3S3IA

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Novel triazolopyridylbenzamides as potent and selective p38 alpha inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3s3iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3s3iA01
3I81A 5LVNA 3F82A 2V0DA 5EK7A 2P33A 2Q0BA 5IQDA 3JUHA 3TM0A 5A4LA 3OROA 4TYIA 4IQ6A 5IA2A 2BKZA 2J6MA 3MJ2A 4XG9A 3P79A 3KMWA 4CFXA 4NM7A 5EYKA 4EZ5A 3CD3A 1YXXA 5IMEA 1FMOE 4FTUA 1UNHA 2RFEA 3KA0A 5TR6A 2YM7A 4R8QA 5AP6A 2C4GA 3PTGA 4KBCA 3BGZA 3DB8A 4D9UA 4QP7A 5A9UA 3MY1A 2JDSA 1GNGA 3TACA 2ITOA 3Q5IA 4RFZA 4ZJIA 2XH5A 3ALNA 3RINA 3TNIA 2ETRA 2X7GA 5C9CA 3W55A 4GIHA 2XIYA 3H0YA 1VYZA 3HP2A 4KBKA 5EQEA 2BTSA 2FSTX 3COKA 1W82A 3F3VA 4YJTA 2XJ2A 3RMFA 2W4JA 2P3GX 5A3XA 5EW8A 4EH4A 4FVQA 3F69A 4BCQA 4F7JA 3JS2A 4FKUA 2I1MA 5HCYA 4BC6A 4XLIA 4K2RA 4IB3A 4FTJA 4YBJA 5D1JA 5E8TA 2YM6A 2FA2A 3ZO1A 3HAMA 3FI4A 4FSYA 1UU8A 3I5ZA 3ODZX 1LPUA 2W99B 2CKQA 4G9RA 4M0YA 4QP1A 3UJGA 5EG3A 2IZTA 2CKOA 4JDKA 3R01A 4O7YA 4FTOA 3D94A 4U44A 5E92A 1OL2A 4AGCA 2PVFA 3G9LX 4BVUA 3UPZA 2F2UA 4OTWA 5GZ8A 4L6QA 3VUIA 3QD4A 1PMUA 2W1FA 5HNGA 2WOTA 5J7BA 2YLFA 3TXOA 3UZTA 1URWA 3UO4A 4F09A 3ANQA 4AGDA 2F9GA 1PXIA 4U43A 1CKIA 3F5UA 1CKJA 3BEGA 4FNXA 1XR1A 5K4IA 4EH6A 2H8HA 4OAUC 3FYJX 4O7VA 3LQ8A 5DWRA 3Q9YA 2IPXA 2OZOA 5BVNA 1SNUA 4O1PA 4XP3A 3FWQA 1YDRE 2FUMA 4CLJA 1PMNA 4B8MA 3WBLA 4G17A 3RI1A 1QPCA 3F5XA 5EYDA 4L3LA 4DEHA 2W9FB 2ITVA 4FA2A 4FNYA 4XRJA 4QQCA 2CGWA 4V04A 4QMUA 3G6GA 3F7ZA 3OMVA 4Y72A 3ORNA 3Q4TA 3VS3A 3GCQA 4BCFA 4F7SA 4RVTA 1JPAA 4FZFB 3QTIA 3CY3A 4TNDA 3AMYA 3W8LA 3EN6A 3EKKA 1FVTA 4FT9A 3OVVA 4PL5A 2FYSA 3RZBA 2WMSA 3L1SA 4QYFA 4AX8A 2R9SA 2GPHA 4J8MA 4HZSA 4KIKB 3MIYA 2BRBA 4L45A 4U41A 2C0TA 3ZLXA 4CZUA 5LMKA 3U6HA 2PUPA 3U8WA 2JEDA 4MXCA 3R7VA 5HOAA 2CN8A 3A7HA 4FV7A 4AA5A 1HCLA 2QU6A 4F1TA 4JQ7A 4C4IA 2XKEA 3QGYA 4WNKA 2HWPA 2YLEA 3QTQA 4CT1A 2YHVA 2Z02A 2W05A 4ZOGA 4XBUA 5F9EA 4NL0A 1Y8YA 3AD4A 4MQ1A 5M09A 1GOLA 3DNDA 3I6UA 1UKHA 4PUZA 4CLIA 1KE9A 4DEIA 5C01A 3DK6A 3EQFA 3KXNA 4XJ0A 2JKMA 2PHKA 3P5KA 5B2LA 4U3ZA 3QD3A 4I23A 4A4OA 2QD9A 3BBTB 4M7IA 4C2WA 4GKIA 4R7BA 4IVCA 4ANOA 3HRCA 4JT3A 3EN4A 2NO3A 3KB7A 3K2LA 4JX7A 2Z8CA 3DQXA 5CF8A 4AN3A 1KV2A 3CLYA 3FMMA 2HXLA 4RFYA 2HW6A 4FTKA 4IC8A 4RC2A 3NIZA 2R0IA 4JLCA 4D2VA 4E6DA 3VUMA 4Y95A 3L8VA 4X21A 4IVDA 4ITHA 2R3JA 2OG8A 2W1ZA 4ERKA 2YZLA 2UW8A 2YM3A 4AGWA 3JY9A 4NW5A 4UALA 1IAHA 4FKJA 1YQJA 3NW6A 5KZ0A 1OKWA 4CFUA 3CJFA 5HNIX 4PPAA 3DPKA 3S2PA 3QQKA 3QZIA 1PY5A 2UW6A 4IIRA 4L67A 3NR9A 5EW3A 4FUXA 5KKRC 3V51A 4F70A 3ZUTA 4XNEA 4KIQA 3TNWA 3NW5A 2OWBA 2PL0A 4I5CA 4FT5A 4PV0A 3N4VA 4M97A 2GNHA 3R0TA 3O8PA 4CCBA 2JBOA 3PYYA 4I41A 2C47A 4I0RA 2X6DA 5L4QA 4F7NA 4EI4A 1KOBA 4J8NA 3ORMA 3SLSA 4DGGA 5JFWA 4DITA 3NCGA 4JRVA 3EQDA 5AMNA 4D2SA 3QA0A 4Q2AA 3AD5A 5JH6A 4YHTA 4H3PA 3G0FA 4YJOA 4QMNA 2XIZA 1RQQA 5AV3A 4E4MA 3CSVA 3Q53A 4MH7A 3ZUUA 4DFXE 1U5RA 3EQIA 3NEWA 4TZRA 1WBVA 4FV4A 1W84A 4WNPA 4PDSA 3QKLA 4UMTA 3SRVA 4ZY5A 4I20A 3ZO2A 3QLGA 4NCTA 4E6CA 2JFLA 5E1SA 3GQLA 4DGOA 4YJVA 1TQIA 3VS4A 1BMKA 1M7NA 2W4KA 3KF7A 4FKTA 4CV9A 1ZMVA 2X2KA 4OTQA 2VWIA 3UO5A 4HVGA 4G3GA 5DYJA 3O7LD 1ZMWA 3QXOA 4FV5A 2XMYA 4E3CA 3QALE 3GENA 4L53A 1IA8A 2QI8A 1NY3A 2C5VA 3QA8A 3DJ7A 5CF5A 4HPUE 5J8IA 4F6UA 2ETKA 1W83A 2W1DA 5B7VA 4ZEGA 3ZUVA 5IH4A 1Y91A 4XG8A 1PYXA 4PQNA 4E93A 5J1WA 3ET7A 1ZWSA 1R39A 4BDAA 2EXEA 2ITZA 2XKFA 3M11A 4A9UA 5LVOA 5GJGA 5D7VA 3HV6A 2BRMA 2PZ5A 3VF9A 2IN6A 2Y6MA 2XUUA 2JKOA 2QKWB 4ZS0A 1NVSA 2BRHA 5KBRA 3SA0A 3DA6A 3NUUA 3RAIA 3ZXZA 4FV8A 2QOOA 4GUBA 4MF0A 4JAJA 4K18A 3FQHA 2QLUA 4EBWA 2BFYA 2XNPA 5IUIA 4QD6A 3QBNA 2G2IA 5E8YA 5F4NA 2QR7A 3AC8A 1YXTA 4KSPA 3SG8A 2GS2A 1M2PA 2QNJA 1Q97A 3L8XA 1REJA 3CTHA 2WHBA 4FG8A 4X3FA 3NUYA 5DT3A 2B7AA 1F3MC 2B9HA 3QFVA 4RJ5A 4NH1A 2H96A 3PPZA 3QQUA 3LQ5A 3OD6X 4TPTA 3ORTA 2C5OA 5HVYA 1G5SA 2DWBA 4G6LA 3CCNA 1JOWB 2XIKA 5M08A 3U51A 4BKYA 4I94A 4FSMA 3ZDUA 4CFNA 3KK8A 2CSNA 2R0UA 2YA9A 4HVIA 3BHHA 2C6EA 3LPBA 4BY9E 4XG3A 3D2IA 2ITTA 5AAEA 5D9HA 3C13A 4G1WA 5B0XA 4KKGA 1U5QA 2PMOX 1NT2A 2UV2A 4X3FC 5FUTA 5JZJA 3ATTA 3F2AA 3BQCA 3MVJA 3FI3A 3PIZA 4FG9A 5LVLA 2IZUA 2QOQA 3QZFA 4YLJA 3ZFMA 1Q24A 2A0CX 3PP1A 5CEKA 3R9OA 1O6KA 4E1ZA 4O96A 2QC6A 3IW6A 4XLVA 5JQ5A 3QCXA 3TTIA 3OT3A 5CNOA 3D7ZA 3QQFA 3ELJA 4MYGA 3C50A 3R30A 2C5NA 3NAYA 3NS9A 4RQVA 5HIEA 3FQEA 3FLZA 3QX2A 4OTGA 4ZSJA 3FXWA 2WTKB 3UNJA 4FIHA 3LCSA 1PKDA 3P86A 4BYJA 3O7LB 4FSTA 4C0TA 2W96B 3VBQA 4WG5A 3FMJA 1SVEA 3PLSA 4IW0A 4PRJA 2PU8A 4RWLA 2W5BA 1YOMA 1AQ1A 4ACHA 5CAVA 2VTMA 3FDNA 3HP5A 4X2JA 2GQGA 4FTNA 4ASEA 1OL7A 4XV2A 4APPA 1JSTA 4LMNA 1O6YA 2JDVA 4IAYA 5HE0A 4C33A 2XJ0A 4W4WA 4JG8A 4U81A 4LM5A 3N9XA 4WUNA 3CPBA 4GU6A 4Y8DA 4GJ2A 4L7SA 3TG1A 5A46A 4KD1A 2BAQA 3HV3A 4FIEA 3SXFA 3CD8A 4CQEA 3E87A 4WG4A 1IR3A 3V5TA 4C61A 4ZTMA 4GYIA 4FV9A 5CENA 5BNJA 3F2RA 3AQVA 4L01A 1IASA 4U3YA 2PUIA 2WQBA 5HHWA 3LMHA 3QWKA 3VUTA 2OZAA 4BBMA 4RRVA 3ZEWA 4FKIA 2R3GA 1L3RE 2XK8A 4UYNA 3ZM4A 4AT4A 3PE1A 4EH2A 3U9CA 5C8MA 