2OJ9A

Structure of igf-1r kinase domain complexed with a benzimidazole inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
295
Chain Sequence
ADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor precursor (EC 2.7.10.1
publication title Discovery and initial SAR of 3-(1H-benzo[d]imidazol-2-yl)pyridin-2(1H)-ones as inhibitors of insulin-like growth factor 1-receptor (IGF-1R).
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 295
sequence length 303
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oj9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oj9A01
3MFSA 3IW5A 4GW8A 5EFQA 2GQRA 2CKEA 2OI4X 2VZ6A 1SVGA 3E63A 1J7IA 2RFDA 3QC4A 3QUEA 2PVRA 2WQMA 4BHZA 3S1HA 4OAVB 5K0KA 3FEGA 4D9UA 4C3PA 3D5UA 2JAMA 3GFWA 4IADA 3PJ1A 5KX8A 5M4FA 4FTAA 4I94A 5FXSA 5KE0A 4FV2A 4KS8A 1Q8YA 3CGOA 4UX9A 3FC1X 4B6LA 2BZHB 3KA0A 2XB7A 3IW4A 5GJGA 5DVRA 4JQEA 4M3QA 2DS1A 3I60A 3I7CA 5EI6A 2JGZA 3NCZA 5EM5A 5EW9A 3RALA 4BY9E 3AD4A 3DZQA 4C4HA 4K1BA 3FZTA 3RM6A 2HW6A 2XK8A 2XEYA 2YM7A 5L4QA 3Q2JA 4YGAA 1ERKA 2OFUA 4OLIA 5HHWA 2G2HA 3EZRA 4BI2A 2ZV7A 5CSHA 2VRXA 4QO9A 4R6VA 3H10A 4XYFA 4B9DA 3FHRA 3BV3A 4O0YA 2OF2A 3OCSA 4KKHA 1CMKE 5CXZA 2PZRA 3GU6A 3NYXA 2REIA 1OL2A 5TE0A 4KBAA 3MBLA 4NM0A 3EL7A 4RFZA 3GC9A 4EQCA 3AXWA 3C9WA 2YCFA 4IX4A 5HO7A 3Q3BA 2EUFB 4AA4A 2C5VA 4XUFA 3SG9A 4IAAA 3PP1A 3MW1A 3MVHA 5KCVA 3ZM9A 4BN1A 3OWLA 3PJ8A 2IVTA 4OTQA 2WMTA 4J52A 5EDQA 1QCFA 5LQFA 2IN6A 2J0IA 3W2QA 4FIIA 3ZRLA 2OK1A 5C01A 4A06A 4FSYA 4KKGA 4UWBA 2QOFA 4GK3A 4BGHA 3AC8A 3FLWA 5EM8A 2XK4A 3D4QA 4HYSA 4RLKA 5HBEA 4G16A 5HNGA 2JIIA 1H28A 1OM1A 4LUDA 2G2FA 2UW4A 5E91A 4F6UA 1H1RA 5GIPE 3VNTA 3EQFA 5LCKA 2HOGA 2GNLA 4J98A 1WBWA 4Q5HA 4L45A 1YOJA 3NUAA 3LW0A 4J8MA 1YKRA 4DEAA 4XOYA 3BBTB 4F09A 4QP3A 5DBXA 3Q96A 4BTJA 2BVAA 2HZIA 3FY2A 2I0VA 4L44A 3B8RA 3NNVA 4J1RA 4ACGA 4ITHA 4D1SA 5M44A 3DNDA 3MGYA 1ZLTA 2C3JA 2W99B 1P14A 3O71A 4PF4A 2ZVAA 4AN3A 4FZFB 5CF8A 2UZWE 1FMKA 2W5BA 2WEIA 4LL0A 3ZOSA 3LOKA 1J1CA 2PE1A 4IQ6A 3DAEA 4OGRA 2XM9A 1FVRA 3LJ2A 5FP5A 3CTHA 2E9OA 4YJOA 1KOAA 2WOTA 4U8ZA 2O3PA 4IAFA 5BYZA 4GKHA 3V8TA 3ZLSA 2R4BA 4U80A 3CTQA 3UO4A 4AQCA 4FZ6A 5HIDA 4DH5A 5E8WA 4FSNA 4FIHA 1ND4A 2WTKC 1GZ8A 1VR2A 2X4FA 1G3NA 2QOQA 3UQFA 5IQBA 2EXEA 4FT3A 4FV9A 2FUMA 1IRKA 3TV4A 4FTQA 4GK4A 2R3JA 3LCSA 4QMYA 2X9EA 3DDPA 1M2PA 3FXXA 4DFLA 1YWRA 1DS5A 2Y4PA 3I7BA 4X6QC 3KEXA 3II5A 4JJRA 4IAIA 3NZ0A 2F2UA 2PUNA 2R2PA 4B8LA 3FMNA 2J0JA 4D9TA 4ZTHA 1M14A 5FBNC 2IWIA 3DZOA 2WEVA 1WBVA 2YZAA 5HLNA 4IZ5A 3ZSGA 5JGDA 5EYDA 4MWIA 4PX6A 3I81A 4J97A 2OO8X 3CLYA 2QHMA 4B7TA 3N4UA 4Q9SA 2OJIA 4XH6A 5CVGA 1JQHA 1R0EA 2JDVA 2ERKA 4NUSA 2OU7A 2I0EA 4A9RA 2ZOQA 4NIFA 4Z3VA 3HMPA 3AC5A 2ZMDA 2OIBA 3V5TA 2JD5A 3NGAA 4ITJA 4RIWA 3OUKA 3A99A 4YZCA 5ETFA 4USEA 5L2SA 2OLCA 4KBKA 3AT4A 1REKA 3Q32A 5DWRA 2BIKB 3Q9ZA 2RIOA 4OBQA 4HGSA 4QMTA 1B6CB 4I3ZA 4ANQA 3HL7A 3TEIA 4GEOA 4O7NA 4D2TA 2WTWA 4RGJA 2G9XA 4IVCA 2W05A 2Y6OA 