3DB8A

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 041
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
261
Chain Sequence
b'KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-isoxazolopyridines as Polo-like kinase inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 70
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3db8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3db8A01
1OL2A 3AOXA 5J7BA 1UU3A 3I79A 1Z57A 1V1KA 3SXRA 5J5TA 3KCKA 4ANSA 3NGAA 4TYJA 4E1ZA 3EL7A 5CU6A 3PVUA 2GS6A 3O7LB 1YHWA 3C7QA 3Q9WA 3QQLA 4FBXA 3TKUA 3AT3A 3HDNA 1OB3A 2Y8OA 3KRRA 4LL5A 4ANBA 4UMRA 3ORTA 4FNWA 3PG3A 1PXKA 3F3ZA 4BR3A 4S31A 3RI1A 4W4WA 5E9EA 1OL7A 2Y9QA 3JS2A 1DAYA 3ZZWA 4L7FA 5EM5A 3ZLYA 3ATSA 4G17A 2WZJA 4O0SA 3R8MA 2VZ6A 4DTAA 4U45A 4HVDA 3BRBA 1I44A 2A4LA 1YQJA 4DYMA 2HZNA 2W1DA 4OTFA 3SHEA 3V5LA 4CLJA 3AMBA 2EB2A 1T45A 3WYYA 3P86A 3DXPA 3ORIA 3RK5A 1NVSA 4QMLA 4S2ZA 2A1AB 2BALA 3KRJA 2QG7A 4C3FA 3WE4A 4QP1A 5BYZA 5T6KA 5IH5A 2ITOA 5EK7A 1GOLA 2YCQA 5ANGA 2HY81 3QD4A 4FTQA 5HVYA 2WMQA 4FNZA 2VAGA 3RPSA 3HRBA 4BB4A 2VTMA 3CC6A 4U42A 3G51A 4OR5A 3KXMA 2VWVA 2P2IA 4X3FA 2CDZA 3TTIA 2EVAA 2UZVA 4D0WA 4DFZE 3GCUA 4FKSA 3WZJA 4RFYA 3W2CA 2VTAA 3BLRA 4JDJA 3WIKA 4KA3A 3GEQA 4BTMA 3KCFA 4OTWA 4AGWA 3PE2A 4LQMA 5HI2A 4TL0A 4AA5A 4O7ZA 3R21A 4WOVA 4ONAA 4RVLA 1IEPA 4JAJA 5DE2A 4AACA 2BTSA 3EKKA 4BRXA 3VW8A 1SYKA 3R1QA 4IX4A 4F1MA 4XG4A 4YC3A 5EHYA 2GPHA 4IX3A 4J98A 3POOA 5FP6A 2CJMA 2UW3A 2C3LA 3PRFA 4YJVA 3BV3A 5HG8A 3O71A 2ZJWA 2WOUA 2I0EA 4UX9A 2C3IB 5IA4A 3TT0A 3T9TA 2HZ4A 4LUDA 4Z7HA 2GNGA 4BI0A 5LOHA 5IISA 3QF9A 1WBSA 1SM2A 3G15A 2DS1A 1YVJA 5T3QA 5KMMA 4L00A 4P90A 5IZFA 1R1WA 4I22A 3W2OA 1RDQE 1Y8YA 4L9IA 4FV3A 4K77A 4C4EA 1UA2A 3AGLA 2XBAA 3QRJA 1FVRA 4EOPA 5JFWA 3KA0A 5J1WA 4O6LA 1OKYA 4AZFA 5M4IA 1JVPP 5BQ0A 5JH6A 5M08A 3KY2A 4WT6A 4EZ7A 2XEYA 4DFBA 3D5WA 5HNBA 5LARA 5H9BA 4NUSA 4DTKA 5M51A 3UIBA 4O84A 5AUYA 4BGQA 4TW9A 3UOJA 4IZAA 1H1WA 3EN4A 4IZYA 4FE2A 1YXSA 1H01A 2JAVA 4TYGA 5DRBA 2W1EA 2FSLX 1NXKA 3R00A 2Q0NA 2QO9A 4S32A 1YWVA 3B8RA 2WEIA 4FIEA 4ALWA 3RZBA 3LXNA 2B4SB 3CKXA 5B2KA 3EJ1A 2R4BA 3GU6A 2IG7A 2QKWB 2JKQA 3LKMA 5LVNA 5HQ0A 2YA9A 3MJ1A 5IMEA 2J0MB 2UW0A 5CTPA 5AMNA 1JOWB 3W2SA 3ZZEA 4AGDA 2XYNA 3DBFA 4Z16A 1CDKA 2CCIA 2O2UA 2XJ0A 5C1QB 1ZOGA 2XNMA 4AFJA 3C13A 3QQGA 5DEWA 2XNEA 4XCUA 4LL0A 1OI9A 1Q97A 4GVJA 4ORKA 4AW1A 3F2AA 3OEFX 4BIDA 4YP8A 2QURA 5FEEA 1JPAA 4GV1A 5D1JA 4RX5A 4MXZA 2XUUA 4RC4A 4JG7A 4A9SA 2PUIA 4X6QC 4LYNA 2PU8A 2QOFA 3MFRA 4EKLA 5KUPA 3LFSA 3M1SA 2HK5A 4A9RA 1UNHA 1REKA 4O0TA 4ZS0A 1PMVA 4F9CA 5CU0A 3HEGA 4F63A 3PA5A 3PDTA 4EOIA 4IXPA 3ZRKA 4RIWB 2GCDA 1O9UA 3KL8A 4BDDA 4ZTRA 4WNPA 2V55A 4IIRA 5HO6A 4C59A 3HMNA 1OECA 3DOGA 4KWPA 2XA4A 4N0SA 3C4WA 2BIYA 3MVHA 1UV5A 3FZPA 3CTJA 4IAKA 4NKSA 4Y83A 5HE2A 3TACA 3ULIA 4E6AA 2QHNA 3G0EA 5HG5A 4KSQA 3PVGA 2YJRA 5I9ZA 4I0SA 4YC8A 5LVMA 3BBTB 1H1RA 3Q04A 5HLNA 2GQRA 3L9LA 3CGOA 4DG2E 3DQWA 4OGRA 3PRIA 1DS5A 1YI3A 3IPHA 3BWJA 5GJGA 5IDPA 4FTMA 4FT5A 2WB8A 3QKKA 4BTJA 2CGWA 3RPVA 2BR1A 5BVDA 4ALUA 2X7FA 1ZYSA 4C2WA 2R3KA 2FO0A 4FV1A 4RIXB 2ONLC 4YHTA 3DBEA 3KEXA 3UNJA 3DS6A 3H10A 4KBKA 4B8LA 3QHRA 4BI2A 1DM2A 5HE1A 4GFOA 3PXQA 4BYJA 2YCRA 3CP9A 3QKMA 4YURA 3VS4A 2JFMA 4RZWA 4PNIA 3GC9A 3G33A 4ZJVA 5M56A 3FY2A 5L8JA 1YI6A 3IW7A 4QMZA 3S3IA 3ET7A 5CAUA 5J9YA 3NVKI 2PHKA 3P4KA 4UV0A 3COIA 4FT9A 4D5HA 3TDVA 1GZKA 3ZYAA 1XR1A 4GK2A 2XM9A 4ZZMA 3NYNA 4L6QA 3TDWA 3ORMA 4IB0A 3N4VA 5FUTA 1BMKA 3EH9A 1SNUA 2Y6MA 3VBXA 2PMOX 4A4XA 1H8FA 3Q2MA 3D5UA 1Q8WA 2RF9A 3R28A 4FIGA 2IVVA 3UC4A 2XK7A 5CSWA 1JNKA 2PVRA 3QALE 3HMIA 3OY1A 2WMRA 3TV4A 2GNFA 2G2FA 3FLYA 4GT5A 1Z5MA 4RWLA 4R7HA 3CPBA 4QTDA 4IMYA 5BMSA 3VS6A 2CNVA 5A3XA 2UVZA 1OIUA 4NIFB 3U87A 1WMKA 3QRTA 1WBPA 4FT3A 2UZEA 2LGCA 1UWJA 2J5FA 3PXZA 5CT7A 3E8NA 5JQ8A 2O3PA 2OF2A 4IVDA 2DQ7X 3DBDA 4NTTA 2PK9A 3Q60A 2WO6A 1PXNA 2VTQA 1YWRA 4FV2A 2BFXA 3VRZA 5HIBA 3NUNA 3TG1A 5IF1A 3BIZA 3C5IA 3P0MA 3FKNA 3LAUA 5HE3A 5F1ZA 2YISA 3Q9ZA 4J8MA 5FTOA 3UTOA 2C6LA 2HELA 4CEGA 3BYSA 4NCTA 3QWJA 1A9UA 5H3QA 1H07A 1V0BA 4XV2A 3LVPA 4EHVA 2ETKA 4FV0A 4O7NA 5JSMA 4TYHA 1R0PA 1M2RA 4ZSGA 2I7QA 4EK8A 2PTKA 3LXPA 3EQRA 4EUTA 4IE9A 4Z7GA 2PZRA 5FEQA 4R8QA 3MIAA 3KMUA 3DKOA 1RW8A 3AD5A 5B0XA 3KMMA 5GIPE 2ZB0A 3F61A 4U8ZA 5HESA 3SOCA 4AS0A 5JRSA 4JIKA 4FZAB 1SZMA 3H4JA 2DWBA 4C3RA 4E8AA 2PULA 1PYEA 3ZLWA 2ITTA 3DGKA 2UW4A 4GK4A 2XIKA 3ZXZA 4IX6A 4C62A 4LRKA 3NX8A 5B2MA 3PSCA 3NIEA 4IAYA 4X2FA 1IAHA 2I0YA 2BDJA 3R9NA 4AOTA 2YM3A 4ITHA 4DCEA 5FWKK 3NZ0A 4CFMA 5KMLA 3EQBA 3CLYA 3NNUA 3Q52A 1XH8A 2X9FA 3BE9A 4U80A 3DQXA 2F4JA 3UYSA 1CKJA 1TQMA 3QCYA 4BCHA 4YU2A 1M2QA 5IA0A 4FOBA 3NNXA 3D7TB 4TWPA 4EZ3A 3TTJA 4MTAA 3VW6A 3LMIA 4GKHA 3NYOA 3GT8A 3LFFA 2QOKA 1OIRA 3FXXA 3EYHA 4M7IA 5F20A 1H1SA 4OTPA 4I4FA 3GB2A 5AP7A 3R7IA 5E1EA 3LJ1A 1PXJA 1J1BA 3NS9A 3BHHA 2UZUE 1HCLA 3BPRA 4MXXA 3I6UA 2I1MA 2UZWE 3FQEA 4QMVA 4D9TA 4GU9A 4AWIA 5M4CA 2QQ7A 2IZSA 4O0XA 2CKOA 4D4SA 2ETRA 3A7HA 4BBMA 3G9NA 3LCOA 5AR2A 1PXLA 