5CTPA 1QPEA 4RMZA 4TW9A 4NUSA 4DT9A 3DKCA 4UWCA 5KMLA 3ORIA 4TRLA 3IW5A 2LGCA 3CQUA 2ITUA 3ULZA 4BHNA 5HO8A 3GC8A 4AUAA 2EB2A 5AM7A 1FGIA 2PUNA 2B9IA 3ZONA 4YJUA 5JZNA 4AW1A 1KE5A 2F2CB 2WMWA 2WTJA 4ZTHA 3W2CA 2VTTA 3QCQA 4YZNA 4BDEA 2B55A 1MRVA 3MSSA 3QCYA 4MVFA 4OBPA 4EH8A 4M8TA 3HAVA 3ZS5A 5BUIA 4HVHA 2QR8A 3SOAA 3QTXA 3UQGA 3HRBA 2OJGA 4O0RA 4IMYA 4NEUA 3TZ9A 4TT7A 1QMZA 5HLNA 5K0KA 3FMEA 4ONAA 4LV5A 1PXLA 2Y8OA 1JAMA 4NW6A 4DEBA 2EXCX 2OIBA 2VTOA 5M06A 5ANJA 4O86A 5KBQA 2W9ZB 4BDFA 2BZIB 4F9CA 4EOIA 3R02A 4LGGA 3R7EA 1MRYA 4JR7A 2KULA 3IECA 3UIXA 5HG8A 1YOLA 2X7FA 3BYSA 4LRMA 3NX8A 5CAOA 3MDYA 3WILA 4XP2A 4M69A 4F9WA 3IK3A 4ERWA 4YPSA 4R1VA 3DLZA 4X2FA 4KIKA 1M2QA 5CQWA 4JQEA 3E5AA 4YMJA 4TWPA 3OHTA 3MB6A 5ANEA 3SAYA 3VS2A 1OUYA 3OEFX 4BYIA 4PTCA 2G9XA 5C1QB 4C3FA 5FQDC 5AR5A 2OF4A 3VAPA 5EYCA 3CY2A 1UU7A 5AP1A 1Q8UA 4S2ZA 1YKRA 3QTRA 3L8PA 4PPBA 4A7CA 4L8MA 3JVSA 2HELA 4X2GA 4D4SA 4D9TA 2YISA 4QYHA 3E8DA 4AXAA 4ZJVA 2JAMA 1STCE 3AMBA 3FC1X 3WZUA 5IPJA 1YDTE 5LCJA 1JQHA 2E9NA 3K5UA 4XS2A 1YXUA 3RNYA 2WOUA 3SDJA 3QUPA 4FMQA 2OGVA 4QYYA 2UVXA 4MTAA 3BYUA 4P4CA 3E62A 5TF9A 5A14A 4HJOA 4WSQA 4DEGA 4H3QA 3PJ1A 1NW1A 4BGQA 3NCZA 3T9TA 4RX5A 3QU0A 4M3QA 3EKNA 5BQ0A 4KS8A 4DN5A 3HGKA 2ZJWA 3NUAA 2ZB0A 3AC5A 1YXVA 5H2UA 3PVGA 4I4FA 1Q4LA 1SM2A 4GK3A 4AN2A 3N51A 2WTCA 1K3AA 3AC2A 4OTFA 4GKHA 2PULA 3BELA 3ZRLA 3BHTA 4F1OA 5CI6A 5C03A 3LFQA 3ZO4A 4EOQA 3IDBA 3OS3A 4IM0A 5E8SA 4D4YA 2HIWA 3DBCA 4I92A 3ORKA 4QNAA 2FSLX 2OXYA 3HYHA 1S9JA 5DE2A 3IOPA 4QMOA 3KRWA 3C4EA 3FZ1A 4NFMA 4LFIA 5AV1A 2G15A 2O63A 3UTOA 3VBVA 3VF8A 5FM2A 2B54A 1JKTA 5CNNA 2PE2A 2VWWA 4DEDA 2EWAA 5EOBA 5I9XA 4IAKA 4NIFB 3ZFYA 1WBOA 4IB0A 4FIGA 3QQJA 4M84A 3P0MA 4JVGA 5EI6A 5HIDA 2YZAA 2WTVA 3I79A 3BE9A 5CY3A 3E8EA 4U6RA 3F5PA 5DN3A 3KQ7A 1GIJA 5DGZA 5AUUA 4FGRA 2P4IA 3OC1A 3LJ0A 1BYGA 4ZJJA 4FEVA 4GFMA 4I4EA 5BYZA 5L6OA 1APME 3COHA 5KE0A 4FIIA 3LXNA 1BL6A 4D2PA 3R71A 5HTBA 3CR0A 1V1KA 3F3WA 3R8ZA 3UMWA 4WKQA 4YLKA 2WO6A 3QD0A 3F61A 1R1WA 2YWPA 1PXJA 1ZRZA 4MD8E 3E63A 3FMKA 4UZDA 4LMUA 3TIZA 4CYIA 3BV2A 3I0QA 3SHEA 3ZEPA 3ZBXA 4QMLA 4MHAA 1FGKA 3PP0A 4S34A 4RZVA 4WNMA 2OJJA 5HKMA 4FSZA 2NRYA 4ZY6A 2O64A 2YACA 4BFMA 3NYVA 5E90A 3R83A 5KMOA 3FZPA 5EM8A 1G3NA 5FRIA 4D0XA 4D5KA 3NMUF 1P2AA 2YIXA 4AZFA 4V01A 5AR3A 3T8OA 4AU8A 4EH3A 2J0MB 4EQCA 2XZSA 3E64A 4GYGA 2BHEA 4BN1A 4D58A 2XYUA 5FBNC 2QKRA 4PX6A 5EOLA 2BIYA 5E9EA 3AGMA 3HZTA 4XG4A 3MN3A 3ZLYA 2ZV2A 3S3IA 3TNHA 3ZLSA 4DYMA 4EOMA 3R1QA 2PVHA 5E8ZA 4XOZA 3E8NA 3O8TA 5BMSA 2UZEA 1XH9A 4P5QA 1MRUA 3ZC6A 4UXQA 4AG8A 2XB7A 4IAZA 4AZWA 4FNZA 4AZSA 3R8LA 2UZOA 4TNBA 3QRTA 3N4TA 4RC3A 3GXLA 4ANNA 4EHVA 1WVYA 2FSMX 3BZ3A 2Z7QA 3FLQA 4J7BA 4ANQA 3WYYA 4FEWA 3AXWA 4LRKA 3RP9A 1RE8A 3ORLA 2YERA 1O6LA 3ZO3A 5EM7A 1U54B 2BAJA 5CT0A 3GT8A 4CG9A 3LCOA 2VWUA 3VRZA 4ZTQA 4AQCA 4KNBA 1KOAA 4GV1A 2CPKE 3GUBA 1OKYA 4M67A 4PP7A 4BCMA 3HX4A 4EH9A 3ZBFA 3VBYA 5LWMA 3O2MA 3FLWA 5AA8A 4MKCA 3UG1A 1H27A 1T46A 4ANLA 3VIDA 5KMNA 2ZDUA 4HCTA 3EQRA 5AX3A 5HG7A 4YNEA 3SW7A 4Y85A 4ZIMA 5IH6A 4AE9A 3EMGA 4KS7A 1XBCA 4JI9A 5HBJA 5CVFA 2XRWA 4QPSA 4C62A 4F1MA 1WVWA 3DCVA 5AV0A 3QX4A 5F20A 3R73A 3PA4A 1AD5A 2F7EE 3KC3A 4QPMA 4BTJA 4PPCA 1UU9A 4UY9A 5M55A 5IQCA 4GVAA 5IA4A 3QQHA 3KU2A 4QMMA 2JLDA 4U40A 3PXRA 4LGDA 4U79A 1YHWA 3VW8A 4BZOA 3OXIA 5HD7A 2CLXA 5IQHA 2X7OA 4KIPA 4KKHA 4LL0A 4YZDA 3Q4CA 3A8WA 2ONLC 4F0GA 4RVKA 2X39A 4AOIA 4JR3A 4O6LA 1JWHA 5I3OA 4E6AA 4PF4A 2XJ1A 2OU7A 2R3FA 2RG5A 3HA6A 4H3BA 3T3UA 4TYJA 2OXXA 4DH1A 2RKUA 5EDQA 1WVXA 2WPAA 2H34A 3M1SA 4EH5A 3WZJA 4EOLA 3LFCA 4OTDA 3FMNA 4H58A 4W4YA 4RIOA 2XNEA 3D2KA 2UZNA 2PVRA 3B2TA 3IG7A 4MXAA 4UMQA 5J7HA 2XK4A 2FB8A 3FY2A 4RZWA 5HEZA 4O7RA 1OIQA 4FSQA 3UZRA 4Y5HA 5EHLA 3V5WA 3TUCA 3GCUA 4L46A 2PK9A 2ZB1A 3GC7A 2VWXA 2GS7A 3Q04A 4U0IA 5DG5A 2PVMA 4E5BA 2PZRA 4O27B 3V01A 2ZM3A 3UODA 3JXWA 5FEEA 5M4UA 3KRXA 4QP8A 2WTKC 4F0IA 3NNWA 5KMMA 1E1XA 1YHSA 4FTTA 3L9MA 1PXKA 4MAOA 5CU2A 5CU3A 4ZZMA 1Y6AA 1UNGA 3OFMA 2OJFE 5JK3A 3U9NA 2W5HA 2HY81 4FL1A 4E8AA 4YPDA 4L3JA 2PMNX 3R8MA 2BAKA 5L8LA 4FV1A 3MB7A 3PXZA 4C34A 4XEYA 1DI8A 1XO2B 2CCIA 3FLYA 2HZNA 3MI9A 1PKGA 4KKEA 4XBRA 3FV8A 2VO3A 4ZK5A 4RLKA 5LJJA 3EHAA 5ACKA 3LMIA 2VN9A 5LVMA 2I40A 4YJSA 5DT4A 1RJBA 4A07A 5IDNA 4B4LA 1M52A 2FH9A 3QQGA 4GT3A 2JFMA 3ANRA 4OBQA 4FNWA 4TYGA 3RAWA 4CYJA 4EKLA 3F9NA 3QF9A 4QQ5A 2V5QA 3DU8A 4CFWA 4CKJA 3FZSA 3KN5A 1SVGA 3RWPA 4C02A 4QP6A 3BLQA 2YCFA 4D4RA 5IQIA 4EKKA 3Q4UA 1Q61A 3COMA 2VNYA 2VTNA 1OBDA 2OZAB 4YHJA 4HZRA 4F6WA 4Q9ZA 5J9LA 3NYNA 5I9UA 4K8AA 3BYMA 3A4OX 3C4CA 2YABA 4ZY4A 2C3JA 5BUEA 3LQ3A 5IZFA 4PL3A 4AZVA 4KA3A 3WF6A 3FMLA 3V6RA 2XP2A 1AGWA 1YDSE 2UZDA 5AIKA 3LFEA 5HGIA 2P0CA 4NSTA 4DLIA 1RDQE 4RJ3A 3EQPA 3D83A 2PVYA 1JVPP 2OIQA 3MVMA 2PE1A 2OLCA 4MBIA 4FC0A 3RK5A 1S9IA 4A9SA 3OWKA 3CP9A 2BIKB 1UVRA 3NDMA 3Q96A 4FK6A 1BX6A 2GS6A 3EZVA 3I6WA 1V0OA 4PL4A 4D1SA 4TY1A 2HYYA 4JL9A 5AR4A 4YSJA 5H3QA 3UNZA 2HY0A 3VUHA 1URCA 4KSQA 4MEDA 4YC8A 4O21A 3S00A 3UP7A 2Y9QA 2IO6A 4FV0A 