4UMUA

Structure of melk in complex with inhibitors
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
331
structure length
316
Chain Sequence
DYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDTAAALVAKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title Structure-Based Design of Type II Inhibitors Applied to Maternal Embryonic Leucine Zipper Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 316
sequence length 331
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4umuA00
3RWPA 5JH6A 2W4KA 3CQWA 4FV5A 5E92A 5CENA 3HV5A 3ZUUA 2EU9A 2PVLA 4Y73A 3C50A 2XYUA 1XQZA 2R3PA 3A61A 2W4OA 3BYUA 4BCIA 5E8UA 4QMLA 2JDOA 2LGCA 4JNWA 3ULZA 3MPTA 4TNDA 2BVAA 1FGKA 3UP2A 4AF3A 3UO5A 4BTKA 3NEWA 2XH5A 1ZYJA 3R21A 4RX8A 2WMSA 5F95A 2JEDA 4YUQA 4AW5A 2XJ2A 4NH1A 3SOAA 4KSPA 3VBTA 1SVHA 2CCHA 5J79A 3RAHA 4G3FA 4W9WA 4EH8A 3O7LB 3L9NA 3Q96A 4J1RA 3UQCA 2OSCA 5B7VA 2Z8CA 3OFMA 4X2NA 3O50A 3M42A 5L8LA 4GSBA 1J1BA 4QP7A 5CANA 5EI6A 3GOKA 2Y6OA 3FKNA 3P08A 5CT7A 4BHZA 4MAOA 2W1GA 1LEWA 1M17A 4FK6A 3EH9A 1W0XC 2P3GX 3BKBA 3DOGA 3VHKA 4JBVA 3BQCA 5KX8A 1O6KA 3RZFA 5LVPA 4HGSA 2YA9A 5HE1A 2PMLX 4C58A 4IVAA 5LCKA 1KE8A 5IEXA 4RC3A 1SZMA 2R3GA 3HEGA 4UMUA 5IA4A 5B0XA 2BHEA 3SVVA 4M7IA 3TNIA 3ZUTA 5ANOA 2FSLX 5A4TA 3K54A 4FGBA 4K33A 4G3DA 2R3MA 3FLQA 5BNJA 1M7QA 1WBOA 4GEOA 4BDAA 1M7NA 4M67A 2H9VA 1H01A 2QO9A 2RL5A 4LUEA 5K3YA 3AOXA 4A9YA 3ZM4A 2WTJA 3PG1A 3IW4A 4X21A 3EKNA 3OZ6A 3ZO4A 4EK6A 2AC5A 2QLQA 2WGJA 4FNZA 3G6HA 3WZDA 5L6OA 2X2LA 4X2KA 3AT2A 3S4QA 4NJ3A 2PZRA 4BGGA 2QR8A 3GVUA 3LPBA 4NUSA 3QZHA 3VBYA 3VQUA 4S31A 4AN3A 2WPAA 3ANRA 4WG4A 2C5VA 4RIYA 4CYJA 5CAVA 3PRIA 4P5QA 3LCOA 2FYSA 4G3CA 4P5ZA 4XG8A 3BGPA 2C3IB 3EQHA 4Y46A 2VUWA 1U54B 2JC6A 2NO3A 3LJ2A 1XH6A 3MH3A 3NLBA 4L7SA 4XRJA 4YJTA 4DGLC 1Y6BA 5IH6A 3IO7A 3P7CA 3UGCA 5EKNA 2XNGA 2WMTA 3NZ0A 3BYMA 4FVPA 4MD8E 5GJFA 3I7BA 4D1SA 4XUFA 4GJ3A 2YM4A 5ITAA 3C0HA 3UIBA 4TWCA 3NGAA 4B9DA 3QKLA 1ZARA 2CGVA 4WRGA 5AV0A 3QTXA 2H6DA 2HZNA 4DITA 4BFMA 2F4JA 1U59A 1UNLA 1ZLTA 5EOLA 4BWPA 3IDPA 3PE2A 3FJQE 1H1WA 4DGOA 3DBFA 3F3ZA 3TNQB 4XV1A 1KE7A 3DQXA 3KN6A 4II5A 4L9IA 5AP7A 4AA0A 1LUFA 3H9OA 3GXLA 3D94A 3PJ1A 4TYHB 2HELA 3R1NA 5T68A 3WIKA 4QYFA 3R0TA 4XMOA 2ITTA 5J9LA 3ZTXA 3R9DA 3ZBFA 4EH7A 2WTCA 2P0CA 2QVSE 3PP0A 5TT7A 4D5KA 3ORLA 3BWJA 5CVHA 1NVSA 5F94A 1WVXA 3FDNA 3ZSIA 2XCKA 3HMMA 4CD0A 4PL4A 5CF5A 3BGQA 4FTKA 4BHNA 2YM6A 2C0IA 2W5HA 5KMLA 3KCFA 4PP7A 5HCYA 2WOTA 5IDNA 1U54A 2X7OA 2X8EA 1Z9XA 3KVXA 3LIJA 3EIDA 3W8QA 4G31A 4NK9A 4V0GB 5CQUA 3FXWA 2QOQA 3QCYA 3EHAA 1M14A 3KA0A 4FV2A 4F64A 4DGGA 3NYNA 3FY0A 2IN6A 2XK6A 3QTWA 4RSSA 4EK8A 2J0IA 4XG4A 1STCE 3A4OX 3D4QA 2BAJA 3RM6A 2YN8A 4MYGA 2PMOX 2ZJWA 3UIXA 2J90A 3W16A 1SVEA 2VX3A 3LJ0A 4ZTLA 5D7AA 3KB7A 4GT3A 4W4XA 5H8GA 2ONLA 5J1WA 1H0VA 3ORNA 4AA5A 4ASDA 3P7BA 3TL8A 2QR7A 3AC8A 2IVVA 1S9JA 2J6MA 4RA4A 3EFLA 4TYHA 4C3PA 4X2FA 4E4LA 4IB5A 1KOAA 2HK5A 4F9BA 3KRJA 5K0KA 1MRYA 1OIQA 5J7HA 4F99A 3AMYA 5E1EA 2JFLA 3BZ3A 3D83A 1NVQA 4RLLA 3VS1A 4BBFA 2YJRA 3TIYA 2R64A 1U46A 2F57A 2EVAA 2J5FA 3IGOA 3QQJA 2VTIA 5AA8A 3R8ZA 1RDQE 3R30A 4FG9A 2R3FA 4CTBA 3A7JA 5AR3A 2QONA 3KC3A 4N6ZA 5D9HA 5LMBA 1Q24A 4GFGA 4PTCA 3R63A 4EKKA 3KL8A 4DEHA 4V0GA 3WOWA 4MF1A 5CU2A 2JIIA 3DA6A 3KULB 4ASZA 3IOPA 3B8QA 1J3HA 2X0GA 3W8LA 4BCKA 1MUOA 4AW0A 4D2WA 3ZEPA 4RX7A 3D7TB 5I3OA 4EBVA 4PL5A 5FM2A 2BCJA 5AUUA 3HYHA 5L6PA 3EL7A 3QTIA 3PIXA 3ETAA 1BI8A 2YCSA 3LJ1A 5IA5A 3VBQA 4C4FA 3HV6A 1UU8A 2GNLA 4KIKB 3ZC6A 2XJ0A 3UVPA 2BRBA 3LXNA 5H2UA 5JFVA 1PKGA 3AXWA 5KZIA 2J5EA 3MVHA 4AWIA 4KIQA 3FZOA 3VS3A 4GUEA 5I9WA 2B4SB 3IGGA 4MD9E 3T8OA 2WKMA 4AE6A 2CMWA 3U6JA 5AX9A 2Z60A 3ORZA 4NEUA 5HNIX 2HWOA 3NNWA 1IEPA 1Z5MA 4V04A 5HNBA 1ZY4A 2VO0A 2UW6A 4H3PA 2ONLC 4W4VA 3TZ8A 5D12A 4JDIA 4WNKA 4OAUC 2VTMA 4S33A 5AR7A 4EWQA 4FL1A 3V3VA 4EHEA 3EFKA 4P90A 5AJQA 4RWIA 3WIGA 3R9NA 1SNUA 4QMNA 5I9VA 4ALVA 4E8AA 2OFUA 3JPVA 4RZVA 2A0CX 3ZLWA 3AC4A 3MJ1A 5CVGA 3GFEA 4C2VA 3BYOA 3PSCA 4I6QA 4WSYA 5CEIA 3KULA 3BE9A 3EQPA 4IZ5A 4O21A 3I79A 2HWPA 5M4UA 3U51A 3TG1A 4IIRA 2B9IA 1CDKA 2VAGA 3D7TA 3HV4A 4I93A 3T3VA 4CFMA 4L44A 5BUJA 2VTHA 2HCKA 3VBWA 4FL2A 4WT6A 3A7HA 4EQMA 4TTHB 3KK8A 3L9MA 3MI9A 3PY0A 2B54A 3ORMA 1YWNA 2OJJA 3DK6A 4IWQA 4QNYA 3ZXZA 2OJFE 3QXOA 2ITWA 4ZTSA 2W1EA 2H34A 3LFFA 4A9RA 3NWWA 4FNXA 4Z9LA 4YZDA 4AGUA 4E5BA 4GK2A 4H58A 5FXSA 2VWXA 4O0SA 1TQPA 5L2TA 4UWCA 3MN3A 5JEBA 3CY2A 3DS6A 2OZOA 3MS9A 3AT3A 3KXZA 3PPKA 4NU1A 4PTEA 4Q9SA 4BDIA 4ZY4A 4O0TA 5JZJA 5KKRC 3VULA 5BVWA 2OI4X 1SVGA 2R3LA 4MWIA 1J1CA 4AQCA 3EN9A 3MA3A 2IW8A 4R3RA 2ITNA 1Q3WA 2RGPA 4O6EA 3GC0A 3TNPC 1K9AA 2HY0A 4PNKA 3DTWA 1Q97A 2YDJA 5CS6A 2JIVA 2XK9A 4UX9A 2PTKA 1XHAA 5KMJA 3F3TA 4DEAA 4JT3A 3R22A 3UMXA 4G6NA 4EOQA 3R9HA 2GU8A 4RJ7A 5CVFA 2CLXA 4HPTE 4LRJA 5AUWA 3BU6A 3ZZWA 3ZUVA 2YISA 2I0HA 4I0SA 1OIRA 2C47A 2G1TA 3P79A 4YC3A 3E7VA 2HIWA 5HI2A 4CMOA 3QQLA 4FZDB 1CMKE 3QQHA 1ZWSA 1OKYA 3I7CA 3EL8A 1TVOA 4BI2A 2CSNA 3A60A 1KV1A 3KF4A 1LPUA 5FDPA 4PDOA 3LW0A 4QTEA 4U42A 3NAXA 4UBAA 3OY1A 3VVHA 3FC2A 