3B8QA 3DK6A 3D0EA 4BZNA 4H3PA 5CU4A 4DF3A 2RIOA 4W9WA 5BVNA 2VGOA 2OF4A 1FOTA 4C2VA 4E20A 4CKRA 3SG9A 2Y6OA 4HW7A 4ALVA 5EKNA 4QYYA 4C38A 1WCCA 3FV8A 2OK1A 4M14A 3E5AA 5KX8A 3RP9A 3PUPA 3H9FA 4J95A 5CAVA 4AW5A 3MTLA 5K5NA 1FVVA 2P55A 2VX3A 5CXZA 4JBVA 4CFVA 3QUEA 3HMOA 4M97A 3ZEWA 5CSHA 4NM5A 4PMSA 2EXEA 4AGCA 1RJBA 2XVDA 1TKIA 4RIYB 3VF8A 2X0GA 5EI6A 4C4GA 4DT9A 3AG9A 4BCNA 4U3YA 5EKOA 4M84A 3MV5A 4APPA 3AD6A 5IUHA 5E8SA 1W7HA 2R2PA 1PY5A 2WFYA 3COKA 5A6NA 1OKVA 1M17A 3KK8A 1W98A 3TN8A 2RKUA 2OJ9A 5CANA 2C0IA 2Z02A 3QUPA 4IAAA 3RPYA 3BE2A 4BKYA 1AD5A 2J7TA 2V7OA 5A14A 2UW9A 5CF5A 3HRFA 4FG7A 1FMKA 2KULA 2F7XE 3UYTA 3W18A 3TKIA 4HGSA 3COMA 3RMFA 1FGIA 4C3PA 2YCFA 4UYNA 4EK4A 4I4EA 4LMNA 4X3JA 4FYNA 5BUEA 2W1FA 3FMLA 3IS5A 4EJ7A 3C0GA 2QOLA 4ENXA 4WKQA 3LLAA 2GHLA 2VO7A 1XQZA 3R7UA 3UPZA 2WIPA 5KCVA 3OTUA 3PPKA 3O7LD 3ODYX 4QYHA 4BBEA 4CMTA 1HCKA 5E4HA 4F65A 4IC7A 2HXQA 4E7WA 4DEEA 4C7TA 3FL4A 2OSCA 4QTCA 2G1TA 1IA8A 4BZOA 2IW6A 4KIKB 2B9JA 2O64A 3PJ2A 3FMMA 3ZC5A 5IUGA 2ITQA 1KOAA 3AMYA 3D94A 4JDIA 4V0GB 3RNIA 3VBTA 3V8SA 4PF4A 4GKIA 4S34A 4H1MA 2NO3A 5HO8A 5IA1A 2XNBA 4BCKA 4D2PA 5DPVA 3HZTA 4FKPA 3RHKA 3OMVA 5EHOA 2VTNA 2F57A 3BZ3A 4R1VA 3LFAA 3MVMA 3EFJA 4XOYA 2QOOA 3DBCA 4O0VA 3Q4CA 4DG0E 4KS7A 3FI3A 3HYHA 3QD3A 1SVGA 3DAJA 3GI3A 4QQTA 4YHFA 4RQVA 5A4EA 2C6KA 3PIZA 4AA0A 2OI4X 4YZNA 5E8WA 2W4OA 2WTVA 4WNKA 4D2VA 1BI8A 2VTOA 3CD8A 4AT4A 1IG1A 3BU5A 5DT0A 3R8LA 5IQCA 3A7JA 3KQ7A 3IDPA 4IBMA 4A07A 5DT3A 4AE6A 4AZVA 5BX0A 3GQLA 3VUGA 3ZDUA 4QP4A 4Y95A 4CGAA 4J8NA 4AT3A 4XV3A 4YUQA 2J0JA 4HGEA 4LOOA 4YHJA 4C57A 1UNGA 3F5PA 3L8PA 2PPQA 2PYWA 5AWMA 4D2TA 4G6NA 4OBOA 2YLEA 3S4QA 5HORA 2BAQA 3LXLA 4XMOA 2R3OA 3LXKA 4FL1A 4QTBA 2OGVA 5EM6A 5IQEA 2WTIA 3F3WA 4AG8A 3BKBA 4GCJA 5CAQA 4BCQA 4G9RA 3LFCA 5CI7A 2W05A 2EXCX 5JZNA 3HVCA 4NKAA 5EI8A 4FSYA 4P2KA 5JFXA 3DCVA 3E8EA 4CG8A 1Q4LA 4FX3A 3D7TA 5HEZA 4EH5A 4FZ7A 3G0FA 3IO7A 4MXAA 4FIJA 4J7BA 2OICA 4NZWB 1ZRZA 1JQHA 3P08A 5LWMA 4IAIA 1G8AA 3LZBA 4FZFB 1BKXA 4EH8A 5HBJA 3DA6A 2R3GA 2OXYA 3A7GA 3UMWA 3ANRA 5ACBC 3WZDA 2XCKA 3MIYA 2GTMA 4DT8A 3TUDA 3HV4A 4B8MA 4JX3A 1XBCA 4HVIA 2ZB1A 4YJOA 5AR5A 4WIHA 2V62A 4XS2A 1UWHA 2B9FA 3AXWA 3CQWA 2IW8A 4FIHA 3FBVA 2F2UA 2Z7QA 3VS3A 3H9RA 4YGAA 2WMSA 3TNIA 1PRYA 4I21A 3A4PA 2C30A 3C4FA 5FXRA 4P5QA 2R7BA 2R3QA 3HL7A 2OH4A 4EBVA 2ONLA 4IC8A 2A27A 5HLPA 4FC0A 1PF8A 3SXFA 3ZO4A 4DH5A 3KC3A 2VNWA 4KSPA 4FEXA 2W0JA 3M2WA 4QYGA 2WIHA 2OZAA 3QGYA 4FG8A 4F1OA 5GJDA 3UOHA 5IEYA 1L8TA 5D12A 3VBQA 4BCFA 3BCEA 1LEWA 1YXTA 2C0TA 5AA9A 4PX6A 5ICPA 3NR9A 4KABA 3BHYA 3GOPA 2BZIB 2AYPA 1YXVA 2ZYBA 3B2TA 4RLLA 1PMNA 2C68A 4RIYA 4UMQA 3NNWA 4ZSLA 5FP5A 4C36A 2R3JA 4BKZA 1SVEA 3DJ7A 4QNAA 4IVBA 3HGKA 5JFSA 1REJA 2BUJA 2WQBA 4GUBA 5HGIA 3N4UA 5J9LA 5H2UA 1PHKA 5AUVA 4DFYA 3TV7A 2EUFB 4J52A 1OVEA 4HPUE 4J1RA 2VRXA 5KHXA 4BHZA 2XIXA 3VUMA 1F0QA 1W83A 2QONA 5IA5A 4I5MA 5M06A 4UMTA 2ESMA 3A7FA 3VS1A 4RG0A 2E9OA 3A4OX 1J7IA 2WMTA 4K6ZA 1P5EA 3QX4A 4NL0A 3CQUA 3AC4A 4Y85A 4YJQA 4OAUC 2J9MA 4WRSA 1J3HA 4AX8A 2OFUA 4PV0A 4E6QA 3EB0A 3T8OA 3IG7A 4C37A 4FSWA 3V3VA 2PE2A 4BKJA 5LVPA 1QPDA 5HTCA 2ERKA 5DR9A 1LEZA 5HHWA 5EQPA 3ZONA 2X8IA 3QQJA 4FKWA 3MPTA 3TKHA 2R3RA 3OCTA 2I40A 3PSBA 3SRVA 3Q5ZA 4I0RA 4U97A 4XG2A 3M11A 4ACCA 3AC5A 4JT3A 4W8EA 3VQUA 5HICA 4HCUA 5AX3A 4KIKA 2IJMA 3MESA 2ITYA 3A99A 5HBHA 2HENA 4FTOA 3SLSA 3G6GA 4DBNA 4BDIA 2WNTA 4G3FA 4RVTA 4C35A 4DEIA 3C1XA 3EQHA 2PSQA 3KRXA 4PDOA 2J51A 4GS6A 3BHUA 4W4VA 2PMNX 3AMAA 3QGWA 4QQCA 1OKWA 1H1PA 5F94A 3AGMA 4TPTA 4ACGA 3BWFA 2YWVA 1F5QA 2BZKB 4EOKA 2XIYA 3RALA 3MBLA 3FQSA 3QWKA 4LUEA 3DB6A 2RGPA 3ACKA 4KRDA 3QA8A 5HD4A 2WEVA 5JGDA 4Q2AA 4B0GA 2PVMA 4O2PA 2UW5A 5LMKC 2XJ2A 3KVWA 3NUAA 4DGLC 5AP6A 5KZ0A 2QKRA 3FLQA 4DEBA 3EYGA 4WUAA 4CVAA 3GCVA 4D2WA 1NY3A 2WU6A 4WBOA 3LE6A 3FC2A 3HAMA 5EDQA 4Q5EA 3I0QA 3QA0A 4BDAA 1QMZA 5KBQA 5JMSA 2OIDA 3IKAA 3UIUA 3QX2A 3TXOA 5A54A 3PJCA 4DGNA 4JL9A 1NVRA 3QL8A 3LJ2A 5AUZA 2ETMA 5AV3A 2BIKB 5AUUA 4BCJA 1O6KA 1PJKA 4I6HA 4U0IA 3NCZA 4CXAA 1ZOEA 2JBOA 2HZIA 4E4XA 4BICA 4EOQA 4BGHA 1KE5A 2BVAA 4EOLA 4I93A 3MDYA 3JVSA 4C0TA 4R7BA 4DCAA 3LOKA 1YKRA 1YXUA 4OUCA 3ODZX 2HWOA 3QBNA 4F9AA 3OW4A 2YZAA 4BVUA 2F7EE 3QQKA 4V05A 3IGGA 3KULB 2J50A 4TTHB 1W8CA 4NM3A 5IA3A 3NUPA 4M69B 3FXZA 3D15A 4EH6A 5AP2A 3UGCA 4II5A 3DKCA 3JVRA 3IGOA 3JPVA 3SQQA 2BKKA 5IMXA 3CJGA 1M7NA 2HY0A 3OP5A 4YZCA 4K9YA 1JKSA 3UODA 4FGBA 5D11A 2Y4IC 2JFLA 2H6DA 1VYWA 3E64A 3F6XA 4FYOA 4A9UA 4IX5A 5ETIA 5CNOA 1ZYLA 4KIPA 5HCXA 1R39A 4BDJA 2X39A 4N57A 4FV5A 2X6EA 2UZOA 5H8EA 4XG9A 2QOCA 2QU5A 1OL1A 3HA8A 4OTRA 3D9VA 3F88A 2CNUA 3L9NA 3I7BA 2OW3A 3I5NA 1V0OA 3EMGA 4F08A 4IFGA 2WD1A 3ORNA 3QKLA 4FKLA 2Y4PA 4GL9A 4RJ7A 1H00A 2J5EA 5EYKA 5D10A 2ZV8A 2Z7RA 3AC3A 2UZLA 3DFAA 3TIYA 3PZEA 4KNBA 3TJDA 2UW8A 3LMHA 4QP3A 4CMUA 3AC2A 2JAMA 3SV0A 1JAMA 4Q9SA 3OCGA 4TZRA 3CEKA 4KINA 4IWQA 3E88A 2E2BA 4RJ3A 4EK6A 2VWUA 4EOMA 4YMJA 4I92A 5AAGA 4C4JA 1NW1A 4ZOGA 2X8DA 4JIAA 3BYOA 2PVKA 4YLKA 3VVHA 5KE0A 4BI1A 3PG1A 4N6YA 4QQ5A 3UC3A 