ZP5A 1XH9A 4O81A 4E5BA 2Y7JA 2PU8A 1GIJA 5IEYA 4ZSJA 2DQ7X 2W1IA 3C4CA 3UE4A 3GENA 5ANJA 5I9UA 3VS2A 2WTDA 4PL3A 3VQUA 3OY1A 4EOMA 3T8OA 4ERWA 3T9TA 4BY9E 4JG6A 1SVEA 5B2KA 1QPEA 4BB4A 3R9OA 2QI8A 5CXZA 2IVTA 5GJFA 2FSMX 3NCGA 4QMOA 2GQRA 3HP2A 4TNBA 2F2UA 3F82A 2AC3A 2XCHA 5LMAA 3DB8A 5M51A 4NZWB 4EK8A 3R1NA 4GSBA 1TKIA 2C0TA 3DFCB 5GZ9A 4BCJA 1V0BA 3ATSA 5DHJA 4DH1A 3V5WA 5IUHA 2JKOA 3D5VA 2QO9A 2QOLA 3R00A 4I5CA 4L42A 5EI8A 5L8JA 1R78A 1U54A 3IW7A 3VUDA 3VUKA 2X39A 3ORPA 4PV0A 3VULA 5DLSA 4FTOA 2XNMA 3O8PA 1DAWA 3JUHA 4YPSA 3FMJA 3FY0A 3ZM4A 4G3FA 1YWNA 1U46A 3C4FA 3OY3A 4GKHA 5ETAA 3QX4A 3F3UA 2WTKB 4GT4A 1XWSA 1YVJA 3QLFA 4HVGA 1G3NA 3C50A 2R3LA 3ZYAA 1PYXA 3QD2B 5L6OA 5CEOA 3LCSA 4M68A 4XLIA 1XH7A 5BUJA 1OB3A 4WHZA 5HU3A 5HQ0A 1H07A 5IA2A 5L2IA 4FSQA 2BRGA 1H8FA 1WBNA 2PVRA 2W4JA 2C68A 2JAVA 3KVWA 4NJ3A 2JITA 4X2JA 4XCUA 4J98A 4Y5HA 1HOWA 3P23A 3OOGA 4S32A 5HG5A 4BCIA 1TQMA 1REJA 3NDMA 1SNXA 3E92A 4HGLA 4M13A 3RMFA 1YKRA 2J6MA 4Y95A 4QP1A 3QWKA 4YC8A 4ARKA 3S95A 2VX0A 2WU6A 4WNOA 5BNJA 3UG2A 2HYYA 4DTAA 3S0OA 2OG8A 3HEGA 3H4JA 4TYEA 1WZYA 3MVJA 2DYLA 3GU8A 4RX7A 3TWJA 4F63A 3CLYA 1EH4A 4BC6A 1I09A 3MSSA 5C9CA 5JGAA 4FC0A 1MRUA 4AT3A 2WOUA 3HV3A 5BVEA 3NW5A 4OTGA 3VC4A 2PMOX 2ZDTA 3LFEA 4MD9E 1GJOA 1IA9A 4HJOA 1UNHA 1WVXA 4CMUA 4D4YA 5A4LA 3OCGA 2JC6A 4QPAA 3EOCA 3DGKA 3GXLA 3M2WA 4FTLA 2XIKA 2BKKA 4LMUA 5HIBA 3EWHA 3MH1A 2WPAA 3IW5A 3Q4CA 3ZLXA 1BX6A 4JRNA 4A9YA 5LWNA 3TZMA 5JZNA 3WBLA 3WF7A 3U6IA 3FMDA 2R4BA 4CMOA 3D15A 2QCSA 3KGAA 1MQ4A 4IVDA 4EQCA 3QD3A 3V8WA 3WZJA 1WBVA 2JKQA 4RC3A 3ODYX 3A8XA 3VRZA 4CCUA 5FTGA 2XCKA 4Z3VA 5KZIA 2BTRA 3GCPA 4WSQA 3R8ZA 4EJ7A 4OBOA 5C03A 3VUGA 3PJ8A 2GQSA 5CT7A 1MQBA 3AMYA 4WT6A 3IONA 4EKLA 5KX8A 3ZH8A 2FUMA 4D55A 3PXZA 3NUSA 2CHLA 3OZ6A 3IO7A 3BU3A 4ZIMA 5DN3A 4G9CA 5CXHA 5H9BA 4IDTA 4AE6A 3WIGA 1O6YA 2YISA 3QU0A 4EOSA 4ALUA 3LCOA 4CKJA 4LI5A 4WG4A 3ZXZA 4U79A 2CMWA 4X2KA 4E3CA 5ETCA 2EWAA 4U81A 2WQBA 3EQFA 4F7SA 2QNJA 2J0JA 4TYIA 2FSLX 5BVWA 3MH3A 4EZ7A 4UN0C 2RFDA 2G2HA 4MXZA 3Q52A 4QTEA 3LXPA 3QUPA 4O7NA 1J7UA 4FVPA 2HZIA 3WYYA 1ZOEA 3C7QA 2C3KA 3NPCA 3HUCA 4DG0E 2HK5A 3ORMA 3MY5A 4GK3A 3BE9A 3FYJX 2OU7A 1J7IA 3B8RA 4L7FA 1ZXEA 3RPYA 3RTPA 5CTPA 4FKJA 4G3DA 3IDCA 2RGPA 4X6RA 1OUYA 2QHMA 2YA9A 3F2RA 4DINA 5CNNA 2VTLA 2RIOA 4G1WA 2JAMA 4RSSA 1UWJA 4O21A 1Q97A 4L43A 3CKXA 3RPRA 3I5NA 4RIYA 4DAWA 3BHHA 1PW2A 3FSFA 4UALA 5I9ZA 1O6LA 5FXRA 5FP5A 2OF2A 2PVNA 2RFSA 5JH6A 1CTPE 4YSMA 3AMBA 4BBMA 5IA5A 3A4PA 2WMTA 2R3JA 3D5XA 3KMMA 3EHAA 3QQHA 4F4PA 4M7IA 2BAQA 2HXLA 1GZKA 5EM8A 3PY3A 4NCTC 5KHWA 4OBPA 1DI9A 4P7EA 4I23A 3HUBA 3UVRA 4EHGA 2CNUA 2UW3A 3KN5A 3HAVA 3ROYA 3VNTA 4JR3A 3R83A 5IQFA 3NAYA 4FL3A 3Q9XA 4F7LA 3NUXA 4X3JA 4BI1A 2NNWB 5I4NA 4GVJA 4RIXA 2Y4IC 4KIPA 3BELA 3TN8A 4HZSA 3HV5A 2WTVA 2WTWA 1YDRE 3E62A 2XMYA 1M2RA 1VYZA 1CKIA 2O64A 4X3FC 4FX3A 5HBEA 3R9DA 4Z7GA 3A61A 4GT3A 1UKHA 4ACDA 1WVWA 3OWJA 4NYEA 2WXVA 4H3PA 2VGOA 5BX0A 1STCE 3IK3A 3QD4A 4UXQA 4PDOA 4FNZA 3QCXA 2W5AA 4C8BA 2UZBA 3WARA 1OIQA 5HVJA 4LQMA 1Y91A 3D2IA 3T9IA 3Q6UA 2UW7A 4IWDA 4UWYA 5GZ8A 5EFQA 2ZV7A 2HW7A 1UV5A 2VO3A 5CEQA 3AC3A 4UMUA 4QP4A 5AR4A 1PMNA 2JDTA 5HE0A 4FV4A 2BCJA 2WOTA 4FYOA 3MN3A 3FMKA 1JSTA 4LOQA 3V5PA 3UNJA 3KEXA 4HNIA 5IQHA 2WGJA 4FG8A 4LGGA 3TCPA 4E4XA 2WB8A 3QUDA 2P55A 4IC7A 4AT4A 4CFMA 3Q96A 3QRUA 5CEKA 2OSCA 5CQWA 5B2MA 3HVCA 5DOSA 3CC6A 1W82A 5F20A 5GINE 3COMA 2HXQA 2OZAA 4IM2A 4F0FA 3K5VA 3PP1A 4GU9A 2ITXA 3LFCA 2HWPA 2GCDA 2QD9A 5KMKA 3N51A 3OROA 5DR2A 4ZSEA 1H28A 3IQ7A 1XH8A 4XG9A 1PXPA 5C1QB 2UVYA 4KBAA 2PVYA 1WAKA 2B55A 3NW7A 4I41A 4RIOA 4FSUA 3ZUUA 5EW9A 4ACMA 1P4OA 3VBWA 3RNIA 5EDPA 3UDBA 2QO7A 4BI0A 2BROA 3GCVA 4XJ0A 5DR6A 1PXLA 5AMNA 4EK4A 5A4EA 4BI2A 2A0CX 2OXXA 3RM6A 3WF9A 4X3FA 3AT2A 4UZDA 4YGAA 2V55A 5I9XA 4D2SA 5CAPA 4LGHA 4IZ7A 4C36A 2OZOA 3Q04A 1H08A 2R5TA 3L8VA 5EK7A 2H6DA 4M67A 4W8EA 5JSMA 5LVNA 1H1PA 3MB6A 4JAJA 4BDGA 4M15A 4RBLA 3SD0A 3OHTA 2UZUE 4BDCA 4WUNA 2J7TA 4FKWA 4RWLA 3ZS5A 3ORXA 5HCZA 3NIZA 3EJ1A 2R3RA 3QGYA 4PX6A 3ZZWA 3OTUA 5HZNA 4J71A 2NPQA 3PG3A 5C4LA 2BFXA 2FB8A 1KE6A 3QC4A 4PDYA 4E5WA 2ETRA 3R02A 4PMPA 3QBNA 5AX9A 2XKDA 3HGKA 1H26A 3LAUA 3FI3A 3D7TA 3HDNA 4YJOA 5DG5A 3SHEA 5AP2A 2I0VA 1XH4A 2C6KA 3TNHA 4YLJA 4AOJA 2B9JA 3TIZA 