4PPCA 4IAZA 2BUJA 3BI6A 4IB1A 1X8BA 2ZYBA 3QD3A 1CKPA 3MDYA 4W8EA 5T3QA 2PHKA 3MH1A 3Q9ZA 4GU6A 4HW7A 5ETCA 2BTSA 4GFOA 4IWPA 2C6DA 3KGAA 4KIPA 4QQCA 5M53A 3LXKA 4ZSAA 2B55A 4JBPA 3IONA 4YP8A 4C33A 2BZHB 4XJ0A 5HOAA 3SXFA 5AAEA 2CLQA 4M66A 4AAAA 4RT7A 4JIAA 4CMUA 4CXAA 5HEZA 2UZWE 4BYJA 3R28A 4FTTA 3RPRA 3AC5A 4K11A 3FMDA 2PE0A 4BZNA 3UO4A 3TCPA 4I24A 4QMOA 5DWRA 4R8QA 5EG3A 4AS0A 2ACXA 3WYXA 3W10A 4BCGA 2ZV7A 3QC4A 4Z55A 1H1RA 1ZAOA 2GTNA 4FTIA 3FZSA 3R71A 5FG8A 4TT7A 2DWBA 2IW9A 3VN9A 3MH0A 1O9UA 3R8UA 3EZVA 3NIZA 4FIGA 4A9UA 4CZYB 4BIBA 2GNHA 3CQUA 4I5MA 3R04A 3GUBA 4I23A 3WE4A 4FUXA 4IW0A 1YDSE 5M44A 3QWKA 4GS6A 4MXCA 2CHLA 2UVYA 4C59A 4QMWA 5E91A 5CSPA 3PPZA 4K77A 2GS2A 4PNIA 1DS5A 4DH5A 5G6VA 3FMEA 4A7CA 1J91A 2YM5A 4V01A 3RPOA 2JBOA 4BI1A 3GNIB 3QLFA 4FMQA 2OU7A 3QKKA 2JD5A 2UV2A 4AA4A 4YTCA 1F0QA 4G34A 5J5TA 5LCJA 1JBPE 3UQGA 3R7YA 3PVUA 5CAQA 4JBOA 4FR4A 5JSMA 2XYNA 3M1SA 5CAPA 3DFAA 1OPLA 2UZNA 3PTGA 2DQ7X 4XHKB 5M4IA 4L01A 2XK3A 4OBPA 4RA5A 3WZUA 4CRLA 5IMEA 5J1VA 3ODYX 5HTBA 4DLIA 2G15A 3REPA 3NUSA 4CLIA 2ITUA 4EC9A 4L52A 1PXLA 2FSTX 4J7BA 2PVJA 5DI1A 1XR1A 3TT0A 4ITJA 4DFXE 2X1NA 5CF8A 4EQCA 2A1AB 5AP2A 1ZZLA 1F5QA 3H9RA 3A7IA 2PVHA 3BU3A 4QMTA 5EDPA 4BCNA 4FUYA 4XV9A 5A4CA 4HGEA 5E90A 2BDWA 3Q60A 2UZTA 2J51A 4FK3A 4U44A 4C38A 3Q9YA 5D10A 3D5XA 3QQUA 2QKRA 4TPTA 1FVRA 1YW2A 4AN9A 4MBJA 3BEGA 4O1PA 3Q6WA 4HYIA 2YCQA 1CTPE 4BRXA 4EC8A 3K5VA 4X3FA 4XV3A 5EOBA 3UZPA 3QTSA 4G5PA 3OT8A 2UW8A 3ACKA 3SD0A 5EM7A 5L2QA 2Y8OA 2IVSA 3E62A 4BTMA 1YHWA 4IZYA 3GFWA 5EYDA 5AWMA 4E5AX 3MPMA 4FV4A 4LYNA 1JAMA 3NW7A 1IG1A 1U5QA 4M3QA 2OO8X 2V7OA 3QZFA 4JRNA 4AZTA 5FTOA 4QYGA 3Q4TA 4FI1A 5IKWA 4KINA 3K3IA 2JAVA 4G6OA 2OGVA 4MBLA 5HHWA 2E2BA 2GNJA 5IH5A 3QZGA 3F5UA 3O0GA 5DN3A 4HPUE 3GC8A 1ZY5A 3QD4A 5J8IA 4CYIA 4OBQA 3R8PA 2RIOA 2C5OA 3C4XA 3H9FA 4YZ9A 3KXNA 4MHAA 5CU6A 4GIIA 3R02A 2UW3A 3SA0A 3R1YA 3GP0A 3LFCA 1PXNA 4ARKA 3WF5A 4AT3A 1IR3A 3OROA 4I5PA 2XNPA 3DAJA 2Z7SA 1PXPA 4U81A 5CSWA 2X4FA 5AIKA 5HE0A 3TTJA 1UNHA 4LL0A 4PDSA 2GDOA 3QX4A 1IRKA 3ACJA 2G01A 4D4RA 1PXKA 3CPBA 4QPSA 2ZDTA 1FOTA 2I6LA 3VAPA 4RGJA 4Y95A 4ZS0A 3TACA 2B52A 3S3IA 4AFEA 4YZBA 4YMJA 3FZTA 4NIFB 1UKIA 4ZJVA 5AEPA 3OW4A 4FSYA 4NWMA 3WF6A 3CCNA 3AMAA 4GYGA 3FY2A 2WOUA 4BDDA 3D7ZA 4XG3A 2I40A 4DLJA 3CTHA 4F6UA 3DDPA 3OY3A 3F3WA 4BCQA 5J87A 4TYIA 4C4JA 1JWHA 2WXVA 3HUBA 5EHYA 3FE3A 4LG4A 4DC2A 3LFSA 2B9JA 1L3RE 4S2ZA 1Q61A 1PW2A 3QTQA 4FV8A 2G2IA 2UW5A 2ITYA 1PMEA 2GHLA 2QCSA 2UUEA 4FKIA 4BGHA 5I3RA 2WIHA 3FMHA 5I5ZA 3GCUA 3BLHA 5ANJA 4E6AA 2YZAA 4AUAA 5GJDA 4HYHA 4MEDA 3JUHA 4YC8A 4XG7A 2W1DA 1FMKA 3RINA 4EK5A 4CFWA 2UW0A 3G0FA 4QYYA 4M97A 4RWKA 1Y8YA 4L3JA 1GZOA 1KWPA 2ITZA 4G6LA 3PSDA 1BYGA 3QZIA 4R7HA 3ITZA 3FQHA 5DNRA 4HVSA 4F9AA 4IACA 2W1HA 4BDJA 4ZZNA 4AOJA 3C1XA 5JGDA 4AZFA 5CSXA 4DFYA 2A4LA 3HECA 4QTDA 3BHHA 3WBLA 4XH6A 5AP4A 3AD6A 3OF0A 4IM3A 2VN9A 4GT5A 2GSFA 1NVRA 3GC7A 2XNMA 3VW8A 4NIFA 5ETAA 2O0UA 4A4LA 3DB6A 5KUPA 4YR8A 5KHXA 2FH9A 3E5AA 4I3ZA 4UALA 4AW1A 4OW8A 5CLPA 2VWZA 3QYZA 4YSJA 5FEEA 1F3MC 1ZZ2A 3FSFA 3UODA 3FLNC 3MFUA 2W1IA 1YXVA 3FUPA 1OVEA 1W7HA 3FBVA 5IMXA 4YURA 3LMGA 4BDBA 5CU0A 4QP6A 4NW6A 3SOCA 3NRMA 3QKMA 3SXRA 4MXYA 3O71A 4I5CA 5JKGA 1R0EA 4AXAA 3AD5A 3VQHA 4BWXA 4L42A 5I0BA 4D4SA 5KE0A 4ANNA 4RZWA 5CWZA 2WQNA 4IADA 3TNHA 4RFZA 4D2TA 3PPJA 2PL0A 4ALUA 4CTCA 4DH7A 4JAIA 5K5XA 3BBWA 4MXOA 4ALWA 2BKZA 4UB7A 3RBWA 4EEVA 5IG1A 2YM8A 3F3VA 3B2TA 4FVRA 4KBKA 3VF9A 4CKRA 2C6TA 4USDA 2NP8A 4LUDA 4LGHA 1YOMA 3GI3A 4C57A 3FI4A 3IQ7A 5EKOA 3A7GA 3HMOA 4M13A 2EB2A 2W96B 2WELA 4KNBA 4QMVA 5DVRA 4ACCA 4D58A 5BQ0A 2OK1A 4AZWA 1DAWA 4IAIA 3VUDA 4DEIA 2PK9A 1OL5A 3HRBA 1M52A 4MTAA 3NS9A 4LOQA 5C9CA 4HVDA 3FKLA 1RE8A 4A9TA 4F6SA 4IAKA 3TV7A 2BZJA 2EUFB 1CKJA 3EN6A 4BCHA 4UMQA 4M68A 3FV8A 2C5XA 4FZAB 1Q8TA 3MFTA 3U9NA 5B2KA 4G9RA 4FV1A 3NUYA 1Q8YA 2XRUA 4X7QA 1B6CB 1Q4LA 1RQQA 4X6QC 2GNIA 4NCTA 4ZSJA 5M56A 5JGAA 4F7LA 4KAOA 4ZK5A 3MW1A 5EM5A 3P4KA 4A9SA 2UZLA 4RQVA 4C02A 4IWDA 3T9IA 4F0IA 4UXLA 2Y9QA 3QUPA 2ETKA 3O2MA 1U4DA 4EONA 3II5A 1DI8A 1ZOGA 5LXMA 1HOWA 4H3BA 3QC9A 2ZB1A 2IZSA 2E9VA 3LFDA 4FEQA 5CNNA 5C03A 5EK7A 4H3QA 4IB3A 1QMZA 3FI2A 2C68A 2VTAA 2ETRA 4JG6A 3QCQA 4BBMA 3W2CA 3EYHA 3V5PA 5DG5A 3MTLA 4LFIA 3F66A 3RM7A 5BX0A 4BDCA 2G2FA 5HU9A 2KTYA 3BIZA 4D2SA 2O5KA 4YZNA 2GTMA 4D28A 1XH4A 2VZ6A 4RIYB 3OD6X 4XCUA 3K5UA 3EFJA 1JSTA 4YC6A 4Z7GA 2GS7A 2E9NA 2GCDA 2VWYA 2VU3A 3U87A 4CSVA 5CQWA 3LZBA 3ALOA 2WTDA 1JOWB 2OJGA 3DBDA 2WZJA 1ATPE 5L2SA 3UOKA 3U8WA 3R1SA 5E7RA 5CZIA 4FTLA 5GHVA 4BIDA 4U3ZA 1VR2A 5HCZA 4ZSEA 2F7EE 2VGOA 1XH8A 3PG3A 4YZMA 2JKKA 2QU6A 2ETMA 2EXCX 2X4ZA 3F7ZA 3R9OA 5C26A 5HG8A 3BE2A 1OMWA 4O27B 5C8NA 2WMBA 5HD7A 2YITA 3ZHPC 3I6WA 4J52A 3C4CA 4NZWB 2WTKB 1GZKA 2ZDUA 5HVYA 2W17A 4NCTC 5HE2A 3ZO2A 4BDHA 4LOPA 4EZ7A 2XB7A 3KXGA 4D0XA 3MGYA 2O3PA 3F61A 4D4YA 2PMNX 4EK3A 1FPUA 2BFYA 4ANSA 2HZ4A 3QUEA 4RC2A 4BB4A 3V5JA 3UOJA 3FLSA 3LM0A 4WOVA 2VTOA 3QTUA 2O65A 3G9NA 3L8XA 4IAAA 5DHJA 4YHJA 2OXDA 5FEQA 5GJGA 4CZUA 3V8SA 5JN2A 4EI4A 