1PXIA 5C4LA 2XKCA 2BTRA 2EXMA 1E9HA 5I3OA 4ZJIA 1JKTA 4U41A 4L3LA 3FMHA 1M52A 4EHGA 2XKFA 3WOWA 4BHNA 4W4YA 4CNHA 2FVDA 3HRCA 3OG7A 3IONA 3R6XA 2W9ZB 5JRQA 4X21A 3OROA 3OUKA 5LMAA 4EORA 4KKGA 1ZY4A 5IEXA 4JOAA 4UXQA 3K5VA 3W2QA 4AAAA 2JITA 3C51A 5ETCA 4F6SA 3D14A 3BHTA 5HCZA 2CGUA 4RSSA 4PL4A 2PWLA 3DDPA 3EN9A 3DNEA 3BYVA 3P7BA 4I5CA 4O0RA 4R3PA 4UZHA 4G9CA 4CFUA 4EH3A 3BLQA 2GS7A 3LHJA 4NYEA 2YABA 2R3NA 5F4NA 3R83A 4WNMA 3F7WA 1OM1A 2ZDUA 3MPMA 3OBGA 4I6BA 4KS8A 4AXAA 4ZJJA 3GNIB 5A4LA 1MRVA 3NUYA 3VBWA 3HMMA 4FL2A 4MYGA 4DBXA 1YRPA 2W7XA 2BFYA 4AT5A 5KMIA 3NW6A 3D83A 5GZ9A 5HZNA 2C6MA 4HOKA 1PXOA 1UU8A 4BDGA 3KKVA 5DWRA 3QQHA 4IQ6A 4R3CA 4UALA 2YERA 1UVRA 5I4NA 1WBWA 4FKVA 4G6LA 4ZEGA 4NH1A 1ZARA 3R63A 4QP6A 1JSTA 5BYYA 4A9YA 3FWQA 3E87A 4QNYA 3W32A 4DLJA 3C9WA 4FSQA 3N4TA 1YWNA 5JT2A 1M2PA 4FICA 5AM6A 3RINA 4M0ZA 3OXZA 4JRNA 4APCA 4RA5A 1VJYA 4MWHA 2VTLA 4YBKA 3HV5A 4ITIA 1OIQA 5F95A 3FLSA 3UOKA 4GG5A 3OUNB 4TY1A 5AR8A 1MRYA 4FT7A 4L44A 3WF9A 5BUJA 3DXNA 4AW0A 3U55A 3RCDA 2JEDA 3U4UA 3VHEA 2C6DA 4O7VA 3HMPA 4CZTA 5K4JA 3QFVA 2YDKA 1O6LA 1Q3WA 1WAKA 2ERZE 3UNKA 3HUCA 2B0QA 3OT8A 3PTGA 3OCBA 3DLSA 3P79A 3OBJA 3IW5A 2GNIA 3P1AA 4GEOA 2X2LA 1IAJA 2R0UA 3MFTA 2FYSA 5AM7A 2JDSA 2Y4IB 1YW2A 2J2IB 3GGFA 4HJOA 1Q24A 3NAYA 3QLFA 4JXFA 2VN9A 2OWBA 2YAKA 2YEXA 3KN6A 3L9PA 2BMCA 3PE1A 2VWWA 1H26A 1WBVA 4QD6A 2GSFA 3WF6A 4D1ZA 1U5QA 3VF9A 4TKSA 4LRMA 4O38A 2VGPA 3SDJA 3M42A 3Q53A 3NRMA 4YZBA 4IAZA 3DTWA 1Q5KA 4QPMA 4ACMA 1Y57A 4HNFA 3W8QA 3QXOA 4GT3A 3DJ5A 2X1NA 4I94A 3UVRA 2V5QA 3CIKA 4E3CA 3RM6A 2BRNA 3H3CA 4ANOA 1UU7A 4F9YA 1AGWA 2F7ZE 2J6MA 2XP2A 4GIIA 4ZMFA 2RFDA 4X0MA 5K3YA 3UE4A 4O7TA 4L42A 4ZTHA 1J7LA 4XEYA 2R3FA 3SXSA 2EWAA 2Y0AA 5JZJA 2VO3A 4MWIA 4M67A 4AF3A 4CRLA 3GU4A 3EL8A 4L3PA 4FKIA 4JRVA 3WF7A 5ETAA 4MKCA 5BNJA 4E4MA 3JY0A 4KKEA 3CSVA 2R3IA 4C33A 4JS8A 5EDPA 3AC8A 1ZYJA 2ITUA 3Q4UA 2WAJA 4BCGA 4D1SA 2BKZA 3MW1A 3V5PA 4R7IA 4PP9A 1YI4A 3TEIA 1B39A 3R9RA 3DK7A 4WUNA 4QMWA 5DR6A 2P4IA 4JJRA 3ANQA 3K54A 3FUPA 3W55A 4CCUA 4HPTE 3TM0A 4LGDA 3TNPC 4CZUA 3V51A 4O0UA 2BHHA 4G3GA 3Q5IA 4D2SA 1ZYDA 4YJSA 3E3BX 1U46A 1MQBA 2EU9A 3TZ9A 4DHFA 2R0IA 4XNEA 1CMKE 4IB3A 2JKOA 3PY0A 4E5BA 3QTXA 4G3EA 1I09A 4WBBB 2PMLX 3UP2A 3FZRA 4BCPA 2CCHA 4JDHA 4FTKA 5IPJA 3R2YA 4KAOA 4FEUA 4BDEA 4AGUA 4DFXE 2FSOX 4D1XA 3MY5A 5DFPA 5M53A 3U6JA 3QYWA 4BDCA 3PSDA 5EG3A 3I5ZA 2R9SA 2PVYA 4IDVA 3EZRA 3R8UA 2W1IA 4XLVA 3G9LX 4UWBA 4UN0C 2JDRA 4ZSAA 1KV1A 5BUIA 3R7GA 4EH7A 4QT1A 3O8PA 4D4YA 5DA3A 4NM0A 3UZRA 3VN9A 5DMZA 4LOPA 3OWKA 4NU1A 5D7AA 3QCSA 2IVTA 1UKHA 2HW7A 4RJ8A 4C34A 1XWSA 4GH2A 5J9ZA 4BFMA 3RHXA 3HV6A 4IM0A 2H34A 2YHVA 4IDTA 2J90A 4YPDA 5JK3A 2R7IA 3PYYA 5A9UA 3PXFA 4WSQA 5KMNA 4CFNA 4E4LA 4OTGA 2E9PA 4AE9A 4E5WA 4E93A 3FE3A 2QLUA 3PJ8A 5LMKA 4XP3A 2XNNA 3F3UA 3GCPA 3KK9A 2QD9A 3C5UA 2P3GX 4ACDA 4IB5A 3GBZA 4Y72A 3OY3A 2NNWB 3R1NA 5JGAA 3FJQE 3FL5A 4C61A 1J91A 4L45A 2IW9A 4E5AX 3U51A 3VS2A 1GZ8A 1IRKA 2X9EA 3MGYA 3PY3A 3QHWA 4NK9A 3ZLXA 4ENYA 4F1TA 2WTDA 5J8IA 4QYEA 2HZ0A 4TYIA 3O17A 4MXCA 5HCYA 3RAKA 3I1AA 3T3UA 3WF8A 3MH3A 4D58A 5DBXA 3CE3A 2C5XA 2C6TA 4CFFA 5AAEA 1BLXA 4RA4A 2ZVAA 5AP4A 1ZOHA 1WVXA 2P33A 3QD0A 3H9OA 4ZY4A 2GQGA 2JD5A 3CY3A 4RX8A 3ZUVA 4AW2A 3ZU7A 3PIYA 2RG5A 3MFUA 3TWJA 5TOZA 3FSFA 3PXRA 1P4FA 4RWKA 2UVXA 4MD9E 4OT5A 3FEGA 2BZJA 5FXSA 4ZY6A 1KWPA 1J1CA 3ENMA 4FTTA 2WU7A 2ZDTA 3BU3A 2X7OA 3IW4A 1H4LA 5KBRA 2WKMA 4PNKA 4MBJA 1H0VA 3IQ7A 3A2CA 3SG8A 3BGPA 5DHJA 4BY9E 2YFXA 1APME 3MA3A 3QC4A 4O2ZA 4AZSA 4QMNA 3MB6A 2PZPA 5F9EA 1MRUA 5KNJA 2ZAZA 5L2TA 3TUBA 3RBWA 3VUIA 4I5PA 2VTJA 2ZOQA 3WF5A 3ERKA 4N4SA 4RIWA 3TI1A 4FVQA 4M66A 5HNGA 4MNFA 3LLTA 2OG8A 3HAVA 3QTUA 5FM2A 3Q9YA 3AD4A 3H30A 5EOLA 4EWHA 3LFBA 4L46A 4OBPA 4EBWA 4YSJA 5CEMA 4UYAA 5EDRA 2FH9A 1IASA 3P23A 5EQYA 3E63A 3CQEA 4DGOA 3O51A 4HCTA 1URWA 5KMOA 1OZ1A 4O7WA 2J4ZA 4W4XA 5FEDA 4BCOA 3UOLA 1OBDA 2AUHA 4P4CA 3R9HA 4PP7A 4PPAA 4ANMA 4F70A 3LMGA 2WQMA 3OF0A 3A62A 3QC9A 4JQEA 4QMYA 3VULA 1PMEA 3O8UA 4AN3A 4ANQA 1G5SA 4JNWA 3OD6X 4Y5QA 1LUFA 2JKMA 2CKQA 3QUDA 3F2NA 4F0IA 3PPZA 4WG4A 4RIXA 5A6OA 4FTIA 2X81A 4LV5A 4I0TA 5BPYA 2XIZA 3JY9A 2WQNA 4K11A 4PDPA 5AUTA 3NMUF 4YTHA 2PUUA 2VTTA 1GNGA 2C3JA 1G3NA 3O96A 4O83A 3IDCA 4EQCA 1SMHA 3BX5A 3FYJX 5FM3A 4EOSA 3I0OA 4GW8A 4LGHA 1OPLA 2B54A 5EM8A 3AT4A 1ZMWA 2A0CX 3LM5A 4O86A 2QI8A 2P0CA 3V01A 5M07A 3GC8A 3MS9A 4XHKB 4F0FA 4NTSA 3F66A 2GHMA 2YM5A 2Z7SA 4KRCA 2CHLA 4GSBA 4RQKA 3TZ7A 3LCSA 5DG5A 4H05A 4XG7A 4YO6A 1KE8A 1XBAA 3RPRA 3ALOA 4X3FC 4AZEA 5A4CA 2WELA 3TUCA 2WMBA 2WTJA 1ATPE 4PPBA 3RAHA 3TNWA 1WBOA 4DA5A 4M13A 5IQBA 4ZTSA 4EI4A 2W1HA 3H0ZA 4QQJA 3MA6A 4YLLA 4DE4A 4NIFA 2B1PA 2P2HA 4CV9A 2GS2A 2YLFA 4IJ9A 2JBPA 3V5JA 5K0XA 2RFNA 4IANA 4IVCA 4F9BA 4G34A 5CEKA 2JLDA 4F09A 2I0VA 4XX9A 1RE8A 3OS3A 3UG1A 5C26A 2JC6A 3FMNA 3MI9A 3NWWA 3FLZA 3U6IA 3MY1A 5E7RA 4BBFA 1ZZ2A 5DR2A 4FOCA 2OBJA 2BDWA 4K2RA 3Q4TA 5M55A 3ENHA 3R0TA 3K2LA 1QPEA 4UWYA 2FSMX 3W2RA 4DGGA 3ZH8A 4YTFA 4F99A 2H96A 4F6UA 4UMUA 4EZ5A 4YZ9A 4MX9A 2ITPA 