4DTBA 4GMYA 4FV6A 2HZ0A 4X2KA 2ITYA 2OIDA 4FIJA 3MESA 1VYWA 4DFBA 4FBXA 3FXZA 4C4HA 4ALWA 5CAUA 4XOYA 4M69B 1PJKA 4RPVA 1JBPE 2P2IA 4I5HA 4TN6A 2WMUA 3NGAA 1ZOGA 3LOKA 2EB3A 4J1RA 3QLFA 2W4OA 4EHEA 4O7WA 2G2HA 3BE2A 4K9YA 5A4EA 2ZM1A 3SXRA 4Y83A 5HE3A 4ZTSA 3UVRA 4AZTA 4FTQA 4BICA 3BHUA 5JFVA 1H08A 2XM8A 4I21A 2VUWA 4FKGA 5DRBA 4YGAA 5L2WA 4TKSA 4JBQA 2I0VA 3GU4A 5H8EA 4QTDA 4ZSAA 2YCSA 5B2MA 3KVWA 4I0TA 2XVDA 3AG9A 4NZWB 4XV9A 5AUZA 2R3QA 2V7OA 3LM5A 3UQFA 2C68A 2DS1A 1FINA 4F63A 5IA3A 1A9UA 1Q3WA 1VJYA 4GL9A 4KAOA 4BR3A 4EOPA 3MW1A 2YFXA 3FZTA 1T45A 3KXMA 4O2PA 3ZRMA 4DCEA 4MXYA 4EQMA 2QURA 5LMKC 3OUNB 2H6DA 2WNTA 3F88A 1Q99A 5HU9A 3V8SA 3OWLA 4QQJA 3Q2MA 5DNRA 2C6MA 2CMWA 1FMKA 2V62A 4K1BA 3RHKA 1OBGA 3FLNC 4CZYB 3IW7A 3M42A 2HOGA 4D2TA 3WZDA 4NIFA 3ZTXA 5ETAA 3QC4A 2WMBA 5KMIA 1UA2A 2RFNA 1NXKA 1KV1A 2WZJA 4WRSA 3HMIA 1MP8A 5ACBC 3G5DA 3D7TA 3ORPA 2P55A 5HICA 2W1EA 2R64A 3QZHA 3NUXA 2Z7LA 4NM0A 3FMDA 3PRIA 4X6QC 4GFGA 4F65A 1WBTA 4JAIA 1WBNA 5I3RA 5BMMA 3PRFA 4FEXA 5FXSA 4B99A 2BUJA 4OTPA 4LOOA 4KRCA 4Y73A 5D12A 3BIZA 2C6OA 5DHJA 4LYNA 2JAVA 3JVRA 5HBEA 2PMLX 5HIBA 2ESMA 5ETIA 3TJDA 4DFNA 5LMAA 4GSBA 4XUFA 4G6NA 4LQMA 4E5AX 3OCGA 3Q32A 2Z2WA 3LCTA 1P4FA 2UW3A 3PXYA 5AP3A 5JRSA 4DFUA 3P7BA 4AP7A 3LHJA 1GY3A 5DMZA 3TKIA 3QRUA 2ZOQA 4BGGA 4N0SA 5A54A 2GTMA 2I0HA 4L00A 3VHEA 3AC4A 3ZOSA 3MPAA 3V04A 5ICPA 4EUUA 1KE6A 3Q6UA 5TE0A 5HX8A 5AWMA 4F7LA 3I4BA 3LM0A 4FKVA 2RFSA 3B8RA 4MBLA 3VBXA 4CFMA 4FVPA 2R3PA 4O0VA 2W06A 1OECA 3BLRA 1Q8TA 3VUKA 4USFA 1Q41A 2QLQA 4GK4A 3U55A 2OFUA 2WU6A 3BBWA 4D1XA 4I1ZA 5IUHA 3PZEA 4U9AA 5CXHA 3U6IA 5E4HA 3PZHA 1PF8A 5E8XA 5HLWA 5IEYA 3IQ7A 3TNPC 5GIOE 4FTAA 4XCUA 4FT0A 3PXKA 2ZMDA 3BU5A 4E20A 1YVJA 2J0KA 3PIXA 3S1HA 4WUAA 3C4XA 1U59A 5CI7A 2R3OA 2QOLA 1JKSA 1UU3A 5DIAA 5M57A 5HORA 2YITA 3TKUA 2R3KA 4FTRA 4EJNA 3P9JA 4MWIA 3UMXA 3W32A 3RPVA 2OI4X 2Y6OA 2W1GA 4OR5A 2XNNA 4C4EA 4HYSA 2GSFA 3O96A 1WCCA 4RFMA 3HA8A 1YW2A 5HLPA 4BRXA 3TUDA 2RGPA 2Y4IB 3NUPA 1U54A 5IDPA 5AUTA 2QG7A 3ITZA 4J95A 3KCKA 4C38A 4CRSA 3R7YA 5CEOA 3HLLA 4J53A 3RCDA 3LXPA 4RC4A 2WTDA 4NCTC 3HMPA 3QZGA 5EH0A 2EUFB 3DV3A 3WZEA 3RAKA 3Q5ZA 4FG7A 4BKJA 2XK9A 3SC1A 3COIA 2IVTA 3R21A 4EOJA 5ANDA 4YZBA 1YI4A 5FM3A 3R00A 3MFTA 3UZPA 4ZMEA 4M12A 1REKA 4D28A 2WQOA 2AYPA 3CEKA 4EOKA 5CEPA 4ID7A 3CGOA 2XM9A 3AOXA 3HMMA 4D5HA 4BDKA 5LOHA 4HYIA 2PMIA 1GZOA 3GCPA 4L9IA 5CANA 2FVDA 3LFBA 4FT7A 4BI1A 2I0YA 2VTSA 4WBOA 4H1MA 4HGLA 3U87A 1J1CA 2VO6A 3WE8A 3MGYA 4TWOA 5B2KA 3QTWA 4FL2A 4BTKA 4UEUA 2RG6A 3DXNA 5HU3A 5M4FA 5AAGA 2C3LA 1XH8A 1ZXEA 1K9AA 4TWCA 5CT7A 4PTEA 3AMAA 3ACJA 1PXMA 4MD7E 5K3YA 5C27A 4NKSA 2GNLA 3OZ6A 4YURA 4ZLZA 5HE1A 3MPTA 5I0BA 3GGFA 2BROA 4YTFA 3HUBA 1UWHA 3A7IA 4QP2A 5HZNA 3RZFA 4EZ7A 3G15A 5C26A 3R2BA 5J5TA 3SG9A 4X3JA 1BLXA 5HG9A 3S95A 3D5UA 3UC3A 4AGUA 4IZYA 1ZARA 2CGUA 3DK7A 1TQMA 3PSBA 3WE4A 4HGSA 4E7WA 3KN6A 4EOSA 2WQNA 4ORKA 4ZLOA 5AX9A 4AF3A 4DINA 4M0ZA 4S30A 4O82A 2R3NA 2CLQA 3LZBA 4M66A 3PSCA 5CVHA 4GK2A 4CT2A 4YZMA 5CEMA 1LUFA 2QG5A 4I6HA 4EZ3A 2VZ6A 4CEGA 3U4UA 5ANKA 4EUTA 2HWOA 4FV3A 2J0LA 1TKIA 4FTIA 1XKKA 3UVQA 5HO7A 1NVQA 3I5NA 4ASZA 4CCUA 4JX3A 5GJDA 5FEDA 3H10A 4BCOA 1LP4A 4H1JA 5CAPA 2W17A 2QOCA 3FYKX 2RIOA 3DT1A 2HZ4A 4FKLA 1ZOEA 1YI6A 5ANGA 3RM7A 4EOOA 4QTAA 4AA4A 4MXZA 5J9ZA 4IAFA 1BUHA 3L9NA 3E7VA 5GINE 2XIXA 3RGFA 1IAJA 2E9VA 3AT3A 5HNBA 1CKPA 5DBXA 1XWSA 2PUUA 4JIKA 1B39A 4O84A 1CDKA 4AN9A 5A6NA 4ZZOA 2WQMA 4I6QA 2IVUA 2XNBA 4RBLA 4EYMA 5EI8A 2JIIA 4NKAA 4X6RA 1GZNA 4RX7A 5ITAA 4FIFA 3EOCA 4E4XA 4E73A 4NM5A 2CJMA 2ERKA 4J99A 3R2YA 2Z7SA 4J71A 3PJCA 4KB8A 2J90A 3AT2A 3C0GA 2R7IA 4R7HA 5CVGA 3R22A 4O22A 4ZSGA 3O51A 2IVVA 3NUSA 4BDJA 4K77A 2R3RA 3NYXA 1PXOA 1F0QA 4GS6A 1PXNA 3QYZA 5CZIA 5IG1A 5FTGA 4GEOA 4ZTLA 3VS6A 3DS6A 3WF9A 1FQ1B 2O0UA 4K0YA 5KHWA 2YDKA 2PVNA 4QMSA 2OF2A 3ENHA 2JGZA 3LAUA 3GCSA 1Z9XA 4EQUA 1OKZA 1KUTA 2BRGA 3BCEA 2C3KA 3FI2A 2XKCA 4YSMA 3GOKA 3WARA 1Y8GA 4C4JA 5E8UA 3DGKA 3EWHA 3BQRA 4LI5A 4FR4A 4QP4A 4OUCA 3PPJA 2QOFA 5L2SA 5J87A 1UKIA 3OXTA 4O7ZA 2X0GA 3MVLA 4O2ZA 2X9FA 5D11A 3V8TA 5FXQA 2X4ZA 5BVKA 4Y5QA 4BTMA 2C6TA 1FVVA 3FHRA 4PY1A 1J3HA 4AW0A 3LJ1A 3EZRA 4C37A 2C1AA 3UIBA 4F0FA 3V5LA 4C58A 1PW2A 3OEZA 3PA3A 3LVPA 3W2PA 4NU1A 4XG2A 3JR1A 5BX0A 5IISA 2O8YA 2VWZA 4WNOA 3PXFA 1B38A 4AFEA 1OB3A 2XBAA 2UZTA 4FSUA 1B6CB 3PY1A 3UYSA 4A4LA 4FVRA 4FZDB 3NYOA 4G3CA 3EQGA 1TQPA 2J9MA 4IFGA 4JDIA 4R7IA 2YM4A 4OW8A 5IKWA 4JS8A 3UC4A 1YRPA 1U4DA 3NIEA 3OBJA 4YO6A 3E88A 3KRRA 3NNXA 4HCVA 3WF5A 1X8BA 3VS0A 4CGAA 3R8PA 5FLFA 4AOTA 2BRNA 2XF0A 4FSWA 3O17A 2C30A 5EM6A 2QONA 2QOHA 4IZ5A 1YI3A 2QOBA 3UOJA 2VV9A 3H9RA 4OT6A 4I5MA 4WSYA 3WYXA 3GU7A 5BVOA 5JSMA 2CNQA 3BYOA 2UZWE 3IW4A 2XCHA 3EYGA 4IX4A 3A2CA 5DI1A 5JT2A 5FEQA 4QO9A 2IWIA 2XK3A 1XQZA 1VEBA 1H25A 2DYLA 2B9FA 2O5KA 3JYAA 4AT5A 4RIYB 1OL5A 4MCVA 3BX5A 4CV8A 5EQYA 1LEZA 3CTJA 5EYMA 1ZAOA 2F7ZE 2OW3A 4R5SA 4DLJA 4FKSA 3B2WA 1ZY5A 4LUDA 3WF7A 2R2PA 3F3ZA 4FZ6A 4YLLA 3R9HA 4DTKA 2KTYA 1BI7A 5HCZA 3G6HA 