2UZDA 5J87A 3KF4A 2R7BA 3QZGA 2X7OA 3R73A 5E8SA 3QYZA 4HPTE 5AP5A 2H34A 4YC3A 5HKMA 4R5YA 3AG9A 2PY3A 4O7WA 4NUSA 2VZ6A 5AUWA 1PMVA 1HCLA 4BCOA 4EYJA 3O23A 4JRVA 4RJ3A 3MBLA 5HNGA 1OPKA 4AN9A 3CCNA 3SAYA 4FUYA 4P5QA 5EOBA 4RC4A 4EH5A 4AW0A 3FXZA 3W55A 4QTCA 3EZRA 4GUBA 4NU1A 3RAWA 3LMHA 1JVPP 2WTJA 3GI3A 4QTAA 4RRVA 4CLJA 5HU9A 5ANOA 3EB0A 4IB1A 2QOIA 4RVTA 3G6GA 4K0YA 3P7CA 4YR8A 4HCVA 2YITA 4IVBA 3CTHA 4FIIA 4U3ZA 3DZOA 2PZYA 5IKWA 5JFXA 2PE1A 3UVPA 4QRCA 3FI8A 5CVHA 3LKMA 4Z55A 5HD4A 2VWWA 4DFBA 4JBQA 4PF4A 4MNEB 1CSNA 5AFVA 3BHTA 5EYKA 3BBTB 5ANKA 5BYZA 5CWZA 3NVKI 3KXNA 3OBJA 4HCTA 3PSDA 2WMXA 3VWAA 3CD3A 3BU5A 4RJ8A 3FZSA 4DE4A 2C3IB 3QRJA 2WZJA 4HZRA 4JX7A 4BWXA 4CFVA 3PLAE 5LMKC 4N0SA 2OFVA 4QOXA 4CKIA 2IWIA 5FEQA 2PZRA 4ASXA 2Z7LA 5ANEA 2PPQA 2CJMA 3II5A 5FTOA 4ZTNA 5LQFA 3NEWA 5L6PA 4EOPA 3FMMA 4PL4A 2SRCA 4PWNA 4R1VA 4S33A 3BU6A 4O0SA 4HNFA 3F2NA 5HLPA 3EN9A 5AJQA 5AP1A 3TDWA 3EH9A 5TO8A 4AA4A 4I1ZA 4TRLA 2CSNA 4UZHA 4O22A 2WEVA 3TNPC 3DBFA 3G0FA 4IACA 4U43A 1ZAOA 3BPRA 4CFFA 5H8GA 2XRUA 4ZLZA 3W2RA 3N9XA 1OPJA 2YM4A 3GCUA 3NIEA 3NR9A 4D0WA 2J2IB 2Z02A 4WA9A 4M3QA 1J3HA 3CJGA 2WTCA 2CKPA 3VHEA 4XG2A 3SX9A 1KV2A 3FXXA 4GU6A 3LFAA 3OWKA 3R8LA 3RALA 5J9ZA 3ZOSA 2ITZA 3AQVA 3G90X 2FO0A 4QMXA 4N6YA 5DT3A 4DH5A 2B54A 3NUAA 4DF3A 2W9FB 4RFYA 4L53A 5F9EA 4J95A 1NY3A 3H10A 4BZDA 3BQCA 2JKKA 4FR4A 4II5A 1H27A 4K8AA 5IMEA 5KMIA 3OFMA 5AAEA 1NW1A 3LHJA 3F5GA 4FKOA 2IZTA 3O96A 5A9UA 3MY0A 4IJPA 2ZM1A 2B0QA 4MTAA 4HGTA 3GQIA 5EYDA 3F9NA 4CT1A 5C8KA 2OZAB 2F7XE 1ZY4A 4H39A 5C8NA 1XQZA 3CQWA 4AUAA 2LGCA 3NZ0A 4L67A 2VTPA 2XK3A 1UA2A 3OXIA 3FBVA 5DGZA 4C35A 3SOAA 3TNIA 5LOHA 1JKSA 2OLCA 3UMXA 3BBWA 3C4ZA 1U5RA 3KL8A 4CGAA 4FL2A 4R5SA 4E93A 5BVFA 4IZYA 5F4NA 4W4VA 3F61A 3CE3A 4FG7A 4C4GA 4FEQA 4DEDA 4GEOA 3W2PA 1PXJA 4YHFA 3F3VA 3H0YA 2KULA 3LIJA 3EQPA 4UYNA 2YABA 2VO7A 3QX2A 5A14A 3FMNA 3R22A 4D1SA 2Q0NA 4ANSA 2HIWA 3HRCA 2W1GA 4BFMA 3PE2A 5FEEA 3UNZA 5A6NA 2R3FA 2OIBA 4Q9SA 1A9UA 4RA4A 3PIXA 1TQIA 2XIYA 1OZ1A 2G1TA 3I79A 3MH0A 1OUKA 2RSVA 3EQDA 5EHLA 3FKNA 3QQLA 3ZBFA 3SVVA 4EJNA 3DZQA 3GC9A 3I7BA 3CSVA 4DFNA 4BZOA 2W4OA 2VWZA 4JNWA 3HL7A 4APPA 2C6OA 2BTSA 2ERKA 3HLLA 3MFUA 3PY0A 4KD1A 5CEIA 4AU8A 4D5KA 3PVGA 1M52A 4FMQA 5FRIA 2J0KA 1ZZLA 4FT3A 4QO9A 2BRHA 3PZEA 1GZOA 4G6OA 4CZTA 5IEXA 3AGLA 4WBOA 4J96A 3DTWA 5KHXA 4IX4A 5TR6A 4BCGA 3NUNA 4MVFA 5BYLA 2HY81 3IW6A 3KULB 4FTCA 1IASA 3ID6C 3AGMA 4U6RA 5H3QA 3VF8A 3VJOA 2C6LA 4JBPA 2WU7A 4EBWA 3HNGA 2AC5A 4UV0A 3ET7A 2VTQA 1Q8TA 3RI1A 3U87A 2QOHA 1DS5A 1PJKA 3ZU7A 3ERKA 4K2RA 3FSKA 1K9AA 4F99A 4FKTA 5L2QA 2Z2WA 5L8LA 4FT5A 5GHVA 3JXWA 4AQCA 2YJSA 5FXQA 3UP7A 2PUPA 3R6XA 2YAKA 3QCQA 3F5UA 3BGPA 1W83A 4MWHA 2BAJA 4BHZA 2F7ZE 2R3OA 5K0XA 3OUNB 2QODA 3UOLA 2GHLA 4C59A 3ZBXA 3KF7A 3PVUA 4FTQA 3BRBA 1YI4A 3KRJA 4NCTA 5CU3A 5GJGA 5B7VA 3P7AA 4BDDA 1VJYA 3R01A 1YW2A 3WE8A 1CKJA 4EZ5A 4LUEA 4IAYA 3W2OA 3V6RA 5LMBA 4Z9LA 5M44A 3Q3BA 2GQGA 3BYOA 4ZY6A 5T3QA 3ZO3A 5AP0A 4APCA 4O84A 4FZAB 4JAIA 2PZIA 4NSTA 5IEVA 1PKGA 2BRBA 5AUUA 2XB7A 5L8KA 2PWLA 3F5PA 4AFEA 1ZZ2A 4GK4A 1ZMUA 2J50A 1ZYCA 3PJCA 1VR2A 2ZV9A 4PMTA 3Q5ZA 2JDVA 2XK9A 5CU2A 1PKDA 2X0GA 2VTRA 3NW6A 3PFQA 5D11A 1Z5MA 3MIYA 3FI2A 2PTKA 4X21A 3NCZA 5D7VA 5E8XA 3TKIA 4AF3A 4LRKA 4CTCA 4ZK5A 4IAKA 5IQDA 4ANNA 4F9WA 1RDQE 5EKOA 3R1QA 4O6EA 3CBLA 2BALA 3DQWA 1XKKA 2UW6A 2REIA 4FNWA 2ETMA 4CQGA 2YM8A 3FLQA 1CKPA 4B8MA 5IH4A 3E87A 3W8QA 5C26A 5L2TA 4J52A 4TWOA 3QTXA 2VTOA 3PPKA 3KRLA 4NL0A 5K4IA 3CD8A 3CXWA 3DAKA 4JQEA 5KMJA 4E1ZA 4XP0A 1MP8A 2G15A 4TPTA 3EFLA 4FIGA 4TNDA 3U4UA 1OL6A 2WQMA 4O38A 4PPBA 2ITYA 4O7YA 4U0IA 4BTJA 4R77A 2BUJA 2O5KA 3QRKA 1WBPA 4CEGA 2WFYA 1CMKE 4PY1A 4JDHA 4DGNA 3PPJA 3W16A 4GCJA 1Z9XA 4GH2A 4W4YA 3GOPA 3P08A 2EUFB 4FUXA 4WUAA 4L7SA 2E9NA 3DJ6A 4ZSAA 1SM2A 2VO0A 3CGFA 4TN6A 2PVHA 2F4JA 2XNBA 3EQGA 2VNYA 4G34A 4BDAA 2ZM4A 3UPXA 2P0CA 4XBRA 3GT8A 4ZSGA 1UNLA 2UUEA 4TYHB 4IXPA 3T3UA 1DI8A 4F9BA 1PY5A 2H96A 4ZZMA 2X6DA 3FHIA 3FQHA 3Q9WA 3RJCA 3PWYA 2XKCA 4ASEA 4EHVA 3R1SA 2VWIA 5H2UA 3AMAA 4I4EA 5L2WA 2GDOA 2C5YA 3PA3A 2BAKA 4JT3A 1H0WA 1ZYJA 2PYWA 2YDJA 3WF8A 4FA2A 2QR8A 4U41A 5TOZA 4J97A 4XUFA 4EQMA 4IQ6A 3KFAA 4RVKA 2HZNA 3QUEA 3K54A 5CF8A 2YDIA 4IWQA 2GS2A 3EQBA 4C2VA 2X2LA 4J53A 4Q5EA 2QLUA 