4NW6A 3QCXA 4MK0A 3ITZA 4U43A 3TNQB 3W1FA 2PZYA 3VUDA 5C8KA 2ITWA 3HECA 3R1SA 4I6QA 5LWNA 4UMPA 4PTEA 2NRUA 3ZHPC 3D2IA 3SD0A 5I9VA 4LM5A 4DH1A 4OTHA 2BRHA 4XG8A 1XH5A 3UQCA 2YIXA 4HYHA 4UEUA 1Z9XA 5CEOA 4MQ1A 4YPSA 4YC6A 2C5NA 1AQ1A 3EKNA 3GENA 1URCA 4FUYA 4E4NA 4EC9A 3KFAA 4F7SA 1V0PA 3GQIA 3OTVA 2YJSA 1GY3A 3MJ2A 3ROYA 5JEBA 3PJ3A 4H1JA 4B6LA 1FQ1B 1SNXA 4CKJA 4XBRA 2C1BA 4CKIA 5AV4A 3BEAA 5E1SA 2I6LA 5JFVA 4DH8A 5M57A 2UZTA 4FVRA 2J0KA 3MVLA 1B38A 2B9HA 3DZQA 3VJOA 5ANIA 4E26A 4U79A 5GINE 5EH0A 5BVKA 4OTIA 3LFEA 3IW8A 4FTNA 5EHLA 2XKEA 3R7OA 3VWAA 4BWPA 3EQGA 2RG6A 4EKKA 5IG1A 3R04A 5M4FA 1W82A 3CBLA 3QU0A 4O21A 5C8MA 2R64A 5FTQA 4DG3E 3FMJA 4MF1A 5CASA 3ZUTA 4NEUA 5DGZA 4QMMA 2JIUA 3CCNA 4P7EA 3G90X 5LXMA 5LMBA 3GCQA 2IN6A 2VNYA 4J96A 5AFVA 3P9JA 4FTRA 3VUKA 4CYIA 2YM4A 3S2PA 1JLUE 3QTQA 4XH6A 5CVGA 3WARA 4XBUA 2OJGA 4U3ZA 4YSMA 3VAPA 4AN2A 5AR3A 5K0KA 4HYUA 4JDKA 3Q6UA 5HVJA 4O82A 3Q96A 2W5AA 2OZOA 3EIDA 3E92A 2XM8A 1E1XA 3GFWA 4FKTA 4FODA 4MXOA 1FVTA 4G31A 3TL8A 3VBYA 3PA4A 4D28A 2QR8A 2Z8CA 3CJFA 4H3QA 4MQ2A 3QAME 3P7AA 3BEGA 4MEDA 5CU3A 3RWQA 4DGMA 5CAPA 5L8KA 4PDYA 2QOIA 2REIA 3IK3A 3ORXA 5G1XA 4O7YA 5TE0A 1EH4A 3HNGA 4ZSEA 3KXGA 4QMTA 3TZ8A 2CN8A 3Q32A 4OW8A 2QU6A 1F3MC 4MNEB 4TRLA 3QTWA 3LCKA 1L3RE 1ZMVA 4YJUA 3UZPA 5C9CA 2BILB 4UY9A 5IQHA 4O91A 4G2FA 4BC6A 5KHWA 5DIAA 5E8UA 1XH9A 4M3QA 4JQ7A 2XEZA 1Y91A 2XK4A 3JYAA 4FK3A 4GG7A 5CENA 4RZVA 1GIJA 2WMXA 4X3FB 5CEPA 1FMOE 2C6OA 3RKBA 3NLBA 3E7OA 2BZHB 2X7GA 4FF8A 4U44A 4KUJA 3O2MA 1YOLA 1XJDA 1R78A 3NEWA 4O7SA 5JGBA 4IB1A 5E8XA 5CF6A 1BL6A 2Z60A 2YIYA 5K9IA 3DKGA 3D7ZA 1K9AA 3FKLA 2PL0A 4Y8DA 3OCSA 3NAXA 5CEQA 2O65A 1A48A 4ANLA 2G2HA 3Q3BA 3DB8A 5AP5A 4HVSA 1Q8ZA 3NYXA 3BQRA 2R3MA 1MQ4A 2WOTA 3UP7A 2W1ZA 4DFLA 2B7AA 3Q4ZA 3T9IA 4FV6A 3HKOA 4NSTA 4QTAA 3CGFA 5CEIA 3NUUA 4KB8A 4IJPA 1Y6BA 5LVLA 3MH2A 4BTFA 1BL7A 5ETFA 4PY1A 5HD7A 5HIEA 1PW2A 3BBWA 4FTCA 4NM7A 4I3ZA 1YDRE 4L3JA 1YDTE 5T68A 5E90A 1H28A 2UZNA 1ZY5A 4FTLA 4CQEA 1JSUA 2GNLA 4L52A 4V0GA 3VBVA 2H9VA 2R3PA 3MN3A 1NT2A 4NWMA 2VTSA 3ORPA 3DBQA 3GFEA 4RRVA 3ACJA 5FG8A 4CSVA 1DAWA 3MH1A 3DTCA 3P7CA 4R1YA 5KO1A 2J0IA 4H3BA 1H25A 5L2IA 3C4XA 1CM8A 2BRBA 2QOQA 4LI5A 5EYCA 4DH3A 3F69A 3VUHA 2Q83A 5CX9A 3B2WA 5AIKA 1YOMA 4CFWA 5FBOA 4BWXA 5CSPA 1FGKA 4TYEA 5FXQA 4A4LA 3OFMA 4DEAA 5HIDA 4C58A 1BYGA 4U9AA 2YIWA 2R3HA 2GFSA 3RTPA 4QMUA 1XH4A 3ZFYA 2F49A 3PA3A 4D55A 3S1HA 2C5OA 1U4DA 3GU8A 1KV2A 4EQMA 3EFKA 4GIHA 3ROCA 4WG5A 4R77A 1W84A 3BHVA 2O0UA 4F6WA 5C8NA 3QCQA 3RJCA 2UZDA 5HKMA 1P14A 2XRUA 3P5KA 5EOBA 5FTGA 3DK3A 2WMVA 2PVFA 5CZHA 4UWCA 1H08A 4EK5A 4USFA 5M09A 3BELA 4LV8A 2BDFA 4X2GA 4FZDB 3OEZA 4CG9A 3FMEA 3MY0A 3KRWA 4FIIA 4LG4A 3BU6A 3R73A 4HYSA 4RFZA 2C5YA 3GCSA 1XH6A 2RSVA 3K5UA 2W4KA 3O23A 2HWPA 4ZLOA 5C27A 5L2WA 3A7IA 4KIQA 2WHBA 4EYMA 3ZEPA 1HOWA 3DDQA 3F5UA 3KREA 5HX8A 4LRJA 1YHSA 1M14A 4I20A 5JN2A 2CPKE 4QP2A 3LQ3A 4USEA 4R3RA 5TT7A 5LVOA 4PRJA 4BL1A 3ZFMA 5LQFA 2XF0A 4XG6A 2VWBA 1CTPE 2FGIA 1H1QA 3RNYA 4YZDA 5KKRB 1LPUA 3QTZA 2ITNA 4MCVA 3ZUUA 4BDFA 5DLSA 3DNDA 4FV8A 1BI7A 3MB7A 5AP1A 2AC3A 4C8BA 5J79A 1OKZA 3R9DA 2YWPA 4XUFA 5DRDA 3OWPA 3EN5A 3FXWA 3V5TA 4JBPA 2CN5A 1IR3A 2X4FA 3ELJA 3PLSA 4U6RA 4RVKA 3NYVA 3PWDA 1JKKA 4IW0A 3OZ6A 4PTCA 5C03A 2YZLA 4L67A 4QMQA 4MBIA 4HNIA 4J71A 3Q2JA 3R7YA 5DOSA 5C01A 4IFCA 4MNEA 5I9UA 2XK9A 5AAFA 3HP5A 5I9WA 3L8VA 4NFNA 3JR1A 3THBA 2JDTA 4U7ZA 4IH8A 4FK6A 2VTHA 4CT2A 4F9WA 1SVHA 3WILA 2LAVA 5CF4A 4G5JA 5E8ZA 3WZKA 3R1YA 1FBNA 3ZO2A 4FEQA 2YIRA 4D9UA 4EC8A 3UPXA 4PPCA 4HCVA 5I9YA 4FTJA 2B9IA 4YJTA 4FSZA 3BQCA 2PZIA 5CVFA 3ULZA 2GQSA 5IH6A 3PZHA 1WBNA 2VWZA 2ZV2A 3I4BA 1S9IA 3ZRMA 1B6CB 5TKDA 4F7NA 3U6HA 2QCSA 4LFIA 1VR2A 5I3RA 3EFWA 3DT1A 3FI4A 3NCGA 2XNPA 3U9NA 3I6WA 3JUHA 4ZTLA 4D4RA 1OUKA 4E73A 5BVFA 5HBEA 3FLWA 4IWDA 3C4ZA 1FINA 1OL6A 4A7CA 4HVGA 5H8GA 4IM3A 4IACA 5HE0A 4DH7A 3QZFA 3KVXA 3NW7A 5M4UA 2XCHA 2QOBA 3OVVA 3DV3A 2WTKB 5J87A 3E62A 2JIIA 4CYJA 4JI9A 2XK8A 4FNXA 5ANKA 3DKFA 4TWOA 4I5HA 4JR3A 5IQAA 3UMXA 3LQ5A 3PJ1A 4QPAA 3MFSA 5BVWA 4ASDA 3VC4A 4BN1A 4EOJA 4U5JA 3WBLA 4FKGA 4PL3A 5FDPA 4C4FA 5AIRA 5FRIA 4MVFA 3REPA 4RWIA 4TYHB 3JXWA 4FZ6A 3W8LA 4ZMEA 1KE9A 5ANDA 3VS7A 2PVLA 5HX6A 2W4JA 3MTFA 2XIRA 2R5TA 2W1GA 5M44A 2VD5A 4NT4A 1Q99A 3RCJA 3IDBA 3HUBA 4EJNA 3WIGA 4RVMA 4CZYB 4PMPA 2HW6A 4JG8A 1OMWA 3LJ0A 5EFQA 2PZ5A 1OIYA 4ZTNA 2PUPA 5CZIA 3F3VA 3KXXA 1O6YA 2OH0E 1DI9A 2GDOA 2PVHA 2YN8A 3A8WA 3QTRA 4O0YA 5I9XA 5DI1A 3D5XA 2ZM4A 1UKIA 3GXLA 3V5QA 1T46A 2DYLA 1WFCA 3PVWA 2YDIA 4MBLA 4DITA 2ZM1A 3EQPA 1Y8GA 1JWHA 5E91A 4Y46A 4LMUA 4EH9A 3C4EA 3SA0A 4ZZNA 4FEWA 4GU6A 4B99A 3TCPA 3BI6A 5IQGA 2C1AA 4ASXA 4KBAA 5HOAA 4BWKA 1IA9A 5LCKA 4NJ3A 4DFUA 2PY3A 3UO5A 4TN6A 2XYUA 4ASZA 2BCJA 3ZBXA 5BMMA 4X6RA 2YM7A 5GZ8A 4HZSA 1PXMA 3LFQA 4IVAA 2OJJA 5HVKA 5I5ZA 3MH0A 1STCE 4P5ZA 3DAEA 3K3IA 2CGXA 4QP7A 4RBLA 4L01A 4S30A 1WZYA 3LPBA 3QQUA 1H24A 3L9MA 4X7QA 2XNGA 4FKOA 3I60A 4G1WA 5EI2A 3VRYA 4ERKA 4GYGA 3S0OA 4QYFA 3PXKA 3MPAA 4GT4A 2PVNA 2YACA 3A61A 3KULA 4NFMA 