5DFPA 2VNWA 2YIQA 3QRIA 4FE2A 3R7IA 2Y4PA 2WTWA 5E8VA 5E1EA 3TIYA 2JKQA 3FHIA 3R8UA 3U4WA 1R78A 4USEA 3LKMA 3C9WA 2ACXA 3I7CA 2UVZA 3QQLA 5FP6A 4WBBB 2IG7A 3QL8A 5DEYA 2WIHA 5FTQA 3UG2A 4EYJA 2QQ7A 1J1BA 1GAGA 5M44A 3F2NA 4NK9A 2OICA 4RJ8A 2UW0A 3FZOA 3ZHPC 2RF9A 3RVGA 4YZ9A 4APCA 4DT8A 2GNIA 1ZYSA 4QMVA 5I9WA 4HVSA 3R7GA 1OI9A 3DKGA 3HKOA 4QTBA 1I44A 3NNUA 4WOVA 5GJFA 5ANIA 2BDFA 4IWDA 2OH0E 3OT8A 4R6VA 4U42A 3V5PA 5M4CA 3AC3A 2WELA 4BDBA 2OH4A 2VX1A 3RK7A 4R3RA 4K6ZA 3D7TB 5KUPA 2VWYA 3ZC5A 2X2LA 3MA6A 4FEQA 3SQQA 3DKOA 3LFAA 3DJ6A 3QRKA 4G6OA 4XG6A 2PVJA 5DR9A 3OUKA 2YJRA 2XS0A 3LIJA 4NTSA 4DFLA 4O7NA 4A9TA 3HVCA 4NM3A 5DH3A 5CSPA 4QMQA 2VO0A 4TYEA 1OIYA 3T9IA 4ASDA 4I22A 3UIMA 4EJ7A 4BGHA 4YC6A 4E5WA 3R9RA 2VGOA 4GT5A 5CASA 3D15A 5CWZA 3DNEA 4BDDA 1H1QA 4J98A 3DQWA 4KABA 4RG0A 2A1AB 4FTLA 3POZA 3C0HA 4EK4A 2IW6A 4OLIA 3WOWA 3ZDIA 4KWPA 3CQEA 4I24A 3D9VA 3R9NA 5J79A 5IA5A 4IDTA 5EKOA 3OTVA 4JXFA 4R1YA 4YNOA 5L8KA 4DGLC 3QHWA 2JIUA 3DZOA 3DY7A 5BPYA 3QUDA 2VTQA 5FDXA 3RNIA 4RWKA 4YR8A 3FZRA 4QQTA 3RPRA 3OTUA 1GIIA 3EIDA 3MV5A 4UV0A 4RA5A 4CFFA 2F49A 2VX0A 5HI2A 2JDOA 4C3RA 2XNGA 1ATPE 1YOJA 4OTRA 4FZAB 4FKRA 4CMTA 5EDPA 3EYHA 3HUCA 2YDJA 5BVWA 4BCKA 3VS1A 5KMJA 2UZVA 3BV3A 3I1AA 2YJSA 3I7BA 2ZAZA 5I9ZA 5IMXA 1JNKA 1Q62A 4HYUA 4L68A 4DH3A 4ALUA 2VTRA 2C69A 3H9OA 4FT3A 2B4SB 4AT3A 4BDIA 4IFCA 2ZV7A 4IX3A 4JDHA 5IEXA 2WGJA 3GNIB 3GU8A 3OOMA 4BL1A 5K5XA 4ENYA 2XNMA 4BCJA 4MNFA 4EBVA 2VU3A 3D5WA 3MH0A 4J96A 4PWNA 5AJQA 2R3IA 1MUOA 2WB8A 4PMPA 4G31A 4UMUA 3ETAA 5FBOA 4AWIA 4L3PA 4O0YA 4WT6A 3G2FA 4C3PA 4EC8A 1WBSA 4NWMA 5AEPA 2F57A 1MQ4A 2Y4IC 2Z7RA 3GOPA 2PSQA 3UIUA 4WD5A 4N57A 2YCQA 3QKMA 4CRLA 4CMUA 5I4NA 4QYEA 5L3AA 4LV8A 4FYNA 3CE3A 4FGBA 4QNYA 2AC3A 3NWWA 2EU9A 4B6LA 4Z7HA 4ACDA 2OBJA 3ERKA 2BMCA 3M2WA 1RW8A 3V8WA 3PXQA 2WQEA 3PFQA 1WFCA 4MNEA 4AOJA 5ETFA 4YU2A 4KUJA 3UDBA 2DQ7X 2X8IA 1E9HA 2UZLA 2ITQA 4GIIA 4O6EA 4QMWA 2XEYA 1JKKA 3P7CA 1OKVA 3TL8A 2BZHB 2AC5A 3C51A 3HDNA 5FG8A 2PVLA 4UZHA 3BHVA 4DF3A 4EEVA 3T3VA 3KMMA 1Q5KA 2WMVA 4ITJA 4TXCA 4DAWA 4RWJA 4PNKA 1H28A 2GNJA 2R3MA 1H4LA 3EFLA 5CF6A 5JKGA 3KL8A 1SZMA 4O0WA 5K5NA 2YWVA 4IZ7A 5F95A 3TTJA 4Q9SA 3QTSA 3MTLA 2XK7A 4DG2E 2C5YA 1LR4A 2F4JA 3TV7A 2X9EA 5JFSA 4FL3A 4PMMA 4YC3A 1TVOA 3BU6A 5HCXA 4FKPA 3UBDA 4HPTE 3TKHA 3LXKA 2J0IA 4BI0A 3Q60A 3PJ8A 4DG0E 4F6SA 3TN8A 5C8KA 2VRXA 5JEBA 3BRBA 4Y46A 5IQEA 3FXXA 2R4BA 3V5JA 3TUBA 5AP4A 1CM8A 3EQCA 1ZYDA 3A60A 5AP7A 2P2HA 3V3VA 5AUVA 5T6KA 4RT7A 3BHYA 1BKXA 3R7UA 1ZYJA 4D0WA 3UYTA 3FQSA 5BVEA 4ACMA 4QPAA 3UO6A 2REIA 4C4GA 3QXPA 3PA5A 1PRYA 4IAAA 1JLUE 3MYGA 4W9WA 2QOIA 5CYIA 3H0ZA 3GP0A 1BI8A 3DKFA 3DFAA 1M17A 2I0EA 2JBPA 3MH2A 4IX6A 4YHFA 5TOZA 3W33A 4E4LA 3FI8A 3GBZA 2W0JA 3L9LA 5M56A 2V7AA 3KGAA 3C0IA 4ACGA 3AD6A 2PZPA 4G2FA 2ERZE 2UW7A 3JY0A 1W0XC 4G9CA 5CU4A 4X2NA 2RSVA 3TV6A 2YIWA 3F66A 4PDOA 3ZZWA 1J91A 4AACA 4O0UA 4EORA 2Q83A 2QODA 2BR1A 5EM5A 3TDVA 1FVRA 1YWVA 2RFDA 4UWBA 3GEQA 3B8QA 3LCKA 3VC4A 2BKKA 1V0BA 3OCTA 2E9OA 5E8WA 2XIRA 4FKWA 4R78A 5AV2A 3K5VA 5M53A 3GB2A 3RTPA 2CGVA 4FF8A 4UBAA 3NLBA 4M68A 3EH9A 3BPRA 2A2AA 4S31A 3E92A 3CGFA 2PY3A 3FAAA 3N4UA 4L42A 4MWHA 4W4XA 3R7OA 2ZYBA 2F7XE 3CIKA 2X81A 4IDVA 3VJNA 1WMKA 1Q3DA 3LFSA 1CSNA 3EFJA 5DPVA 3QWJA 4RIWA 4BCGA 1A48A 4A9RA 3THBA 3K3IA 4M15A 4DBXA 1DAWA 5C4LA 1VZOA 2WEIA 4ANSA 2ZV9A 3KRJA 4C35A 4ITIA 4GU9A 3RPOA 1H1RA 3PJ2A 3NAXA 2JD5A 3W16A 2BCJA 2GQRA 2ZMCA 3BGPA 3QUEA 4R3CA 5IEVA 4BDCA 3LW0A 2WMRA 3TZ7A 4W9XA 2WEVA 2GFCA 4AE6A 3ALOA 4RIXA 3ORZA 2CCHA 3EL7A 2XYNA 5AUYA 4E26A 5AFVA 2VGPA 1J7LA 1WBPA 2YN8A 3C4FA 3IGGA 3OW3A 3TNQB 3SX9A 2XKDA 4TL0A 4O7SA 4RJ6A 3GCVA 1M14A 3OY3A 2GCDA 5DR6A 3TCPA 2R7BA 4K33A 2GNFA 3VQHA 5FGKA 1PMVA 3ZM9A 1H1SA 3LMGA 4XV1A 4CNHA 4I93A 3UOHA 3LFFA 1DS5A 4FZ7A 4YJNA 3P4KA 4Z55A 1G8SA 3TJCA 4KRDA 3S0OA 4O91A 4EONA 3TZMA 3C4ZA 3MIAA 4DH8A 2XA4A 3EN7A 3LE6A 1QL6A 4IEBA 3F5GA 1K2PA 3MA3A 1NVRA 2W1IA 3IONA 4V0GA 4AZEA 3ODYX 4RIYA 5KMKA 4FSRA 2OKRA 2PTKA 3G33A 2BDWA 3SOCA 2X1NA 3A4PA 5CS6A 3MTFA 4I5PA 4BCNA 3HV4A 2XEZA 3R1YA 4R5YA 4ALVA 3ZSIA 2PE0A 2JDRA 1H00A 2BVAA 3DBDA 3DOGA 4B7TA 3EQHA 1Y6BA 4ZZNA 3GU6A 3H9FA 3V6SA 5IA1A 3SVVA 3ZCLA 2O3PA 2PZIA 5CLPA 4G16A 5J95A 3UPXA 4BIDA 4EK3A 4DA5A 2G2FA 5CEIA 4EK5A 4CTBA 3EQBA 5CALA 4V05A 4JG6A 4YZCA 5TKDA 3TEIA 1UV5A 5A6OA 3DBEA 3SW4A 5IQBA 2A4LA 2WMTA 3KK9A 2PYWA 2A19B 2CKEA 1LEWA 3KFAA 4BB4A 4XV3A 4YBKA 4QMPA 2QOKA 1WBWA 4FI1A 3POOA 1H24A 2ETMA 2WMAA 3DZQA 3R9DA 4X0MA 4O81A 2ZV8A 4OTHA 5EQPA 3ZYAA 4D4VA 4FTMA 3W10A 4TYHB 5G1XA 5FD2A 2C5XA 3O8UA 4BF2A 2J5FA 5CQUA 1H0WA 3EB0A 1WAKA 1PHKA 3KEXA 4R3PA 2J0JA 1YWNA 3R1SA 3R6XA 2IW9A 3UGCA 4ZS4A 3MFSA 2NPQA 3UOKA 4USDA 5AM6A 5LCKA 3PWDA 1H8FA 2I6LA 3DB6A 3W2OA 5FDPA 3RPYA 1ND4A 2UW9A 2VWBA 4EH7A 4JBOA 3MY5A 1Z5MA 3ZFXA 4LG4A 5E7RA 5L6WL 5CXZA 2JIVA 3LJ2A 4BZDA 3H30A 1YHVA 3Q2JA 3PWYA 5IQFA 5HVKA 4MD9E 3MPMA 3IKAA 4BWPA 5LMBA 1IEPA 2EXMA 4FEUA 1PMEA 1XJDA 3RWQA 3EL8A 3SV0A 2QO7A 4NJ3A 4BDGA 1XHAA 3QAME 3R1NA 4DH5A 