2Z7LA 3MPAA 3TUBA 4DF3A 2AC5A 4HPUE 5J8IA 3QTQA 3U51A 2W4OA 1HCKA 4YUQA 2PULA 3LQ8A 4FG9A 5TF9A 2XNNA 2GTNA 3GVUA 3QKMA 3C0HA 1CM8A 1CTPE 1KE8A 2NRUA 3QQGA 3MVJA 3NR9A 2DQ7X 2QKWB 4EZ5A 3W18A 2R7BA 3I4BA 3VS1A 3BU3A 4M13A 3V5PA 4I0RA 4TRLA 3AGMA 3EN5A 2OH0E 3R21A 3DFAA 3LM5A 2WOUA 3SDJA 1QMZA 2A1AB 3BLQA 2BUJA 4L01A 5HE1A 1MRYA 4GRBA 4JVGA 5EYKA 4ARKA 5GZAA 2QNJA 2W5AA 2WU7A 4AT4A 3H9OA 4BVUA 2GTMA 3D15A 5J1VA 1J91A 3KXZA 5DHJA 4BFMA 4LV8A 3NEWA 4E6AA 1GZOA 4PPCA 4PTGA 5AUXA 4PL5A 1RQQA 1UWHA 4O27B 1OL1A 3FMHA 3HDNA 3ANRA 1SVHA 2C5YA 5J7BA 1RDQE 4BCHA 5IQAA 3G0EA 5IUIA 4QP8A 4YR8A 5JKGA 3V5LA 3I5ZA 4O2ZA 2VWBA 4OTHA 2QR8A 4OT5A 4E6QA 2GHLA 2WMRA 1YDTE 4NT4A 5T68A 2XRWA 3SAYA 4I5HA 2XF0A 2XK7A 2XBJA 5KZ0A 3D83A 4FYOA 5EK7A 3PXKA 1YWNA 3FKNA 4O7WA 1CKJA 4MF1A 4ZTMA 3PLSA 4MXYA 5CT7A 4P5ZA 3CBLA 3PXRA 5TR6A 3VHKA 4ALVA 5JMSA 2G2IA 3E5AA 4PMPA 3PSBA 4FTOA 4G9CA 3EFWA 3G9NA 4EK3A 2VWVA 3U87A 2B1PA 5IEXA 4K6ZA 4RJ7A 2YJSA 1YXSA 2J0KA 3D5WA 4Y46A 1Q61A 2UVZA 4YLKA 4DEGA 1XH7A 1FINA 2IZUA 2NRYA 2VTOA 2R3KA 2HK5A 5CQWA 1WVYA 1Q41A 3ZYAA 4P2KA 2WMAA 3PPJA 3ZXTA 4CT2A 3QAME 1YWVA 1ZYCA 4IAZA 4YTCA 1ZY5A 4A9SA 1R78A 4BCKA 2GHMA 4S2ZA 3DAKA 4HPTE 3QQHA 1UNHA 3PVWA 4TWNA 4W4VA 2WB8A 4JNWA 1M17A 3N4VA 2VTAA 2BDFA 2HCKA 3C4EA 3ORNA 4KD1A 3W55A 5HE2A 5K3YA 4JBVA 3RBWA 4MF0A 4X6RA 3W32A 5F9EA 4Y85A 2CCHA 3E92A 3M2WA 3VBWA 3IW7A 3E8NA 4GS6A 3LCOA 3M1SA 3VIDA 3WF6A 3ORLA 1GIJA 2JDOA 4YJTA 4IDVA 4F0IA 3FPMA 3PE2A 1L3RE 3DKFA 3P1AA 3EQBA 4RPVA 4U7ZA 4U44A 4AE6A 1YDSE 5BVOA 5CI6A 2GS7A 3KULB 3OROA 5AR4A 3BLRA 5FTQA 3V5QA 4GMYA 2PMLX 3T8OA 2CGXA 2E9NA 4HYHA 4KIPA 3F66A 1S9IA 3G6HA 4XV9A 1YHWA 4D2SA 4TWPA 3V6SA 2ZB0A 4TW9A 5DA3A 5GNKA 3S3IA 2UVXA 5F20A 4JL9A 1SZMA 2ITXA 4FV8A 5L6PA 2E9UA 3ZSHA 2FSOX 4I24A 3P7CA 4EBWA 2A27A 2OICA 4U3YA 5HG5A 2XVDA 4D55A 4ZTQA 4ZZMA 4DA5A 3LCDA 2O65A 5BYLA 5LVNA 5DE2A 4GL9A 4CZTA 5L2IA 3GNIB 3MN3A 1R0PA 3QX4A 4XG8A 2BHHA 1BL6A 3IDBA 3CE3A 4OTWA 4S32A 3F2RA 1XJDA 2BAJA 4DGMA 3UZPA 2C1AA 2ITYA 4FKUA 4EJNA 4IJPA 4QOXA 5HICA 4RIYA 1PXMA 4O7RA 1H8FA 3V5JA 3UIUA 3LMHA 1XKKA 4OTDA 2FO0A 3R71A 3RPVA 4WBBB 5AJQA 3F5GA 4ZSAA 2W4JA 2PVYA 5AUTA 5E8YA 4D0WA 1H08A 2X8EA 5DR9A 2I0HA 4AN9A 2QKRA 3VBTA 1CSNA 2GNFA 2PVJA 2QO9A 2WIPA 4KIOA 1GJOA 5K0XA 2X4ZA 3MS9A 4BBFA 1U5RA 4U97A 3ZH8A 2VU3A 3E62A 2NP8A 2F4JA 3NPCA 4YJPA 3DQWA 1ZMWA 5IA1A 3TKHA 4U40A 1F0QA 2OJGA 4S31A 3B2TA 3CIKA 4HVDA 2VWXA 4IJ9A 1O6KA 4FG7A 4FT9A 4BI1A 4ZTLA 4GVJA 1UU7A 4L3PA 4UN0C 4MCVA 4BTFA 4I6QA 1U5QA 5HOAA 1KV2A 4H3BA 4FV7A 2CPKE 4FNZA 4FTRA 5E1EA 1Q8WA 3QCXA 5CNNA 3SRVA 3UPXA 4F9CA 4DCAA 2WMWA 5H8EA 4XP3A 3T9TA 3ZZWA 5CAOA 1YVJA 1YXXA 3QFVA 4FYNA 4O38A 4AW0A 2BRNA 5HE3A 4C59A 2JKOA 2VX1A 4IVBA 2G01A 2VGOA 2V7OA 3TTJA 4E7WA 4DTBA 4GG7A 4ZTNA 3FE3A 1JVPP 4GU9A 5IUHA 3KK9A 3QTIA 1J7UA 3I6UA 2VNWA 1ZAOA 4RWIA 4N70A 5DT4A 5C8KA 4L67A 3GCVA 1H1PA 4LMUA 4NCTC 3ORIA 2UZDA 4DEIA 3UODA 3MB6A 2J5EA 5DEYA 2V0DA 3FYKX 4CEGA 