3FY2A 3GC0A 2VO6A 4IW0A 2C4GA 1YHSA 1I44A 2VNWA 2WQNA 3O0GA 4D9UA 2QOQA 3TV7A 5JZJA 4E4NA 4AWIA 3L1SA 4Y73A 4ZS0A 4EH3A 2R3HA 4DT9A 4ZTMA 5C01A 2OK1A 3PRFA 4R7HA 4TL0A 2GNFA 4I24A 3FMEA 4RZWA 4YC6A 4YJQA 5AM6A 3TNWA 4AN2A 5JFWA 4MD8E 3ORIA 4Y46A 1SVGA 2HOGA 5DI1A 3RAHA 3R1YA 2C47A 4EORA 2PMLX 5A6OA 2G01A 5IQCA 4AFJA 4BCKA 2YCQA 3HMPA 3ZMMA 5IA1A 4K77A 4FIJA 5DE2A 3W2CA 2QQ7A 3QQKA 4BYIA 2PMIA 4CFWA 4RIXB 5CENA 4IDVA 2O8YA 3RCJA 2CLQA 3VQHA 5CALA 3JR1A 2J4ZA 2VUWA 4ORKA 3TDVA 4QMMA 4F08A 3D94A 3QLGA 4L01A 1WBOA 3G6HA 5E92A 4AA5A 2WIHA 4Y72A 5KE0A 3UVQA 1R0PA 2XK8A 2ZJWA 4V05A 4C4IA 2QC6A 1QL6A 3QCSA 2JFMA 2ZVAA 5AV2A 1ZOHA 5J7BA 3A4OX 5AAGA 4FVQA 3Q4UA 4GIHA 5IDPA 1YI3A 4O7SA 2ZYBA 3V51A 3DLZA 2YIYA 5KCVA 4OTDA 3G51A 1BYGA 4N4SA 5M4CA 1M2PA 2QKWB 3Q9YA 2X4ZA 3PJ3A 4H3QA 1LP4A 5ANDA 4ZMEA 3ZRMA 3H9RA 5HLWA 5KKRB 4RX9A 3QFVA 4AZTA 3UIUA 1OL7A 4JBOA 3RWQA 3JY9A 4JVGA 5LCJA 5E9EA 4QPMA 3NMUF 5J95A 5AV4A 3R30A 3PSCA 5IZFA 2XKFA 4C02A 3I6UA 1M17A 4DTKA 3QRIA 1JAMA 4FIHA 3ZZEA 2C0OA 3NUPA 2ZB0A 3A99A 3O51A 3ZDUA 4IX6A 4AACA 4V0GA 3VJNA 2EB2A 1FGKA 3DB6A 4I0SA 1LR4A 4IB5A 5DRDA 3W8LA 3FZOA 4D2WA 4HVHA 1Y8GA 2UZWE 4JG7A 3R28A 3FQSA 3HP5A 4MHAA 3ULZA 1ERKA 2YIWA 4H58A 5J1WA 4DBXA 1A48A 5HE1A 2GFCA 2V7OA 4O1PA 3ZLYA 2WMSA 3BIZA 3DU8A 3KRRA 5DEWA 4I4FA 3P79A 4KIQA 2YM3A 4BDHA 3V01A 4BHNA 1XBAA 2PL0A 1PRYA 3VBTA 1GY3A 1RQQA 4L52A 4YURA 2WEIA 3KULA 3NX8A 4NK9A 4YTFA 3H3CA 5HE2A 2IZSA 1OGUA 2X2KA 5D10A 1A06A 2BDJA 4L68A 4IC8A 3UIXA 3NRMA 4YZBA 3I6WA 3PVWA 3HA8A 3FZ1A 3NNXA 4ZJJA 4CRLA 4Q9ZA 3E8CA 4X0MA 3MVMA 4ALVA 5CSHA 1H24A 3SXRA 2JIUA 4O6LA 1FVTA 1VZOA 3E3PA 4LL0A 4RJ4A 3F2AA 4GRBA 4WKQA 5BUEA 2Z60A 5LMKA 3TACA 2Y6OA 4AGWA 4TYHA 4AOTA 3PVBA 2PUUA 4AW5A 3NGAA 4IVCA 3BCEA 4AGCA 2FSOX 2X6EA 1DM2A 3P0MA 3R63A 5BPYA 1YOMA 3K3JA 4WNMA 4U80A 4FIEA 4PDSA 1SVHA 3HV7A 5M55A 3VUHA 4QMQA 3R8PA 1WVYA 3AD6A 4R7IA 4FYNA 4B99A 3BLHA 4EC8A 5IMXA 3W18A 3KRWA 1OKYA 3IOKA 3MPMA 4DCAA 4MBLA 2XVDA 3TJDA 2O2UA 5EYCA 3FYKX 4N70A 1XR1A 1Y8YA 3P4KA 5C4KA 5HHWA 1RW8A 4RGJA 2XM8A 4FK3A 2VTHA 4RMZA 4C37A 5M4UA 3DKFA 1XO2B 5DBXA 2OGVA 4BDKA 4RJ6A 2WTIA 4ZLYA 3UZTA 2I0HA 1CDKA 4IIRA 2UW9A 5HD7A 5IF1A 3KXGA 3VHKA 2GHGA 2WIPA 2P2IA 2XNPA 3E8EA 3UJGA 4I93A 3UQGA 5JFSA 3M11A 2UZEA 4CFUA 1E9HA 3FZTA 3V04A 2X1NA 5HCXA 1MRVA 5IG1A 2O0UA 3DAJA 5H8BA 3RPOA 2UZLA 3JVRA 2C5OA 4FTNA 4F6WA 1Q3WA 5CF4A 3RAIA 4WD5A 3NNVA 4J99A 1FOTA 5EHYA 3ZFYA 4NWMA 2BMCA 5FP6A 1URCA 5EQPA 4CV9A 5A46A 5CU0A 1W0XC 4FSRA 5I5ZA 5EKNA 4MBJA 2JDSA 4D0XA 1Q3DA 4NM0A 5AR2A 1JBPE 5CY3A 3IW4A 5L6WL 3C4WA 4DGGA 4TW9A 4C33A 5JEBA 3LPBA 4PDPA 4MF1A 3G0EA 1U5QA 2YZAA 4MBIA 2IVUA 3FPMA 3R21A 3D5UA 4JDIA 3HV6A 4QMLA 2PZ5A 3E3BX 4O0YA 2BZHB 3F5XA 4OT6A 3WOWA 4EUUA 3O8TA 4W4XA 1Q4LA 2WMAA 1NT2A 1YXTA 3IDPA 3R2BA 3HKOA 3L8XA 5J79A 3TG1A 2FYSA 4CD0A 5CU6A 3THBA 4E20A 2UVXA 3A7FA 2RG5A 4MYGA 4E4MA 2X7GA 2VD5A 2YIQA 4CFXA 5EQEA 4QT1A 2X8EA 4PTCA 2RL5A 3EL8A 2PE0A 3QC9A 4QP9A 2X9EA 3CP9A 3ZCLA 4L00A 4R3RA 2OWBA 5E1SA 5FDPA 2ZOQA 4NT4A 4AX8A 1G5SA 1OECA 4DC2A 1W84A 3SOCA 3Q60A 3PUPA 3GU6A 4A9SA 4BTMA 4CNHA 3FLNC 2Y6MA 2PVKA 4D9TA 3TUBA 3CEKA 3KREA 2BPMA 2P33A 3FKOA 2R3KA 3ZLSA 3BQRA 3ORNA 3V5LA 5CF6A 4F9CA 3LFFA 4EYMA 2VV9A 3QQUA 4FVRA 2IVVA 4QYHA 4IB3A 1K2PA 3ETAA 3QHRA 5IA4A 5J9YA 3VUTA 2HY0A 5LVLA 5EM6A 1UU7A 3P5KA 4Y85A 3RK5A 4QQJA 4EOOA 5J5TA 3D5WA 4WNPA 3ENHA 4BIDA 3VBQA 4J8NA 2R0IA 3TJCA 1QCFA 2XH5A 3OMVA 2PVMA 4DH7A 2IO6A 2VTJA 4FOCA 5HE3A 4LMNA 2GS6A 3LOKA 5AV1A 3V8SA 4BGGA 4EONA 3L9PA 3NYNA 3UBDA 4FKGA 4EBVA 3CGOA 4LUDA 5D9HA 3RPVA 3ZC6A 4ZMFA 4BVUA 4I5MA 4C3PA 1Y57A 3S2PA 1Q5KA 3OVVA 4I6FA 4TKSA 4EWQA 3LJ1A 4GG7A 4MEDA 4WIHA 3WYXA 2JFLA 3C9WA 4OBQA 4ZEGA 5IDNA 4BCHA 3ODZX 5CSWA 2JEDA 5HCYA 3U4WA 1YXVA 4ACGA 3ACKA 4CG8A 3VF9A 4S34A 3PDTA 4ZY5A 4YLKA 4E4LA 5CI6A 4DHFA 3NNWA 3JYAA 1BL6A 5FD2A 4F1MA 1S9IA 4D4VA 5FM2A 5JFVA 4FZDB 3DV3A 3PE1A 3UYSA 4YJNA 4KS8A 2F57A 1XH6A 3VRYA 3TZ7A 2CCIA 5HNBA 4G5JA 3VS3A 4YO4A 1B6CB 4DEBA 1H4LA 4O82A 3TT0A 3M1SA 2ITUA 3SC1A 3D2KA 5TKDA 3IDBA 2BFYA 4RLLA 5JN2A 3NSZA 5KUPA 1XBBA 3AT3A 4FV7A 1J91A 3H9FA 5BVKA 3VBYA 3MESA 1V1KA 3DT1A 1BKXA 1WMKA 4FI1A 3C1XA 4ITIA 1BMKA 3VBXA 4ENYA 4AT5A 5E91A 1H01A 2YN8A 2BHHA 3A7IA 3RP9A 3BHYA 3POZA 4XHKB 4AA0A 2VGPA 5ACBC 