3CKWA 1V0OA 3CEKA 3S0OA 2V5QA 5KMNA 4XEYA 5HBJA 4JQ7A 2BFXA 1APME 3SC1A 4C3FA 2RG6A 5AUYA 3QD0A 3MY1A 4YPSA 4HNIA 4DFNA 3L1SA 4JQEA 4XV2A 2F2UA 3IDCA 4UYNA 2XUUA 1ZMWA 5HU3A 3CE3A 4GUBA 4I5HA 2EWAA 1RJBA 2R3JA 3R7OA 4ACDA 4ACHA 3DLSA 2C6LA 4R1YA 1E1XA 4IJPA 3TEIA 1BLXA 3OW3A 2C5NA 4G9CA 3C5UA 1O6LA 5K0XA 2WMXA 4GG7A 4IM2A 2JDTA 4CCUA 2HW7A 3UQFA 2GHGA 2SRCA 2UW7A 3KRRA 3UOLA 5AUZA 4C4EA 1BI7A 3P1AA 3KU2A 4O6LA 2W1ZA 4MNEB 4TWNA 5JMSA 1UWJA 4FV0A 4F4PA 4FT5A 2UZBA 1OIYA 4O96A 4FTUA 2HW6A 1ZYSA 3R83A 4WO5A 2X7GA 3E63A 3NUNA 4AX8A 3PUPA 4PUZA 4FSWA 3ZONA 3COIA 4KRDA 3ZDIA 3ZRLA 4NJDA 5FP5A 3U6HA 3FMMA 3QA8A 4CV9A 5EDRA 4CT1A 4EOKA 4BDEA 1SM2A 2BAQA 3PIYA 3AC2A 2OG8A 5CX9A 4AGCA 3H3CA 1REJA 3WI6A 2YLFA 5HO6A 4J95A 4B7TA 2QHMA 2YDIA 3F69A 5TF9A 2IWIA 3SDJA 5M57A 4C36A 3O8UA 3RCJA 1DM2A 2ERZE 2QOFA 4Y5QA 3VW6A 4KKGA 3D5UA 2J0JA 5CSHA 4LL5A 3Q5ZA 3JY9A 3DNEA 3BHYA 3PY3A 3EN7A 5L8JA 3VJNA 4EH4A 5E8XA 3GC9A 2DYLA 4I21A 3L8VA 3EQRA 5KMKA 3NYVA 4ZOGA 3PVBA 4FTNA 4I20A 3UYTA 2BMCA 4G1WA 1BUHA 2R5TA 2G9XA 4DHFA 4LOOA 1OGUA 4MNEA 4BVUA 1PYXA 5AR4A 5KKRB 3PA4A 3KMUA 5ANIA 4XLIA 3ZCLA 4FT0A 1XBBA 4K18A 2C69A 4OTFA 3G0EA 4PP9A 4R1VA 5CT0A 4D1XA 4HVHA 2WTKC 3KFAA 5EDQA 3F7WA 4BCMA 4HNFA 3VS7A 2VD5A 2C6OA 3PYYA 3PJ3A 3O8TA 2VTRA 4FT7A 4ZSLA 2B1PA 3AC1A 4OTIA 1B39A 1IA8A 3FQEA 3VUKA 2J2IB 4FSZA 2JDVA 1WBTA 3PY1A 3UYSA 4E3CA 4G17A 5AV1A 1GOLA 1GAGA 1YWVA 1OB3A 2XKFA 4BF2A 2XNOA 4QMXA 4S32A 3BLRA 5FM3A 2J7TA 3C4WA 2XEZA 4IANA 5BPYA 4NTSA 4PMPA 3AQVA 3CR0A 2YAKA 2ITVA 3MVJA 4FTQA 2W1FA 4GIHA 3RAIA 4QMSA 3W2OA 4BGQA 4E4NA 3RZBA 4ANOA 3V01A 3ODZX 1H8FA 2HENA 4R5YA 3HA8A 3R7EA 2C30A 2OW3A 1UU7A 4U8ZA 2VX0A 3RNYA 2X9EA 3OCGA 5FXQA 2VWBA 4FKLA 2RFEA 5EM8A 4JR7A 5KO1A 4DG0E 5HD4A 4O0XA 5AM7A 4QMYA 2ITXA 4ENXA 2FSOX 3UPXA 2X6DA 4J98A 5D1JA 3RP9A 2W06A 1MQBA 3RPVA 4DGMA 3E92A 4JG8A 3HRFA 4OTRA 3EB0A 3O17A 4DCEA 5A4EA 1UU9A 1VYZA 2X9FA 2UW4A 2RFSA 3R8VA 3BYVA 4IE9A 4OUCA 4FZ6A 4N4SA 4ERKA 3G33A 4NT4A 1KE5A 3A8WA 3K2LA 2EB3A 2X2MA 5HLPA 2LAVA 2BIKB 4MQ2A 4FZ7A 3ROCA 1Q8ZA 3EQFA 4O0RA 5I9ZA 3ZDUA 3SAYA 4C7TA 4ID7A 3DNDA 3HMPA 1K3AA 4EOOA 5HG9A 4XBRA 4EHVA 4JG7A 4Q2AA 4NM0A 3R8LA 4MXZA 4FT9A 3ZEWA 1NY3A 4J8NA 2I0YA 3UPZA 4JI9A 1ZRZA 2WTWA 1Y6AA 5CAUA 2WTVA 2XP2A 4ZTRA 3R7IA 3ZRKA 3QTZA 3PXRA 1A9UA 3DK3A 3JYAA 3RGFA 3LFEA 5GZAA 5LVOA 3TUBA 2HZIA 5AAFA 4CQGA 4I4EA 2JLDA 2WQBA 3Q4ZA 3EKKA 3IG7A 5DEWA 4LM5A 2IVTA 3AGLA 3T3UA 3ZO3A 3DGKA 4FX3A 3BV3A 2R7IA 4LQMA 5IA3A 1ZYCA 4RIWA 3GB2A 4QP1A 4A07A 2NRUA 4FSRA 3CD3A 3PWDA 5DH3A 1XJDA 4YO6A 5AX3A 4C34A 2R3HA 4QMQA 5KMMA 5A9UA 3LE6A 4H36A 4XNEA 4AT5A 3NPCA 3P7AA 3W55A 2XK7A 2BDJA 2B9HA 5FLFA 2QURA 3PFQA 4JBQA 1P4FA 2IVUA 4OTWA 4D2VA 4JRVA 4JX3A 4CKJA 4MF0A 4OAVB 2BZIB 3ENHA 3F88A 3I0QA 4RJ8A 5IPJA 4FKOA 1H0WA 2OZAB 3GU8A 4FKJA 3UG1A 3V5TA 3VUMA 4C62A 2FGIA 3OXIA 4OTPA 4JDJA 2CGWA 2XIKA 4E4XA 4W4YA 5CSVA 4M8TA 3BV2A 2HZ0A 4JJRA 4IVCA 5FBOA 3NYXA 4BWKA 4KS7A 4CKIA 4GRBA 2H8HA 4R3PA 5H9BA 3NDMA 3CLYA 4ZAUA 4UY9A 3HA6A 3L8PA 4FKSA 5ANDA 4AZEA 3PXYA 4D5HA 2W5AA 2XEYA 2X81A 2YWPA 5AA9A 2GQGA 3D2KA 3V5LA 5F20A 1ZMUA 3QX2A 1R3CA 3KVWA 4BC6A 3E3PA 2OIBA 4J97A 1Q62A 4A4OA 4OTQA 5CU3A 2A27A 4C4HA 4D55A 1AD5A 5CALA 3QRJA 5DGZA 2XJ1A 2JKMA 1W83A 4E6CA 1OECA 3HX4A 2HY81 2BPMA 2YACA 3H30A 3PE1A 4BKYA 4UMRA 1FGIA 4EBWA 5LVNA 4XOYA 1PXMA 3D5WA 2O64A 5AV4A 4F1MA 2G2HA 3E8EA 1BMKA 4RJ5A 4GK4A 4FA2A 2CGUA 2IO6A 5HORA 1GIIA 3ORIA 3UO6A 3LXPA 5HG5A 1E9HA 4GU9A 4Y72A 3VS0A 3LM5A 2OZAA 1JKSA 4PL3A 2Q0BA 2GS6A 3R2BA 4RFMA 2ZOQA 1V0PA 4XG6A 4AT4A 4JS8A 1JLUE 5BYYA 4LRMA 4WG3A 4RIXB 5HBEA 3LQ8A 1SMHA 3ZLYA 5IEVA 4EOIA 4F6WA 3DKFA 3NX8A 3RJCA 4OLIA 3WZEA 2PVFA 4QT1A 1UV5A 5ICPA 4RG0A 3QHRA 5CYIA 4L45A 4QQJA 4YZCA 4Q9ZA 2UW9A 3GU4A 4E5WA 1VZOA 3UVQA 3ULIA 3IW8A 4HZSA 2WAJA 2WQMA 5FGKA 1TKIA 4WSQA 1T46A 3B8RA 4QP4A 5HLWA 4HYUA 2IZTA 2PZ5A 2J50A 1JKKA 3GCPA 3CBLA 5H8BA 3TXOA 4CFVA 2QODA 3L9PA 3FZPA 3C7QA 2CJMA 5CZHA 4PMTA 5CXZA 1YI6A 2OF4A 3RI1A 3COHA 3RPSA 3OMVA 3S2PA 3C4FA 4CFXA 3EYGA 1YDRE 1DAYA 3SLSA 2ITPA 2JBPA 4N70A 3NNXA 4IB0A 4EUUA 4FODA 3CKXA 1UWHA 4NM3A 4C2WA 4FYOA 4X3FB 4RJ3A 2RF9A 1Z57A 2WMWA 3FWQA 2ERKA 4OGRA 2QHNA 2VNWA 3PVWA 4UYAA 5AP6A 4AZVA 4FF8A 4X3JA 4QP2A 4IC8A 3D15A 3FL4A 3KK9A 3MV5A 4IZ7A 3VS5A 3AC3A 4APCA 2CN5A 3UG2A 1M2PA 1XH7A 3O8PA 4QTCA 3IW7A 4H1MA 4CV8A 5EHOA 5LWMA 1VEBA 3QCSA 4RIXA 2XKEA 5A6OA 3WILA 4KB8A 3VWAA 1NXKA 3ZFYA 3I60A 4GVJA 3TWJA 3TV4A 3VRZA 3IW6A 2GMXA 2Y6MA 5E8VA 3BX5A 4D2PA 2ZM1A 3KY2A 4PWNA 4TYGA 3RCDA 4F65A 2H96A 1R1WA 3R73A 5TO8A 4QP3A 3OUNB 3NUXA 3QL8A 3DZQA 2YLEA 4DN5A 3SX9A 1BKXA 4IAFA 4U0IA 5DFPA 3SW4A 4B6LA 4D0WA 3HDMA 5HVKA 1Y8GA 3A2CA 3HRCA 2VTQA 4X2JA 1FQ1B 1H1QA 1M2RA 5CU4A 5HG7A 1KOBA 4FNYA 1IASA 3OUKA 1Q8UA 4O0WA 3I5ZA 4YTIA 4FKUA 4AOIA 1FVTA 5HX8A 4IWOA 2ITQA 2XNNA 4XYFA 4L7FA 1OUKA 3R2YA 2UZVA 3EFWA 4FV6A 5JK3A 3D9VA 4F9CA 3O51A 2XNEA 2Z7RA 5TKDA 4QOXA 5DOSA 3ORXA 1QPJA 3OOMA 2R0IA 4M14A 4YJOA 3ZYAA 4KA3A 1H4LA 4YLJA 4BTFA 5L8KA 2PZIA 4IX5A 3ZFMA 3G9LX 1PJKA 3POOA 5F1ZA 2OKRA 4EYJA 4EORA 