2Q0NA 3E3BX 5L2IA 4PMSA 5C4KA 4RJ7A 3NSZA 4A06A 1R3CA 3PJ3A 4CFVA 2EVAA 5DVRA 1KWPA 4RX8A 4CKIA 5IF1A 4WHZA 4DFYA 4KBAA 4XRLA 4DFZE 4HNFA 3RCJA 4BCHA 3C4WA 4UXLA 5CAQA 4LL5A 3D5VA 3GQIA 4PP9A 4OAVB 3RBWA 3BKBA 4IVAA 1Y57A 3LLTA 2XRUA 4F9AA 2R3HA 2RL5A 3ZZEA 5IQGA 2HK5A 1P4OA 3Q9XA 2HAKA 5L6PA 4L52A 5KO1A 4GG7A 4DTAA 1SYKA 3RJCA 3ENMA 2WD1A 3WIKA 5LVPA 2J4ZA 4LOPA 3NVKI 4EHZA 3OG7A 3VS7A 5JMSA 4LRJA 4R77A 3VULA 1Z57A 5GIPE 1OGUA 2VO7A 2GHLA 4XYFA 3FSFA 2E9UA 3C7QA 1DM2A 4PTGA 3ID6C 2Z60A 4CD0A 2HENA 3BWJA 4YJRA 3DFCB 1V0PA 5HTIA 3QGWA 2GFSA 3MY0A 3GU5A 3R28A 3IDCA 4RA4A 5D10A 2WTIA 2E9PA 3CTQA 4O1OA 2QHMA 5CSVA 4DCAA 1CMKE 5A4TA 4WA9A 4BCIA 5IA0A 4FOBA 3MFRA 5BVDA 3DXQA 1R0EA 2GHGA 3ULIA 2CHLA 4EC9A 3D14A 4OBOA 3FPQA 2J50A 3REPA 3K3JA 3GC9A 3HECA 5HVJA 5KNJA 3HMNA 2YIRA 3PG3A 4QMXA 4UB7A 4ZP5A 4Z9LA 3KY2A 3A7FA 3A7JA 3E3PA 5CF4A 1KE7A 1MQBA 4LOQA 2JDTA 5HTCA 4A4XA 1ZZLA 3DAEA 4FODA 1XH4A 2C6LA 2A27A 3KCFA 3VWAA 1R0PA 3FUPA 3OOGA 3C5IA 2GNGA 1QPJA 3ZU7A 4D2RA 5CSXA 4I0SA 5ANOA 5KZIA 2W7XA 1DAYA 2X2MA 4GJ3A 2BZJA 2W1CA 1IA9A 4NYEA 3C1XA 3KULA 1G8AA 4RX9A 3ORXA 5FP5A 3W2QA 5AA9A 5EW9A 4JRNA 4IANA 4UMRA 3CS9A 3QRJA 3MWUA 2HW7A 3DDQA 3JPVA 3FKNA 2C6KA 5DRDA 3RK9A 3HEGA 4JJRA 4MBJA 4U97A 2QO9A 3IS5A 1QPDA 3CPCA 2GU8A 4IJPA 3HL7A 5G6VA 3A61A 4MNEB 3PVBA 3G90X 2NRUA 3VS5A 5JQ8A 4U8ZA 3SGCA 2AUHA 3U54A 4JIAA 5TT7A 5H9BA 2ITXA 4C8BA 4I6BA 1L8TA 1M2RA 2J7TA 2BDJA 2JITA 3W8QA 1VR2A 2HCKA 3FJQE 4FSNA 4S32A 3C5UA 4II5A 1W7HA 3MVHA 1FBNA 1OPKA 3GI3A 4IWPA 4FICA 1XBBA 4FTCA 1XH5A 4IVBA 2C6IA 1UNLA 2E2BA 4XMOA 4C4FA 5DT0A 4CXAA 2V22A 3FLSA 5FWKK 5ETCA 4IH8A 4D2WA 4C36A 1ZLTA 4OT5A 3VBWA 2VTLA 3IPHA 3NUNA 2BPMA 4BIEA 1Q8WA 3LFDA 2FSOX 3QYWA 3HDMA 4WRGA 3P78A 3W1FA 5L2TA 2SRCA 4PDPA 3O50A 4HCUA 3W2SA 5HX6A 5BUJA 1GZ8A 4O83A 3EN9A 3MS9A 2XK6A 4BBEA 2WXVA 3PVWA 4F64A 5HE2A 4UN0C 4XP0A 3CXWA 2B53A 3FY0A 4FK3A 5CEQA 3ROCA 3IGOA 4M13A 2YCRA 4AAAA 4Q5HA 3LCDA 1CTPE 1ZMUA 2C3IB 3DBFA 4MXOA 2VTPA 4N70A 5CU6A 3KRLA 3UE4A 4ASXA 3G51A 4JNWA 3F7WA 5J9YA 3PDTA 2BZKB 3VHKA 5AADA 2J51A 4E4NA 5LARA 2GHMA 3IOKA 3CQWA 3PG1A 3FSKA 4GUEA 5AP5A 4JQ8A 4ACCA 4BTFA 3FPMA 5GZ9A 3VRYA 3DXPA 3TWJA 4AW2A 1ERKA 3P23A 3A62A 5K4JA 2WU7A 3ZH8A 2NNWB 5AIRA 3IW8A 2CKPA 4QMYA 3NPCA 5T3QA 3ZSGA 4GT4A 5J1VA 4NJDA 5L2QA 2QO2A 3QKKA 4EK8A 4FX3A 3G0EA 3FC2A 3PY3A 3RPSA 4TTHB 3ZXTA 2X4FA 3KREA 4O7TA 5HQ0A 2BHHA 2H9VA 3H4JA 3O0GA 4DC2A 3EFKA 1OIRA 4DEAA 4N6ZA 3CBLA 4MX9A 5A4QA 5FXRA 5M51A 3VO3A 4HVDA 3HMOA 3PSDA 1GIHA 3S4QA 3ZSHA 1W8CA 3DTWA 1I09A 3QTZA 3WF8A 3KMUA 4QOXA 4YTCA 4ZMFA 2OK1A 4C7TA 2B1PA 4YTHA 4CTCA 4MF1A 3G9NA 4ZLYA 1OUKA 3O71A 4PNIA 2QCSA 5EI2A 2UVYA 4F08A 5D7AA 4D1ZA 4AS0A 5I9VA 3R63A 3D5XA 3OCBA 3DLSA 4HNIA 2VX3A 2ITNA 2YEXA 4B8LA 5HD4A 4JG7A 2GTNA 2QHNA 4K11A 1SNXA 4RIWB 4U45A 4DE4A 4NTTA 3WZKA 2HXQA 1GJOA 3MFUA 4IM2A 4CKRA 1J7UA 1OIUA 4G5PA 4RLLA 5L8JA 3VN9A 3FMHA 1JSVA 3EN5A 1GZKA 5EDRA 1H26A 5GHVA 3F3TA 4IB5A 4L44A 3II5A 3VBTA 5JRQA 3L8SA 2BILB 2VWVA 3DAJA 4O0SA 3CC6A 4RIXB 2BFXA 4ZXTA 3BWFA 3TV4A 1J7IA 3TI1A 1ZOHA 3NVMB 5AP0A 3DTCA 3BU3A 2ITWA 4O38A 4IX5A 1WZYA 2XCKA 3DK3A 1FPUA 3VJOA 3MH3A 1Q8YA 3UP2A 4AFJA 3E8CA 5CSWA 2JKKA 5EHOA 2DUVA 5JFXA 3U6JA 2ZVAA 3QCSA 5FTOA 1SMHA 4W4VA 5LXMA 4I3ZA 4M14A 4ENXA 4FYOA 3AGLA 4YUQA 2X8EA 4QT1A 5IUGA 5F1ZA 4PMTA 4U7ZA 4EK6A 5E91A 4HGEA 4DEEA 3VW6A 3A99A 1YWRA 2W5AA 4JDJA 5AP2A 2CGXA 4LGHA 2VTAA 4A9YA 4MK0A 4J97A 4G3FA 5J5SA 2J5EA 4MQ2A 3PPKA 3F6XA 3FL5A 4V0GB 3NZ0A 1ZY4A 2VTJA 5K9IA 2YAKA 3EJ1A 4ZTRA 2UUEA 2V55A 3QHRA 1JSUA 1H01A 4OTIA 3O23A 3W2RA 4ANMA 3D4QA 2ITPA 4L7FA 5K0XA 5T68A 4HGTA 5DLSA 3QC9A 4QP9A 1F5QA 4FV2A 5DA3A 2WMQA 1DI9A 3ZMMA 3OY1A 4ZSEA 3DJ5A 4TYHA 4WG3A 4XHKB 4CVAA 4DG3E 2VD5A 2BALA 3DAKA 3I0OA 3KXZA 3TT0A 1W98A 4N6YA 4GW8A 2X6EA 3QTUA 5CX9A 3KVXA 4ARKA 2XNOA 4UYAA 2IZSA 3LLAA 4P7EA 4DGNA 3ACKA 3RM6A 3NNVA 2FGIA 1UWJA 2GMXA 5HBHA 4B9DA 4BHZA 4BKZA 1IG1A 5TO8A 2YIYA 3OWPA 5CU0A 4FKQA 4DBNA 3UQCA 4TWNA 3VVHA 2QU5A 3Q9ZA 3EFWA 3KF4A 3TDWA 4EWQA 3HRFA 2UZUE 2YM8A 4H39A 1XH7A 2C0IA 3IO7A 3A7GA 3RAHA 4EHGA 4QYGA 4WO5A 3SKCA 4CG8A 3GFEA 4UMPA 4HYHA 5AAFA 4IACA 4E6QA 2B52A 1OPJA 3NRMA 4X7QA 3AC1A 3E7OA 4IADA 4RWIA 5LWNA 3DDPA 5CZHA 5KKRB 4G34A 5BYLA 4IXPA 3Q4ZA 3VUGA 3H3CA 4UWYA 3FEGA 2PVKA 4I6FA 2OXDA 2IZRA 3V5QA 5BVFA 3IDPA 3R04A 3WIGA 4ZAUA 2PWLA 4RJ4A 5AR7A 4CSVA 3W18A 3ZRKA 2WIPA 5LQFA 3VQUA 2WKMA 4B0GA 3Q52A 4ZSLA 4G5JA 2Y7JA 4P2KA 1OITA 3BLHA 4OGRA 3PE2A 3KXHA 4QMTA 3RHXA 3WI6A 5M4IA 5KX8A 1EH4A 1P14A 1HOWA 3UOLA 4JBPA 4G3EA 1OPLA 2VAGA 4O0XA 4BBFA 3BYVA 1H0VA 5HESA 4BWXA 3MH1A 4CQGA 3QD2B 3RALA 4P5ZA 4FKOA 2LAVA 5I9YA 3P7AA 4RVMA 4IC7A 4CZTA 5AUWA 3VNTA 5KHXA 4D55A 2C6DA 3FKOA 3P08A 5F94A 2G1TA 3GVUA 3Q3BA 3OCSA 4J52A 4IB1A 4RQKA 5DR2A 1KE8A 1U46A 2NP8A 3NW7A 3SXSA 5I5ZA 2GDOA 4L43A 4WIHA 1M7QA 2B9JA 4IJ9A 4JBVA 4KIOA 5DEWA 4IWQA 4W8EA 4KINA 2UW4A 4AW5A 1NA7A 2CDZA 2R5TA 2OSCA 1P5EA 3BEAA 4JOAA 2YDIA 3ATSA 2CN5A 4BIBA 5GZAA 4C59A 1OZ1A 2WMXA 3I60A 2UW5A 4Q5EA 4RGJA 2OO8X 