4BGGA 2G9XA 3G6HA 5CWZA 3V04A 4BTKA 4M69A 3MVJA 3TZMA 4G3DA 3TJCA 4F0GA 3HDMA 3OXTA 4N70A 4EH4A 3DFCB 4WO5A 5GNKA 4BZDA 4E6CA 5IDNA 3E7VA 4R5SA 4EYJA 3FY0A 2XBJA 4O1PA 5AUXA 4A4OA 4GK3A 4XLIA 4ARKA 4CV8A 1KSWA 3DJ6A 4RPVA 1GIHA 5IEVA 4IAFA 2CLXA 4RC2A 4HZRA 4ZY5A 4U81A 2GU8A 4DEGA 2BRGA 4QPSA 4TXCA 4EUUA 3VHKA 3FC1X 1M7QA 4UZDA 3K3JA 4F7LA 4PUZA 2C6IA 3IECA 4L53A 4QMSA 5IQDA 2WMWA 3ZCLA 2C5VA 2XK3A 2YM8A 3ORLA 5D41A 4J53A 3WZUA 3R02A 4GYIA 3ZMMA 2QOHA 4D4VA 1U5RA 4MD7E 5AV1A 1KUTA 4W8DA 3VNTA 5CQUA 3VO3A 3U4WA 4BCMA 4QOXA 3AC1A 4OT6A 4BDHA 5DN3A 4YTIA 2W5HA 3DLZA 4FNYA 3UG2A 3ZS5A 2QO2A 2I0HA 1GAGA 4B7TA 2OU7A 1PXPA 4J99A 4RMZA 2VWYA 3QTSA 4OLIA 3RZFA 3UIXA 4AUAA 4HVHA 3PFQA 4EONA 4W9XA 4GVAA 4WRGA 4GMYA 4GUEA 5FLFA 2CGVA 1LP4A 1K2PA 2OO8X 3ZFXA 5KMJA 2JKKA 4FSRA 5HTBA 4CD0A 2CKPA 1KE6A 3R30A 4IZ7A 1FPUA 4MAOA 3H0YA 2F2CB 3ZSIA 3NW5A 4AFEA 4G3CA 3A8XA 5L4QA 4FTUA 4V01A 2GMXA 3QRIA 2WGJA 4G16A 4KIOA 5ANEA 1Q62A 2FSTX 4USDA 2HIWA 4FSMA 1U59A 2QO7A 1LR4A 3V8WA 3R7VA 2NP8A 2G2IA 2ZM3A 3HLLA 3KRLA 4OBQA 4QRCA 4AN9A 4EQUA 3FZSA 2VTPA 3COHA 3IOKA 2HCKA 3W10A 4K33A 4LOQA 5B2LA 5JQ5A 2A2AA 1GIIA 1KOBA 1DI8A 4PTGA 4YR8A 3ZLSA 4ID7A 3QZGA 5ANJA 4XP2A 5IQFA 5CU2A 4EHZA 4K8AA 3EQIA 2XH5A 3KXNA 4X2NA 5E8TA 3SAYA 2X2KA 4DFNA 4HYIA 4L7SA 3TIZA 2OLCA 3UVPA 3IW6A 3D5VA 5GJFA 2UV2A 2O8YA 3Q6WA 5FDXA 3C0HA 4YJPA 1PYXA 5IQIA 5AX9A 3C0IA 3KXHA 3ZBFA 4HGLA 3WE8A 3ORZA 2ZMCA 4FKJA 3EOCA 4RX9A 4BCIA 3FI2A 4Z9LA 2BHEA 2VX1A 2W17A 4WSYA 2XZSA 2HOGA 4J97A 5B7VA 3FI8A 5H8BA 3ZTXA 5EM7A 4M8TA 2A19B 4Y5HA 2QC6A 1GZNA 3CKWA 4GJ3A 2C3KA 2OFVA 4O1OA 4PL5A 2VO0A 3RK9A 5BYLA 4MHAA 3U8WA 3G5DA 1BX6A 4CQGA 4ZLYA 3HP2A 2HAKA 4ZLZA 5JKGA 3KB7A 2H8HA 3R8PA 4ERWA 3LW0A 4CCBA 3O50A 4HGTA 4BDBA 4EEVA 4XYFA 2B52A 5AA8A 2WMAA 3ZSGA 3E8DA 4ZTQA 3SW7A 1TVOA 4FKRA 3G2FA 3UZTA 5GIOE 3ID6C 4YJNA 4V04A 3UVQA 4F64A 5EW3A 1TQIA 4U40A 5EQEA 2F9GA 2FA2A 2AC5A 2ITZA 4FT0A 4DC2A 5HLWA 4A06A 2WQOA 2HYYA 3EZVA 4GRBA 3D2KA 1R3CA 3CY2A 4GJ2A 2QG5A 5HNIX 3QXPA 1A06A 1VZOA 2ACXA 2W06A 1XBBA 3EN6A 3FMKA 4FMQA 4I41A 3EWHA 4YBJA 1TQPA 4KKHA 4L8MA 2IPXA 3QRKA 4R6VA 2IVSA 2ZV7A 1ZMUA 3KF7A 2W96B 4PWNA 2OIQA 4XG3A 3UDBA 4RJ6A 2C0OA 4ZTMA 3QYZA 4CFXA 5AP0A 4YO4A 2VWIA 4CT1A 5IKWA 1RQQA 2VX0A 3II5A 4H36A 3GP0A 5AR4A 5GHVA 2C47A 2VTIA 4JBOA 3GC0A 3R7EA 3ZO1A 4EH2A 3FYKX 3NUXA 3R2BA 3EQFA 5D9HA 1ZYCA 5A4TA 4O81A 1Q61A 2OXXA 4XV1A 3VIDA 3GVUA 3KGAA 2G15A 4F7JA 3QQFA 5L2QA 4M12A 2CSNA 1W0XC 4OTQA 2GHGA 4I23A 5AEPA 1JBPE 1YDSE 3FZOA 4R5YA 4FV4A 3WI6A 4CRSA 5CNNA 1VYZA 2QVSE 1WVWA 2IZRA 3EQCA 3DAKA 1MP8A 4RIOA 4XP0A 2IWIA 5L3AA 4H39A 4YNEA 3E8CA 3NDMA 4MXYA 3V5WA 3D4QA 3LQ8A 1ERKA 3E3PA 4G6OA 4LGGA 4RJ5A 1Q8UA 2YCSA 4IM2A 2OZAB 4O6EA 3SX9A 4PDSA 3CD3A 4QO9A 2C4GA 2JDOA 2Y7JA 3MSSA 3O8TA 3W33A 2Z7LA 3OT3A 4QP9A 2B53A 2NRYA 3OWLA 5J95A 4AOJA 4EWQA 3V8TA 2OKRA 3DZOA 2RFEA 1QPJA 2YIQA 4CMOA 4DLIA 1BUHA 4AOIA 3DXQA 4FI1A 3EFLA 5AJQA 3OOGA 3ZDIA 3HX4A 2Z2WA 3SW4A 2BAKA 3FDNA 3QZHA 5IH4A 5L8LA 4XV9A 3NSZA 4RJ4A 4JG6A 3FPMA 3OHTA 4K1BA 1OITA 3TNHA 2ITVA 5IU2A 4DTBA 5C4KA 4QP8A 4CTCA 2ZV9A 5K5XA 1YXXA 3CPCA 1YHVA 4I6FA 4QMOA 2QNJA 2YAAA 3GC7A 3KU2A 5CYIA 3SOAA 2V22A 5TR6A 4IEBA 4X2JA 1GJOA 4WD5A 3ALNA 4ITJA 4G5PA 3UO4A 1OPKA 4AZWA 4XRJA 4FV9A 5EW9A 1XH7A 3N51A 3I7CA 4L68A 2X2MA 4FIFA 4ZIMA 4WG3A 4B4LA 4FEVA 4JAIA 2BPMA 3VJNA 3C4CA 5FBNC 5G6VA 3GU5A 4RWJA 4IADA 1OGUA 2GNHA 5AV0A 5FQDC 5CF8A 1P2AA 4JX7A 4FA2A 2V7AA 2C69A 5CSXA 5HG9A 3F3TA 4E6DA 3WYXA 5TO8A 3UBDA 5L6PA 3SRVB 1S9JA 5AP3A 4JQ8A 3GUBA 5CLPA 3FQHA 3W16A 4EHEA 4FL3A 4AQCA 3L8XA 5A46A 3A60A 3PP0A 3PWYA 1WBTA 2IZUA 5CSVA 3UQGA 5J1VA 2XB7A 3BV2A 4KD1A 2O5KA 1ZZLA 3RAIA 4ASEA 1R0EA 4I1ZA 1YOJA 1XO2B 4ZSJA 2SRCA 5EYDA 2QHMA 4AA4A 2PE1A 2IO6A 3ZM9A 4RGJA 3OW3A 5HU9A 3FMDA 4JLCA 2UW7A 4FSNA 2OIBA 3L1SA 3F9NA 2JDVA 5CALA 4PQNA 1OUYA 3VUTA 5KMKA 4ZP5A 4DAWA 2OJIA 2J0LA 2GNJA 5L6WL 1G8SA 3EQDA 3PVBA 1Y6AA 4GFGA 4PMMA 4NJDA 3ZO3A 3ZOSA 4AZTA 2YDJA 2G01A 3FZTA 1U54B 3FHIA 4FKQA 4O0WA 2CKEA 4D0XA 4YLJA 3NPCA 2W9FB 5HG7A 3ORKA 2E9UA 2GFCA 3I81A 4EK3A 4TNBA 4O27B 4L43A 1PMUA 3ZM4A 5BVOA 4JR7A 4KBCA 3BLHA 1JKLA 4YTCA 2W1CA 2VWXA 3Q9XA 3RM7A 5ANOA 3VQHA 3V6RA 1ZLTA 5EYMA 2PUNA 2W5BA 3VS5A 4A9TA 4CTBA 1H0WA 4FSTA 1P4OA 4Q5HA 3RK7A 3UIMA 1J7UA 4O7LA 3E93A 3UQFA 3EHAA 3QRUA 4IWOA 5AADA 3PP1A 4M0YA 2VTRA 4ZXTA 5DT4A 1PKDA 3SKCA 4ACHA 4D2RA 4I24A 3CS9A 3WZEA 1QL6A 3MYGA 4O22A 4Q9ZA 4RFMA 3PIXA 4YNOA 5EW8A 5LJJA 2B55A 3KN5A 3CXWA 4IZ5A 2CNQA 2WXVA 5L2SA 3F7ZA 2E9VA 2WQEA 3ETAA 3DU8A 5DYJA 2KTYA 3T3VA 4D5KA 5DH3A 1OL5A 3OC1A 4GFMA 3LIJA 3BGZA 2OXDA 4QTEA 1XKKA 5CVHA 5J5SA 1CKIA 3POZA 2IZTA 1Q8TA 3RVGA 3FLNC 4UB7A 4BIEA 2WMUA 4EOOA 2VU3A 5CS6A 4ANNA 3BYMA 3W2PA 4H58A 3PLAE 1CSNA 3AQVA 3SGCA 2PMIA 2XS0A 5FD2A 5KKRC 1UU9A 3U54A 4DN5A 3EN7A 3L8SA 1ZAOA 2XK6A 3R22A 4XJ0A 4YJRA 1OBGA 4FGRA 3FHRA 4TT7A 3QD2B 3U9CA 4PMTA 3KF4A 5I0BA 4JBQA 1PKGA 3KMWA 3C50A 3HV7A 2BAJA 5CXHA 1ZWSA 4FVPA 5ACKA 3TV6A 5FGKA 1GZOA 3LFNA 3V6SA 3QTIA 1Q3DA 1K3AA 2E9NA 3RGFA 4IWPA 3UJGA 5HTIA 