4BICA 3BRBA 3QALE 3GQLA 3LFQA 1XO2B 4E7WA 4FG8A 3OTVA 4MKCA 3FZRA 3DT1A 4KKEA 4IAYA 1T45A 4U79A 4DG3E 3CJFA 4E93A 1WCCA 4NM7A 1PXJA 1WBSA 4L53A 4G3GA 4TXCA 2V55A 1Q3DA 3FZ1A 3V5QA 4EYMA 3JVRA 2GFCA 2B7AA 4F63A 3O96A 3GGFA 3PSBA 2VO6A 4C4GA 3UOHA 1OM1A 3A62A 4JXFA 4L3LA 4BCOA 4MD7E 1Q99A 3COMA 4FOCA 4EUTA 2PVRA 5A14A 3GT8A 3BHTA 3PJ8A 3WARA 5HE3A 4AACA 4CNHA 3FSKA 4RX9A 2RFNA 1JKLA 4PX6A 4Y83A 1Y91A 4UEUA 1KV2A 2YDKA 4ZTMA 5KBRA 4F7JA 1EH4A 1YOJA 3WE8A 3ERKA 3Q9XA 2UVZA 1XKKA 4I0RA 3C0GA 3KEXA 4IXPA 1TQMA 2O8YA 3HZTA 3OOGA 4FKTA 3QUDA 4FYNA 4IVBA 3HKOA 4O0YA 1YI3A 4FTRA 2QI8A 4M84A 5E8YA 3UNZA 5K4IA 1K2PA 4WHZA 2BROA 4X3FC 4L8MA 3QHWA 4FSTA 4EOPA 1FINA 3CIKA 4J8MA 2VWWA 4E6DA 3IPHA 2PE1A 5IH4A 4D9UA 4YPDA 4L67A 3P5KA 3C9WA 3MVMA 4IBMA 5HIEA 1P5EA 5HQ0A 3MSSA 3OEFX 3SKCA 4YO4A 3LFBA 5A6NA 5CEQA 1H27A 4N6YA 4XG9A 3UC4A 3RK9A 2F2CB 3UP7A 1W98A 4K0YA 4EHGA 3F82A 4L43A 3P86A 5D11A 3Q4UA 5AAGA 5CEOA 5H3QA 3TUDA 4X0MA 3A8XA 4F08A 4GH2A 4XLVA 4G16A 2OJIA 5HX6A 3GCSA 5LWNA 2REIA 4LMNA 1P2AA 3FPMA 3S00A 3FYJX 2BIYA 3ELJA 1ZMVA 3CPCA 3QGWA 2XM8A 3CTQA 3R6XA 4TYEA 4U9AA 4V05A 3UTOA 2E9PA 3IW5A 4U41A 4F7NA 4G3EA 4O38A 5M55A 2OIQA 5HLNA 3DCVA 3U6IA 4O0UA 4EH5A 4BZOA 4DEEA 2QOKA 3SRVB 4OR5A 3OC1A 5EFQA 2Q0NA 1CSNA 3ORPA 4EL9A 3DB8A 2Y0AA 3FXZA 2QD9A 4UV0A 2IW6A 4NW5A 4EHZA 5HIDA 2QC6A 5HESA 4TRLA 3ZC5A 5AR5A 4U7ZA 2YCRA 2WD1A 3RNIA 3FHIA 3VS2A 2W0JA 3N51A 4F0GA 1WBVA 3MJ2A 4M0YA 4M15A 2RSVA 4I6BA 5FP6A 3VHEA 3FLWA 2VV9A 5ETFA 3QRTA 2YM7A 4M12A 4U97A 3TZ9A 3DBCA 4IJ9A 3NUPA 2VRXA 3ZS5A 2XBAA 5IISA 4RMZA 3WF8A 5LQFA 3E8CA 4K6ZA 4LGGA 4IEBA 4CRSA 4JL9A 2ITOA 3OG7A 3I5NA 4ZLZA 3NCZA 4AFJA 2W4JA 5BUEA 5JQ8A 4PF4A 4FSQA 1CM8A 4Y5HA 4JDKA 2P33A 3A4PA 2HXQA 5A46A 1M2QA 4C35A 3GOPA 4G2FA 2PVKA 4PV0A 5I4NA 4H1JA 4MXXA 1YQJA 4BYIA 5EW9A 3OWLA 4MQ1A 5HNGA 3E88A 4NSTA 3PWYA 3TI1A 3UZTA 3DBEA 1URWA 4NM5A 4ACGA 4PPBA 2C6EA 3LCSA 3W32A 2C6MA 3DTCA 3F5PA 3LCDA 4MXAA 4E20A 3SRVA 3DQWA 3SW7A 5D7VA 5CY3A 2C0OA 4ASEA 2YEXA 4FNWA 4FKQA 3R01A 5IUIA 4WNPA 3DKOA 4YJUA 4DGNA 4MNFA 4PMSA 4YJRA 5BVKA 5JQ5A 5EI2A 4WBBB 5BYZA 1BX6A 1PYEA 4X6RA 1Q41A 3RAKA 4HJOA 4BCPA 3A7FA 5ANEA 3DJ6A 4NFNA 4IC7A 3E7OA 3V6SA 3BCEA 4FIEA 5K9IA 1ZOEA 3QRIA 3PJCA 4FTJA 1AQ1A 3JS2A 5C1QB 5HVJA 4RPVA 2HXLA 4IMYA 2CN8A 2VTLA 4HGTA 5JRQA 4E4MA 1I44A 3TZMA 4TYJA 3UC3A 4PY1A 1QCFA 4W9XA 2ZV2A 4MX9A 3F5GA 2OH0E 5BVDA 2JIUA 3KMWA 5IEYA 4L3PA 3WZKA 1OL6A 1MRVA 3C0IA 2VTNA 3L9LA 3WYYA 2BRMA 3GBZA 3BWFA 4BTJA 3QCXA 3FQSA 4TWPA 2GHMA 3QA0A 4F7SA 4EOLA 5HBHA 3DV3A 4D2RA 3HMIA 3C13A 4HVGA 2R0UA 1OI9A 2BHHA 3SHEA 3ZFXA 4J99A 1CKIA 5IUGA 2I0EA 3G5DA 4O0VA 3KF7A 3U4WA 4HGLA 4YJNA 2WNTA 4WD5A 2JKOA 2FA2A 4JIKA 4FTMA 2YCFA 4FBXA 5D41A 4AE9A 2WU7A 4KBCA 1KE6A 4HCVA 3ZOSA 3AMBA 3D0EA 5DMZA 3GEQA 4RVKA 5EW8A 1GJOA 2P55A 4EZ5A 2QNJA 3Q6UA 2WHBA 2XBJA 4IM0A 2X7FA 4AOTA 2XK4A 4C61A 3NW6A 3O7LD 4I22A 2X6EA 4BCFA 3QLGA 3UDBA 3GU6A 3Q9WA 4P7EA 3IK3A 4FKRA 5AADA 3GCQA 2OBJA 4NKSA 3V8WA 4DBNA 2GNGA 5CEMA 2OFVA 5DR9A 3RK5A 4EH2A 1H25A 5C27A 3W2SA 3KMMA 3VNTA 4FL3A 3MWUA 1WBNA 3UIUA 4MCVA 2OICA 3VF8A 1Y57A 5HGIA 3PP1A 4P4CA 4KRCA 3UVRA 3E64A 4FVQA 5DE2A 2ZVAA 3CTJA 4WKQA 5CI7A 5EH0A 1YHSA 3G6GA 2JDRA 5AV2A 3G51A 3GU7A 1H08A 4IFGA 3RMFA 2NPQA 4ZTQA 3BHVA 3CGFA 3ZH8A 4CFNA 5A54A 4IH8A 3EQDA 5LARA 3E8NA 2XS0A 4JAJA 1JVPP 3DY7A 2ZAZA 5IU2A 2Z7LA 4FTOA 3TTIA 2C6KA 3BQRA 5HIBA 1URCA 5HCXA 5F9EA 2Y4IB 4YNEA 3Q4CA 4F0FA 3Q3BA 4I0TA 4XP3A 4AU8A 4F1TA 3NW5A 3IDBA 4JX7A 3OVVA 3PIZA 4QYEA 3QGYA 3FPQA 3MA6A 3KRWA 3AD4A 2XIZA 4IQ6A 3LCKA 3ALNA 4MK0A 4O2ZA 2XVDA 3UJGA 1JSUA 2Z2WA 2QO7A 4RLKA 4IX4A 3QRUA 2W9ZB 1OITA 3BLQA 2DUVA 2YIXA 1UA2A 4DEDA 5G1XA 4JLCA 4F70A 5J5SA 5K5NA 3EZRA 1E1VA 2B9FA 3F2NA 4G5JA 2QOCA 4IFCA 5KZ0A 5I9YA 4HOKA 4WIHA 5JFWA 3SXSA 4A06A 1PHKA 3DJ7A 3GENA 5FEDA 4D1ZA 4I41A 2VWUA 4CEGA 3ORKA 1W8CA 5A3XA 3H10A 3HLLA 2I0VA 4U6RA 2WB8A 3EOCA 3QQFA 2JFMA 3ROYA 3UNJA 5CEPA 3S1HA 2E9UA 4BN1A 4U80A 3POZA 3DLZA 4XOZA 2CKEA 5ANKA 4FKWA 1XH5A 3C51A 4XP2A 4WNMA 3PLSA 4BI0A 2E9OA 3FAAA 1PMVA 5K4JA 4F09A 4UZHA 1U5RA 5KNJA 1JPAA 2AUHA 4EKLA 2PSQA 3PZEA 4UWYA 5E8SA 3W2PA 1UU3A 3W2QA 2P4IA 2YM3A 2PVYA 3BELA 4EZ3A 3CS9A 3DAKA 3L8SA 3DFCB 3QWJA 3TUCA 2BDFA 1OIUA 4QMPA 3VO3A 3FHRA 1YI4A 3GU5A 3P23A 3CGOA 5EI8A 4KSQA 4LV8A 4AGDA 5AUVA 4XX9A 4DEGA 5J95A 3OP5A 3D2IA 4BZDA 2VWIA 2J0LA 4B0GA 3ZO1A 2VTTA 4ZZOA 3R1QA 2WEIA 4B8LA 3AGMA 1PY5A 2R2PA 4FT3A 2R3OA 4GYIA 3VUGA 4LMUA 1YVJA 3OCSA 2P2IA 3MTFA 4EOJA 3G2FA 4ZP5A 3BHUA 3MPAA 3TZ7A 3LFAA 3UE4A 5E8WA 2R9SA 4Z3VA 5GNKA 4DEBA 2C0TA 4O22A 3EWHA 4ZZMA 4MBIA 3OCTA 2C4GA 3MIYA 4PMMA 1LR4A 1GZ8A 4QPMA 2VGPA 2CPKE 4QMUA 2BRNA 3FMNA 4KBAA 3V8TA 3MFSA 4K1BA 4MWHA 3TKUA 2JGZA 4RVMA 1I09A 3R00A 2XK8A 3F5XA 3DDQA 4CMTA 2YFXA 3CD8A 4S34A 4ZJIA 4RIWB 3HV3A 3Q32A 4RVLA 4FKGA 4H39A 3RWQA 4FICA 3ZBXA 2F49A 2JAMA 2UZUE 3KXXA 5FBNC 4UMTA 4UXQA 2GFSA 4WUNA 5EM6A 2QG5A 3PJ2A 3D5VA 3ZSHA 2OXYA 4ZTHA 5CF4A 4YSMA 4I6HA 1XBCA 4TL0A 2Y4IC 3I0OA 1PXIA 3F6XA 4XRLA 5CTPA 4WBOA 4YTHA 5JFSA 2R3IA 2QU5A 2ZMCA 4JOAA 4BL1A 