4UX9A 3P1AA 3KXGA 3RKBA 4H36A 3SRVB 5AV4A 2I7QA 2HZIA 1OL6A 3D0EA 2OFVA 2OJ9A 1OVEA 3OP5A 4RVLA 4O7LA 3KXXA 2JC6A 3BGQA 3MJ1A 1BL7A 2G01A 1IRKA 2ZDTA 4ANBA 1OM1A 5DOSA 4ZTNA 5A4CA 4HOKA 4DH7A 3FKLA 1KSWA 3KKVA 4P90A 5EFQA 4PDYA 5HO6A 1FOTA 1XBAA 5CSHA 3ROYA 4C2VA 4NT4A 2YM5A 5H8GA 3GC0A 3LFNA 4GVJA 1OL1A 4S33A 5JN2A 2UZBA 3FBVA 1PXPA 2J2IB 2VTHA 3PUPA 4U5JA 3HV7A 4BZNA 3PIYA 3Q9WA 4YJQA 2BTRA 4GCJA 4MXXA 3PLAE 1SVHA 2XBJA 4Z16A 3UVPA 2OJIA 4NFNA 3KULB 5AUXA 4N4SA 3CKXA 1E1VA 4GG5A 4DGMA 4XH6A 4F9YA 4YO4A 4Z3VA 4YJPA 5EKNA 5C8NA 2ONLA 1ZYLA 2WFYA 2Y0AA 3OBGA 4CMOA 2VTIA 2R3LA 3LXLA 4GH2A 1O9UA 5EHYA 4IM3A 4C57A 4Z7GA 4F9BA 1HCKA 3FE3A 4QMZA 3FL4A 3F3UA 4F4PA 1ZYCA 3GFWA 3Q6WA 4X3FB 5AR2A 1XH6A 5GNKA 2ZM4A 4BI2A 1H07A 4GFOA 4QRCA 3OXZA 5AR8A 2C0OA 4EL9A 4FOCA 2GQSA 3MBLA 4GRBA 2W1HA 3DBQA 3TZ8A 5JGBA 1OMWA 5BYYA 2PPQA 5IQAA 4U80A 1Q8ZA 4YTIA 4BDHA 1A06A 1ZZ2A 2YAAA 4AA0A 1H1PA 4EWHA 2O65A 3K54A 2IJMA 2X8DA 3OW4A 2C1BA 3E93A 4LUEA 5IU2A 5JGAA 2QVSE 5HG5A 4DHFA 3R8VA 1H1WA 2CNVA 4FUYA 3UNKA 3BI6A 4XG7A 1PYEA 4O0TA 4XX9A 4QTEA 3PY0A 4H05A 4BCPA 1JKLA 2PZYA 2O2UA 4IAIA 4QP3A 4QTCA 5M07A 3PVUA 4YP8A 4F99A 4IHPA 4W8DA 4IBMA 2IVSA 3OF0A 5H8BA 5IH5A 3A8XA 2B0QA 3CJGA 4HW7A 5JGDA 3ZLWA 3VUDA 1YXSA 2FO0A 3HNGA 3OWJA 4G3DA 4IZAA 4IWOA 4RSSA 5D41A 4BWKA 2CNUA 1QCFA 3L9PA 3HV5A 3AT4A 2IW8A 3CKWA 3SD0A 5KCVA 2WAJA 4IE9A
chains in the Genus database with same CATH superfamily
3I81A 5LVNA 3F82A 2V0DA 5EK7A 2P33A 2Q0BA 5IQDA 3JUHA 3TM0A 5A4LA 3OROA 4TYIA 4IQ6A 5IA2A 2BKZA 2J6MA 3MJ2A 4XG9A 3P79A 3KMWA 2XANA 4CFXA 4NM7A 5EYKA 4EZ5A 3CD3A 1YXXA 5IMEA 1FMOE 4FTUA 1UNHA 2RFEA 3KA0A 5TR6A 2YM7A 4R8QA 5AP6A 2C4GA 3PTGA 4KBCA 3BGZA 3DB8A 4D9UA 4QP7A 5A9UA 3MY1A 2JDSA 1GNGA 3TACA 2ITOA 3Q5IA 4RFZA 4ZJIA 2XH5A 3ALNA 3RINA 3TNIA 2ETRA 2X7GA 5C9CA 3W55A 4GIHA 2XIYA 3H0YA 1VYZA 3HP2A 4KBKA 5EQEA 2BTSA 2FSTX 3COKA 1W82A 3F3VA 4YJTA 2XJ2A 3RMFA 2W4JA 2AQXA 2P3GX 5A3XA 5EW8A 4EH4A 4FVQA 3F69A 4BCQA 4F7JA 3JS2A 4FKUA 2I1MA 5HCYA 4BC6A 4XLIA 4K2RA 4IB3A 4FTJA 4YBJA 5D1JA 5E8TA 2YM6A 2FA2A 3ZO1A 3HAMA 3FI4A 4FSYA 1UU8A 3I5ZA 3ODZX 1LPUA 2W99B 2CKQA 4G9RA 4M0YA 4QP1A 3UJGA 5EG3A 2IZTA 2CKOA 4JDKA 3R01A 4O7YA 4FTOA 3D94A 4U44A 5E92A 1OL2A 4AGCA 2PVFA 3G9LX 4BVUA 3UPZA 2F2UA 4OTWA 5GZ8A 4L6QA 3VUIA 3QD4A 1PMUA 2W1FA 5HNGA 2WOTA 5J7BA 2YLFA 3TXOA 3UZTA 1URWA 3UO4A 4F09A 3ANQA 4AGDA 2F9GA 1PXIA 4U43A 1CKIA 3F5UA 1CKJA 3BEGA 4FNXA 1XR1A 5K4IA 4EH6A 2H8HA 4OAUC 3FYJX 4O7VA 3LQ8A 5DWRA 3Q9YA 2IPXA 2OZOA 5BVNA 1SNUA 4O1PA 4XP3A 3FWQA 1YDRE 2FUMA 4CLJA 1PMNA 4B8MA 3WBLA 4G17A 3RI1A 1QPCA 3F5XA 5EYDA 4L3LA 4DEHA 2W9FB 2ITVA 4FA2A 4FNYA 4XRJA 4QQCA 2CGWA 4V04A 4QMUA 3G6GA 3F7ZA 3OMVA 4Y72A 3ORNA 3Q4TA 3VS3A 3GCQA 4BCFA 4F7SA 4RVTA 1JPAA 4FZFB 3QTIA 3CY3A 4TNDA 3AMYA 3W8LA 3EN6A 3EKKA 1FVTA 4FT9A 3OVVA 4PL5A 4DHJA 2FYSA 3RZBA 2WMSA 3L1SA 4QYFA 4AX8A 2R9SA 2GPHA 4J8MA 4HZSA 4KIKB 3MIYA 2BRBA 4L45A 4U41A 2C0TA 3ZLXA 4CZUA 5LMKA 3U6HA 2PUPA 3U8WA 2JEDA 4MXCA 3R7VA 5HOAA 2CN8A 3A7HA 4FV7A 4AA5A 1HCLA 2QU6A 4F1TA 4JQ7A 4C4IA 2XKEA 3QGYA 4WNKA 2HWPA 2YLEA 3QTQA 4CT1A 2YHVA 2Z02A 2W05A 4ZOGA 4XBUA 5F9EA 4NL0A 1Y8YA 3AD4A 4MQ1A 5M09A 1GOLA 3DNDA 3I6UA 1UKHA 4PUZA 4CLIA 1KE9A 4DEIA 5C01A 3DK6A 3EQFA 3KXNA 4XJ0A 2JKMA 2PHKA 3P5KA 5B2LA 4U3ZA 3QD3A 4I23A 4A4OA 2QD9A 3BBTB 4M7IA 4C2WA 4GKIA 4R7BA 4IVCA 4ANOA 3HRCA 4JT3A 3EN4A 2NO3A 3KB7A 3K2LA 4JX7A 2Z8CA 3DQXA 5CF8A 4AN3A 1KV2A 3CLYA 3FMMA 2HXLA 4RFYA 2HW6A 4FTKA 4IC8A 4RC2A 3NIZA 2R0IA 4JLCA 4D2VA 4E6DA 3VUMA 4Y95A 3L8VA 4X21A 4IVDA 3TMOA 4ITHA 2R3JA 2OG8A 2W1ZA 4ERKA 2YZLA 2UW8A 2YM3A 4AGWA 3JY9A 4NW5A 4UALA 1IAHA 4FKJA 1YQJA 3NW6A 5KZ0A 1OKWA 4CFUA 3CJFA 5HNIX 4PPAA 1TZDA 3DPKA 3QQKA 3QZIA 1PY5A 2UW6A 4IIRA 4L67A 3NR9A 5EW3A 4FUXA 5KKRC 3V51A 4F70A 3W0NA 3ZUTA 4XNEA 4KIQA 3TNWA 3NW5A 2OWBA 2PL0A 4I5CA 4FT5A 4PV0A 3N4VA 4M97A 2GNHA 3R0TA 3O8PA 4CCBA 2JBOA 3PYYA 4I41A 2C47A 4I0RA 2X6DA 5L4QA 4F7NA 4EI4A 1KOBA 4J8NA 3ORMA 3SLSA 4DGGA 5JFWA 4DITA 3W0QA 3NCGA 4JRVA 3EQDA 5AMNA 4D2SA 3QA0A 4Q2AA 3AD5A 5JH6A 4YHTA 4H3PA 3G0FA 4YJOA 4QMNA 2XIZA 1RQQA 5AV3A 4E4MA 3CSVA 3Q53A 4MH7A 3ZUUA 4DFXE 1U5RA 2XARA 3EQIA 3NEWA 4TZRA 1WBVA 4FV4A 1W84A 4WNPA 4PDSA 3QKLA 4UMTA 3SRVA 4ZY5A 4I20A 3ZO2A 3QLGA 4NCTA 4E6CA 2JFLA 5E1SA 3GQLA 4DGOA 4YJVA 1TQIA 3VS4A 1BMKA 2IEWA 1M7NA 2W4KA 3KF7A 4FKTA 4CV9A 1ZMVA 2X2KA 4OTQA 2VWIA 3UO5A 4HVGA 4G3GA 5DYJA 3O7LD 1ZMWA 3QXOA 4FV5A 2XMYA 4E3CA 3QALE 3GENA 4L53A 1IA8A 2QI8A 1NY3A 2C5VA 4BJJA 3QA8A 3DJ7A 5CF5A 4HPUE 5J8IA 4F6UA 2ETKA 1W83A 2W1DA 5B7VA 4ZEGA 3ZUVA 5IH4A 1Y91A 4XG8A 1PYXA 4PQNA 4E93A 5J1WA 3ET7A 1ZWSA 1R39A 4BDAA 2EXEA 2ITZA 2XKFA 3M11A 4A9UA 5LVOA 5GJGA 5D7VA 3HV6A 2BRMA 2PZ5A 3VF9A 2IN6A 2Y6MA 2XUUA 2JKOA 2QKWB 4ZS0A 1NVSA 2BRHA 5KBRA 3SA0A 3DA6A 3NUUA 3RAIA 3ZXZA 4FV8A 2QOOA 4GUBA 4MF0A 4JAJA 4K18A 3FQHA 2QLUA 4EBWA 2BFYA 2XNPA 5IUIA 4QD6A 3QBNA 2G2IA 5E8YA 5F4NA 2QR7A 3AC8A 1YXTA 4KSPA 3SG8A 2GS2A 1M2PA 2QNJA 1Q97A 3L8XA 1REJA 3CTHA 2WHBA 4FG8A 4X3FA 3NUYA 5DT3A 