4ACHA 4TTHB 4LV8A 3NS9A 4PQNA 4RVMA 1OMWA 4O27B 3LJ2A 2A2AA 4R8QA 4A4OA 4F65A 4KIKA 5IA3A 4HOKA 4FSMA 4EOKA 4DGLC 3R7VA 2IJMA 5AV3A 3COIA 5HG9A 3HECA 2J51A 4DCEA 3BZ3A 4MH7A 3BGZA 1CM8A 4DITA 3QXPA 3U6HA 4ASZA 4ZZNA 2CKOA 3DTCA 4IM0A 2C5XA 2C6TA 3A8WA 4AN3A 2QG5A 2ITWA 4R3CA 2GNGA 1JKKA 3DNEA 3LJ0A 4QYFA 4RA5A 2EXEA 5D7AA 3ZUVA 3VS1A 4G16A 3Q4TA 1GOLA 5F94A 5E4HA 4BICA 3C13A 4RQVA 2YIRA 4OW8A 3U8WA 4EEVA 1WBWA 4JJRA 4OR5A 5T6KA 2YDKA 3FDNA 3PG1A 3EN5A 4UXLA 1R3CA 5J7HA 4XH6A 4B7TA 4DEEA 3TM0A 3FKLA 4XG6A 5FBOA 4PMMA 1O9UA 2PK9A 2NRUA 3UNKA 4O91A 4F09A 2A27A 2AYPA 4JLCA 4RX5A 4WG5A 4FT0A 4H36A 1TVOA 1HCKA 4L9IA 4CFNA 4NH1A 1YHWA 3MWUA 5AIKA 5DR9A 2QVSE 4FKRA 2W9ZB 4QYEA 4XEYA 2YCRA 2BZIB 5AP6A 4FTRA 4I21A 4TXCA 3CPBA 1R1WA 4O0XA 5HO8A 2R3IA 5CZHA 3OEFX 1AGWA 4JS8A 1Q8ZA 3F3ZA 3ORLA 4UY9A 5LWMA 5AWMA 5FGKA 3POOA 3UZPA 3OCSA 3NWWA 2W1FA 4GIIA 2BRMA 2XBAA 2RFEA 2XUUA 2ZMCA 3ULIA 1G8SA 4U42A 2B53A 4PMSA 1M14A 3QL8A 2J9MA 5AAFA 1KUTA 4RIYB 5L3AA 3R2YA 3G15A 3C0IA 3A2CA 4FTIA 3VVHA 4IFCA 2CGXA 3PLSA 5B0XA 2J5FA 3V5JA 4EZ3A 4O7RA 5HOAA 1UU8A 2WHBA 5CF5A 3PXYA 2VTMA 4K1BA 4QMUA 1IAJA 4C4HA 2OW3A 2PVLA 4PP7A 3DS6A 3GU7A 4QP3A 3QGWA 5EI6A 3P86A 3QTWA 2ITQA 4D2VA 2QOOA 1WBTA 2CNVA 3V8TA 2GFSA 3FZPA 2WMRA 4FTAA 4OT5A 4GL9A 1FVRA 5L4QA 3DFAA 4UWBA 2V0DA 3DK7A 2UVZA 3ANRA 3ANQA 3DJ7A 4QQCA 4YJRA 3BWFA 5FG8A 2CNQA 2XNGA 4B9DA 4EHEA 4CRSA 5JRQA 2WQEA 4UWCA 1Q8WA 1UVRA 5IQBA 1OIUA 5K5XA 4F0GA 4JQ8A 1W7HA 3JVSA 3DJ5A 5AUYA 4OAVB 3LFDA 2YIXA 3A62A 1M7QA 5I3OA 3ZO4A 3QTIA 3QAME 1Q61A 5DNRA 3SRVB 4EK6A 4LRMA 2BZKB 4DLIA 5BMSA 5LJJA 3LMIA 5LVOA 4GYIA 4FNXA 1WCCA 2I6LA 3PWDA 4OTHA 3HV4A 3QKMA 3PRIA 1OIYA 2XP2A 3EQRA 3OT3A 3GU5A 4XRLA 3VS5A 4IX3A 3TL8A 3FL5A 5IUGA 3CPCA 3CKWA 3PY1A 3RAKA 4HYSA 3PJ2A 3EQIA 5HBJA 3FI4A 3I81A 4ZTLA 4JIKA 4TYGA 3V5TA 4BBEA 5FBNC 4WNKA 5BQ0A 5C27A 3DLSA 3QF9A 3QRTA 3DY7A 3VS6A 5AADA 4TWCA 1ZYLA 3WI6A 4ANBA 1URWA 3SV0A 2R64A 4WG3A 4BGQA 1Y6BA 3GFEA 5EI2A 2XF0A 5J5SA 4B4LA 3UQFA 2XA4A 4HGSA 4O86A 3H30A 4Z7HA 4YJSA 5IU2A 3FLWA 3LQ5A 4G6LA 5LVMA 3MPTA 4ZTHA 3UMWA 3CS9A 5D12A 4XYFA 2VAGA 4FV8A 3W10A 3VW8A 2XZSA 5EOLA 4BCNA 4I5PA 3GGFA 1U54B 3CY3A 4O7VA 3BHVA 4QTBA 3QYWA 3D0EA 4JIAA 3CQUA 4YP8A 3DA6A 3COKA 5HORA 3P9JA 3VS7A 3KKVA 3LE6A 3IKAA 3KMWA 2VTNA 3BYSA 3FZRA 4JXFA 5CI7A 4BDEA 3E88A 4H3BA 1X8BA 3BWJA 5FXSA 2IG7A 2ITNA 2B52A 3E7VA 1KE9A 4FOBA 2X81A 4CYJA 1SNUA 4NM7A 4Y83A 3I4BA 5EG3A 3WIKA 3UYTA 1QPDA 4F6UA 1P5EA 2QR7A 3AT4A 3OTVA 3LW0A 3BLQA 2YLEA 4OTFA 3HDMA 3C0GA 2R3QA 1ZLTA 2DS1A 3OG7A 4C34A 2Y9QA 4FT7A 3GC8A 3A7GA 3KCFA 1OKVA 3L8PA 4ITHA 4QTDA 4A06A 5LXMA 3I60A 3E7OA 3H9OA 3MVLA 4BGHA 5LVPA 2WMUA 3HA6A 1KE5A 4BTFA 1FBNA 2WKMA 4FTKA 2JBPA 4WO5A 1H00A 4DGMA 3D7ZA 1FINA 3F3TA 4R7BA 4MXOA 5DRBA 2B4SB 2FA2A 4XBUA 1L8TA 1PYEA 4IH8A 3I0QA 1NXKA 1R0EA 2W05A 5DT0A 1OM1A 3R7IA 4EK3A 2X4FA 1OKZA 3UC3A 2UZOA 3A7JA 3KCKA 3B2WA 2PVJA 4YO6A 1XHAA 4K6ZA 4DEHA 5EH0A 2GS7A 3KXZA 4FEXA 4RIWA 5CSXA 2C3LA 4O7ZA 4V01A 2VWYA 3E63A 3GQLA 5M06A 3EYGA 4YJVA 4MK0A 5CVFA 1FMKA 3A7HA 3RWPA 1OL2A 2WD1A 4MQ2A 3RZBA 1REKA 2OBJA 4NFMA 2ITPA 3UGCA 4FKIA 2VWUA 4M14A 2W96B 4IZAA 3LCDA 4O0RA 3C5UA 3VIDA 3WF5A 3G2FA 1F0QA 2PHKA 4YBJA 4RLKA 1UU9A 2J0IA 4FIFA 4F0IA 4CZUA 4CLIA 3UO4A 4MKCA 3DBDA 3AOXA 5KBRA 2AUHA 2BDFA 2VTIA 5IH6A 4I6BA 4QMZA 1KE8A 3DBCA 3K2LA 1DAYA 4ASDA 4AGUA 4C57A 4BTKA 3FL4A 4RFZA 3VW6A 3KRXA 4K11A 3OP5A 1YOJA 3SGCA 4FTJA 4MNEA 4BDFA 1IRKA 4F9AA 5TF9A 2J0MB 1OBGA 2PULA 4PTGA 4DFUA 4L3LA 4LGDA 3TI1A 4DTBA 2H9VA 2VX3A 3AC5A 1OL5A 3CQEA 2Z7RA 5HVKA 3LQ8A 2GSFA 4FKSA 3TKHA 4R1YA 3L9MA 4BZNA 3ZXTA 4EQUA 3FHRA 3UTOA 1YXXA 4FV0A 2XEZA 3LLTA 4A4LA 3LZBA 4ERKA 4X2NA 2BVAA 4XG3A 4CXAA 2G2IA 4U45A 4I0TA 5CAQA 4WBBB 4MAOA 5FUTA 5M09A 2J90A 2JBOA 4L8MA 4QMSA 3TTIA 5HO7A 4PL5A 4YBKA 4FV5A 3BYUA 3QTQA 1RJBA 3O8UA 2W1DA 1P4FA 5EM5A 2QG7A 5EQYA 2CKEA 2R3PA 3EFKA 4JG8A 5E1EA 4BCFA 4K18A 1G8AA 2CLXA 3D14A 3F6XA 3HMMA 4XV9A 3CTQA 2YCSA 4QPSA 5KO1A 1TQPA 2ESMA 3DDQA 3IGOA 2OXDA 3KA0A 3FV8A 4C2WA 2QONA 5ACKA 4WSYA 3LCKA 4IWOA 5DT4A 4D28A 4OTRA 4V04A 4G5PA 4IADA 3GVUA 1YDTE 4KINA 5A54A 4Y8DA 4EOIA 3KB7A 4CMTA 4I94A 4ANQA 5AUVA 2OICA 4U7ZA 1ZY5A 4HYIA 3GP0A 1OITA 1APME 2O63A 3PXFA 3FQEA 3U6JA 4BIBA 3C51A 2EXCX 1XBCA 4AP7A 4I6QA 5HTCA 