3F2RA 2DUVA 4XRLA 5CAOA 2ZMDA 4Z3VA 1H27A 2UVYA 4K18A 3R8VA 3SVVA 4TWCA 3FKOA 4RX7A 2JGZA 1QCFA 4AU8A 1X8BA 1MUOA 2X4ZA 3QZIA 3ZRLA 4WNOA 3BGQA 4C4HA 2WPAA 2WTCA 1ZXEA 2O63A 4FG9A 4S33A 5HO7A 1XHAA 2C6EA 3PY1A 2X6DA 4MD8E 5E8YA 2CLQA 3CTHA 3FPQA 5ITAA 4BIBA 3N9XA 4DEHA 2OJFE 3AT2A 2IVUA 4TWNA 3NIZA 3NVMB 3SC1A 1NVQA 3GU7A 1NA7A 2CMWA 4K0YA 2ITXA 1UNLA 3F82A 4BYIA 2FB8A 4O7RA 5IUIA 4FSUA 2JIVA 1Q8YA 2NPQA 5TF9A 1E1VA 3ZSHA 5L6OA 5K4IA 2QLQA 3S95A 4FV7A 3OWJA 2XMYA 3FAAA 4TNDA 4FR4A 4BF2A 4ZAUA 2PVJA 4RC3A 4Y73A 5E92A 4MF0A 3RWPA 5LCJA 2WTWA 2UZBA 5DEYA 4M15A 3LFDA 5DVRA 4ZS4A 3P78A 3PPJA 3O0GA 5KZIA 1QPCA 2YM6A 4WA9A 1JSVA 3F5GA 3FZ1A 2HXLA 5CQWA 4QMXA 3NUSA 3F5XA 4YZMA 4WHZA 3ZC6A 4AP7A 2WTKC 1CKPA 4C02A 3DY7A 3LM0A 2QODA 5AUWA 4F4PA 1ND4A 2X8EA 3BYUA 1WVYA 5E8VA 1KE7A 2VUWA 3LCTA 3R9OA 3FSKA 4ZZOA 4IHPA 1VEBA 2XKDA 2XRWA 4ZK5A 4NCTC 4UBAA 2UUEA 3HA6A 3OXIA 3QLGA 4OAVB 2FUMA 4FUXA 2RL5A 3CR0A 5GZAA 3VS0A 4N6ZA 2PE0A 5D7VA 5AR7A 3R71A 2BRMA 4FKUA 2EB3A 4BDKA 5HU3A 2W99B 2R3LA 3S00A 3CTQA 2XNOA 4FTAA 4Z55A 4X2KA 4OTDA 3R8ZA 4DINA 2VV9A 2RFSA 3OOMA 4XOZA 2V0DA 3HV3A 1Q41A 3RAWA 2Q0BA 4MH7A 2XJ1A 1U54A 4QMPA 3GOKA 5DNRA 4B9DA 4O96A 2UW6A 4NW5A 4CLIA 1OPJA 4RT7A 5BVEA 2BROA 3R01A 3IOPA 2VO6A 3LCDA 5CI6A 5J7HA 3NNVA 3KXZA 4R78A 4EL9A 4JVGA 4C4IA 2YITA 5A4QA 3DPKA 3MWUA 4UXLA 3RPOA 3ATTA 2QR7A 4DEDA 4M68A 5CT0A 5AV2A 3PXYA 4RLKA 3ZXTA 5IA2A 2GTNA 3UNZA 3UO6A 5CY3A
chains in the Genus database with same CATH superfamily
1OL2A 3AOXA 5J7BA 1UU3A 3I79A 1Z57A 1V1KA 3SXRA 5J5TA 3UDZA 3KCKA 4ANSA 3NGAA 4TYJA 4E1ZA 3EL7A 5CU6A 3PVUA 2GS6A 3O7LB 1YHWA 3C7QA 3Q9WA 3QQLA 4FBXA 3TKUA 3AT3A 3HDNA 1OB3A 2Y8OA 3KRRA 4LL5A 4ANBA 4UMRA 3ORTA 4FNWA 3PG3A 1PXKA 3F3ZA 4BR3A 4S31A 3RI1A 4W4WA 5E9EA 1OL7A 2Y9QA 3JS2A 1DAYA 3ZZWA 4L7FA 4DDIA 5EM5A 3ZLYA 3ATSA 4G17A 2WZJA 4O0SA 3R8MA 2VZ6A 4DTAA 4U45A 4HVDA 3BRBA 1I44A 2A4LA 1YQJA 4DYMA 2HZNA 3AKLA 2W1DA 4OTFA 3SHEA 3V5LA 4CLJA 3AMBA 2EB2A 1T45A 3WYYA 3P86A 3DXPA 3ORIA 3RK5A 1NVSA 4QMLA 4S2ZA 2A1AB 2BALA 3KRJA 2QG7A 4C3FA 3WE4A 4QP1A 5BYZA 5T6KA 5IH5A 2ITOA 5EK7A 1GOLA 2YCQA 5ANGA 2HY81 3QD4A 4FTQA 5HVYA 2WMQA 4FNZA 2VAGA 3RPSA 3HRBA 4BB4A 2VTMA 1XMLA 3CC6A 4U42A 3G51A 4OR5A 3KXMA 2VWVA 2P2IA 4X3FA 2CDZA 3TTIA 2EVAA 2UZVA 4D0WA 4DFZE 3GCUA 4FKSA 3WZJA 4RFYA 3W2CA 2VTAA 3BLRA 4JDJA 3WIKA 4KA3A 3GEQA 4BTMA 3KCFA 4OTWA 2XAMA 4AGWA 3PE2A 4LQMA 5HI2A 4TL0A 4AA5A 4O7ZA 3R21A 4WOVA 4ONAA 4RVLA 1IEPA 4JAJA 5DE2A 4AACA 2BTSA 3EKKA 4BRXA 3VW8A 1SYKA 3R1QA 4IX4A 4F1MA 4XG4A 4YC3A 5EHYA 2GPHA 4IX3A 4J98A 2NYAA 3POOA 5FP6A 2CJMA 2UW3A 2C3LA 3PRFA 4YJVA 3BV3A 5HG8A 3O71A 2ZJWA 2WOUA 2I0EA 4UX9A 2C3IB 5IA4A 3TT0A 3T9TA 2HZ4A 4LUDA 4Z7HA 2GNGA 4BI0A 5LOHA 5IISA 3QF9A 1WBSA 1SM2A 3G15A 2DS1A 1YVJA 5T3QA 5KMMA 4L00A 4P90A 5IZFA 1R1WA 4I22A 3W2OA 1RDQE 1Y8YA 4L9IA 4FV3A 4K77A 4C4EA 1UA2A 3AGLA 2XBAA 3QRJA 1FVRA 4EOPA 5JFWA 3KA0A 5J1WA 4O6LA 1OKYA 4AZFA 5M4IA 1JVPP 5BQ0A 5JH6A 5M08A 3KY2A 4WT6A 4EZ7A 2XEYA 4DFBA 3D5WA 5HNBA 5LARA 5H9BA 4NUSA 4DTKA 5M51A 3UIBA 4O84A 5AUYA 4BGQA 4TW9A 3UOJA 4IZAA 1H1WA 3EN4A 4IZYA 4FE2A 1YXSA 1H01A 2JAVA 4TYGA 5DRBA 2W1EA 2FSLX 1NXKA 3R00A 2Q0NA 2QO9A 4S32A 1YWVA 3B8RA 2WEIA 4FIEA 4ALWA 3RZBA 3LXNA 2B4SB 3CKXA 5B2KA 3EJ1A 2R4BA 3GU6A 2IG7A 2QKWB 2JKQA 3LKMA 5LVNA 5HQ0A 2YA9A 3MJ1A 5IMEA 2J0MB 2UW0A 5CTPA 5AMNA 1JOWB 3W2SA 3ZZEA 4AGDA 2XYNA 3DBFA 4Z16A 1CDKA 2CCIA 2O2UA 2XJ0A 5C1QB 1ZOGA 2XNMA 4AFJA 3C13A 3QQGA 5DEWA 2XNEA 4XCUA 4LL0A 1OI9A 1Q97A 4GVJA 4ORKA 4AW1A 3F2AA 3OEFX 4BIDA 4YP8A 2QURA 5FEEA 1JPAA 4GV1A 5D1JA 4RX5A 4MXZA 2XUUA 4RC4A 4JG7A 4A9SA 2PUIA 4O4CA 4LYNA 4X6QC 2PU8A 2QOFA 3MFRA 4EKLA 5KUPA 3LFSA 3M1SA 2HK5A 4A9RA 1UNHA 1REKA 4O0TA 4ZS0A 1PMVA 4F9CA 5CU0A 3HEGA 4F63A 3PA5A 3PDTA 4EOIA 4IXPA 3ZRKA 4RIWB 2GCDA 1O9UA 3KL8A 4BDDA 4ZTRA 4WNPA 2V55A 4IIRA 5HO6A 4C59A 3HMNA 1OECA 3DOGA 4KWPA 2XA4A 4N0SA 3C4WA 2BIYA 3MVHA 1UV5A 3FZPA 3CTJA 4IAKA 4NKSA 4Y83A 5HE2A 3TACA 3ULIA 4E6AA 2QHNA 3G0EA 5HG5A 4KSQA 3PVGA 3BL9A 2YJRA 5I9ZA 4I0SA 4YC8A 5LVMA 3BBTB 1H1RA 3Q04A 5HLNA 2GQRA 3L9LA 3CGOA 4DG2E 3DQWA 4OGRA 3PRIA 1DS5A 1YI3A 3IPHA 3BWJA 5GJGA 5IDPA 4FTMA 4FT5A 2WB8A 3QKKA 4BTJA 2CGWA 3RPVA 2BR1A 5BVDA 4ALUA 2X7FA 1ZYSA 4C2WA 2R3KA 2FO0A 4FV1A 4RIXB 2ONLC 4YHTA 3DBEA 3KEXA 3UNJA 3DS6A 3H10A 4KBKA 4B8LA 3QHRA 4BI2A 1DM2A 5HE1A 4GFOA 3PXQA 4BYJA 2YCRA 3CP9A 3QKMA 4YURA 3VS4A 2JFMA 4RZWA 4PNIA 3GC9A 3G33A 4ZJVA 5M56A 3FY2A 5L8JA 1YI6A 3IW7A 4QMZA 3S3IA 3ET7A 5CAUA 5J9YA 3NVKI 2PHKA 3P4KA 4UV0A 3COIA 4FT9A 4D5HA 3TDVA 1GZKA 3ZYAA 1XR1A 4GK2A 2XM9A 4ZZMA 3NYNA 4L6QA 3TDWA 3ORMA 4IB0A 3N4VA 5FUTA 1BMKA 3EH9A 1SNUA 2Y6MA 3VBXA 2PMOX 4A4XA 1H8FA 3Q2MA 3D5UA 1Q8WA 2RF9A 3R28A 4FIGA 2IVVA 3UC4A 2XK7A 5CSWA 1JNKA 2PVRA 3QALE 3HMIA 3OY1A 2WMRA 3TV4A 2GNFA 2G2FA 3FLYA 4GT5A 1Z5MA 4RWLA 4R7HA 3CPBA 4QTDA 4IMYA 5BMSA 3VS6A 2CNVA 5A3XA 2UVZA 1OIUA 4NIFB 3U87A 4BJJA 1WMKA 3QRTA 1WBPA 3PFYA 4FT3A 2UZEA 2LGCA 1UWJA 2J5FA 3PXZA 5CT7A 3E8NA 5JQ8A 2O3PA 2OF2A 4IVDA 2DQ7X 3DBDA 4NTTA 2PK9A 3Q60A 