2B7AA 1F3MC 2B9HA 3QFVA 4RJ5A 4NH1A 2H96A 3PPZA 3QQUA 3LQ5A 3OD6X 4TPTA 3ORTA 2C5OA 5HVYA 1G5SA 2DWBA 4G6LA 3CCNA 1JOWB 2XIKA 5M08A 3U51A 4BKYA 4I94A 4FSMA 3ZDUA 4CFNA 3KK8A 4I6LA 2CSNA 2R0UA 2YA9A 4HVIA 3BHHA 2C6EA 3LPBA 4BY9E 4XG3A 3D2IA 2ITTA 5AAEA 5D9HA 3C13A 4G1WA 5B0XA 4KKGA 1U5QA 2PMOX 1NT2A 2UV2A 4X3FC 5FUTA 5JZJA 3ATTA 3F2AA 3BQCA 3MVJA 3FI3A 3PIZA 4FG9A 5LVLA 2IZUA 2QOQA 3QZFA 4YLJA 3ZFMA 1Q24A 2A0CX 3PP1A 5CEKA 3R9OA 1O6KA 4E1ZA 4O96A 2QC6A 3IW6A 4XLVA 5JQ5A 3QCXA 3TTIA 3OT3A 5CNOA 3D7ZA 3QQFA 3ELJA 4MYGA 3C50A 3R30A 2C5NA 3NAYA 3NS9A 4RQVA 5HIEA 3FQEA 3FLZA 3QX2A 4OTGA 4ZSJA 3FXWA 2WTKB 3UNJA 4FIHA 3LCSA 1PKDA 3P86A 4BYJA 3O7LB 4FSTA 4C0TA 2W96B 3VBQA 4WG5A 3FMJA 1SVEA 3PLSA 4IW0A 4PRJA 2PU8A 1G8JA 4RWLA 2W5BA 1YOMA 1AQ1A 4ACHA 5CAVA 2VTMA 3FDNA 3HP5A 4X2JA 2GQGA 4FTNA 4ASEA 1OL7A 4XV2A 4APPA 1JSTA 4LMNA 1O6YA 2JDVA 4IAYA 5HE0A 4C33A 2XJ0A 4W4WA 4JG8A 4U81A 4LM5A 3N9XA 4WUNA 3CPBA 4GU6A 4Y8DA 4GJ2A 4L7SA 3TG1A 5A46A 4KD1A 2BAQA 3HV3A 4FIEA 3SXFA 3CD8A 4CQEA 4O4CA 3E87A 4WG4A 1IR3A 3V5TA 4C61A 4ZTMA 4GYIA 4FV9A 5CENA 5BNJA 3F2RA 3AQVA 4L01A 1IASA 4U3YA 2PUIA 2WQBA 5HHWA 3LMHA 3QWKA 3VUTA 2OZAA 4BBMA 4RRVA 3ZEWA 4FKIA 2R3GA 1L3RE 2XK8A 4UYNA 3ZM4A 4AT4A 3PE1A 4EH2A 3U9CA 5C8MA 5CTPA 1QPEA 4RMZA 4TW9A 4NUSA 4DT9A 3DKCA 4UWCA 5KMLA 3ORIA 4TRLA 3IW5A 2LGCA 3CQUA 2ITUA 3ULZA 4BHNA 5HO8A 3GC8A 4AUAA 2EB2A 5AM7A 1FGIA 2PUNA 2B9IA 3ZONA 4YJUA 5JZNA 4AW1A 1KE5A 2F2CB 2WMWA 2WTJA 4ZTHA 3W2CA 4JMQA 2VTTA 3QCQA 4YZNA 4BDEA 2B55A 1MRVA 3MSSA 3QCYA 4MVFA 4OBPA 4EH8A 4M8TA 3HAVA 3ZS5A 5BUIA 4HVHA 2QR8A 3SOAA 3QTXA 3UQGA 3HRBA 2OJGA 4O0RA 4IMYA 4NEUA 3TZ9A 4TT7A 1QMZA 5HLNA 5K0KA 3FMEA 4ONAA 4LV5A 1PXLA 2Y8OA 1JAMA 4NW6A 4DEBA 2EXCX 2OIBA 2VTOA 5M06A 5ANJA 4O86A 5KBQA 2W9ZB 4BDFA 2BZIB 4F9CA 4EOIA 3R02A 4LGGA 3R7EA 1MRYA 4JR7A 2KULA 3IECA 3UIXA 5HG8A 1YOLA 2X7FA 3BYSA 4LRMA 3NX8A 5CAOA 3MDYA 3WILA 4XP2A 4M69A 4F9WA 3IK3A 4ERWA 4YPSA 3PUFC 4R1VA 3DLZA 4X2FA 4KIKA 1M2QA 5CQWA 4JQEA 3TYKA 3E5AA 4YMJA 4TWPA 3OHTA 3MB6A 5ANEA 3SAYA 3VS2A 1OUYA 3OEFX 4BYIA 4PTCA 2G9XA 5C1QB 4C3FA 5FQDC 5AR5A 2OF4A 3VAPA 5EYCA 3CY2A 1UU7A 5AP1A 1Q8UA 4S2ZA 1YKRA 3QTRA 3L8PA 4PPBA 4A7CA 4DHIB 4L8MA 3JVSA 2HELA 4X2GA 4D4SA 4D9TA 2YISA 4QYHA 3E8DA 4AXAA 4ZJVA 2JAMA 1STCE 3AMBA 3FC1X 3WZUA 5IPJA 1YDTE 5LCJA 1JQHA 2E9NA 3K5UA 4XS2A 1YXUA 3RNYA 2WOUA 3SDJA 3QUPA 4FMQA 2OGVA 4QYYA 2UVXA 4MTAA 3BYUA 4P4CA 3E62A 5TF9A 5A14A 4HJOA 4WSQA 2A98A 4H3QA 4DEGA 3PJ1A 4O4DA 1NW1A 4BGQA 3NCZA 3T9TA 4RX5A 3QU0A 4M3QA 3EKNA 5BQ0A 4KS8A 4DN5A 3HGKA 2ZJWA 3NUAA 2ZB0A 3AC5A 1YXVA 5H2UA 3PVGA 4I4FA 1Q4LA 1SM2A 4GK3A 4AN2A 3N51A 2WTCA 1K3AA 3AC2A 4OTFA 4GKHA 2PULA 3ML1A 3BELA 3ZRLA 3BHTA 4F1OA 5CI6A 5C03A 3LFQA 3ZO4A 4EOQA 3IDBA 3OS3A 4IM0A 5E8SA 4D4YA 2HIWA 3DBCA 4I92A 3ORKA 4QNAA 2FSLX 2OXYA 3HYHA 1S9JA 5DE2A 3IOPA 4QMOA 3KRWA 3C4EA 3FZ1A 4NFMA 4LFIA 5AV1A 2G15A 2O63A 3UTOA 3VBVA 3VF8A 5FM2A 2B54A 1JKTA 5CNNA 2PE2A 2VWWA 4DEDA 2EWAA 5EOBA 5I9XA 4IAKA 4NIFB 3ZFYA 1WBOA 4IB0A 4FIGA 3QQJA 4M84A 3P0MA 4JVGA 5EI6A 5HIDA 2YZAA 2WTVA 3I79A 3BE9A 5CY3A 3E8EA 4U6RA 3F5PA 5DN3A 3KQ7A 1GIJA 5DGZA 5AUUA 4FGRA 2P4IA 3OC1A 3LJ0A 1BYGA 4ZJJA 4FEVA 4GFMA 4I4EA 5BYZA 5L6OA 1APME 3COHA 5KE0A 4FIIA 3LXNA 1BL6A 4D2PA 3R71A 5HTBA 3CR0A 1V1KA 3F3WA 3R8ZA 3UMWA 4WKQA 4YLKA 2WO6A 3QD0A 3F61A 1R1WA 2YWPA 1PXJA 1ZRZA 4MD8E 3E63A 3FMKA 4UZDA 4LMUA 3TIZA 4CYIA 3BV2A 3I0QA 3SHEA 3ZEPA 3ZBXA 4QMLA 4MHAA 1FGKA 3PP0A 4S34A 4RZVA 4WNMA 2OJJA 5HKMA 4FSZA 2NRYA 4ZY6A 2O64A 2YACA 4BFMA 3NYVA 5E90A 3R83A 5KMOA 3FZPA 3BL7A 5EM8A 1G3NA 5FRIA 4D0XA 4D5KA 3NMUF 1P2AA 2YIXA 4AZFA 4V01A 5AR3A 3T8OA 4AU8A 4EH3A 2J0MB 4EQCA 2XZSA 3E64A 4GYGA 2BHEA 4BN1A 4D58A 2XYUA 5FBNC 2QKRA 4PX6A 5EOLA 2BIYA 5E9EA 3AGMA 3HZTA 4XG4A 3MN3A 3ZLYA 2ZV2A 3S3IA 3TNHA 3ZLSA 4DYMA 4EOMA 3R1QA 2PVHA 5E8ZA 4XOZA 3E8NA 3O8TA 5BMSA 2UZEA 1XH9A 4P5QA 1MRUA 3ZC6A 4UXQA 4AG8A 2XB7A 4IAZA 4AZWA 4FNZA 4AZSA 3R8LA 2UZOA 4TNBA 3QRTA 3N4TA 4RC3A 3GXLA 4ANNA 4EHVA 4BJJB 1WVYA 2FSMX 3BZ3A 2Z7QA 3FLQA 4J7BA 4ANQA 3WYYA 4FEWA 3AXWA 4LRKA 3RP9A 1RE8A 3ORLA 2YERA 1O6LA 3ZO3A 5EM7A 1U54B 2BAJA 5CT0A 3GT8A 4CG9A 3LCOA 2VWUA 3VRZA 4ZTQA 4AQCA 4KNBA 1KOAA 4GV1A 2CPKE 3GUBA 1OKYA 4M67A 4PP7A 4BCMA 3HX4A 4EH9A 3ZBFA 3VBYA 5LWMA 3O2MA 3FLWA 5AA8A 4MKCA 3UG1A 1H27A 1T46A 4ANLA 3VIDA 5KMNA 2ZDUA 4HCTA 3EQRA 5AX3A 5HG7A 4YNEA 3SW7A 4Y85A 4ZIMA 5IH6A 4AE9A 3EMGA 4KS7A 1XBCA 4JI9A 5HBJA 5CVFA 2XRWA 4QPSA 4C62A 4F1MA 1WVWA 3DCVA 5AV0A 3QX4A 5F20A 3R73A 3PA4A 1AD5A 2F7EE 3KC3A 4QPMA 4BTJA 4PPCA 1UU9A 4UY9A 5M55A 5IQCA 4GVAA 5IA4A 3QQHA 3KU2A 4QMMA 2JLDA 4U40A 3PXRA 4LGDA 4U79A 1YHWA 3VW8A 4BZOA 3OXIA 5HD7A 2CLXA 1VLRA 5IQHA 2X7OA 4KIPA 4KKHA 4LL0A 4YZDA 3Q4CA 3A8WA 2ONLC 4F0GA 4RVKA 2X39A 4AOIA 4JR3A 4O6LA 1JWHA 5I3OA 4E6AA 4PF4A 2XJ1A 2OU7A 2R3FA 2RG5A 3HA6A 4H3BA 3T3UA 4TYJA 2OXXA 4DH1A 2RKUA 5EDQA 1WVXA 2WPAA 2H34A 3M1SA 4EH5A 3WZJA 4EOLA 3LFCA 4OTDA 3FMNA 4H58A 4W4YA 4RIOA 2XNEA 3D2KA 2UZNA 2PVRA 3B2TA 3IG7A 4MXAA 4UMQA 5J7HA 2XK4A 2FB8A 