5BUIA 2HAKA 5AMNA 2XIRA 3Q53A 3ORTA 5DLSA 5C8MA 5CXHA 5IA0A 2PY3A 3HP2A 3PXKA 2OXXA 1WBWA 2X8IA 3G90X 4IX3A 3SV0A 5HTCA 3FMJA 4O2PA 3LOKA 4QQTA 5J9YA 1GNGA 1NA7A 3NNUA 4GFMA 4W4WA 5FDXA 3V51A 4I6FA 2XM9A 4HVIA 5AP3A 2AC3A 3HV7A 1ZYLA 3Q52A 3QBNA 5CEKA 4Z7HA 4GV1A 3DKCA 2WEVA 5LVMA 5EYKA 3VC4A 1S9IA 4D4VA 1OKVA 5H8EA 5LVLA 3FI3A 5L6WL 4EWHA 1QL6A 4YJSA 1Q8WA 4L00A 3FMLA 4U45A 2J9MA 1FMOE 2YAAA 3R7GA 3LHJA 3QFVA 3TNWA 5L3AA 4LRKA 3ET7A 3R8MA 2XCHA 5TR6A 4HCUA 4QQ5A 1JNKA 3PVGA 2VO7A 3I81A 3EQBA 4QRCA 4YJQA 5TE0A 4BCJA 4FIHA 2ZV9A 4ZEGA 4AW2A 3OXTA 4CT2A 2HYYA 3RK7A 2ZM4A 3CC6A 5CASA 2XIYA 4IZAA 2OJ9A 5DBXA 2WMAA 5HICA 3V5WA 2PVNA 4K9YA 4FSUA 3ZRMA 2NRYA 4YGAA 1YRPA 2XKCA 5DPVA 5CF6A 3IS5A 3LFNA 4RJ6A 4FC0A 5M4CA 2F7XE 4YBKA 3TKHA 2R3NA 4I94A 1XH9A 1SYKA 1YKRA 1A06A 2V62A 1KE9A 4HZRA 3TIZA 5IF1A 2WMQA 3DJ5A 2X39A 4NKAA 2YHVA 1OKZA 3HNGA 3HP5A 3U4UA 4ZLYA 4FIIA 3RAWA 4B99A 4XS2A 2YIWA 4RVTA 4F9YA 1OUYA 4Q5HA 5AR2A 5FQDC 3H4JA 2PWLA 3RKBA 4KIKA 1PMUA 1W82A 3AT4A 3QD2B 3VJOA 1HCKA 4USEA 4X2GA 2YJSA 1QPDA 2OIDA 3H0ZA 3LVPA 4TY1A 5GZ9A 4EH6A 2EXEA 4FTAA 4R7IA 1B38A 1G3NA 1PXOA 2RFDA 3T9TA 3GQIA 1PMNA 3C4ZA 3PA5A 1ZXEA 4LI5A 4GMYA 4W8DA 3PA3A 2C3JA 5AUXA 4ONAA 3EN4A 4ZXTA 2O63A 4HCTA 2C3KA 4FZFB 3KCKA 3V6RA 3E3BX 5E8ZA 3HMNA 3EQCA 3BBTB 4QTAA 5AP5A 4LV5A 4KS8A 2QOIA 4BBEA 3CJGA 3CQEA 2WU6A 2PVMA 4ANQA 4FIJA 1Q5KA 5CNOA 3UMWA 1H1SA 4GG5A 2HOGA 4ZJJA 2XNBA 1UNGA 5KCVA 4UWBA 3ZMMA 2QOOA 2XRWA 5L2IA 4M0ZA 3DZOA 4EOSA 4QNAA 2C1BA 3NR9A 5DT0A 4EJNA 2R3QA 4RWJA 3VBVA 4PPAA 2QOBA 1YXSA 2UZOA 2XZSA 2QQ7A 2XMYA 3RHKA 2UZDA 1P4OA 4WNOA 3TV6A 1VJYA 2W7XA 3K3JA 4UMPA 5JZNA 2I1MA 3D14A 4TKSA 1OPKA 3CP9A 4YU2A 2R4BA 5LMKA 5AIRA 4IDVA 3KXMA 2QOLA 5BMMA 4QYHA 4JDHA 5J7BA 3H0YA 3P0MA 3VS4A 1OL7A 3B2WA 2BZKB 1FVVA 2XKDA 4U40A 4APPA 3DAEA 5ACBC 4DH8A 3NNVA 3ZLSA 2P2HA 2DS1A 2WQOA 3THBA 2OH4A 3EQIA 5DEYA 4C3RA 5BMSA 2ZB0A 2J4ZA 4U3YA 4ZIMA 4CZTA 3I4BA 3QYWA 4RX5A 1ERKA 3I1AA 3KRLA 4L68A 4ACMA 3W18A 2BILB 3M2WA 3OWKA 3ZLXA 1LEZA 1KSWA 3ENMA 3VRYA 5IUHA 4C4IA 3Q2MA 4J96A 4OTGA 4ENYA 1MQ4A 1XWSA 1YOLA 2VWVA 4CLJA 4BDGA 4USFA 4OTHA 4TW9A 2PUUA 4KABA 3DBQA 5FD2A 4FG7A 4RQKA 3ZSGA 2C1AA 4EH3A 1PF8A 5B2MA 3IECA 4WA9A 4S30A 2O2UA 3EMGA 3FYKX 5BVFA 4R5SA 2WMUA 3CXWA 5ACKA 4R3CA 2IZUA 5CAOA 4CFFA 5AUTA 2CGXA 3QAME 2R3KA 2VTJA 4ANLA 5KMIA 5J9ZA 1MP8A 3ZXTA 4E26A 1QPCA 3MH2A 4IDTA 2QO2A 5A4LA 3QTRA 3MY0A 4Y8DA 4BDKA 3BGZA 4DAWA 2GNFA 3V04A 5JFXA 2IJMA 4QP8A 4DYMA 2BRHA 3IKAA 5ETIA 5A4QA 4IX6A 4RJ4A 5LMKC 2JKQA 2W05A 3EJ1A 3FLZA 4CFUA 5DIAA 4I92A 3OWJA 1YDTE 2UVXA 4FV3A 5E1SA 5BVOA 5L4QA 3EQGA 3TJDA 4GT4A 3MVLA 4YLKA 3FMKA 1V1KA 2ESMA 4RRVA 4BKJA 4RFYA 1ZYDA 5JT2A 4YNOA 1UKHA 3ANQA 4P2KA 4MVFA 3LAUA 2V22A 3OBGA 5F4NA 3FXXA 3UBDA 5EYCA 2EXMA 4TZRA 4QMZA 3MB6A 4CQEA 2AYPA 4E73A 2A19B 4ERWA 5HO8A 5BVNA 1WVYA 5IZFA 4RC4A 5BVEA 1GZNA 4YLLA 5AR8A 3QF9A 5FRIA 5LMAA 2QOHA 5KMOA 4QD6A 1OZ1A 1VYWA 3F3UA 4OT6A 3MY5A 2C6IA 3OT3A 3BU5A 4Y85A 1GY3A 1PKDA 2XA4A 4YJVA 4AP7A 3GCVA 4FV7A 3KXHA 4ZLOA 3DXNA 1R39A 4XBUA 2VNYA 4PTGA 3RVGA 2FSMX 2CDZA 3FLYA 4I4FA 1YXXA 3HUCA 3EN5A 2Y4PA 1W84A 4PDPA 5AP0A 3HDNA 3P9JA 4J53A 4XG2A 3PZHA 1YXUA 3FC1X 2F7ZE 3N9XA 1GIHA 3OTUA 5HTIA 4NTTA 2ZM3A 1H07A 3C4EA 3NIEA 4R6VA 3QU0A 1AGWA 2IZRA 4OBOA 3P78A 3TJCA 2GPHA 4ANBA 4RIOA 1JKTA 5ANGA 1YXTA 5IA2A 3VIDA 5FTQA 4YBJA 3FL5A 3MYGA 3OS3A 5HZNA 4JVGA 1V0BA 4JQ8A 5M4FA 2XIXA 4FV9A 5AP1A 3F9NA 4B4LA 5JRSA 4DFZE 3RALA 4E1ZA 3VBXA 1H28A 2C3LA 2CCIA 2W9FB 2Z7QA 4FIFA 4KKHA 3COKA 1WVWA 4ITHA 3W33A 3ZU7A 4ZSGA 3SQQA 2WMVA 3R7UA 5T6KA 4TNBA 3RHXA 3Q5IA 5M51A 2VX1A 2WMRA 3PXZA 5KBQA 5L2WA 1HCLA 4N0SA 3NCGA 3KQ7A 5DR6A 3KRXA 2JITA 3KN5A 3A99A 3QXPA 3TN8A 3RPYA 4AN2A 2ZMDA 1OPJA 4OT5A 3VUIA 2W99B 4C0TA 1DI9A 2VTPA 5LOHA 4KD1A 2WQEA 3DU8A 3OHTA 2BTRA 5FWKK 4DTKA 5DT3A 4M69B 4RBLA 3BYSA 3LXLA 3MIAA 1REKA 3OCBA 4JR3A 1BL6A 2RKUA 5TOZA 1JQHA 3W2RA 1H1PA 4UZDA 2BALA 4O91A 3W1FA 2FVDA 5I9XA 3TKIA 3NYOA 2A2AA 5EHLA 4F9WA 4O1OA 5DRBA 4GCJA 3UNKA 1R78A 4GW8A 5IA1A 4TN6A 3PRFA 4FSNA 3LCTA 2BRGA 4PQNA 3O23A 4GK3A 2YIYA 3S95A 4FKVA 5EYMA 5DR2A 4QO9A 4EQUA 3HL7A 4DH3A 1OL2A 3RTPA 3UIMA 4DINA 2Y7JA 3JY0A 4IVDA 3AG9A 3VS6A 5CI6A 3JVSA 3MFRA 3PXFA 4ITIA 1TQIA 4Q5EA 2R7BA 3MB7A 2V7AA 4WUAA 1H00A 1OL1A 3NSZA 4YHFA 3HGKA 4BKZA 1SNXA 1JSVA 3VUTA 1WBPA 4YHTA 2X2KA 5LJJA 4QTBA 5HKMA 3ZZEA 2YIQA 3FKOA 3DKGA 4WRSA 5GZ8A 2PZPA 1ZOHA 2OF2A 2YIRA 3HVCA 3VUHA 4DFLA 5FXRA 1UVRA 4DG2E 3OBJA 2YERA 3OXZA 4M69A 3E87A 3U9CA 1XBAA 2WO6A 5B2LA 1OKWA 2C5YA 4BIEA 4OTDA 3LQ5A 4RWLA 4WG5A 4E6QA 3QQGA 2FB8A 3OWPA 4KIOA 4QPAA 5AM6A 1WAKA 3JXWA 3LLTA 1H26A 2ZV8A 4KWPA 4A4XA 2F9GA 2YABA 4FSMA 1YHVA 3F2AA 4QMMA 4L46A 1WMKA 2VTSA 4BDFA 4IHPA 4MH7A 4DH1A 5AV3A 4C8BA 2V0DA 3E8DA 4EH9A 5KHWA 2FO0A 3WF9A 4GL9A 2PMIA 2RG5A 1WFCA 4ANMA 4EOMA 3DK7A 3NAYA 4ZY5A 2WIPA 5E8TA 5DT4A 2WFYA 5HO7A 1G5SA 2W1CA 4U5JA 4D9TA 2W5BA 4UN0C 4YTFA 2R3RA 1O6YA 3QQKA 3I6UA 3DPKA 4FTCA 4K2RA 2FUMA 2KULA 4I1ZA 4L6QA 4GJ2A 4PRJA 4ZTNA 5C01A 4B8MA 4XP0A 4J71A 4CVAA 2OWBA 2VO3A 1LP4A 2XF0A 4TWOA 5C8KA 3R7VA 4HYSA 2PE2A 3WF7A 4Z16A 2PZYA 4ZY6A 5JGBA 2B53A 3NUUA 1BL7A 4U43A 5I9UA 1RW8A 2BR1A 4YJPA 2WTIA 1YWRA 5DRDA 4C37A 1GIJA 4ASXA 4GVAA 2J0KA 4FKPA 1MRUA 3WZJA 4EK4A 4AGWA 4K8AA 3Q04A 2BAKA 4NFMA 4AZSA 2UZEA 1WZYA 3M11A 3MBLA 2QLUA 1H24A 3OEZA 4F1OA 2J0MB 3CY3A 3QRKA 3IOKA 1R0PA 5DA3A 5IDPA 3E93A 3BPRA 3PXQA 2JDSA 2X8DA 3BEAA 1P14A 3KKVA 4LGDA 2QKWB 4QP9A 5EW3A 1QPEA 4AG8A 4CCBA 4FOBA