2KTYA 5K5XA 2WD1A 3HAVA 4UYNA 4L52A 4CRSA 4BI0A 5KKRC 4OT6A 3KRXA 3R9OA 3GCSA 3COHA 4ASDA 1YOLA 4DGOA 3BHYA 4N0SA 5JEBA 4N4SA 5M55A 4M8TA 3TZ8A 2FSTX 5CY3A 3SW7A 4KIKA 3FMDA 1O6LA 4L68A 4U41A 5EOBA 4Y83A 3ZUVA 4DFNA 3F2NA 3UNZA 3REPA 3BHUA 3FMLA 3P23A 4UB7A 4BYJA 1BKXA 4C33A 4EKLA 4WA9A 3VBQA 4BKYA 4BTMA 2WPAA 5CAPA 4E4NA 2ITPA 3F3WA 3Q53A 5F1ZA 5LMAA 1ZYJA 1OIQA 3R7YA 4O96A 3IGGA 5HBHA 5HORA 4Y95A 2QG7A 4N57A 3KVXA 5CZHA 1TQIA 3G90X 3UP7A 2I6LA 3MFRA 2FVDA 1KUTA 4XX9A 4O86A 1U54B 3CQWA 2VN9A 2IVUA 3IPHA 3OTUA 4YHJA 3H4JA 4LRMA 4ZJJA 3FZOA 3RVGA 5L8JA 5ANEA 3GQIA 3KQ7A 2Z02A 3MB7A 2JIUA 1OMWA 4FT0A 2LAVA 4G3FA 3OXTA 3GI3A 3HLLA 3VUMA 5C8NA 2ZV9A 2W0JA 3JY9A 4GV1A 4MX9A 1OZ1A 3TCPA 1OL7A 5AUWA 4BC6A 4RFMA 4M14A 3KU2A 4EH6A 4ACCA 3OCTA 4X2FA 1GOLA 2ZB1A 3WZUA 4FZDB 4ENYA 5I5ZA 3E64A 5CSWA 1MQBA 4Y8DA 4R5SA 5IQEA 1QPJA 1MRVA 3OBJA 3RK5A 2ZMCA 3QU0A 3FI3A 4XHKB 2B4SB 3OTVA 5AR7A 3SHEA 1R3CA 3ZO4A 2XYUA 3HKOA 3F5PA 4ZSLA 4AU8A 4BDAA 4L3LA 2WKMA 2J5FA 2GMXA 4FTKA 3LJ1A 3NNUA 1Z9XA 4MQ1A 4WNKA 5HCYA 3RPRA 3R9HA 4TL0A 4AGWA 5FWKK 4I0SA 2XUUA 3FBVA 4X2KA 4BCFA 4PUZA 3P08A 4YZMA 5FXQA 4Q2AA 2PUPA 5IPJA 4XG4A 4CLIA 2F7ZE 2YFXA 4O0WA 4PWNA 4D5KA 2H8HA 5J9YA 5CU4A 3MY5A 3EKKA 4J99A 5M57A 4RRVA 5KHWA 1V0BA 2YHVA 1KV1A 2VO3A 3SKCA 3ZU7A 5AR8A 2UZVA 1H00A 4PL4A 2CCIA 4PPAA 3F7ZA 4QMMA 4DC2A 3PY1A 3OCGA 3FKLA 1YRPA 2QOLA 2R3MA 1L8TA 3MESA 3NYVA 4BDIA 3ZHPC 2PZYA 4NFMA 3KCKA 3ZLYA 4H1MA 5E92A 2VUWA 3IW6A 4AE9A 3IDCA 5L2TA 3R9RA 5CF6A 4X3FA 1H24A 4EOSA 4P7EA 4H05A 4M66A 1G8SA 2Y0AA 4BWXA 4H3QA 3DFCB 1XBCA 4O6LA 2QO2A 4FKSA 5JFSA 5EM7A 1KSWA 1NVQA 4UMRA 4ZMEA 1FMOE 3GC7A 4EOQA 2ZDUA 5IDNA 4RA5A 3RZBA 4A07A 3QZGA 3UNKA 2WTCA 3UMXA 5FEEA 4NM3A 4FC0A 3UBDA 4AF3A 4QTAA 4F1OA 5IDPA 4FTLA 3UYTA 4FV3A 4TYJA 2PVFA 4JAJA 4ITIA 4PTEA 1MRUA 4DFXE 2Y8OA 2JAVA 5K4IA 1PF8A 3P0MA 4DFYA 3SVVA 3R1QA 3EN9A 2J90A 2VTNA 3BYVA 3I5NA 2OBJA 3GCQA 4Z9LA 1ZYLA 5FEQA 5EDPA 4WSYA 4F70A 3FC2A 5DN3A 2P4IA 3ROYA 4IM3A 4NSTA 1PMEA 2P2IA 3B8QA 3DGKA 3GU4A 4IC8A 4E26A 3K5VA 3PY0A 5CTPA 3WZEA 2ITOA 4WIHA 4G3GA 1XH9A 3UNJA 2J2IB 5EQPA 3QTXA 4PMMA 2WTKB 2H6DA 5I9VA 5JZNA 4CFFA 1CKIA 3D5XA 2O63A 4YPDA 4BZNA 4FKOA 5FDPA 3QF9A 3HA8A 4Q9ZA 3WZKA 1SM2A 4HZSA 4RJ6A 4FX3A 3DAJA 5BVDA 3LFEA 1OPLA 3QHRA 4FT5A 3RWQA 4WO5A 2QOOA 4K2RA 4O1OA 4A4XA 3I1AA 2IZTA 3ANQA 4LYNA 2QO7A 5J95A 3R22A 4R7BA 3DB6A 3A7JA 3LFDA 3A4OX 3CEKA 2RGPA 2B55A 3DBDA 2YA9A 3OT3A 4FUXA 4U81A 1J3HA 3E88A 3ET7A 4DCEA 3Q9WA 5ANJA 4QTBA 4CLJA 4GSBA 1PXPA 3PXZA 5EYCA 4A9UA 3BZ3A 2PYWA 4RJ8A 3FMJA 2VTTA 4JAIA 3QRKA 4AT5A 3RAIA 4EK4A 5IQDA 3TNIA 5I9XA 4FKQA 2WELA 2CJMA 5J5SA 2VWZA 2QOIA 3TIZA 2O5KA 4IWQA 4MBJA 4ZLZA 3TDWA 2BZKB 3TWJA 3H3CA 1QL6A 2XZSA 4YHFA 3KB7A 5AA9A 2HZ4A 4O0VA 1Q97A 4YLLA 4LG4A 4OAUC 4LRKA 4O1PA 4BWKA 5A4EA 4O7YA 4L8MA 4S34A 2XMYA 4CFVA 3BKBA 5E90A 4FGBA 3EIDA 5B2KA 4U3ZA 2J6MA 3R8ZA 4EH5A 4XP2A 4EH7A 3ZMMA 3CSVA 1GY3A 4G6LA 4M84A 4IAYA 4U79A 4WG5A 