5IUIA 3FLZA 3IPHA 5M56A 3E64A 3R0TA 3WZUA 1ZRZA 3Q53A 3W1FA 2W5BA 3FAAA 2VTSA 4IBMA 1YRPA 4MWIA 4XLVA 4PP9A 2P4IA 3D9VA 4HVDA 2UV2A 3PSBA 2OIDA 4YZ9A 4RQKA 3PYYA 4F1TA 1KSWA 3OW4A 4TY1A 4YTIA 4IM3A 3U54A 3K5UA 4H1JA 4EI4A 4FE2A 2UZVA 2W1ZA 5H8EA 4AW1A 4F70A 3KXMA 3MB7A 3D7TB 5FEDA 3KMUA 2Z7QA 3R7UA 3QTUA 4G2FA 5CAOA 1YDSE 2Q0BA 1AQ1A 3G9NA 4FL1A 4YNOA 4YHTA 1ND4A 5LCKA 2OJJA 4NJDA 4PRJA 4IVAA 3TKUA 4IMYA 4NKAA 3LQ3A 1OBDA 3JY0A 5CANA 4F7NA 2C1AA 3RM7A 3DKGA 4BDIA 5HTBA 4RC2A 4AZEA 1ZMWA 4MXCA 4G3GA 3HX4A 3I5ZA 4O7LA 4I0RA 2UW5A 4FKQA 5HVYA 2UZTA 4CQEA 4GKIA 4S31A 2ITTA 4YZMA 4R6VA 1W8CA 4EOQA 3S1HA 3MGYA 1JQHA 2HWOA 3PIZA 4FV2A 4A9UA 4EOJA 4D2RA 4XV3A 2B7AA 2OJIA 3MTFA 4C61A 3ZO2A 2FSTX 2GNJA 4TZRA 3OS3A 3R04A 4NTTA 2GNIA 2IW9A 1E1XA 4YSJA 2OKRA 3MFSA 2XK7A 3MTLA 2I0YA 2XNOA 2B9FA 3AD5A 3C4XA 4RWKA 5CZIA 3PTGA 4GJ3A 4AZFA 5IQAA 2P3GX 3QA8A 5AA9A 2VRXA 2C1BA 2CGUA 4E6DA 4C58A 3RHXA 3RK9A 2YWVA 4B6LA 3D83A 3SRVA 1SZMA 5KMNA 3DK3A 1YI6A 4USEA 2Z7SA 3F3WA 1ZOGA 1MUOA 3QZIA 1NVQA 4RFMA 1JOWB 5BVNA 2WTKC 4M69A 1FGIA 2A4LA 4ZJIA 2JGZA 3ZO1A 5I9VA 4QQ5A 2R9SA 4FV6A 4CVAA 1T46A 3FLSA 3W33A 3NYVA 4OTWA 3MY1A 4DFZE 2FGIA 3GCQA 1H1QA 4ZTQA 4JX3A 2IW6A 4TWPA 3PIYA 5F1ZA 3C0HA 3WZKA 3LFQA 2XK4A 4YTHA 3P78A 2RFNA 2X7FA 5EYMA 2HZ0A 1IA8A 4PUZA 4IAFA 5K9IA 4EH4A 2RKUA 4ITJA 5AP4A 5GJDA 3E93A 1LPUA 4Q5HA 1FPUA 4KIKB 2CKQA 3Q2JA 1PHKA 2HAKA 4UBAA 3LMGA 3N4VA 4FSTA 4FNYA 4IAIA 4QMYA 3RGFA 3MPAA 3PA4A 2JDOA 1YWVA 3SKCA 3ZRLA 3FC2A 4ACCA 5AP7A 4M12A 3MS9A 5AUZA 2W1EA 5FQDC 3DXQA 5DIAA 3NYXA 4KABA 3OWLA 2BRNA 2BZJA 1IAHA 3KVXA 3KQ7A 2R3MA 4DEAA 1ATPE 4S2ZA 2FH9A 3OWPA 3TXOA 4CTBA 3EN6A 3EFWA 5ICPA 4CKRA 1JSUA 2WQOA 3FUPA 3QQJA 1JWHA 2W99B 5CAVA 4FEUA 4ENXA 5G6VA 3KC3A 2OFUA 5IPJA 4U44A 2JIVA 2A1AB 2OH4A 4GMYA 5HX6A 3R7GA 1V0OA 4CYIA 2QU5A 4WRSA 3DQXA 3PP0A 2E9PA 4KBKA 2R3GA 3I1AA 3NAXA 4IB0A 4PNKA 2F49A 2BHEA 3BKBA 4YJPA 4M97A 2Q83A 3R8MA 5E8TA 3UPZA 5HG8A 3F88A 3RPSA 1UWHA 4L46A 3DPKA 1J1BA 2C5NA 1YXSA 2OI4X 2BKZA 3BX5A 4D1ZA 4JOAA 5IQGA 2EVAA 2WNTA 2ZDUA 1BL7A 4HCUA 4P90A 4ZY4A 4QNYA 3ORZA 4KNBA 3VS0A 5KMLA 4MX9A 4FBXA 4XP3A 1H1WA 2PUNA 1LEZA 1FVVA 5AR8A 4O0TA 2C6IA 4JI9A 4FK6A 5G1XA 1NA7A 2IW8A 4O1OA 5E8UA 3RCDA 5E8ZA 3JPVA 3OT8A 4B0GA 1T45A 1OIRA 4DFLA 4BKJA 2ZAZA 1V0PA 3ZFMA 2XM9A 3IOPA 1PXOA 2ZM3A 4FODA 1OL1A 4TYJA 3SW7A 3KK9A 5DVRA 3ZM9A 4BR3A 1E1VA 3QXOA 2G9XA 2O65A 3BEGA 2ONLA 3RK7A 1FQ1B 3O7LB 3S3IA 3MDYA 1IR3A 1R39A 5E8YA 4BYJA 5I3RA 3GUBA 4QMPA 4FGRA 3ZSGA 3HMOA 3EIDA 5DYJA 4AZWA 4C7TA 3SQQA 4I6HA 3OF0A 4JR7A 5ANIA 1YWRA 2R3NA 3PZHA 2YAAA 5JGBA 3GOKA 4JBVA 4ANLA 5HLNA 2UW0A 3ZUTA 5GNKA 2KTYA 2YWPA 4GJ2A 5CX9A 2V62A 4A9RA 4F1OA 2DUVA 4FTMA 3MVHA 3KN6A 4CZYB 5BVDA 4DG3E 1UU3A 4FKVA 3GC7A 4DFXE 3FMHA 3DXNA 2YZLA 1NVRA 2HZ4A 1GZNA 4DEIA 4RWIA 3ZEPA 4ZS4A 4BF2A 3UO6A 3OD6X 1GAGA 1KOBA 4O0UA 4CCBA 2VWXA 3FWQA 3O2MA 4I20A 4GW8A 4JQ7A 4EH9A 1UKIA 4G3CA 2W06A 2XYUA 3H0ZA 4LV5A 4GV1A 4L3PA 4RIWB 2B1PA 4RZVA 2Y8OA 2R2PA 4KA3A 3F7WA 2NRYA 2C6EA 1M2QA 5AP3A 1Z57A 2BIKB 3B8QA 3S4QA 4X2GA 4EK5A 1VEBA 4F64A 3ORTA 4ID7A 3BEAA 4KKEA 4YNEA 4UMQA 5FDXA 3ALNA 2ZB1A 4BBFA 4AW2A 4C38A 4L3JA 5HESA 3RNYA 3VN9A 1PXNA 5CQUA 1U59A 2X8IA 2C6DA 1OI9A 2RF9A 2XK6A 3NUYA 2NO3A 3Q4ZA 3OXTA 3GU4A 2ZMDA 4PNIA 5BUIA 5HIEA 2YM7A 3FXWA 3EN4A 3AC4A 1B39A 2C3JA 4BDJA 4DGOA 4RJ7A 3QQGA 4DBNA 5FM3A 4D5HA 4YPDA 5IQEA 5DMZA 2JD5A 5CS6A 4UX9A 4CG9A 5AR5A 5HBHA 2JKMA 3GFWA 4ZSLA
chains in the Genus database with same CATH superfamily
3HZTA 2XNEA 3AC1A 4O83A 2XRWA 4GVAA 3LVPA 4U40A 3UOJA 3QCYA 4OLIA 3TNQB 5JKGA 1M7NA 3ZLWA 1MRYA 3W2QA 4NM5A 1P2AA 2XKEA 3Q5IA 2UW4A 2IPXA 2WMQA 4UMPA 5T68A 3Q6WA 2WMWA 1VYWA 3OW3A 4F9YA 5K4JA 3ROCA 4NIFB 4IHPA 4ZXTA 1W98A 4DYMA 3FPQA 4DH8A 5KZ0A 4BDBA 3EQHA 1B38A 2HELA 4DG2E 4YU2A 1AD5A 4AAAA 3MV5A 4IEBA 3DNDA 3K3IA 4QYGA 4EC9A 2VWVA 1FMOE 3E8NA 3P1AA 3U9CA 1LUFA 4O4EA 1YHVA 3OCBA 4AOIA 4YUQA 3RVGA 2R7IA 3R8VA 2YLFA 2ZV2A 4GFOA 4M66A 4I92A 1F3MC 4P2KA 2OJFE 3OCTA 3GBZA 2CGVA 5AIRA 3S00A 5E8VA 2O3PA 3IS5A 4W8DA 4ZTSA 3Q2MA 5EHOA 4B8LA 3KK8A 3UZRA 2F7EE 2ITOA 4D2TA 4QMWA 3NFFB 5J9LA 4PTEA 2X9FA 1KWPA 2B9IA 3RHKA 4XX9A 4BIEA 2JDRA 4IANA 3WE4A 2QO2A 4NTSA 4L6QA 4GFMA 4UMTA 4O0VA 4YLLA 5EW3A 4FEVA 2OO8X 3W2SA 4M0YA 3HYHA 4OGRA 