chains in the Genus database with same CATH superfamily
3RWPA 5JH6A 2W4KA 3CQWA 4FV5A 5E92A 5CENA 3HV5A 3ZUUA 2EU9A 2PVLA 4Y73A 3C50A 2XYUA 1XQZA 2R3PA 3A61A 2W4OA 3BYUA 4BCIA 5E8UA 4QMLA 2JDOA 2LGCA 4JNWA 3ULZA 3MPTA 4TNDA 2BVAA 1FGKA 3UP2A 4AF3A 3UO5A 4BTKA 3NEWA 2XH5A 1ZYJA 3R21A 4RX8A 2WMSA 5F95A 2JEDA 4YUQA 4AW5A 2XJ2A 4NH1A 3SOAA 4KSPA 3VBTA 1SVHA 2CCHA 5J79A 3RAHA 4G3FA 4W9WA 4EH8A 3O7LB 3L9NA 3Q96A 4J1RA 3UQCA 2OSCA 5B7VA 2Z8CA 3OFMA 4X2NA 3O50A 3M42A 5L8LA 4GSBA 1J1BA 4QP7A 5CANA 5EI6A 3GOKA 2Y6OA 3FKNA 3P08A 5CT7A 4BHZA 4MAOA 2W1GA 1LEWA 1M17A 4FK6A 3EH9A 1W0XC 2P3GX 3BKBA 3DOGA 3VHKA 4JBVA 3BQCA 5KX8A 1O6KA 3RZFA 5LVPA 4HGSA 2YA9A 5HE1A 2PMLX 4C58A 4IVAA 5LCKA 1KE8A 5IEXA 4RC3A 1SZMA 2R3GA 3HEGA 4UMUA 5IA4A 5B0XA 2BHEA 3SVVA 4M7IA 3TNIA 3ZUTA 5ANOA 2FSLX 5A4TA 3K54A 4FGBA 4K33A 4G3DA 2R3MA 3FLQA 5BNJA 1M7QA 1WBOA 4GEOA 4BDAA 1M7NA 4M67A 2H9VA 1H01A 2QO9A 2RL5A 4LUEA 5K3YA 3AOXA 4A9YA 3ZM4A 2WTJA 3PG1A 3IW4A 4X21A 3EKNA 3OZ6A 3ZO4A 4EK6A 2AC5A 2QLQA 2WGJA 4FNZA 3G6HA 3WZDA 5L6OA 2X2LA 4X2KA 3AT2A 3S4QA 4NJ3A 2PZRA 4BGGA 2QR8A 3GVUA 3LPBA 4NUSA 3QZHA 3VBYA 3VQUA 4S31A 4AN3A 2WPAA 3ANRA 4WG4A 2C5VA 4RIYA 4CYJA 5CAVA 3PRIA 4P5QA 3LCOA 2FYSA 4G3CA 4P5ZA 4XG8A 3BGPA 2C3IB 3EQHA 4Y46A 2VUWA 1U54B 2JC6A 2NO3A 3LJ2A 1XH6A 3MH3A 3NLBA 4L7SA 4XRJA 4YJTA 4DGLC 1Y6BA 5IH6A 3IO7A 3P7CA 3UGCA 5EKNA 2XNGA 2WMTA 3NZ0A 3BYMA 4FVPA 4MD8E 5GJFA 3I7BA 4D1SA 4XUFA 4GJ3A 2YM4A 5ITAA 3C0HA 3UIBA 4TWCA 3NGAA 4B9DA 3QKLA 1ZARA 2CGVA 4WRGA 5AV0A 3QTXA 2H6DA 2HZNA 2IEWA 4DITA 4BFMA 2F4JA 1U59A 1UNLA 1ZLTA 5EOLA 4BWPA 3IDPA 3PE2A 3FJQE 1H1WA 4DGOA 3DBFA 3F3ZA 3TNQB 4XV1A 1KE7A 3DQXA 3KN6A 4II5A 4L9IA 5AP7A 4AA0A 1LUFA 3H9OA 3GXLA 3D94A 3PJ1A 4TYHB 2HELA 3R1NA 5T68A 3WIKA 4QYFA 3R0TA 4XMOA 2ITTA 5J9LA 3ZTXA 3R9DA 3ZBFA 4EH7A 2WTCA 2P0CA 2QVSE 3PP0A 5TT7A 4D5KA 3ORLA 3BWJA 5CVHA 1NVSA 5F94A 1WVXA 3FDNA 3ZSIA 2XCKA 3HMMA 4CD0A 4PL4A 5CF5A 3BGQA 4FTKA 4BHNA 2YM6A 2C0IA 2W5HA 5KMLA 3KCFA 2X0PA 4PP7A 5HCYA 2WOTA 5IDNA 1U54A 2X7OA 2X8EA 1Z9XA 4FRFA 3KVXA 3LIJA 3EIDA 3W8QA 4G31A 4NK9A 4V0GB 5CQUA 3FXWA 2QOQA 3QCYA 3EHAA 1M14A 3KA0A 4FV2A 4F64A 4DGGA 3NYNA 3FY0A 2IN6A 2XK6A 3QTWA 4RSSA 4EK8A 2J0IA 4XG4A 1STCE 3A4OX 3D4QA 2BAJA 3RM6A 2YN8A 4MYGA 2PMOX 2ZJWA 3UIXA 2J90A 3W16A 1SVEA 2VX3A 3LJ0A 4ZTLA 5D7AA 3KB7A 4GT3A 4W4XA 5H8GA 2ONLA 5J1WA 1H0VA 3ORNA 4AA5A 4ASDA 3P7BA 3TL8A 2QR7A 1W2FA 2IVVA 3AC8A 1S9JA 2J6MA 4RA4A 3EFLA 4TYHA 4C3PA 4X2FA 4E4LA 4IB5A 1KOAA 2HK5A 4F9BA 3KRJA 5K0KA 1MRYA 1OIQA 5J7HA 4F99A 3AMYA 5E1EA 2JFLA 3BZ3A 3D83A 1NVQA 4RLLA 3VS1A 4BBFA 2YJRA 3TIYA 2R64A 1U46A 2F57A 2EVAA 2J5FA 3IGOA 3QQJA 2VTIA 5AA8A 3R8ZA 1RDQE 3R30A 4FG9A 2R3FA 4CTBA 3A7JA 5AR3A 2QONA 3KC3A 4N6ZA 5D9HA 5LMBA 1Q24A 4GFGA 4PTCA 3R63A 4EKKA 3KL8A 4DEHA 4V0GA 3WOWA 4MF1A 5CU2A 2JIIA 3DA6A 3KULB 4ASZA 3IOPA 3B8QA 1J3HA 2X0GA 3W8LA 4BCKA 1MUOA 4AW0A 4D2WA 3ZEPA 4RX7A 3D7TB 5I3OA 4EBVA 4PL5A 5FM2A 2BCJA 5AUUA 3HYHA 5L6PA 3EL7A 3QTIA 3PIXA 3ETAA 1BI8A 2YCSA 3LJ1A 5IA5A 3VBQA 4C4FA 3HV6A 1UU8A 2GNLA 4KIKB 3ZC6A 2XJ0A 3UVPA 2BRBA 3LXNA 5H2UA 5JFVA 1PKGA 3AXWA 5KZIA 2J5EA 3MVHA 4AWIA 4KIQA 3FZOA 3VS3A 4GUEA 5I9WA 2B4SB 3IGGA 4MD9E 3T8OA 2WKMA 4AE6A 2CMWA 3U6JA 5AX9A 2Z60A 3ORZA 4NEUA 5HNIX 2HWOA 3NNWA 1IEPA 1Z5MA 4V04A 5HNBA 1ZY4A 2VO0A 2UW6A 4H3PA 2ONLC 4W4VA 3TZ8A 5D12A 4JDIA 4WNKA 4OAUC 2VTMA 4S33A 5AR7A 4EWQA 4FL1A 3V3VA 4EHEA 3EFKA 4P90A 5AJQA 4RWIA 3WIGA 3R9NA 1SNUA 4QMNA 5I9VA 4ALVA 4E8AA 2OFUA 3JPVA 4RZVA 2A0CX 3ZLWA 3AC4A 3MJ1A 5CVGA 3GFEA 4C2VA 3BYOA 3PSCA 4I6QA 4WSYA 5CEIA 3KULA 3BE9A 3EQPA 4IZ5A 4O21A 3I79A 2HWPA 5M4UA 3U51A 3TG1A 4IIRA 2B9IA 1CDKA 2VAGA 3D7TA 3HV4A 4I93A 3T3VA 4CFMA 4L44A 5BUJA 2VTHA 2HCKA 3VBWA 4FL2A 4WT6A 3A7HA 4EQMA 4TTHB 3KK8A 3L9MA 3MI9A 3PY0A 2B54A 3ORMA 1YWNA 2OJJA 3DK6A 4IWQA 4QNYA 3ZXZA 2OJFE 3QXOA 2ITWA 4ZTSA 2W1EA 2H34A 3LFFA 4A9RA 3NWWA 4FNXA 4Z9LA 4YZDA 4AGUA 4E5BA 4GK2A 4H58A 5FXSA 2VWXA 4O0SA 1TQPA 5L2TA 4UWCA 3MN3A 5JEBA 3CY2A 3DS6A 2OZOA 3MS9A 3AT3A 3KXZA 3PPKA 4NU1A 4PTEA 4Q9SA 4BDIA 4ZY4A 4O0TA 5JZJA 5KKRC 3VULA 5BVWA 2OI4X 1SVGA 2R3LA 4MWIA 1J1CA 4AQCA 3EN9A 3MA3A 2IW8A 4R3RA 2ITNA 1Q3WA 2RGPA 4O6EA 3GC0A 3TNPC 1K9AA 2HY0A 4PNKA 3DTWA 1Q97A 2YDJA 5CS6A 2JIVA 2XK9A 4UX9A 2PTKA 1XHAA 5KMJA 3F3TA 4DEAA 4JT3A 3R22A 3UMXA 4G6NA 4EOQA 3R9HA 2GU8A 4RJ7A 5CVFA 2CLXA 4HPTE 4LRJA 5AUWA 3BU6A 3ZZWA 3ZUVA 2YISA 2I0HA 4I0SA 1OIRA 2C47A 2G1TA 3P79A 4YC3A 3E7VA 2HIWA 5HI2A 4CMOA 3QQLA 4FZDB 1CMKE 3QQHA 1ZWSA 1OKYA 3I7CA 3EL8A 1TVOA 4BI2A 2CSNA 3A60A 1KV1A 3KF4A 1LPUA 5FDPA 4PDOA 3LW0A 4QTEA 4U42A 3NAXA 4UBAA 3OY1A 3VVHA 3FC2A 4PPCA 4IAZA 2BUJA 