4CKIA 2GS2A 4XCUA 4HW7A 5JH6A 5KBQA 4UZHA 4IFCA 3QQKA 3E3BX 5HESA 1PW2A 1M7QA 4PDSA 4UV0A 2VTJA 2YM6A 4XOZA 3CY2A 4RBLA 3D2KA 3W1FA 4JBOA 3FLQA 4O7TA 3LCKA 2XNBA 3G2FA 3RKBA 5CAUA 2BIYA 4E4LA 3HP5A 3VS2A 1UVRA 2QCSA 4HGLA 3C4ZA 1Z57A 3GEQA 4FICA 1TQMA 4IFGA 5A4LA 2VAGA 3NYOA 2Z8CA 3V01A 4G31A 3V5WA 4E20A 2JEDA 3F3VA 5E8VA 4BBMA 3FAAA 1AGWA 2X6EA 3F2AA 4FG8A 4FZ7A 4G6NA 4GT3A 5EOLA 3FY0A 1OBDA 1DI9A 5EDRA 2WQBA 4N6YA 4BZOA 1XHAA 3QGWA 4NW5A 5LWMA 5AUVA 3F3ZA 1WBOA 3FZSA 2QU6A 2W1CA 1WVWA 4NFNA 1ATPE 2C30A 4J71A 4RQKA 3ZM4A 4AACA 5CSXA 2Q83A 3SXFA 3LZBA 3SOAA 4F7SA 4RX8A 2R64A 2W06A 1U4DA 2PUUA 3G6GA 3OOGA 4TTHB 4MEDA 4YNOA 4L7FA 4ANOA 4EC9A 1Q24A 2O64A 2WGJA 2WTVA 5ANDA 3R1NA 5ANKA 1URWA 2BDWA 4HZRA 4BCMA 2NO3A 3UG2A 5CENA 3HUBA 4R1VA 3VJOA 3D0EA 3OC1A 5FTOA 2X7FA 4P5QA 3UZTA 3NSZA 4GK2A 4ANMA 3QUPA 4YZNA 4YNEA 5L6OA 2AYPA 2QC6A 4CZUA 3TJCA 3NRMA 3O17A 3UE4A 4IWPA 3FXZA 4QMNA 4BDFA 5HG8A 2BRBA 2CNQA 1JPAA 3PG3A 3DPKA 4AA0A 3PG1A 4QPSA 4FEUA 3ALNA 4FKRA 4XNEA 2X8DA 3FZ1A 3QUDA 3F6XA 3PUPA 4QMLA 4IVDA 1Y57A 3ORMA 4QPMA 3U8WA 4BDCA 1UNLA 2QOKA 3DXPA 2ZDTA 4BCOA 5BPYA 2OXYA 1PXLA 3QA0A 5ANOA 3HEGA 3IS5A 3EWHA 3VVHA 4QMWA 3SQQA 2XJ2A 3LFSA 3O96A 4P4CA 5GZ8A 5ITAA 3R04A 3LXPA 4NK9A 3OT8A 2I40A 4O7LA 3R9DA 3MIAA 4C61A 1GZKA 2YEXA 4Y73A 4NW6A 4C0TA 2XIKA 3F3UA 5EQEA 2ITUA 3GB2A 2C6LA 3FLYA 4FSMA 4D5HA 4FKLA 2VWWA 3TDVA 4JDJA 4IZYA 3DJ5A 4OTRA 3LQ3A 2QG5A 4APPA 4EZ3A 3VJNA 3C1XA 5GJDA 3TKUA 2R3LA 1G5SA 1WCCA 2C69A 2HZ0A 4LFIA 3RK7A 5GIOE 3CR0A 1IAJA 4DGGA 1J1BA 4AZVA 3OZ6A 1JKSA 4QTCA 2WTIA 2CHLA 3U9NA 2DYLA 3BEGA 3LAUA 3EN7A 4W9WA 4X2JA 3L8XA 2R3PA 1PMVA 3N9XA 3R8PA 3BHVA 4D58A 3SXSA 3PFQA 4FKGA 3RMFA 4G17A 3G33A 3BGQA 1BX6A 2OZOA 3RPOA 3ZDIA 4AFJA 5K5NA 4V0GA 2R5TA 2GDOA 3CXWA 5AP2A 1OITA 4MXZA 4C36A 2ITTA 5L2QA 2OZAA 1ZMUA 5IZFA 3TACA 2HAKA 4I0TA 1XH4A 3V6RA 2XIYA 1OGUA 3UDBA 4Z16A 5BMSA 5CEMA 4YC6A 5K9IA 2GFSA 4IB1A 4WT6A 5KKRB 3M11A 2A2AA 2QLUA 3NUSA 3G15A 4CTCA 4MAOA 5BVKA 1JSVA 2HY81 4FTIA 1ZOEA 3QXPA 3LKMA 2Y9QA 1W82A 4FIEA 5D10A 3DS6A 4CGAA 1H4LA 2ONLA 3R30A 2OJFE 3HECA 3PZEA 2W1FA 5IA2A 4DFUA 2ITQA 1CDKA 4CG8A 1ZZLA 2VO7A 2GQGA 2Y4IC 4BCQA 2A4LA 2WTDA 3ODZX 3PJ3A 5TT7A 1OL5A 5ICPA 5CI7A 3WE8A 4DTKA 1K2PA 3PSDA 4RIXB 3NVKI 5L8LA 4BDKA 3NIZA 5EKOA 2YABA 1Q99A 3FPQA 3OOMA 5AV1A 4PDOA 4ERKA 4DH3A 3ENMA 3TM0A 3D7TB 1MP8A 2HXLA 3KF4A 1OL6A 3EOCA 3OWJA 3EFJA 4EI4A 3MFUA 4KINA 5DOSA 5CEPA 3O8UA 4O0UA 4F7JA 4TWCA 2YIQA 3GUBA 2BZIB 3C4CA 4UWCA 3IGOA 4D4RA 3Q9XA 4RZVA 4TT7A 5LVOA 4B99A 3PJ2A 4U9AA 3PA4A 2CGUA 4MBLA 4ZMFA 1O9UA 1UA2A 3VAPA 3VW8A 2CMWA 2VTPA 5H3QA 4C8BA 3CTJA 4EOPA 2CNUA 5M06A 4DYMA 4FR4A 2UV2A 3TV7A 2PZIA 4L7SA 3AD6A 5LMKA 3VULA 3NAXA 2NPQA 3O8PA 3ZO2A 3IQ7A 3DJ7A 1PXOA 4FKIA 3HA6A 5IG1A 3R7GA 3MTLA 3A61A 4FIGA 5EKNA 3HMMA 2IO6A 4F08A 4EOIA 2BRGA 2YCQA 3ATSA 2CLQA 3QRUA 4FKJA 3MTFA 5CSPA 3DV3A 1ZYSA 4L42A 4PV0A 4RG0A 4BIBA 1H0WA 2LGCA 4EORA 5HTCA 5KMLA 1VYWA 4EQUA 3A62A 