2WO6A 1PXNA 2VTQA 1YWRA 4FV2A 2AEGA 2BFXA 3VRZA 5HIBA 3NUNA 3TG1A 5IF1A 3BIZA 3C5IA 3P0MA 3FKNA 3LAUA 5HE3A 5F1ZA 2YISA 3Q9ZA 4J8MA 5FTOA 3UTOA 2C6LA 5BV3A 2HELA 4CEGA 3BYSA 4NCTA 3QWJA 1A9UA 5H3QA 1H07A 1V0BA 4XV2A 3LVPA 4EHVA 2ETKA 4FV0A 4O7NA 5JSMA 4TYHA 1R0PA 1M2RA 4ZSGA 2I7QA 4EK8A 2PTKA 3LXPA 3EQRA 4EUTA 4IE9A 4Z7GA 2PZRA 5FEQA 4R8QA 3MIAA 3KMUA 3DKOA 1RW8A 3AD5A 5B0XA 3KMMA 5GIPE 2ZB0A 3F61A 4U8ZA 5HESA 3SOCA 4AS0A 5JRSA 4JIKA 4FZAB 1SZMA 3H4JA 2DWBA 4C3RA 4E8AA 2PULA 1PYEA 3ZLWA 2ITTA 3DGKA 2UW4A 4GK4A 2XIKA 3ZXZA 4IX6A 4C62A 4LRKA 3NX8A 5B2MA 3PSCA 3NIEA 4IAYA 4X2FA 1IAHA 2I0YA 2BDJA 3R9NA 4AOTA 2YM3A 4ITHA 4DCEA 5FWKK 3NZ0A 4CFMA 5KMLA 3EQBA 3CLYA 3NNUA 3Q52A 1XH8A 2X9FA 3BE9A 4U80A 3DQXA 2F4JA 3UYSA 1CKJA 1TQMA 3QCYA 4BCHA 4YU2A 1M2QA 5IA0A 4FOBA 3NNXA 3D7TB 4TWPA 4EZ3A 3TTJA 4MTAA 3VW6A 3LMIA 4GKHA 3NYOA 3GT8A 3LFFA 2QOKA 1OIRA 3FXXA 3EYHA 4M7IA 5F20A 1H1SA 4OTPA 4I4FA 4QDEA 3GB2A 5AP7A 3R7IA 5E1EA 3LJ1A 1PXJA 1J1BA 3NS9A 3BHHA 2UZUE 1HCLA 3BPRA 4MXXA 3I6UA 2I1MA 2UZWE 3FQEA 4QMVA 4D9TA 4GU9A 4AWIA 5M4CA 2QQ7A 2IZSA 4O0XA 2CKOA 4D4SA 2ETRA 3A7HA 4BBMA 3G9NA 3LCOA 5AR2A 1PXLA 3W0PA 3B8QA 3DK6A 3D0EA 4BZNA 4H3PA 5CU4A 4DF3A 2RIOA 4W9WA 5BVNA 2VGOA 2OF4A 4I6LA 1FOTA 4C2VA 4E20A 4CKRA 3SG9A 2Y6OA 4HW7A 4ALVA 5EKNA 4QYYA 4C38A 1WCCA 3FV8A 2OK1A 4M14A 3E5AA 5KX8A 3RP9A 3PUPA 3H9FA 4J95A 5CAVA 4AW5A 3MTLA 5K5NA 1FVVA 2P55A 2VX3A 5CXZA 4JBVA 4CFVA 3QUEA 3HMOA 4M97A 3ZEWA 5CSHA 4NM5A 4PMSA 2EXEA 4AGCA 1RJBA 1OGYA 2XVDA 1TKIA 4RIYB 3VF8A 2X0GA 5EI6A 4C4GA 4DT9A 3AG9A 4BCNA 4U3YA 5EKOA 4M84A 3MV5A 4APPA 3AD6A 5IUHA 5E8SA 1W7HA 2R2PA 1PY5A 2WFYA 3COKA 5A6NA 1OKVA 1M17A 3KK8A 1W98A 3TN8A 2RKUA 2OJ9A 5CANA 2C0IA 2Z02A 3QUPA 4IAAA 3RPYA 3BE2A 4BKYA 1AD5A 2IF8A 2J7TA 2V7OA 5A14A 2UW9A 5CF5A 3HRFA 4FG7A 1FMKA 2KULA 2F7XE 3UYTA 3W18A 3TKIA 1ST4A 4HGSA 3COMA 3RMFA 1FGIA 4C3PA 2YCFA 4UYNA 4EK4A 4I4EA 4LMNA 4X3JA 4FYNA 5BUEA 2W1FA 3FMLA 3IS5A 4EJ7A 3C0GA 2QOLA 4ENXA 3KIOC 4WKQA 3LLAA 2GHLA 2VO7A 1XQZA 3R7UA 3UPZA 2WIPA 5KCVA 3OTUA 3PPKA 3O7LD 3ODYX 4QYHA 4BBEA 4CMTA 1HCKA 5E4HA 4F65A 4IC7A 2HXQA 4E7WA 4DEEA 4C7TA 3FL4A 2OSCA 4QTCA 2G1TA 1IA8A 4BZOA 2IW6A 4KIKB 2B9JA 2O64A 3PJ2A 3FMMA 3ZC5A 5IUGA 2ITQA 1KOAA 3AMYA 3D94A 4JDIA 4V0GB 3RNIA 3VBTA 3V8SA 4PF4A 4GKIA 4S34A 4H1MA 2NO3A 5HO8A 5IA1A 2XNBA 4BCKA 4D2PA 5DPVA 3HZTA 4FKPA 3RHKA 3OMVA 5EHOA 2VTNA 2F57A 3BZ3A 4R1VA 3LFAA 3MVMA 3EFJA 4XOYA 2QOOA 3DBCA 4O0VA 3Q4CA 4DG0E 4KS7A 3FI3A 3HYHA 3QD3A 1SVGA 3DAJA 3GI3A 4QQTA 4YHFA 4RQVA 5A4EA 2C6KA 3PIZA 4AA0A 2OI4X 4YZNA 5E8WA 2W4OA 2WTVA 4WNKA 4D2VA 1BI8A 2VTOA 3CD8A 4AT4A 1IG1A 3BU5A 5DT0A 3R8LA 5IQCA 3A7JA 3KQ7A 3IDPA 4IBMA 4A07A 5DT3A 4AE6A 4AZVA 4AXCA 5BX0A 3GQLA 3VUGA 3ZDUA 4QP4A 4Y95A 4CGAA 4J8NA 4AT3A 4XV3A 4YUQA 2J0JA 4HGEA 4LOOA 4YHJA 4C57A 1UNGA 3F5PA 3L8PA 2PPQA 2PYWA 5AWMA 4D2TA 4G6NA 4OBOA 2YLEA 3S4QA 5HORA 2BAQA 3LXLA 4XMOA 2R3OA 3LXKA 4FL1A 4QTBA 2OGVA 5EM6A 5IQEA 2WTIA 3F3WA 4AG8A 3BKBA 4GCJA 5CAQA 4BCQA 4G9RA 3LFCA 5CI7A 2W05A 2EXCX 5JZNA 3HVCA 4NKAA 5EI8A 4FSYA 4P2KA 5JFXA 3DCVA 3E8EA 4CG8A 1Q4LA 4FX3A 3D7TA 5HEZA 1VLRA 4EH5A 4FZ7A 3G0FA 3IO7A 4MXAA 4FIJA 4J7BA 2OICA 4NZWB 3W0RA 1ZRZA 1JQHA 3P08A 5LWMA 4IAIA 1G8AA 3LZBA 4FZFB 1BKXA 4EH8A 5HBJA 3DA6A 2R3GA 2OXYA 3A7GA 3UMWA 3ANRA 5ACBC 3WZDA 2XCKA 3MIYA 2GTMA 4DT8A 3TUDA 3HV4A 4B8MA 4JX3A 1XBCA 4HVIA 2ZB1A 4YJOA 5AR5A 4WIHA 2V62A 4XS2A 1UWHA 2B9FA 3AXWA 3CQWA 2IW8A 4FIHA 3FBVA 2F2UA 2Z7QA 3VS3A 3H9RA 4YGAA 2WMSA 3TNIA 1PRYA 4I21A 3A4PA 2C30A 3C4FA 5FXRA 4P5QA 2R7BA 2R3QA 3HL7A 2OH4A 4EBVA 2ONLA 4IC8A 2A27A 5HLPA 4FC0A 1PF8A 3SXFA 3ZO4A 4DH5A 3KC3A 2VNWA 4KSPA 4FEXA 2W0JA 3M2WA 4QYGA 2WIHA 2OZAA 3QGYA 4FG8A 4F1OA 5GJDA 3UOHA 5IEYA 1G8JA 1L8TA 5D12A 3VBQA 4BCFA 3BCEA 1LEWA 1YXTA 2C0TA 5AA9A 4PX6A 5ICPA 3NR9A 4KABA 3BHYA 3GOPA 2BZIB 2AYPA 1YXVA 2ZYBA 3B2TA 4RLLA 1PMNA 2C68A 4RIYA 4UMQA 3NNWA 4ZSLA 5FP5A 4C36A 2R3JA 4BKZA 1SVEA 3DJ7A 4QNAA 4IVBA 3HGKA 5JFSA 1REJA 2BUJA 2WQBA 4GUBA 5HGIA 3N4UA 5J9LA 5H2UA 1PHKA 5AUVA 4DFYA 3TV7A 2EUFB 4J52A 1OVEA 4HPUE 4J1RA 2VRXA 5KHXA 4BHZA 2XIXA 3VUMA 1F0QA 1W83A 2QONA 5IA5A 4I5MA 5M06A 4UMTA 2ESMA 3A7FA 3VS1A 4RG0A 2E9OA 3A4OX 1J7IA 2WMTA 4K6ZA 1P5EA 3QX4A 4NL0A 3CQUA 3AC4A 4Y85A 4O4EA 4YJQA 2ZFYA 4OAUC 2J9MA 4WRSA 1J3HA 4AX8A 2OFUA 4PV0A 4E6QA 3EB0A 3T8OA 3IG7A 4C37A 4FSWA 3V3VA 2PE2A 4BKJA 5LVPA 1QPDA 5HTCA 2ERKA 5DR9A 1LEZA 5HHWA 5EQPA 3ZONA 2X8IA 3QQJA 4FKWA 3MPTA 3TKHA 2R3RA 3OCTA 2I40A 3PSBA 3SRVA 3Q5ZA 4I0RA 4U97A 4XG2A 3M11A 4ACCA 3AC5A 4JT3A 4W8EA 3VQUA 5HICA 4HCUA 5AX3A 4KIKA 2IJMA 3MESA 2ITYA 3A99A 5HBHA 2HENA 4FTOA 3SLSA 3G6GA 4DBNA 4BDIA 2WNTA 4G3FA 4RVTA 4C35A 4DEIA 3C1XA 3EQHA 2PSQA 3KRXA 4PDOA 2J51A 4GS6A 3BHUA 4W4VA 2PMNX 3AMAA 3QGWA 4QQCA 1OKWA 1H1PA 5F94A 3AGMA 4TPTA 4ACGA 3BWFA 2YWVA 1F5QA 2BZKB 4EOKA 2XIYA 3RALA 3MBLA 3FQSA 3QWKA 4LUEA 3DB6A 2RGPA 3ACKA 4KRDA 3QA8A 5HD4A 4AXDA 2WEVA 5JGDA 4Q2AA 4B0GA 2PVMA 4O2PA 2UW5A 5LMKC 2XJ2A 3KVWA 3NUAA 4DGLC 5AP6A 5KZ0A 2QKRA 3FLQA 4DEBA 3EYGA 4WUAA 4CVAA 3GCVA 4D2WA 