3BI6A 4IB1A 1X8BA 2ZYBA 3QD3A 1CKPA 3MDYA 4W8EA 5T3QA 2PHKA 3MH1A 3Q9ZA 4GU6A 4HW7A 5ETCA 2BTSA 4GFOA 4IWPA 2C6DA 3KGAA 4KIPA 4QQCA 5M53A 3LXKA 4ZSAA 2B55A 4JBPA 3IONA 4YP8A 4C33A 2BZHB 4XJ0A 5HOAA 3SXFA 5AAEA 2CLQA 4M66A 4AAAA 4RT7A 4JIAA 4CMUA 4CXAA 5HEZA 2UZWE 4BYJA 3R28A 4FTTA 3RPRA 3AC5A 4K11A 3FMDA 2PE0A 4BZNA 3UO4A 3TCPA 4I24A 4QMOA 5DWRA 4R8QA 5EG3A 4AS0A 2ACXA 3WYXA 3W10A 4BCGA 2ZV7A 3QC4A 4Z55A 1H1RA 1ZAOA 2GTNA 4FTIA 3FZSA 3R71A 5FG8A 4TT7A 2DWBA 2IW9A 3VN9A 3MH0A 1O9UA 3R8UA 3EZVA 3NIZA 4FIGA 4A9UA 4CZYB 4BIBA 2GNHA 3CQUA 4I5MA 3R04A 3GUBA 4I23A 3WE4A 4FUXA 4IW0A 1YDSE 5M44A 3QWKA 4GS6A 4MXCA 2CHLA 2UVYA 4C59A 4QMWA 5E91A 5CSPA 3PPZA 4K77A 2GS2A 4PNIA 1DS5A 4DH5A 5G6VA 3FMEA 4A7CA 1J91A 2YM5A 4V01A 3RPOA 2JBOA 4BI1A 3GNIB 3QLFA 4FMQA 2OU7A 3QKKA 2JD5A 2UV2A 4AA4A 4YTCA 1F0QA 4G34A 5J5TA 5LCJA 1JBPE 3UQGA 3R7YA 3PVUA 5CAQA 4JBOA 4FR4A 5JSMA 2XYNA 3M1SA 5CAPA 3DFAA 1OPLA 2UZNA 3PTGA 2DQ7X 4XHKB 5M4IA 4L01A 2XK3A 4OBPA 4RA5A 3WZUA 4CRLA 5IMEA 5J1VA 3ODYX 5HTBA 4DLIA 2G15A 3REPA 3NUSA 4CLIA 2ITUA 4EC9A 4L52A 1PXLA 2FSTX 4J7BA 2PVJA 5DI1A 1XR1A 3TT0A 4ITJA 4DFXE 2X1NA 5CF8A 4EQCA 2A1AB 5AP2A 1ZZLA 1F5QA 3H9RA 3A7IA 2PVHA 3BU3A 4QMTA 5EDPA 4BCNA 4FUYA 4XV9A 5A4CA 4HGEA 5E90A 2BDWA 3Q60A 2UZTA 2J51A 4FK3A 4U44A 4C38A 3Q9YA 5D10A 3D5XA 3QQUA 2QKRA 4TPTA 1FVRA 1YW2A 4AN9A 4MBJA 3BEGA 4O1PA 3Q6WA 4HYIA 2YCQA 1CTPE 4BRXA 4EC8A 3K5VA 4X3FA 4XV3A 5EOBA 3UZPA 3QTSA 4G5PA 3OT8A 2UW8A 3ACKA 3SD0A 5EM7A 5L2QA 2Y8OA 2IVSA 3E62A 4BTMA 1YHWA 4IZYA 3GFWA 5EYDA 5AWMA 4E5AX 3MPMA 4FV4A 4LYNA 1JAMA 3NW7A 1IG1A 1U5QA 4M3QA 2OO8X 2V7OA 3QZFA 4JRNA 4AZTA 5FTOA 4QYGA 3Q4TA 4FI1A 5IKWA 4KINA 3K3IA 2JAVA 4G6OA 2OGVA 4MBLA 5HHWA 2E2BA 2GNJA 5IH5A 3QZGA 3F5UA 3O0GA 5DN3A 4HPUE 3GC8A 1ZY5A 3QD4A 5J8IA 4CYIA 4OBQA 3R8PA 2RIOA 2C5OA 3C4XA 3H9FA 4YZ9A 3KXNA 4MHAA 5CU6A 4GIIA 3R02A 2UW3A 3SA0A 3R1YA 3GP0A 3LFCA 1PXNA 4ARKA 3WF5A 4AT3A 1IR3A 3OROA 4I5PA 2XNPA 3DAJA 2Z7SA 1PXPA 4U81A 5CSWA 2X4FA 5AIKA 5HE0A 3TTJA 1UNHA 4LL0A 4PDSA 2GDOA 3QX4A 1IRKA 3ACJA 2G01A 4D4RA 1PXKA 3CPBA 4QPSA 2ZDTA 1FOTA 2I6LA 3VAPA 4RGJA 4Y95A 4ZS0A 3TACA 2B52A 3S3IA 4AFEA 4YZBA 4YMJA 3FZTA 4NIFB 1UKIA 4ZJVA 5AEPA 3OW4A 4FSYA 4NWMA 3WF6A 3CCNA 3AMAA 4GYGA 3FY2A 2WOUA 4BDDA 3D7ZA 4XG3A 2I40A 4DLJA 3CTHA 4F6UA 3DDPA 3OY3A 3F3WA 4BCQA 5J87A 4TYIA 4C4JA 1JWHA 2WXVA 3HUBA 5EHYA 3FE3A 4LG4A 4DC2A 3LFSA 2B9JA 1L3RE 4S2ZA 1Q61A 1PW2A 3QTQA 4FV8A 2G2IA 2UW5A 2ITYA 1PMEA 2GHLA 2QCSA 2UUEA 4FKIA 4BGHA 5I3RA 2WIHA 3FMHA 5I5ZA 3GCUA 3BLHA 5ANJA 4E6AA 2YZAA 4AUAA 5GJDA 4HYHA 4MEDA 3JUHA 4YC8A 4XG7A 2W1DA 1FMKA 3RINA 4EK5A 4CFWA 2UW0A 3G0FA 4QYYA 4M97A 4RWKA 1Y8YA 4L3JA 1GZOA 1KWPA 2ITZA 4G6LA 3PSDA 1BYGA 3QZIA 4R7HA 3ITZA 3FQHA 5DNRA 4HVSA 4F9AA 4IACA 2W1HA 4BDJA 4ZZNA 4AOJA 3C1XA 5JGDA 4AZFA 5CSXA 4DFYA 2A4LA 3HECA 4QTDA 3BHHA 3WBLA 4XH6A 5AP4A 3AD6A 3OF0A 4IM3A 2VN9A 4GT5A 2GSFA 1NVRA 3GC7A 4O4BB 2XNMA 3VW8A 4NIFA 2IF8A 5ETAA 2O0UA 4A4LA 3DB6A 5KUPA 4YR8A 5KHXA 2FH9A 3E5AA 4I3ZA 4UALA 4AW1A 4OW8A 5CLPA 2VWZA 3QYZA 4YSJA 5FEEA 1F3MC 1ZZ2A 3FSFA 3UODA 3FLNC 3MFUA 2W1IA 1YXVA 3FUPA 1OVEA 1W7HA 3FBVA 5IMXA 4YURA 3LMGA 4BDBA 5CU0A 4QP6A 4NW6A 3SOCA 3NRMA 3QKMA 3SXRA 4MXYA 3O71A 4I5CA 5JKGA 1R0EA 4AXAA 3AD5A 3VQHA 4BWXA 4L42A 5I0BA 4D4SA 5KE0A 4ANNA 4RZWA 5CWZA 2WQNA 4IADA 3TNHA 4RFZA 4D2TA 3PPJA 2PL0A 4ALUA 4CTCA 4DH7A 4JAIA 5K5XA 3BBWA 4MXOA 4ALWA 2BKZA 4UB7A 3RBWA 4EEVA 5IG1A 2YM8A 3F3VA 3B2TA 4FVRA 4KBKA 3VF9A 4CKRA 2C6TA 4USDA 2NP8A 4LUDA 4LGHA 1YOMA 3GI3A 4C57A 3FI4A 3IQ7A 5EKOA 3A7GA 3HMOA 4M13A 2EB2A 2W96B 2WELA 4KNBA 4QMVA 5DVRA 4ACCA 4D58A 5BQ0A 2OK1A 4AZWA 1DAWA 4IAIA 3VUDA 4DEIA 2PK9A 1OL5A 3HRBA 1M52A 4MTAA 3NS9A 4LOQA 5C9CA 4HVDA 3FKLA 1RE8A 4A9TA 4F6SA 4IAKA 3TV7A 2BZJA 2EUFB 2X0QA 1CKJA 3EN6A 4BCHA 4UMQA 4M68A 3FV8A 2C5XA 4FZAB 1Q8TA 3MFTA 3U9NA 5B2KA 4G9RA 4FV1A 3NUYA 1Q8YA 2XRUA 4X7QA 1B6CB 1Q4LA 1RQQA 4X6QC 2GNIA 4NCTA 4ZSJA 5M56A 5JGAA 4F7LA 4KAOA 4ZK5A 3MW1A 5EM5A 3P4KA 4A9SA 2UZLA 4RQVA 4C02A 4IWDA 3T9IA 4F0IA 4UXLA 2Y9QA 3QUPA 2ETKA 3O2MA 1U4DA 4EONA 3II5A 1DI8A 1ZOGA 5LXMA 1HOWA 4H3BA 3QC9A 2ZB1A 2IZSA 2E9VA 3LFDA 4FEQA 5CNNA 5C03A 5EK7A 4H3QA 4IB3A 1QMZA 3FI2A 2C68A 2VTAA 2ETRA 4JG6A 3QCQA 4BBMA 3W2CA 3EYHA 3V5PA 5DG5A 3MTLA 4LFIA 3F66A 3RM7A 5BX0A 4BDCA 2G2FA 5HU9A 2KTYA 3BIZA 4D2SA 2O5KA 4YZNA 2GTMA 4D28A 1XH4A 2VZ6A 4RIYB 3OD6X 4XCUA 3K5UA 3EFJA 1JSTA 4YC6A 4Z7GA 2GS7A 2E9NA 2GCDA 2VWYA 2VU3A 3U87A 4CSVA 5CQWA 3LZBA 3ALOA 2WTDA 1JOWB 2OJGA 3DBDA 2WZJA 1ATPE 5L2SA 3UOKA 3U8WA 4O4EA 3R1SA 5E7RA 5CZIA 4FTLA 5GHVA 4BIDA 4U3ZA 1VR2A 5HCZA 4ZSEA 2F7EE 2VGOA 1XH8A 3PG3A 4YZMA 2JKKA 2QU6A 2ETMA 2EXCX 2X4ZA 3F7ZA 3R9OA 5C26A 5HG8A 3BE2A 1OMWA 4O27B 5C8NA 2WMBA 5HD7A 2YITA 3ZHPC 3I6WA 4J52A 3C4CA 4NZWB 2WTKB 1GZKA 2ZDUA 5HVYA 2W17A 4NCTC 5HE2A 3ZO2A 4BDHA 1W2CA 4LOPA 4EZ7A 2XB7A 3KXGA 4D0XA 3MGYA 2O3PA 3F61A 4D4YA 2PMNX 4EK3A 1FPUA 2BFYA 4ANSA 2HZ4A 3QUEA 4RC2A 4BB4A 3V5JA 3UOJA 3FLSA 3LM0A 4WOVA 2VTOA 3QTUA 2O65A 3G9NA 3L8XA 4IAAA 5DHJA 4YHJA 2OXDA 5FEQA 5GJGA 4CZUA 3V8SA 