4BGQA 3QYZA 2XYNA 2R7IA 3U55A 3RTPA 3PRIA 3DNEA 2XNEA 5AV4A 4K18A 2RKUA 3ORTA 1BL7A 3QTZA 5D7VA 3DU8A 1Q62A 4IB0A 3SX9A 3PVBA 3TZ9A 1B39A 3FUPA 4MNFA 1APME 5FGKA 1X8BA 3L9LA 4F7LA 2ZJWA 2HW7A 3T3VA 4CMUA 5IQCA 4MH7A 4RWJA 3PPKA 4HVSA 5AIKA 4CYIA 4MVFA 4TPTA 4M0ZA 3BI6A 5L6WL 2PE2A 2IW9A 4KUJA 4QP6A 2VTHA 3VC4A 4ANBA 4ZJVA 4I5MA 3NAYA 2WQEA 4FIJA 3DLSA 4G5JA 2XKCA 4RVTA 2FGIA 4D2WA 2JIVA 3OVVA 1WVXA 4IBMA 4NM5A 3RK9A 2YIXA 3QQJA 2CDZA 3ITZA 3KXXA 4BDJA 2BKKA 3O23A 5HNBA 1URCA 3ORKA 4GFMA 4ASEA 2ETRA 4BCJA 4RIOA 4QMVA 4QP1A 3C4FA 3VRZA 4PRJA 3WIKA 4L3JA 3ODYX 2W9FB 5HG7A 5DYJA 2VTLA 4GKIA 3DK6A 3W8QA 1Y8YA 2XIXA 1PMUA 3JYAA 2FA2A 3FQSA 2BCJA 5JRQA 5JFXA 3PVGA 5KMNA 3EQRA 4YZDA 2WXVA 2CKQA 4AA5A 1E1XA 2J0MB 2BDJA 5J5TA 5M07A 1YDRE 2XNMA 5AEPA 2YISA 3I0OA 4D1ZA 1UWJA 4O22A 1T46A 5JFWA 3R2YA 3FWQA 3ORXA 5CF5A 3WF7A 4X0MA 3ZRMA 3PY3A 2UZEA 1Q3DA 2IZSA 4RQVA 3L9MA 2YITA 5L8KA 3QX2A 1FQ1B 2HWOA 5HO8A 2Z7RA 2C6KA 2JKQA 3CJFA 2E9VA 3EQPA 4O21A 5A4QA 4E5AX 2OF4A 3K3IA 4YO6A 4RJ5A 1UNGA 3KRWA 5D12A 3V51A 4ZS4A 1Y6BA 3C5UA 3D5VA 4BIEA 5IQHA 2XNPA 5CLPA 1STCE 3CS9A 3WBLA 1H0VA 2C3KA 3MI9A 3Q4ZA 1ZOHA 3DK3A 3W16A 5BVNA 1BMKA 4UEUA 3PDTA 3KN5A 4RVLA 3DLZA 4L9IA 3ZUTA 4I6HA 1WBPA 5KO1A 4FKVA 5AUZA 3ZBFA 5AUUA 4GYGA 1BYGA 3TNWA 4CV9A 3AC2A 1Q8UA 2RFNA 4IM0A 4IM2A 4MXAA 2HXQA 2GS6A 3GC8A 4PPBA 4QYHA 3LVPA 2ZYBA 2EWAA 4FV0A 2W7XA 4BCIA 4AZSA 2J0LA 3EYHA 4G3CA 2Q0BA 3W33A 5JRSA 3DCVA 3FXWA 2BKZA 3L9PA 3KKVA 2XRUA 4QMXA 5ETCA 4ENXA 2QHNA 4GJ2A 3FV8A 4IANA 2VNYA 4X3FC 3W2SA 1MQ4A 2HIWA 2W1HA 4PMTA 2OGVA 2ITWA 2IJMA 4TKSA 2BTRA 3UQCA 5J7HA 4U45A 4IHPA 2J9MA 4CTBA 4A4LA 5CAVA 2VTMA 4MQ2A 3UTOA 3U6IA 4PMSA 5EI2A 3EQGA 3VW6A 4RFYA 5IEYA 3WZJA 2PVKA 2B9HA 4M69A 3HMIA 3SOCA 5AADA 3VS4A 4WNMA 3ZZEA 2X8IA 4JIKA 1SNUA 4RWLA 1NXKA 1H1QA 4IWDA 1JKLA 4A4OA 4DFBA 1PY5A 4NKSA 1PYEA 4C37A 4R5YA 3ZRKA 4W9XA 3UIXA 4E6DA 5E8XA 4Q5EA 4UMQA 4O7ZA 4E93A 4F9BA 4BCGA 2P0CA 3JVRA 4GIHA 4APCA 3LHJA 4HOKA 4BDGA 3OF0A 2X39A 4EOOA 3D9VA 4F65A 4A9TA 2X7GA 4UMPA 4R3RA 1R39A 1ZARA 2G15A 1PYXA 2WQNA 3ELJA 3LXKA 4KIQA 3MJ1A 3UMWA 2Z2WA 3MFTA 4C4IA 2V55A 4CFWA 4O0RA 4TYHB 5AMNA 4L00A 3Q60A 5FBOA 1JSTA 5AP1A 3TNHA 2BAKA 4FSRA 2BPMA 4YSMA 5FQDC 3DTCA 2B9FA 4AZEA 3QC9A 2JDTA 4AZWA 5AP4A 1V0PA 4O83A 3CGFA 2IPXA 2IZRA 4AT3A 1OKWA 1KE7A 4DITA 2XKFA 4BKZA 4IMYA 1OB3A 1FVTA 3AOXA 3BQRA 4ZTRA 4FEWA 1VEBA 2HZNA 4ANLA 2YDIA 5HCZA 1EH4A 1Q5KA 3OG7A 4WD5A 4DLIA 4F9WA 5HEZA 3QRJA 4TWOA 4OR5A 3GBZA 2WO6A 3E7VA 1K9AA 1W84A 4TNBA 5CEOA 1WBSA 4PTCA 4F1TA 4EH8A 3PWDA 3Q52A 5AR5A 2PPQA 3BHHA 4RVKA 5E8SA 3UP2A 3R1SA 2PUIA 3HNGA 4PDYA 1XR1A 2YDKA 4BHNA 4DBNA 5DG5A 4XV1A 4QMQA 2ERZE 3EFLA 2JFMA 4XRLA 3UIBA 1P4OA 4RIWB 5I4NA 4D28A 4AXAA 4ERWA 2JDRA 1P4FA 4YC8A 5E9EA 3W2OA 2R3NA 2VTRA 2WHBA 4G9RA 5I9WA 5FXRA 5A6NA 4JR7A 4DG3E 1GNGA 3ORZA 2R3GA 5C8MA 4C3RA 3MIYA 4JR3A 4TZRA 1KE9A 2FSLX 2XK6A 2W1EA 3KMMA 3ZTXA 2YZLA 5EHLA 2Z7SA 2BRHA 4LGGA 4PDPA 4C2VA 1YXVA 