1Y6AA 4YJUA 5KMOA 3R7OA 4LG4A 4AE9A 2OF4A 1ZWSA 5CASA 3P7BA 3MA3A 4MF0A 2GNLA 3DAEA 3TV6A 2ZV8A 5M57A 5CEMA 4XG8A 4AS0A 1PXKA 3EQCA 3TV4A 3EKKA 3LCTA 4N57A 1BUHA 3I0OA 1H1SA 2E2BA 3UODA 4ANOA 4NW5A 3BV2A 3OC1A 4BCMA 4GG5A 5EM7A 3EFJA 4C4JA 5AM7A 3IW8A 5KKRC 2WMBA 3HMIA 4GT5A 3UG1A 4FV1A 3CIKA 5C8MA 2GMXA 3ACJA 3QTZA 3TZ8A 4GFGA 5HIDA 1JKTA 4IAAA 4E7WA 3G9LX 4F7JA 4F6SA 4X3FB 3BV3A 5JQ8A 4X6QC 4A7CA 4QD6A 3R9RA 1JPAA 3ELJA 2QHNA 4JDJA 1H0VA 5CVGA 5DA3A 2IN6A 2IF8A 4XP2A 2PSQA 4E6QA 3VO3A 3RBWA 2C69A 2WELA 1IG1A 4BL1A 3SW4A 4AZSA 4QMTA 3LM0A 2YM6A 3ZONA 5JQ5A 5IQIA 3B2TA 1GIIA 2YJRA 3F66A 4KRCA 4IAZA 4HYHA 4NFNA 2V22A 2W17A 4AGDA 1WBSA 4XRJA 2X2MA 2HCKA 3L9LA 5IISA 3BE2A 3CY2A 4F78A 2C30A 2ACXA 3G5DA 4YZNA 4NIFA 5K0KA 2ETKA 4MD7E 5K3YA 3UOHA 3GEQA 5EDQA 4NEUA 5ITAA 2VX1A 3D4QA 3CJFA 1BI8A 2OH0E 2F2CB 4A07A 3VUIA 4DEGA 4I5HA 2PMNX 3R8UA 2WO6A 4TWNA 4LOOA 4FV3A 4GYGA 4E8AA 1JKLA 4IJ9A 3E8DA 3QZFA 4ZOGA 4MQ1A 2I40A 3PA5A 3ZC5A 4R78A 4G6NA 1OVEA 4FEWA 3T3VA 1JSVA 5ETFA 4RVLA 5CT0A 1P14A 2HW6A 3REPA 3QQFA 4H1MA 1OKWA 4XOZA 2P2HA 2PVFA 1Q24A 2BDWA 4YJTA 3V5QA 4EUTA 3FMLA 4FT9A 4DLJA 2C0IA 3FE3A 4E5AX 4J8MA 4QMNA 3I7CA 2VN9A 3QALE 4IE9A 2XIZA 4E6AA 2BR1A 4M69B 2E9UA 5TE0A 3GB2A 3UO5A 3QHWA 4QQTA 1BI7A 4ZZOA 4IFGA 4V0GB 4NM3A 2YERA 5A4QA 1H1RA 5D41A 3RZFA 5CSVA 3NVMB 5E90A 5AR7A 1JNKA 3U9NA 2PE2A 4DH3A 4I22A 3QKLA 2GTMA 4PPCA 4RWJA 5DH3A 3R9HA 5EW8A 4YZCA 3VUMA 4BCPA 2YHVA 4DFYA 3DBQA 2HENA 3PPZA 4LRJA 3AD4A 2BILB 2PZPA 2J5EA 2CPKE 1XH5A 4NW6A 3QD0A 5IA0A 3FJQE 2A19B 3BI6A 5DEYA 4KBCA 3ZEWA 4KSPA 1KE7A 4FV9A 4UYAA 5CEPA 2CDZA 5AUTA 4DA5A 5CAUA 2GPHA 3MI9A 2GTNA 1K3AA 4NKSA 3WZEA 2F9GA 2G2FA 3DOGA 4RX8A 2IVSA 2XJ1A 5CYIA 5I9WA 3LFSA 5GZAA 2CCHA 2YEXA 4G9RA 3BHUA 4KRDA 2YACA 1ZYDA 4PPAA 3LFBA 4J1RA 4EKKA 1RE8A 4AXAA 2EXMA 2UW8A 4EH6A 5A3XA 3FC1X 3SXSA 2W5HA 3TTJA 3IECA 3LXKA 2FVDA 2XEYA 4A4XA 3Q32A 5JMSA 2W4KA 4O2PA 4LOPA 5M53A 3ATTA 4KSQA 4YHJA 5FTQA 3C5IA 5M4IA 3BGQA 1PXIA 4AG8A 3BYVA 2QOFA 5F95A 4HYUA 3WF6A 4C4FA 2W1HA 5EDRA 4FTUA 3C4EA 4RJ5A 3VAPA 1VLRA 2DWBA 5GIPE 3O17A 4DN5A 4BRXA 3EMGA 3SA0A 2GU8A 4FSWA 3JS2A 4RPVA 2CN5A 5AX3A 4K33A 4FJVA 2XIRA 3CR0A 4LFIA 3OEZA 4QEBA 2GNHA 5HG7A 5HICA 3DBEA 4QP8A 4DT8A 2JLDA 2E9OA 2YCFA 3MW1A 4QP2A 4A9TA 3OXZA 4D4SA 4FSZA 4O96A 3KY2A 4HVSA 4W4WA 4H05A 3EN7A 4C3FA 2C6MA 4RT7A 4EHZA 3LLAA 4N6ZA 2V5QA 3G33A 4OTQA 3O71A 2YM5A 4IWPA 2XNNA 1JLUE 1LEWA 5AEPA 1WFCA 4QDVA 1J1CA 4Y5QA 3KU2A 3GNIB 1UNGA 1YQJA 4O0WA 4M8TA 5BMMA 3UOKA 3A60A 4C3RA 3E5AA 4X2FA 1S9JA 5FWKK 3IGGA 3EL7A 4QP6A 5M4FA 4MXYA 1YXUA 5ETIA 3N4TA 3F7ZA 4HVIA 4CSVA 3SLSA 1SYKA 4IZ5A 1H25A 4Q2AA 2LAVA 3V6SA 3ZSHA 4S30A 4D58A 3SG8A 2JIIA 3EZVA 5BVOA 3ZTXA 4XG4A 1KV1A 2NP8A 4CT2A 2I0EA 2QOKA 3AC8A 4LM5A 4JL9A 3UP2A 1KOAA 4UB7A 4G3EA 4ANMA 1QMZA 2XAOA 4FZ7A 3QTRA 4AAYA 2EU9A 3KXHA 2QURA 4LL5A 3SG9A 5FLFA 1PF8A 1Q99A 4GUEA 3ZSIA 4CV8A 3OUKA 1U4DA 4FKPA 4FKUA 4FZ6A 4XOYA 2Z8CA 3W32A 3PXQA 4KKGA 4YMJA 4L44A 2VU3A 3LM5A 3UIBA 3OOMA 2ERZE 4X7QA 2XJ2A 4FICA 4FSYA 3OBGA 3VBVA 4G31A 4U9AA 5DPVA 4HW7A 1XMLA 4K9YA 2X8DA 3FLYA 4BWKA 2EB3A 3ALOA 3MFTA 4KUJA 3UIMA 4C4EA 4XMOA 2R0UA 3DDPA 1GNGA 3PFYA 4LYNA 4W9WA 4G17A 4D1XA 2QKRA 5J1VA 4LDTA 4WOVA 4FZFB 4D2PA 1F5QA 5HO6A 4P5ZA 4UMRA 2QU6A 3FEGA 3ENMA 3PJ1A 3TUCA 2XJ0A 2CGWA 3BYMA 2VWBA 3QKKA 4FKLA 4BN1A 3R71A 2XS0A 5HNIX 4USDA 3U51A 3IG7A 3NYOA 3GCSA 4KAOA 4BWPA 3WILA 5I9YA 1QPJA 1ZYSA 3EYHA 1OPLA 3PXRA 4FF8A 4OTPA 4ALWA 3TIYA 2W1CA 3MH2A 3ZFXA 4U97A 3QWJA 4BKZA 4KB8A 3EKNA 5CLPA 2W7XA 4UEUA 3L8SA 2QOCA 5M07A 3R9NA 2H8HA 2XBJA 1L3RE 5CNOA 2W0JA 4OUCA 3QTSA 3QZHA 4EOLA 5B2LA 5DWRA 5I0BA 5HX8A 4U3YA 2J0LA 5HI2A 1SMHA 3Q9ZA 3AXWA 4FG9A 3HRBA 4XV1A 3ZHPC 4C0TA 5KNJA 4ZAUA 5CU4A 5AR3A 5A4CA 3TUDA 4BKYA 3N4UA 3V3VA 4U8ZA 2B9HA 4MNFA 5TT7A 3RKBA 4R3PA 3VS4A 2Y0AA 4XV2A 1ZARA 2OJ9A 5DFPA 3TEIA 4I3ZA 5KMMA 4OAUC 3LFNA 5HEZA 1QPCA 4U5JA 4EH8A 2ITVA 5JRSA 2E9VA 3MYGA 4HGEA 4EH7A 2OXYA 4QYYA 3ORKA 1GZ8A 1Q8UA 1NVSA 2YFXA 3SDJA 2C5VA 2WAJA 4WRGA 4FTTA 3F69A 4JDKA 3DKCA 4QNAA 3ZRKA 1XJDA 2I1MA 1PMEA 1GIHA 3NUUA 3ML1A 3R7YA 5M08A 4FSNA 4XG7A 4ONAA 4HPUE 5JGDA 5AA8A 2PUIA 4MXAA 4KWPA 3PXKA 3HRFA 3MA6A 4C62A 4MCVA 4E73A 3MFRA 3LXNA 4M84A 4QP7A 2IZUA 4GS6A 4BCQA 5JT2A 4QMVA 4E26A 3MIAA 4XS2A 3UC4A 