1NY3A 2WU6A 4WBOA 3LE6A 3FC2A 3HAMA 5EDQA 4Q5EA 3I0QA 3QA0A 4BDAA 2A98A 1QMZA 5KBQA 5JMSA 2OIDA 3IKAA 3UIUA 3QX2A 3TXOA 5A54A 3PJCA 4DHZA 4DGNA 4JL9A 1NVRA 3QL8A 3LJ2A 5AUZA 2ETMA 5AV3A 2BIKB 5AUUA 4BCJA 1O6KA 1PJKA 4I6HA 4U0IA 3NCZA 4CXAA 1ZOEA 2JBOA 2HZIA 4E4XA 4BICA 4EOQA 4BGHA 1KE5A 3W0MA 2BVAA 4EOLA 4I93A 3MDYA 3JVSA 4C0TA 4R7BA 4DCAA 3LOKA 1YKRA 1YXUA 4OUCA 3ODZX 2HWOA 3QBNA 4F9AA 3OW4A 2YZAA 4BVUA 2F7EE 3QQKA 4V05A 3IGGA 3KULB 2J50A 4TTHB 1W8CA 4NM3A 5IA3A 3NUPA 4M69B 3FXZA 3D15A 4EH6A 5AP2A 3UGCA 4II5A 3DKCA 3JVRA 3IGOA 3JPVA 3SQQA 2BKKA 5IMXA 3CJGA 1M7NA 2HY0A 3OP5A 4YZCA 4K9YA 1JKSA 3UODA 4FGBA 5D11A 2Y4IC 2JFLA 2H6DA 1VYWA 3E64A 3F6XA 4FYOA 4A9UA 4IX5A 3NFFB 5ETIA 5CNOA 1ZYLA 4KIPA 5HCXA 1R39A 4BDJA 2X39A 4N57A 4FV5A 2X6EA 2UZOA 5H8EA 4XG9A 2QOCA 2QU5A 1OL1A 3HA8A 4OTRA 3D9VA 3F88A 2CNUA 3L9NA 3I7BA 2OW3A 3I5NA 1V0OA 3EMGA 4F08A 4IFGA 2WD1A 3ORNA 3QKLA 4FKLA 2Y4PA 4GL9A 4RJ7A 1H00A 2J5EA 5EYKA 5D10A 2ZV8A 2Z7RA 3AC3A 2UZLA 3DFAA 3TIYA 3PZEA 4KNBA 3TJDA 2UW8A 3LMHA 4QP3A 4CMUA 3AC2A 2JAMA 3SV0A 1JAMA 4Q9SA 3OCGA 4TZRA 3CEKA 4KINA 4IWQA 3E88A 4O4BB 2E2BA 4RJ3A 4EK6A 2VWUA 4EOMA 4YMJA 4I92A 5AAGA 4C4JA 1NW1A 4ZOGA 2X8DA 4JIAA 3BYOA 2PVKA 4YLKA 3VVHA 5KE0A 4BI1A 3PG1A 4FJVA 4N6YA 4QQ5A 3UC3A 1PXIA 5C4LA 2XKCA 2BTRA 2EXMA 1E9HA 5I3OA 4ZJIA 1JKTA 4U41A 4L3LA 3FMHA 1M52A 4EHGA 2XKFA 3WOWA 4BHNA 4W4YA 4CNHA 2FVDA 3HRCA 3OG7A 3IONA 3R6XA 2W9ZB 5JRQA 4X21A 3OROA 3OUKA 5LMAA 4EORA 4KKGA 1ZY4A 5IEXA 4JOAA 4UXQA 3K5VA 3W2QA 4AAAA 2JITA 3C51A 5ETCA 4F6SA 3D14A 3BHTA 5HCZA 2CGUA 4RSSA 4PL4A 2PWLA 3DDPA 3EN9A 3DNEA 3BYVA 3P7BA 4I5CA 4O0RA 4R3PA 4UZHA 4G9CA 4CFUA 4EH3A 1XMMA 4AXEA 3BLQA 2GS7A 3LHJA 4NYEA 2YABA 2R3NA 5F4NA 3R83A 4WNMA 3F7WA 1OM1A 2ZDUA 3MPMA 3OBGA 4I6BA 4KS8A 4AXAA 4ZJJA 3GNIB 5A4LA 1MRVA 3NUYA 3VBWA 3HMMA 4FL2A 4MYGA 4DBXA 1YRPA 2W7XA 2BFYA 4AT5A 5KMIA 3NW6A 3P5JC 3D83A 5GZ9A 5HZNA 2C6MA 4HOKA 1PXOA 1UU8A 4BDGA 3KKVA 5DWRA 3QQHA 4IQ6A 4R3CA 4UALA 2YERA 1UVRA 5I4NA 1WBWA 4FKVA 4G6LA 4ZEGA 4NH1A 1ZARA 3R63A 4QP6A 1JSTA 5BYYA 4A9YA 3FWQA 3E87A 4QNYA 3W32A 4DLJA 3C9WA 4FSQA 3N4TA 1YWNA 5JT2A 1M2PA 4FICA 5AM6A 3RINA 4M0ZA 3OXZA 4JRNA 3VONA 4APCA 4RA5A 1VJYA 4MWHA 3W0QA 2VTLA 4YBKA 3HV5A 4ITIA 1OIQA 5F95A 3FLSA 3UOKA 4GG5A 3OUNB 4TY1A 5AR8A 1MRYA 4FT7A 4L44A 3WF9A 5BUJA 3DXNA 4AW0A 3U55A 3RCDA 2JEDA 3U4UA 3VHEA 2C6DA 4O7VA 3HMPA 4CZTA 5K4JA 2X0OA 3QFVA 2YDKA 1O6LA 1Q3WA 1WAKA 2ERZE 3UNKA 3HUCA 2B0QA 3OT8A 3NFGB 3PTGA 3OCBA 3DLSA 3P79A 3OBJA 3IW5A 2GNIA 3P1AA 4GEOA 2X2LA 1IAJA 2R0UA 3MFTA 2FYSA 5AM7A 2JDSA 2Y4IB 1YW2A 2J2IB 3GGFA 4HJOA 1Q24A 3NAYA 3QLFA 4JXFA 2VN9A 2OWBA 2YAKA 2YEXA 3KN6A 3L9PA 2BMCA 3PE1A 2VWWA 1H26A 1WBVA 4QD6A 2GSFA 3WF6A 4D1ZA 1U5QA 3VF9A 4TKSA 4LRMA 4O38A 2VGPA 3SDJA 3M42A 3Q53A 3NRMA 4YZBA 4IAZA 3DTWA 1Q5KA 4QPMA 4ACMA 1Y57A 4HNFA 3W8QA 3QXOA 4GT3A 3DJ5A 2X1NA 4I94A 3UVRA 2V5QA 3CIKA 4E3CA 3RM6A 2BRNA 3H3CA 4ANOA 1UU7A 4F9YA 1AGWA 2F7ZE 2J6MA 2XP2A 4GIIA 4ZMFA 2RFDA 4X0MA 5K3YA 3UE4A 4O7TA 4L42A 4ZTHA 1J7LA 4XEYA 2R3FA 3SXSA 2EWAA 2Y0AA 5JZJA 2VO3A 4MWIA 4M67A 4AF3A 4CRLA 3GU4A 3EL8A 4L3PA 4JMQA 4FKIA 4JRVA 3WF7A 5ETAA 4MKCA 5BNJA 4E4MA 4DHJA 3JY0A 4KKEA 3CSVA 2R3IA 4C33A 4JS8A 5EDPA 3AC8A 1ZYJA 2ITUA 3Q4UA 2WAJA 4BCGA 4D1SA 2BKZA 3MW1A 3V5PA 4R7IA 4PP9A 1YI4A 3TEIA 1B39A 3R9RA 3DK7A 4WUNA 4QMWA 5DR6A 2P4IA 4JJRA 3ANQA 3K54A 3FUPA 3W55A 4CCUA 4HPTE 3TM0A 4LGDA 3TNPC 4CZUA 3V51A 4O0UA 2BHHA 4G3GA 3Q5IA 4D2SA 1ZYDA 4YJSA 3E3BX 1U46A 1MQBA 2EU9A 3TZ9A 4DHFA 2R0IA 4XNEA 1CMKE 4IB3A 2JKOA 3PY0A 4E5BA 3QTXA 4G3EA 1I09A 4WBBB 2PMLX 3UP2A 3FZRA 4BCPA 2CCHA 4JDHA 4FTKA 5IPJA 3R2YA 4KAOA 4FEUA 4BDEA 4AGUA 4DFXE 2FSOX 4D1XA 3MY5A 5DFPA 5M53A 3U6JA 3QYWA 4BDCA 3PSDA 5EG3A 3I5ZA 2R9SA 2PVYA 4IDVA 3EZRA 3R8UA 2W1IA 4XLVA 3G9LX 4UWBA 4UN0C 2JDRA 4ZSAA 1KV1A 5BUIA 3R7GA 4EH7A 4QT1A 3O8PA 4D4YA 5DA3A 4NM0A 3UZRA 3VN9A 5DMZA 4LOPA 3OWKA 4NU1A 5D7AA 3QCSA 2IVTA 1UKHA 2HW7A 4RJ8A 4C34A 1XWSA 4GH2A 5J9ZA 1ST0A 4BFMA 3RHXA 3HV6A 2X0QA 2H34A 4IM0A 2YHVA 4IDTA 2J90A 4YPDA 5JK3A 2R7IA 3PYYA 5A9UA 3PXFA 4WSQA 5KMNA 4CFNA 4E4LA 4OTGA 2E9PA 4AE9A 4E5WA 4E93A 3FE3A 2QLUA 3PJ8A 5LMKA 4XP3A 2XNNA 3F3UA 3GCPA 3KK9A 3W0OA 2QD9A 3C5UA 2P3GX 4ACDA 4IB5A 3GBZA 4Y72A 3OY3A 2NNWB 3R1NA 5JGAA 3FJQE 3FL5A 4C61A 2XALA 1J91A 4L45A 2IW9A 4E5AX 3U51A 3VS2A 1GZ8A 1IRKA 2X9EA 3MGYA 3PY3A 3QHWA 4NK9A 3ZLXA 4ENYA 4F1TA 3BLAA 2WTDA 5J8IA 4QYEA 2HZ0A 4TYIA 3O17A 4MXCA 5HCYA 3RAKA 3I1AA 3T3UA 3WF8A 3MH3A 4D58A 5DBXA 3CE3A 2C5XA 2C6TA 4CFFA 5AAEA 1BLXA 4RA4A 2ZVAA 5AP4A 1ZOHA 1WVXA 2P33A 3QD0A 3H9OA 4ZY4A 2GQGA 2JD5A 3CY3A 4RX8A 3ZUVA 4AW2A 3ZU7A 3PIYA 2RG5A 3MFUA 3TWJA 5TOZA 3FSFA 3PXRA 1P4FA 4RWKA 2UVXA 4MD9E 4OT5A 3FEGA 2BZJA 5FXSA 4ZY6A 1KWPA 1J1CA 3ENMA 4FTTA 2WU7A 2ZDTA 3BU3A 2X7OA 3IW4A 1H4LA 5KBRA 2WKMA 4PNKA 4MBJA 1H0VA 3IQ7A 3A2CA 3SG8A 3BGPA 5DHJA 4BY9E 2YFXA 1APME 3MA3A 3QC4A 4O2ZA 4AZSA 4QMNA 3MB6A 2PZPA 5F9EA 1MRUA 5KNJA 2ZAZA 5L2TA 3TUBA 3RBWA 3VUIA 4I5PA 2VTJA 2ZOQA 3WF5A 3ERKA 4N4SA 4RIWA 3TI1A 4FVQA 4M66A 5HNGA 4MNFA