4DINA 3EFKA 3EH9A 3ZLWA 4QMSA 2QODA 3EN6A 3GOPA 3QTRA 1UU8A 4D2RA 3QCYA 4RT7A 3AG9A 5TO8A 5EQYA 3I6WA 2BILB 5C1QB 4EH3A 2QQ7A 4HNIA 4RVMA 3ZONA 2GU8A 4IAKA 2W17A 4DTAA 3VS0A 1WAKA 1OIYA 2BALA 3MA3A 4MXCA 4UY9A 4V01A 2W1ZA 3O7LD 3OCBA 2XS0A 2WAJA 3E3PA 1AD5A 4BDBA 4YC3A 1KE6A 3JR1A 2W4KA 4NH1A 5M08A 3IOPA 5E8UA 3OXZA 3I79A 5LARA 3MH0A 4JDIA 5ETIA 4EK5A 3UOJA 4I20A 5E4HA 2X2KA 3F5UA 4WHZA 3BGZA 4XJ0A 3SC1A 4FTTA 1E1VA 3Q4TA 4UXLA 3UPZA 5M51A 4FUYA 4HCTA 5JFVA 5HE0A 3BHTA 5AV3A 3LFQA 3WF9A 4C4JA 3IO7A 1PXKA 5LJJA 3O2MA 2WMUA 2RFSA 4QYEA 5AR3A 2EXCX 4JIAA 4KAOA 5CU0A 3FI8A 2BZJA 2UZLA 4FI1A 3H0ZA 4U42A 3ZC6A 4FK3A 2CKOA 3OBGA 4H36A 4CV8A 4XG7A 3T9IA 4O2PA 1LEWA 5AP0A 1JKTA 1VZOA 2PK9A 4U6RA 4UZDA 3S0OA 3DA6A 4YPSA 3A7HA 3MY1A 4OW8A 4YMJA 2PSQA 4FNXA 5BUIA 3RP9A 4ZSEA 3EB0A 3UOLA 4QNAA 3GU5A 3OHTA 3F61A 5CEQA 3RWPA 5KHXA 3NUYA 2UZTA 3PA5A 3VQUA 4CFMA 4UXQA 2W1IA 4NJDA 4RMZA 1NVSA 1AQ1A 4KBCA 3QQLA 2CKPA 4HVHA 2QR7A 4IXPA 1Z5MA 4FV4A 2IVSA 3LXLA 4GU6A 2SRCA 4MTAA 4R7IA 4QYGA 4ZTSA 3DK7A 3R2BA 1OI9A 3OWPA 3LFFA 2X1NA 3QZHA 1M2RA 4V05A 4W4WA 4AGCA 4CQEA 3TG1A 4EH4A 4GJ3A 3DKGA 3OUNB 4FKTA 2YLFA 5HZNA 3WARA 2ETMA 5LVPA 4BR3A 2RG6A 4E6CA 5AA8A 5BVEA 4GFOA 4E8AA 3DY7A 4D4SA 4ZAUA 5HD4A 4JDKA 3PLAE 2C1BA 4NL0A 3HVCA 4XMOA 4G34A 4F6WA 4BDEA 4X3JA 3HAMA 5AP6A 5I3RA 4IDTA 4K0YA 1F3MC 3R02A 1IASA 3BLHA 4QNYA 5BX0A 4FGRA 1A06A 1MUOA 2H34A 1Y8GA 2YIWA 3ORPA 5C4LA 4M12A 5IA3A 3QALE 3E7OA 2R0UA 4WBOA 4ANNA 1SYKA 4FA2A 3PVUA 3QKKA 4CNHA 4FL2A 1PKGA 4UYAA 3JXWA 3BCEA 3VUDA 5LOHA 4IIRA 5KMOA 4PP9A 5CQUA 2RF9A 4MK0A 3GCUA 5AM6A 1ZWSA 2UW7A 4XBRA 2B9IA 3IECA 4QP4A 3TIYA 3NNWA 1O6YA 2C6DA 4RIXA 1WMKA 2E2BA 3F3TA 3FHIA 2R3IA 3QCQA 3BELA 5CZIA 3CC6A 1VYZA 2W1DA 3OY1A 5AWMA 3BWFA 2WMXA 3D7TA 4CT1A 1KOBA 2ONLC 4C02A 4FTNA 3AC3A 4XEYA 1FVVA 3A7IA 5HU9A 4CG9A 3SG8A 4O84A 4MYGA 3FZPA 3U4WA 4AZTA 5DR6A 5JGBA 2PY3A 2XBAA 4LI5A 4KWPA 5KMKA 4RIYB 2XM8A 3W2RA 3W8LA 4F4PA 1ZXEA 3TKIA 1YHVA 1DM2A 4MD9E 3DJ6A 2FH9A 1NW1A 2YAAA 3ROCA 4JBPA 4DN5A 3G5DA 1TQPA 3LFAA 4G3DA 4MXXA 2ZAZA 3KC3A 5ANIA 4FSUA 4BDHA 3NMUF 1ZOGA 4NYEA 4C7TA 4AOIA 3RHXA 2Z7QA 3O51A 5CX9A 3W2CA 4AOTA 4IZ7A 2C6TA 4TNDA 3RAHA 3IONA 4O0TA 4S30A 5JT2A 4XG6A 3AGLA 3WYXA 2WFYA 3PXQA 2VWYA 2VO6A 5AP5A 4BBEA 1ZYDA 2YM3A 2JC6A 4X2NA 4LM5A 5B0XA 2IVVA 3MH1A 1OIUA 5CU6A 4C62A 4D1XA 4WOVA 4C4GA 3FDNA 2VX0A 1REJA 3R8UA 5LMKC 3LMGA 4FKWA 2XNOA 2C6EA 3UOHA 1LEZA 2GNIA 4R8QA 4IX6A 5CU3A 2F57A 2ZM3A 2C5XA 4QQ5A 4ZK5A 4NJ3A 3ULIA 3PIYA 4U0IA 4LGHA 3Q04A 4KB8A 5CSVA 4QT1A 4F1MA 5EW3A 4QQTA 5BUEA 3BRBA 4FEXA 4RC4A 2ACXA 3A7FA 2RFEA 3UVRA 2IG7A 1XBAA 1XBBA 5ACBC 2ZV2A 5IA5A 4DGLC 4YURA 5CAQA 4FEVA 5D1JA 3CJGA 3ZUUA 2C6MA 4D4VA 3P79A 2VD5A 4RA4A 4H1JA 5E8TA 4KABA 1M52A 3EKNA 4O0SA 4XS2A 5CNOA 2R3HA 3CQUA 2UZNA 1RE8A 4XLIA 2C4GA 2JKKA 3QD2B 4FTCA 3P7BA 4EUUA 4UWYA 1I44A 4E5BA 3LIJA 4F99A 4X7QA 2DWBA 3P7AA 2JBOA 5FM2A 3U4UA 1JBPE 1WFCA 3UQGA 3R00A 5HX8A 3RNYA 4MNEB 