5L2SA 2VTTA 2IZRA 4E6CA 3O50A 3ITZA 4KKHA 1ZMVA 4W9XA 3L9NA 3TZ9A 3U55A 3O7LD 4ZJVA 2BIYA 2RG6A 1BLXA 1YOLA 5A4TA 3M42A 4L45A 2GHMA 3CTJA 4J7BA 5JK3A 4YZDA 4O7TA 1IEPA 5BYYA 4P4CA 5AUXA 5GIOE 3DCVA 4RG0A 4EH2A 2CN8A 4EWHA 3DXPA 5IH5A 2XIXA 5AV0A 4M0ZA 3R7EA 3RINA 2WMVA 4Z16A 3QA0A 3AC2A 4GK2A 4IX5A 1Q62A 3DK6A 2OJGA 3HMNA 4AZVA 4OTIA 1O6KA 3SXFA 4XNEA 4ZLOA 2UZNA 1Q8YA 3DKOA 4EL9A 2V7AA 1PMUA 2XYNA 4YTCA 2OIQA 2QOBA 4D4RA 3ZDIA 3NLBA 5LARA 2Y4IB 2Y4PA 5E8WA 4USFA 3MJ1A 3UQCA 2I7QA 5KBQA 5J8IA 5E7RA 3MJ2A 4MXXA 5D1JA 4FGBA 2QLQA 4O2ZA 5HGIA 5CSPA 3HAMA 1PXMA 1Q41A 3WZDA 5ANGA 2ONLC 3COHA 3LXLA 3NNUA 5K5NA 4TT7A 4KIOA 5HTIA 1J7LA 2VTAA 3BLRA 4ZTRA 3KXXA 4KS7A 4ZP5A 1XH9A 4O81A 4E5BA 2Y7JA 2PU8A 1GIJA 5IEYA 4ZSJA 2DQ7X 2W1IA 3C4CA 3UE4A 3GENA 5ANJA 5I9UA 3VS2A 2WTDA 4PL3A 3VQUA 3OY1A 4EOMA 3T8OA 4ERWA 3T9TA 4BY9E 4JG6A 1SVEA 5B2KA 1QPEA 4BB4A 3R9OA 2QI8A 5CXZA 2IVTA 5GJFA 2FSMX 3NCGA 4QMOA 2GQRA 3HP2A 4TNBA 2F2UA 3F82A 2AC3A 2XCHA 5LMAA 3DB8A 5M51A 4NZWB 4EK8A 3R1NA 4LV7A 4GSBA 1TKIA 2C0TA 3DFCB 5GZ9A 4BCJA 1V0BA 3ATSA 5DHJA 4DH1A 3V5WA 5IUHA 2JKOA 3D5VA 2QO9A 2QOLA 3R00A 4I5CA 4L42A 5EI8A 5L8JA 1R78A 1U54A 3IW7A 3VUDA 1TZDA 3VUKA 3KIOC 2X39A 3ORPA 4PV0A 3VULA 5DLSA 4FTOA 2XNMA 3O8PA 1DAWA 3JUHA 4YPSA 2XALA 3FMJA 3FY0A 3ZM4A 4G3FA 1YWNA 1U46A 3C4FA 3OY3A 4GKHA 5ETAA 3QX4A 3F3UA 2WTKB 4GT4A 1XWSA 1YVJA 3QLFA 4HVGA 1G3NA 3C50A 2R3LA 3ZYAA 1PYXA 3QD2B 5L6OA 5CEOA 3LCSA 4M68A 4XLIA 1XH7A 5BUJA 1OB3A 3O5AA 4WHZA 5HU3A 5HQ0A 1H07A 5IA2A 5L2IA 4FSQA 2BRGA 1H8FA 1WBNA 2PVRA 2W4JA 2C68A 2JAVA 3KVWA 4NJ3A 2JITA 4X2JA 4XCUA 4J98A 4Y5HA 1HOWA 3P23A 3OOGA 4S32A 5HG5A 4BCIA 1TQMA 1REJA 3NDMA 1SNXA 3E92A 4HGLA 4M13A 3RMFA 1YKRA 2J6MA 4Y95A 4QP1A 3QWKA 4YC8A 4ARKA 3S95A 2VX0A 2WU6A 4WNOA 5BNJA 3UG2A 2HYYA 4DTAA 3S0OA 2OG8A 3HEGA 3H4JA 4TYEA 1WZYA 3MVJA 2DYLA 3GU8A 4RX7A 3TWJA 4F63A 3BLAA 3CLYA 1EH4A 4BC6A 1I09A 3MSSA 5C9CA 5JGAA 4FC0A 1MRUA 4AT3A 2WOUA 3HV3A 5BVEA 3NW5A 4OTGA 3VC4A 2PMOX 2ZDTA 3LFEA 4MD9E 1GJOA 1IA9A 4HJOA 1UNHA 1WVXA 4CMUA 4D4YA 5A4LA 3OCGA 2JC6A 4QPAA 3EOCA 3DGKA 3GXLA 3M2WA 4FTLA 2XIKA 2BKKA 4LMUA 5HIBA 3EWHA 3MH1A 2WPAA 3IW5A 3Q4CA 3ZLXA 1BX6A 4JRNA 4A9YA 5LWNA 3TZMA 5JZNA 3WBLA 3WF7A 3U6IA 3FMDA 2R4BA 4CMOA 3D15A 2QCSA 3KGAA 1MQ4A 4IVDA 4EQCA 3QD3A 3V8WA 3WZJA 1WBVA 2JKQA 4RC3A 3ODYX 4AXCA 3A8XA 3VRZA 4CCUA 5FTGA 2XCKA 4Z3VA 5KZIA 2BTRA 3GCPA 4WSQA 3R8ZA 4EJ7A 4OBOA 5C03A 3VUGA 3PJ8A 2GQSA 5CT7A 1MQBA 3AMYA 4WT6A 3IONA 4EKLA 5KX8A 3ZH8A 2FUMA 4D55A 3PXZA 3NUSA 1TFFA 2CHLA 3OZ6A 3IO7A 3BU3A 4ZIMA 5DN3A 4G9CA 5CXHA 5H9BA 4IDTA 4AE6A 3WIGA 1O6YA 2YISA 3QU0A 4EOSA 4ALUA 3LCOA 4CKJA 4LI5A 4WG4A 3ZXZA 4U79A 2CMWA 4X2KA 4E3CA 5ETCA 2EWAA 4U81A 2WQBA 3EQFA 4F7SA 2QNJA 2J0JA 4TYIA 2FSLX 5BVWA 3MH3A 4EZ7A 4UN0C 2RFDA 2G2HA 4MXZA 3Q52A 4QTEA 3LXPA 3QUPA 4O7NA 1J7UA 4FVPA 2HZIA 3WYYA 1ZOEA 3BL7A 3C7QA 2C3KA 3NPCA 3HUCA 4DG0E 2HK5A 3ORMA 3MY5A 4GK3A 3BE9A 3FYJX 2OU7A 1J7IA 3B8RA 4L7FA 1ZXEA 3RPYA 3RTPA 5CTPA 4FKJA 4G3DA 3IDCA 2RGPA 4X6RA 1OUYA 2QHMA 2YA9A 3F2RA 4DINA 5CNNA 2VTLA 2RIOA 4G1WA 2JAMA 4RSSA 1UWJA 4O21A 1Q97A 4L43A 3CKXA 3RPRA 3I5NA 4RIYA 4DAWA 3BHHA 1PW2A 3FSFA 4UALA 5I9ZA 1O6LA 5FXRA 5FP5A 2OF2A 2PVNA 2RFSA 5JH6A 1CTPE 4YSMA 3AMBA 4BBMA 5IA5A 3A4PA 2WMTA 2R3JA 3D5XA 3KMMA 3EHAA 3QQHA 4F4PA 4M7IA 2BAQA 2HXLA 1GZKA 5EM8A 3PY3A 4NCTC 5KHWA 4OBPA 1DI9A 4P7EA 4I23A 3HUBA 3UVRA 4EHGA 2CNUA 2UW3A 3KN5A 3HAVA 3ROYA 3VNTA 4JR3A 3R83A 5IQFA 3NAYA 4FL3A 3Q9XA 4F7LA 3NUXA 4X3JA 4BI1A 4DDGA 2NNWB 5I4NA 4GVJA 4RIXA 2Y4IC 4KIPA 3BELA 3TN8A 4HZSA 4DDIA 3HV5A 2WTVA 2WTWA 1YDRE 3W0SA 3E62A 2XMYA 1M2RA 1VYZA 1CKIA 2O64A 4X3FC 4FX3A 5HBEA 3R9DA 4Z7GA 3A61A 4GT3A 1UKHA 4ACDA 1WVWA 3OWJA 4NYEA 2WXVA 4H3PA 2VGOA 2X0OA 1STCE 3IK3A 5BX0A 3QD4A 4UXQA 4PDOA 4FNZA 3QCXA 2W5AA 4C8BA 1G8KA 2UZBA 3WARA 1OIQA 5HVJA 4LQMA 1Y91A 3D2IA 3T9IA 3Q6UA 2UW7A 2X0QA 4IWDA 4UWYA 5GZ8A 5EFQA 2ZV7A 2HW7A 1UV5A 2VO3A 5CEQA 3AC3A 4UMUA 4QP4A 5AR4A 1PMNA 2JDTA 5HE0A 4FV4A 2BCJA 2WOTA 4FYOA 3MN3A 3FMKA 1JSTA 4LOQA 3V5PA 3UNJA 3KEXA 3W0NA 4HNIA 5IQHA 2WGJA 4FG8A 4LGGA 3TCPA 4E4XA 2WB8A 3QUDA 2P55A 4IC7A 4AT4A 4CFMA 3Q96A 3QRUA 5CEKA 2OSCA 5CQWA 5B2MA 3HVCA 5DOSA 1ST0A 3CC6A 1W82A 5F20A 5GINE 3COMA 2HXQA 2OZAA 4IM2A 4F0FA 3K5VA 3PP1A 4GU9A 2ITXA 