3FY2A 4RZWA 5HEZA 4O7RA 1OIQA 4FSQA 3UZRA 4Y5HA 5EHLA 3V5WA 3TUCA 3GCUA 4L46A 2PK9A 2ZB1A 3GC7A 4QDEA 2VWXA 2GS7A 3Q04A 4U0IA 5DG5A 2PVMA 4E5BA 2PZRA 4O27B 3V01A 2ZM3A 3UODA 3JXWA 5FEEA 5M4UA 3KRXA 4QP8A 2WTKC 4F0IA 3NNWA 5KMMA 1E1XA 1YHSA 4FTTA 3L9MA 1PXKA 4MAOA 5CU2A 5CU3A 4ZZMA 1Y6AA 1UNGA 3OFMA 2OJFE 5JK3A 3U9NA 2W5HA 2HY81 4FL1A 4E8AA 4YPDA 4L3JA 2PMNX 3R8MA 2BAKA 5L8LA 4FV1A 1ST0A 3MB7A 3PXZA 4C34A 4XEYA 1DI8A 1XO2B 2CCIA 3FLYA 2HZNA 3MI9A 1PKGA 4KKEA 4XBRA 3FV8A 2VO3A 4ZK5A 4RLKA 5LJJA 3EHAA 5ACKA 3LMIA 2VN9A 5LVMA 2I40A 4YJSA 5DT4A 1RJBA 4A07A 5IDNA 4B4LA 1M52A 2FH9A 3QQGA 4GT3A 2JFMA 3ANRA 4OBQA 4FNWA 4TYGA 3RAWA 4CYJA 4EKLA 2XALA 3F9NA 3QF9A 4QQ5A 2V5QA 3DU8A 4CFWA 4CKJA 3FZSA 3KN5A 1SVGA 3RWPA 4C02A 4QP6A 3BLQA 2YCFA 4D4RA 5IQIA 4EKKA 3Q4UA 1Q61A 3COMA 2VNYA 2VTNA 1OBDA 2OZAB 4YHJA 4HZRA 4F6WA 4Q9ZA 5J9LA 3NYNA 5I9UA 4K8AA 3BYMA 3A4OX 3C4CA 2YABA 4ZY4A 2C3JA 5BUEA 3LQ3A 5IZFA 4PL3A 4AZVA 4KA3A 3WF6A 3FMLA 3V6RA 2XP2A 1AGWA 1YDSE 2UZDA 5AIKA 3LFEA 5HGIA 2P0CA 4NSTA 4DLIA 1RDQE 4RJ3A 3W0SA 3EQPA 3D83A 2PVYA 4AXCA 1JVPP 2OIQA 3MVMA 2PE1A 2OLCA 4MBIA 4FC0A 3RK5A 1S9IA 4A9SA 3OWKA 3CP9A 2BIKB 1UVRA 3NDMA 3Q96A 4FK6A 1BX6A 2GS6A 3EZVA 3I6WA 1V0OA 4PL4A 4D1SA 4TY1A 2HYYA 4JL9A 5AR4A 4YSJA 5H3QA 3UNZA 2HY0A 3VUHA 1URCA 4KSQA 4MEDA 4YC8A 4O21A 3S00A 3UP7A 2Y9QA 2IO6A 4FV0A 4DTBA 4GMYA 4FV6A 2HZ0A 4X2KA 2ITYA 2OIDA 4FIJA 3MESA 1VYWA 4DFBA 4FBXA 3FXZA 4C4HA 4ALWA 5CAUA 4XOYA 4M69B 1PJKA 4RPVA 1JBPE 2P2IA 4I5HA 4TN6A 2WMUA 3NGAA 1ZOGA 3LOKA 2EB3A 4J1RA 3QLFA 2W4OA 4EHEA 4O7WA 2G2HA 3BE2A 4K9YA 5A4EA 2ZM1A 3SXRA 4Y83A 5HE3A 4ZTSA 3UVRA 4AZTA 4FTQA 4BICA 3BHUA 5JFVA 1H08A 2XM8A 4I21A 2VUWA 4FKGA 5DRBA 4YGAA 5L2WA 4TKSA 4JBQA 2I0VA 3GU4A 5H8EA 4QTDA 4ZSAA 2YCSA 5B2MA 3KVWA 4I0TA 2XVDA 3AG9A 4NZWB 4XV9A 5AUZA 2R3QA 2V7OA 3LM5A 3UQFA 2C68A 2DS1A 1FINA 4F63A 5IA3A 1A9UA 1Q3WA 1VJYA 4GL9A 4KAOA 4BR3A 4EOPA 3MW1A 2YFXA 3FZTA 1T45A 3KXMA 4O2PA 3ZRMA 4DCEA 4MXYA 4EQMA 2QURA 5LMKC 3OUNB 2H6DA 2WNTA 3F88A 1Q99A 5HU9A 3V8SA 3OWLA 4QQJA 3Q2MA 5DNRA 2C6MA 2CMWA 1FMKA 2V62A 4K1BA 3RHKA 1OBGA 3FLNC 4CZYB 3IW7A 3M42A 2HOGA 4D2TA 3WZDA 4NIFA 3ZTXA 5ETAA 3QC4A 2WMBA 5KMIA 1UA2A 2RFNA 1NXKA 1KV1A 2WZJA 4WRSA 3HMIA 1MP8A 5ACBC 3G5DA 3D7TA 3ORPA 2P55A 5HICA 2W1EA 2R64A 3QZHA 3NUXA 2Z7LA 4NM0A 3FMDA 3PRIA 4X6QC 4GFGA 4F65A 1WBTA 4JAIA 1WBNA 5I3RA 5BMMA 3PRFA 4FEXA 5FXSA 4B99A 2BUJA 4OTPA 4LOOA 4KRCA 4Y73A 5D12A 3BIZA 2C6OA 5DHJA 4LYNA 3VONA 2JAVA 3JVRA 4FRFA 5HBEA 2PMLX 5HIBA 2ESMA 5ETIA 3BL9A 3TJDA 4DFNA 5LMAA 4GSBA 4XUFA 4LV7A 4G6NA 4LQMA 4E5AX 3OCGA 3Q32A 2Z2WA 3LCTA 1P4FA 2UW3A 3PXYA 5AP3A 5JRSA 4DFUA 3P7BA 4AP7A 3LHJA 1GY3A 5DMZA 3TKIA 3QRUA 2ZOQA 4BGGA 4N0SA 5A54A 2GTMA 2I0HA 4L00A 3NFFB 3VHEA 3AC4A 3AKJA 3ZOSA 3MPAA 3V04A 5ICPA 4EUUA 1KE6A 3Q6UA 5TE0A 5HX8A 5AWMA 4F7LA 3I4BA 3LM0A 4FKVA 2RFSA 3B8RA 4MBLA 3VBXA 4CFMA 4FVPA 2R3PA 4O0VA 2W06A 1OECA 3W0PA 3BLRA 1Q8TA 3VUKA 4USFA 1Q41A 2QLQA 4GK4A 3U55A 2OFUA 2WU6A 3BBWA 4D1XA 4I1ZA 5IUHA 3PZEA 4U9AA 5CXHA 3U6IA 5E4HA 3W0OA 3PZHA 1PF8A 5E8XA 5HLWA 5IEYA 3IQ7A 3TNPC 5GIOE 4FTAA 4XCUA 4FT0A 3PXKA 2ZMDA 3BU5A 4E20A 1YVJA 2J0KA 3PIXA 3S1HA 4WUAA 3C4XA 1U59A 5CI7A 2R3OA 2QOLA 1JKSA 1UU3A 5DIAA 5M57A 5HORA 2YITA 3TKUA 2R3KA 4FTRA 4EJNA 3P9JA 4MWIA 3UMXA 3W32A 3RPVA 2OI4X 2Y6OA 2W1GA 4OR5A 2XNNA 4C4EA 4HYSA 2GSFA 3O96A 1WCCA 4RFMA 3HA8A 1YW2A 5HLPA 4BRXA 3TUDA 2RGPA 2Y4IB 3NUPA 1U54A 5IDPA 5AUTA 2QG7A 3ITZA 4J95A 3KCKA 4C38A 4CRSA 3R7YA 5CEOA 3HLLA 4J53A 3RCDA 3LXPA 4RC4A 4DHZA 2WTDA 4NCTC 3HMPA 3QZGA 5EH0A 2EUFB 3DV3A 3WZEA 3RAKA 3Q5ZA 4FG7A 4BKJA 2XK9A 3SC1A 3COIA 2IVTA 3R21A 4EOJA 5ANDA 4YZBA 1YI4A 5FM3A 3R00A 3MFTA 3UZPA 4ZMEA 4M12A 1REKA 4D28A 2WQOA 2AYPA 3CEKA 4EOKA 5CEPA 4ID7A 3CGOA 2XM9A 3AOXA 3HMMA 4D5HA 4BDKA 5LOHA 4HYIA 2PMIA 1GZOA 3GCPA 4L9IA 5CANA 2FVDA 3LFBA 4FT7A 4BI1A 2I0YA 2VTSA 4WBOA 4H1MA 4HGLA 3U87A 1J1CA 2VO6A 3WE8A 3MGYA 4TWOA 5B2KA 3QTWA 4FL2A 4BTKA 4UEUA 2RG6A 3DXNA 5HU3A 5M4FA 5AAGA 2C3LA 1XH8A 1ZXEA 1K9AA 4TWCA 5CT7A 4PTEA 3AMAA 3ACJA 1PXMA 4MD7E 5K3YA 5C27A 4NKSA 2GNLA 3OZ6A 4YURA 4ZLZA 5HE1A 3MPTA 5I0BA 3GGFA 2BROA 4YTFA 3HUBA 1UWHA 3A7IA 4QP2A 5HZNA 3RZFA 4EZ7A 3G15A 5C26A 3R2BA 5J5TA 3SG9A 4X3JA 1BLXA 5HG9A 3S95A 3D5UA 3UC3A 4AGUA 4IZYA 1ZARA 2CGUA 3DK7A 1TQMA 3PSBA 3WE4A 4HGSA 3AKKA 4E7WA 3KN6A 4EOSA 2WQNA 4ORKA 4ZLOA 5AX9A 4AF3A 4DINA 4M0ZA 4S30A 4O82A 2R3NA 2CLQA 3LZBA 4M66A 3PSCA 5CVHA 4GK2A 4CT2A 4YZMA 5CEMA 3AKLA 1LUFA 2QG5A 4I6HA 4EZ3A 2VZ6A 4CEGA 3U4UA 5ANKA 4EUTA 2HWOA 4FV3A 2J0LA 1TKIA 4FTIA 1XKKA 3UVQA 5HO7A 1NVQA 3I5NA 4ASZA 4CCUA 4JX3A 5GJDA 5FEDA 3H10A 4BCOA 1LP4A 4H1JA 5CAPA 2W17A 2QOCA 3FYKX 2RIOA 3DT1A 2HZ4A 4FKLA 1ZOEA 1YI6A 5ANGA 3RM7A 4EOOA 4QTAA 4AA4A 4MXZA 5J9ZA 4IAFA 1BUHA 3L9NA 3E7VA 5GINE 2XIXA 3RGFA 1IAJA 2E9VA 3AT3A 5HNBA 1CKPA 5DBXA 1XWSA 2PUUA 4JIKA 1B39A 4O84A 1CDKA 4AN9A 5A6NA 4ZZOA 2WQMA 4I6QA 2IVUA 2XNBA 4RBLA 4EYMA 5EI8A 2JIIA 4NKAA 4X6RA 1GZNA 4RX7A 5ITAA 4FIFA 3EOCA 4E4XA 4E73A 4NM5A 1ST4A 2CJMA 2ERKA