5M4IA 4DHFA 4KSPA 1WBNA 2CSNA 4L6QA 3NW6A 5F4NA 3KREA 2ITNA 4MHAA 3CY3A 4EUTA 4Z7GA 4CCUA 4E73A 4UMTA 3GP0A 4ZLOA 3DBQA 3EJ1A 1Q3WA 2ZV8A 4HGTA 4ALWA 3DXQA 3Q2MA 3R63A 4BKJA 4JRVA 5IISA 5E1SA 3H9RA 3ZO3A 5GZ9A 3BX5A 2F49A 4EBVA 5J79A 5IQGA 3R7VA 3HP2A 2X7OA 3UO5A 4FKPA 3U6HA 3ETAA 4C2WA 4Z7HA 3QQUA 3IW8A 3FMMA 3LFCA 5A4TA 2YCRA 4Y5HA 1TVOA 3PTGA 3LMIA 4YJUA 4FTMA 3SLSA 4DG0E 4XRJA 3GC0A 3RM7A 3CKWA 3FYJX 4JQ8A 1YQJA 3A7GA 3AMAA 3QCSA 4XG9A 4Y5QA 4J96A 4ACHA 4O6EA 4OUCA 4JDHA 4JX3A 2UW0A 4K8AA 3ZEPA 3EMGA 4FVQA 4EYJA 2W96B 2YIRA 4FNWA 3WILA 5HIBA 2E9PA 2O0UA 3EN4A 1QPEA 4KS7A 4DLJA 4ZZNA 4YTHA 2CN5A 3NS9A 3PSCA 4JRNA 4GT5A 3BE9A 2GNGA 3BGPA 4XG2A 2PU8A 4QMZA 3UG1A 3FSFA 2XJ1A 4GVAA 5CALA 5CF4A 5JQ5A 4JX7A 4IX3A 3ENHA 5AIRA 3KULA 4FOBA 5HCXA 1H01A 4JI9A 2PL0A 3CCNA 1BUHA 3IDPA 4G2FA 3OY3A 4G6OA 5A14A 3NNXA 3VBVA 4Y72A 3C7QA 3BYSA 5AFVA 4G5PA 4F9YA 4HVGA 3WF5A 5IA4A 3QZFA 1LR4A 3AC1A 3ZLXA 2VWUA 4CFXA 5IEVA 2GPHA 4FZAB 2W5HA 3GXLA 4AW2A 4C57A 3K54A 3L1SA 4S33A 4EH9A 2UZOA 3RINA 3SGCA 1KWPA 5B7VA 5JQ8A 4FSQA 5HTIA 4GUBA 4XV2A 4PL3A 3HMNA 3QHWA 2C68A 4IVAA 2RSVA 4XV3A 5FLFA 3ALOA 1YXUA 4QRCA 3OW4A 5I9ZA 3BYUA 4JLCA 4GG5A 2UW9A 2UW8A 3KF7A 4QQCA 3KCFA 3PXFA 4L43A 4USDA 4DEHA 5DR2A 4YO4A 3U54A 4K9YA 3KK8A 4G1WA 1SMHA 2QURA 4ZJIA 3V04A 3VWAA 3NUPA 5L2WA 2OW3A 2ESMA 4BZDA 2A0CX 4X3FB 4DT8A 4W8DA 4WRSA 4F9AA 1GIHA 5AP3A 4FTUA 4JT3A 4P90A 3GQLA 5EYMA 2VTIA 2V7AA 2O8YA 4B0GA 5IA0A 2YLEA 2C6OA 4FODA 4WKQA 2CGVA 2C5OA 1XH5A 2VTSA 1I09A 2WNTA 3MV5A 3TXOA 3ZXZA 4FVRA 3BV2A 5AV2A 5JZJA 2PZ5A 3KFAA 3VUGA 4PP7A 3EQHA 3KN6A 4TYHA 5I0BA 4E5WA 5A46A 2R3QA 2JDSA 3CPBA 4QPAA 4R3CA 2WMBA 1OKYA 2I7QA 3QYWA 5HGIA 5BVFA 2OG8A 3VS3A 5LVMA 3H9FA 3VS5A 2QI8A 4BGGA 4MKCA 4B8MA 4PNIA 1U59A 5IQFA 3QD3A 2EB2A 5KNJA 4CFUA 4C4FA 4U43A 2Q0NA 2EB3A 3PP0A 3R7IA 4HVIA 3R01A 3R8LA 2VWIA 3QLFA 1BI8A 2WQOA 4CMTA 3CP9A 1NA7A 2YWPA 3IK3A 2X81A 3FMKA 4NWMA 1P5EA 3DDQA 5AAFA 3CKXA 3V3VA 3CD3A 2ITVA 5FP6A 1UKHA 3BWJA 2PMOX 4DEBA 3KVWA 3Q5IA 4I1ZA 3TZMA 2HWPA 5K4JA 4PQNA 3NYNA 4WUAA 3UVPA 3VQHA 3PRFA 3RAWA 2X9FA 1Q8ZA 2YJRA 4NM7A 4FBXA 3W2PA 3C4WA 3R73A 3HRCA 3FLZA 3ZDUA 4FL3A 5CYIA 5FEDA 1M7NA 5IMEA 3MWUA 3CQEA 2UW3A 4BDDA 5A6OA 4FV1A 5DEWA 3ERKA 1CKPA 3EHAA 2CN8A 3COIA 3OS3A 5EHYA 4R7HA 5GJFA 4YTFA 3BIZA 1OVEA 2HELA 3QWJA 1GIIA 5KUPA 3B2WA 3VUHA 4O82A 3Q4CA 5CU2A 1JWHA 4C34A 5DIAA 3WYYA 5M4CA 3P4KA 3VUTA 2YIYA 4V04A 1DAYA 1YI3A 1LUFA 3GU8A 4GIIA 4H58A 1VJYA 4YHTA 3KMUA 3QTSA 2V22A 4JG6A 2XK3A 4RX7A 1OKZA 3KXMA 4F7NA 4OTGA 3LFNA 4DEDA 2GCDA 4LOQA 3DT1A 3K2LA 5HG9A 3QXOA 4YP8A 5C9CA 1B38A 3KL8A 3NUUA 4YTIA 3R7UA 3V8WA 3ZFYA 4LL5A 3PWYA 3PE1A 3FL5A 4OTIA 1U54A 4QTDA 2GHGA 5AP7A 3WZDA 3DTWA 4EQMA 3LPBA 3GCPA 4FOCA 3EQCA 3RZFA 5L3AA 4C38A 2XCKA 2VGPA 2F9GA 3BQCA 3PJCA 4X21A 3MA6A 2I1MA 4HYUA 5I3OA 3UC4A 3W10A 4DEEA 4NTTA 1Y91A 2W1GA 4I93A 4YLJA 4D0XA 4ZY4A 3NW7A 4N6ZA 3FSKA 4O91A 5AUYA 2YCSA 3P86A 5GINE 3D14A 3LE6A 4UBAA 3O7LB 