3LFCA 2HWPA 2GCDA 4DHJA 2QD9A 5KMKA 3N51A 3OROA 5DR2A 4ZSEA 1H28A 3IQ7A 1XH8A 4XG9A 1PXPA 5C1QB 2UVYA 4KBAA 2PVYA 1WAKA 2B55A 3NW7A 4I41A 4RIOA 4FSUA 3ZUUA 5EW9A 4ACMA 1P4OA 3VBWA 3RNIA 5EDPA 3UDBA 2QO7A 4BI0A 2BROA 3GCVA 4XJ0A 5DR6A 1PXLA 5AMNA 4EK4A 5A4EA 4BI2A 2A0CX 2OXXA 3RM6A 3WF9A 4X3FA 3AT2A 4UZDA 4YGAA 2V55A 5I9XA 4D2SA 5CAPA 4LGHA 4IZ7A 4C36A 2OZOA 3Q04A 1H08A 2AQXA 2R5TA 3L8VA 5EK7A 2H6DA 4M67A 4W8EA 5JSMA 5LVNA 1H1PA 3MB6A 4JAJA 4BDGA 4M15A 2XAMA 4RBLA 3SD0A 3OHTA 2UZUE 4BDCA 4WUNA 2J7TA 4FKWA 4RWLA 3ZS5A 3ORXA 5HCZA 3NIZA 3EJ1A 2R3RA 3QGYA 4PX6A 3ZZWA 3OTUA 5HZNA 4J71A 2NPQA 3PG3A 5C4LA 2BFXA 2FB8A 1KE6A 3QC4A 4PDYA 4E5WA 2ETRA 3R02A 4PMPA 3QBNA 5AX9A 2XKDA 3HGKA 1H26A 3LAUA 3FI3A 3D7TA 3HDNA 4YJOA 5DG5A 3SHEA 5AP2A 2I0VA 1XH4A 2C6KA 3TNHA 4YLJA 4AOJA 2B9JA 3TIZA 2UZDA 5J87A 3KF4A 2R7BA 3QZGA 2X7OA 3R73A 5E8SA 3QYZA 4HPTE 5AP5A 2H34A 4YC3A 5HKMA 4R5YA 3AG9A 2PY3A 4O7WA 4NUSA 2VZ6A 5AUWA 1PMVA 1HCLA 4BCOA 4EYJA 3O23A 4JRVA 4RJ3A 3MBLA 5HNGA 1OPKA 4AN9A 3CCNA 3SAYA 4FUYA 4P5QA 5EOBA 4RC4A 4EH5A 4AW0A 3FXZA 3W55A 4QTCA 3EZRA 4GUBA 4NU1A 3RAWA 3LMHA 1JVPP 2WTJA 3GI3A 4QTAA 4RRVA 4CLJA 5HU9A 5ANOA 3EB0A 4IB1A 2QOIA 4RVTA 3G6GA 4K0YA 3P7CA 4YR8A 4HCVA 2YITA 4IVBA 3CTHA 4FIIA 4U3ZA 3DZOA 2PZYA 5IKWA 5JFXA 2PE1A 3UVPA 4QRCA 3FI8A 5CVHA 3LKMA 4Z55A 5HD4A 2VWWA 4DFBA 4JBQA 4PF4A 4MNEB 1CSNA 5AFVA 3BHTA 5EYKA 3BBTB 5ANKA 5BYZA 5CWZA 3NVKI 3KXNA 3OBJA 4HCTA 3PSDA 2WMXA 3VWAA 3CD3A 3BU5A 4RJ8A 3FZSA 4DE4A 2C3IB 3QRJA 2WZJA 4HZRA 4JX7A 4BWXA 4CFVA 3PLAE 5LMKC 4N0SA 2OFVA 4QOXA 4CKIA 2IWIA 5FEQA 2PZRA 4ASXA 2Z7LA 5ANEA 2PPQA 2CJMA 3II5A 5FTOA 4ZTNA 5LQFA 3NEWA 5L6PA 4EOPA 3FMMA 4PL4A 2SRCA 4PWNA 4R1VA 4S33A 3BU6A 4O0SA 4HNFA 3F2NA 5HLPA 3EN9A 5AJQA 5AP1A 3TDWA 3EH9A 5TO8A 4AA4A 4I1ZA 4TRLA 2CSNA 4UZHA 4O22A 2WEVA 3TNPC 3DBFA 2AEGA 3G0FA 4IACA 4U43A 1ZAOA 3BPRA 4CFFA 5H8GA 2XRUA 4ZLZA 3W2RA 3N9XA 1OPJA 2YM4A 3GCUA 3NIEA 3NR9A 4D0WA 2J2IB 2Z02A 4WA9A 4M3QA 1J3HA 3CJGA 2WTCA 2CKPA 3VHEA 4XG2A 3SX9A 1KV2A 3FXXA 4GU6A 3LFAA 3OWKA 1G8JA 3R8LA 3RALA 5J9ZA 3ZOSA 2ITZA 3AQVA 3G90X 2FO0A 4QMXA 4N6YA 5DT3A 4DH5A 2B54A 3NUAA 4DF3A 2W9FB 4RFYA 4L53A 5F9EA 4J95A 1NY3A 3H10A 4BZDA 3BQCA 2JKKA 4FR4A 4II5A 1H27A 4K8AA 5IMEA 5KMIA 3OFMA 5AAEA 1NW1A 3LHJA 3F5GA 4FKOA 2IZTA 3O96A 5A9UA 3MY0A 4IJPA 2ZM1A 2B0QA 4MTAA 4HGTA 3GQIA 5EYDA 3F9NA 4CT1A 5C8KA 2OZAB 2F7XE 1ZY4A 4H39A 5C8NA 1XQZA 3CQWA 4AUAA 2LGCA 3NZ0A 4L67A 2VTPA 2XK3A 1UA2A 3OXIA 3FBVA 5DGZA 4C35A 3SOAA 3TNIA 5LOHA 1JKSA 2OLCA 3UMXA 3BBWA 3C4ZA 1U5RA 3KL8A 4CGAA 4FL2A 4R5SA 4E93A 4BJJA 5BVFA 4IZYA 5F4NA 4W4VA 3F61A 3CE3A 4FG7A 4C4GA 4FEQA 4DEDA 4GEOA 3W2PA 1PXJA 4YHFA 3F3VA 3H0YA 2KULA 3LIJA 3EQPA 4UYNA 2YABA 2VO7A 3QX2A 5A14A 3FMNA 3R22A 4D1SA 1W2DA 2Q0NA 4ANSA 2HIWA 3HRCA 2W1GA 4BFMA 3PE2A 5FEEA 3UNZA 5A6NA 2R3FA 2OIBA 4Q9SA 1A9UA 4RA4A 3PIXA 1TQIA 2XIYA 1OZ1A 2G1TA 3I79A 3MH0A 1OUKA 2RSVA 3EQDA 5EHLA 3FKNA 3QQLA 3ZBFA 3SVVA 4EJNA 3DZQA 3UDZA 3GC9A 3I7BA 3CSVA 4DFNA 4BZOA 2W4OA 2VWZA 4JNWA 3HL7A 4APPA 2C6OA 2BTSA 2ERKA 3HLLA 3MFUA 3PY0A 4KD1A 5CEIA 4AU8A 4D5KA 3PVGA 1M52A 4FMQA 5FRIA 2J0KA 1ZZLA 4FT3A 4QO9A 2BRHA 3PZEA 1GZOA 4G6OA 4CZTA 5IEXA 3AGLA 4WBOA 4J96A 3DTWA 5KHXA 4AQKA 4IX4A 5TR6A 4BCGA 3NUNA 4MVFA 5BYLA 2HY81 3IW6A 3KULB 4FTCA 1IASA 3ID6C 3AGMA 4U6RA 5H3QA 3VF8A 3VJOA 2C6LA 4JBPA 2WU7A 4EBWA 2A98A 3HNGA 2AC5A 4UV0A 3ET7A 2VTQA 1Q8TA 3RI1A 3U87A 2QOHA 1DS5A 1PJKA 3ZU7A 3ERKA 4K2RA 3FSKA 1K9AA 4F99A 4FKTA 5L2QA 2Z2WA 5L8LA 4FT5A 5GHVA 3JXWA 4AQCA 2YJSA 5FXQA 3UP7A 2PUPA 3R6XA 2YAKA 3QCQA 3F5UA 3BGPA 1W83A 4MWHA 2BAJA 4BHZA 2F7ZE 2R3OA 5K0XA 3OUNB 2QODA 3UOLA 2GHLA 4C59A 3ZBXA 3KF7A 3PVUA 4FTQA 3BRBA 1YI4A 3KRJA 4NCTA 5CU3A 5GJGA 5B7VA 3P7AA 4BDDA 1VJYA 3R01A 1YW2A 3WE8A 1CKJA 4EZ5A 4LUEA 4IAYA 3W2OA 3V6RA 5LMBA 4Z9LA 5M44A 3Q3BA 2GQGA 3BYOA 4ZY6A 5T3QA 3ZO3A 5AP0A 4APCA 2XANA 4FZAB 4O84A 4JAIA 2PZIA 4NSTA 5IEVA 1PKGA 2BRBA 5AUUA 2XB7A 5L8KA 2PWLA 3F5PA 4AFEA 1ZZ2A 4GK4A 1ZMUA 2J50A 1ZYCA 3PJCA 1VR2A 2ZV9A 4PMTA 3Q5ZA 2JDVA 2XK9A 5CU2A 1PKDA 2X0GA 2VTRA 3NW6A 3PFQA 5D11A 1Z5MA 3MIYA 3FI2A 2PTKA 4X21A 3NCZA 5D7VA 5E8XA 3TKIA 4AF3A 4LRKA 4CTCA 4ZK5A 4IAKA 5IQDA 4ANNA 4F9WA 1RDQE 5EKOA 3R1QA 4O6EA 3CBLA 2BALA 3DQWA 1XKKA 2UW6A 2REIA 4FNWA 2ETMA 4CQGA 2YM8A