5JN2A 4EI4A 3CKWA 1V0OA 3CEKA 3S0OA 2V5QA 5KMNA 4XEYA 5HBJA 4JQ7A 2BFXA 1APME 3SC1A 4C3FA 2RG6A 5AUYA 3QD0A 3MY1A 4YPSA 4HNIA 4DFNA 3L1SA 4JQEA 4XV2A 2F2UA 3IDCA 4UYNA 2XUUA 1ZMWA 5HU3A 3CE3A 4GUBA 4I5HA 2EWAA 1RJBA 2R3JA 3R7OA 4ACDA 4ACHA 3DLSA 2C6LA 4R1YA 1E1XA 4IJPA 3TEIA 1BLXA 3OW3A 2C5NA 4G9CA 3C5UA 1O6LA 5K0XA 2WMXA 4GG7A 4IM2A 2JDTA 4CCUA 2HW7A 3UQFA 2GHGA 2SRCA 2UW7A 3KRRA 3UOLA 5AUZA 4C4EA 1BI7A 3P1AA 3KU2A 4O6LA 2W1ZA 4MNEB 4TWNA 5JMSA 1UWJA 4FV0A 4F4PA 4FT5A 2UZBA 1OIYA 4O96A 4FTUA 2HW6A 1ZYSA 3R83A 4WO5A 2X7GA 3E63A 3NUNA 4AX8A 3PUPA 4PUZA 4FSWA 3ZONA 3COIA 4KRDA 3ZDIA 3ZRLA 4NJDA 5FP5A 3U6HA 3FMMA 3QA8A 4CV9A 5EDRA 4CT1A 4EOKA 4BDEA 1SM2A 2BAQA 3PIYA 3AC2A 2OG8A 5CX9A 4AGCA 3H3CA 1REJA 3WI6A 2YLFA 5HO6A 4J95A 4B7TA 2QHMA 2YDIA 3F69A 5TF9A 2IWIA 3SDJA 5M57A 4C36A 3O8UA 3RCJA 1DM2A 2ERZE 2QOFA 4Y5QA 3VW6A 4KKGA 3D5UA 2J0JA 5CSHA 4LL5A 3Q5ZA 3JY9A 3DNEA 3BHYA 3PY3A 3EN7A 5L8JA 3VJNA 4EH4A 5E8XA 3GC9A 2DYLA 4I21A 3L8VA 3EQRA 5KMKA 3NYVA 4ZOGA 3PVBA 4FTNA 4I20A 3UYTA 2BMCA 4G1WA 1BUHA 2R5TA 2G9XA 4DHFA 4LOOA 1OGUA 4MNEA 4BVUA 1PYXA 5AR4A 5KKRB 3PA4A 3KMUA 5ANIA 4XLIA 3ZCLA 4FT0A 1XBBA 4K18A 2C69A 4OTFA 3G0EA 4PP9A 4R1VA 5CT0A 4D1XA 4HVHA 2WTKC 3KFAA 5EDQA 3F7WA 4BCMA 4HNFA 3VS7A 2VD5A 2C6OA 3PYYA 3PJ3A 3O8TA 2VTRA 4FT7A 4ZSLA 2B1PA 3AC1A 4OTIA 1B39A 1IA8A 3FQEA 3VUKA 2J2IB 4FSZA 2JDVA 1WBTA 3PY1A 3UYSA 4E3CA 4G17A 5AV1A 1GOLA 1GAGA 1YWVA 1OB3A 2XKFA 4BF2A 2XNOA 4QMXA 4S32A 3BLRA 5FM3A 2J7TA 3C4WA 2XEZA 4IANA 5BPYA 4NTSA 4PMPA 3AQVA 3CR0A 2YAKA 2ITVA 3MVJA 4FTQA 2W1FA 4GIHA 3RAIA 4QMSA 3W2OA 4BGQA 4E4NA 3RZBA 4ANOA 3V01A 3ODZX 1H8FA 2HENA 4R5YA 3HA8A 3R7EA 2C30A 2OW3A 1UU7A 4U8ZA 2VX0A 3RNYA 2X9EA 3OCGA 5FXQA 2VWBA 4FKLA 2RFEA 5EM8A 4JR7A 5KO1A 4DG0E 5HD4A 4O0XA 5AM7A 4QMYA 2ITXA 4ENXA 2FSOX 3UPXA 2X6DA 4J98A 5D1JA 3RP9A 2W06A 1MQBA 3RPVA 4DGMA 3E92A 4JG8A 3HRFA 4OTRA 3EB0A 3O17A 4DCEA 5A4EA 1UU9A 1VYZA 2X9FA 2UW4A 2RFSA 3R8VA 3BYVA 4IE9A 4OUCA 4FZ6A 4N4SA 4ERKA 3G33A 4NT4A 1KE5A 3A8WA 3K2LA 2EB3A 2X2MA 5HLPA 2LAVA 2BIKB 4MQ2A 4FZ7A 3ROCA 1Q8ZA 3EQFA 4O0RA 5I9ZA 3ZDUA 3SAYA 4C7TA 4ID7A 3DNDA 3HMPA 1K3AA 4EOOA 5HG9A 4XBRA 4EHVA 4JG7A 4Q2AA 4NM0A 3R8LA 4MXZA 4FT9A 3ZEWA 1NY3A 4J8NA 2I0YA 3UPZA 4JI9A 1ZRZA 2WTWA 1Y6AA 5CAUA 2WTVA 2XP2A 4ZTRA 3R7IA 3ZRKA 3QTZA 3PXRA 1A9UA 3DK3A 3JYAA 3RGFA 3LFEA 5GZAA 5LVOA 3TUBA 2HZIA 5AAFA 4CQGA 4I4EA 2JLDA 2WQBA 3Q4ZA 3EKKA 3IG7A 5DEWA 4LM5A 2IVTA 2AQXA 3AGLA 3T3UA 3DGKA 3ZO3A 4FX3A 3BV3A 2R7IA 4LQMA 5IA3A 1ZYCA 4RIWA 3GB2A 4QP1A 4A07A 2NRUA 4FSRA 3CD3A 3PWDA 5DH3A 1XJDA 4YO6A 5AX3A 4C34A 2R3HA 4QMQA 5KMMA 5A9UA 3LE6A 4H36A 4XNEA 4AT5A 3NPCA 3P7AA 3W55A 2XK7A 2BDJA 2B9HA 5FLFA 2QURA 3PFQA 4JBQA 1P4FA 2IVUA 4OTWA 4D2VA 4JRVA 4JX3A 4CKJA 4MF0A 4OAVB 2BZIB 3ENHA 3F88A 3I0QA 4RJ8A 5IPJA 4FKOA 1H0WA 2OZAB 3GU8A 4FKJA 3UG1A 3V5TA 3VUMA 4C62A 2FGIA 3OXIA 4OTPA 4JDJA 2CGWA 2XIKA 4E4XA 4W4YA 5CSVA 4M8TA 3BV2A 2HZ0A 4JJRA 4IVCA 5FBOA 3NYXA 4BWKA 4KS7A 4CKIA 4GRBA 2H8HA 4R3PA 5H9BA 3NDMA 3CLYA 4ZAUA 4UY9A 3HA6A 3L8PA 4FKSA 5ANDA 4AZEA 3PXYA 4D5HA 2W5AA 2XEYA 2X81A 2YWPA 5AA9A 2GQGA 3D2KA 3V5LA 5F20A 1ZMUA 3QX2A 1R3CA 3KVWA 4BC6A 3E3PA 2OIBA 4J97A 1Q62A 4A4OA 4OTQA 5CU3A 2A27A 4C4HA 4D55A 1AD5A 5CALA 3QRJA 5DGZA 2XJ1A 2JKMA 1W83A 4E6CA 1OECA 3HX4A 2HY81 2BPMA 2YACA 3H30A 3PE1A 4BKYA 4UMRA 1FGIA 4EBWA 5LVNA 4XOYA 1PXMA 3D5WA 2O64A 5AV4A 4F1MA 2G2HA 3E8EA 1BMKA 4RJ5A 4GK4A 4FA2A 2CGUA 2IO6A 5HORA 1GIIA 3ORIA 3UO6A 3LXPA 5HG5A 1E9HA 4GU9A 4Y72A 3VS0A 3LM5A 2OZAA 1JKSA 4PL3A 2Q0BA 2GS6A 3R2BA 4RFMA 2ZOQA 1V0PA 4XG6A 4AT4A 4JS8A 1JLUE 5BYYA 4LRMA 4WG3A 4RIXB 5HBEA 3LQ8A 1SMHA 3ZLYA 5IEVA 4EOIA 4F6WA 3DKFA 3NX8A 3RJCA 4OLIA 3WZEA 2PVFA 4QT1A 1UV5A 5ICPA 4RG0A 3QHRA 5CYIA 4L45A 4QQJA 4YZCA 4Q9ZA 2UW9A 3GU4A 4E5WA 1VZOA 3UVQA 3ULIA 3IW8A 4HZSA 2WAJA 2WQMA 5FGKA 1TKIA 4WSQA 1T46A 3B8RA 4QP4A 5HLWA 4HYUA 2IZTA 2PZ5A 2J50A 1JKKA 3GCPA 3CBLA 5H8BA 3TXOA 4CFVA 2QODA 3L9PA 3FZPA 3C7QA 2CJMA 5CZHA 4PMTA 5CXZA 1YI6A 2OF4A 3RI1A 3COHA 3RPSA 3OMVA 3S2PA 3C4FA 4CFXA 3EYGA 1YDRE 1DAYA 3SLSA 2ITPA 2JBPA 4N70A 3NNXA 4IB0A 4EUUA 4FODA 3CKXA 1UWHA 4NM3A 4C2WA 4FYOA 4X3FB 4RJ3A 2RF9A 1Z57A 2WMWA 3FWQA 2ERKA 4OGRA 2QHNA 2VNWA 3PVWA 4UYAA 5AP6A 4AZVA 4FF8A 4X3JA 4QP2A 4IC8A 3D15A 3FL4A 3KK9A 3MV5A 4IZ7A 3VS5A 3AC3A 4APCA 2CN5A 3UG2A 1M2PA 1XH7A 3O8PA 4QTCA 3IW7A 4H1MA 4CV8A 5EHOA 5LWMA 1VEBA 3QCSA 4RIXA 2XKEA 5A6OA 3WILA 4KB8A 3VWAA 1NXKA 3ZFYA 3I60A 4GVJA 3TWJA 3TV4A 3VRZA 3IW6A 2GMXA 2Y6MA 5E8VA 3BX5A 4D2PA 2ZM1A 3KY2A 4PWNA 4TYGA 3RCDA 4F65A 2H96A 1R1WA 3R73A 5TO8A 4QP3A 3OUNB 3NUXA 3QL8A 3DZQA 2YLEA 4DN5A 3SX9A 1BKXA 4IAFA 4U0IA 5DFPA 3SW4A 4B6LA 4D0WA 3HDMA 5HVKA 1Y8GA 3A2CA 3HRCA 2VTQA 4X2JA 1FQ1B 1H1QA 1M2RA 5CU4A 5HG7A 1KOBA 4FNYA 1IASA 3OUKA 1Q8UA 4O0WA 3I5ZA 4YTIA 4FKUA 4AOIA 1FVTA 5HX8A 4IWOA 2ITQA 2XNNA 4XYFA 4L7FA 1OUKA 3R2YA 2UZVA 3EFWA 4FV6A 5JK3A 3D9VA 4F9CA 3O51A 2XNEA 2Z7RA 5TKDA 4QOXA 5DOSA 3ORXA 1QPJA 3OOMA 2R0IA 4M14A 4YJOA 3ZYAA 4KA3A 1H4LA 4YLJA 4BTFA 5L8KA 2PZIA 4IX5A 3ZFMA 3G9LX 1PJKA 3POOA 5F1ZA