2BFYA 5BVWA 2R9SA 5T6KA 3QLGA 1F5QA 5GHVA 4AP7A 3A4PA 2QD9A 1GZNA 5CWZA 5FDXA 5HU3A 5BQ0A 1P2AA 2XNGA 3HRBA 1DAWA 4JQ7A 5EG3A 3BE2A 2OJ9A 4I4FA 3M42A 3QTUA 4I5PA 4C35A 4USFA 4TN6A 2FYSA 4IZAA 3QGYA 5C26A 5DH3A 3ZCLA 4XLVA 2WMSA 4CKRA 3V8SA 2GQSA 3HV4A 1A9UA 2XKEA 3NLBA 2FB8A 4GUEA 4IH8A 4QP2A 3UGCA 3FQHA 2XK9A 3NIEA 3D94A 4NU1A 4L53A 1V0OA 1Q8TA 3KGAA 4TXCA 1UKIA 3QBNA 3R28A 4IB3A 2H9VA 2PE0A 2QVSE 4LUEA 2UZBA 3U9CA 4F0GA 2OWBA 2H96A 1YXTA 3R1YA 4CD0A 2WU6A 3TL8A 1IR3A 2BR1A 3F82A 1V1KA 2AC3A 5HVJA 3FKOA 1FGKA 4I4EA 1H26A 4FT7A 5FD2A 4ZEGA 4BL1A 3CPCA 3QL8A 5G6VA 2HYYA 4IEBA 5H2UA 4EL9A 3FQEA 3FL4A 3MPTA 4W4XA 2IW8A 3UC3A 3VUIA 5IH4A 5KMMA 5DRDA 3RI1A 4BRXA 2UUEA 5DI1A 3QD4A 5IKWA 3JUHA 4CVAA 3WI6A 3K5UA 5AV0A 4AWIA 4EOLA 1FPUA 4HYIA 4AN2A 3DBEA 3K3JA 3DBFA 4JBQA 2KULA 5EHOA 3TJDA 3ULZA 3S95A 3S00A 2BMCA 2XP2A 3OXIA 5C27A 3WE4A 3ZEWA 5B2LA 4EJ7A 5KBRA 4ANSA 1YI6A 1GAGA 3A60A 1UU3A 3QWKA 3RPYA 4BWPA 1LP4A 1RW8A 3DOGA 4FTJA 1H27A 5J9ZA 1XQZA 3VF9A 3LLTA 4C58A 5JN2A 4AG8A 1YOMA 3VHEA 3RGFA 1H25A 4I22A 5DFPA 2Y6MA 4ZOGA 2UVYA 4GCJA 3E93A 3COMA 5DNRA 3SW4A 3R7OA 5HLWA 2R3OA 2HENA 3GENA 4RLLA 2BTSA 4CMOA 4QMUA 3F9NA 3SXRA 3KXHA 4OBOA 4BCPA 2BRMA 4QMOA 2J50A 1U46A 4DAWA 3POZA 4ACDA 4OTFA 4EK6A 3UZRA 1PRYA 4CQGA 3BYOA 4PNKA 5IU2A 1JKKA 2A19B 2QONA 2P3GX 5G1XA 2QOBA 4DH1A 1SVEA 2XEZA 4F63A 5HNIX 3RNIA 2PVNA 3DXNA 3LFBA 4O7SA 5ANGA 4BCNA 4MXOA 4J8NA 1PMNA 5CEIA 2R3FA 4FV5A 4IWOA 5TOZA 1A48A 2UW5A 4QMPA 4DT9A 3MYGA 2F7EE 4EONA 2XH5A 3MJ2A 3QRTA 4ASXA 1H07A 4GYIA 4AUAA 3ACKA 4ZSJA 4LOOA 1W8CA 5F94A 3GFEA 4R3PA 2V62A 3PA3A 4RC2A 5KMJA 3F5XA 3EYGA 3L8VA 4V0GB 5AAGA 2QLQA 3ZS5A 5B2MA 5M09A 2OZAB 4KRDA 5M56A 1OKVA 3C13A 4M67A 1XWSA 4RJ3A 4TYEA 5TKDA 2YWVA 4WSQA 3LJ0A 4DH8A 4ZLYA 2VX3A 3EL8A 2X0GA 4BICA 3BU6A 2OKRA 3GU7A 4AAAA 5DT0A 3ZC5A 2WIHA 3KRLA 2JITA 4BIDA 1QPDA 4FV6A 3FJQE 2ETKA 5HVKA 5EI8A 1ZMVA 2C6IA 4CXAA 5J9LA 1PXJA 3DQXA 3KRJA 3QA8A 5CVHA 5D7AA 3D2IA 4CCBA 4I6BA 3FI2A 2J4ZA 4K33A 4EEVA 4F0FA 5FG8A 1K3AA 1OUKA 2R3RA 3COKA 3POOA 1G8AA 2EVAA 1NVRA 3QRIA 5C03A 3T3UA 4ALUA 1R1WA 1WZYA 3CD8A 3GT8A 3RAKA 5J1WA 4AGUA 3VS6A 2OIQA 4EK8A 4IX5A 1IAHA 4EWHA 4ZIMA 4E3CA 4RZWA 3MVLA 4I92A 4WG3A 4FF8A 5HI2A 5IMXA 4O0XA 3QQFA 5I9UA 2JFLA 4NIFB 2BHEA 5IUGA 5DGZA 1SNXA 4NKAA 4FL1A 2C0TA 4E1ZA 4L46A 4DG2E 4M0YA 3SD0A 1E9HA 1LPUA 4QYFA 3TUCA 5KZIA 3EQIA 3R9NA 2XKDA 2VO0A 3NX8A 4ORKA 2ZM1A 4XP0A 4MWHA 4II5A 4ASZA 1IA8A 4AZFA 5DMZA 4JOAA 4NZWB 3NWWA 2X2LA 4FSZA 4RX9A 2XCHA 3DBCA 4R78A 1W7HA 3UJGA 5LXMA 4IC7A 3D7ZA 5EW8A 4F6SA 3DKCA 4EHEA 3AMBA 3Q6WA 4FVPA 2B54A 3HV5A 5CS6A 3A2CA 5HKMA 3GOKA 4AFEA 3QZIA 2YACA 4NTSA 4FEQA 5ACKA 4FK6A 4W4YA 1YI4A 5AX9A 4NEUA 2RG5A 4AW1A 3VS7A 4B4LA 2C47A 3NUNA 2B7AA 4CSVA 4O7VA 4C4EA 2J7TA 4HNFA 5AX3A 2QU5A 1W98A 4G3EA 5EM6A 2YM8A 3FI4A 1JOWB 4MNEA 2P2HA 3FLSA 4ZS0A 3SV0A 3O0GA 2GSFA 3L8SA 3MH2A 1JSUA 3U6JA 2PVMA 3Q5ZA 2WMQA 4J95A 1YW2A 3G9LX 4CYJA 2PMIA 2W9ZB 3F69A 1YHSA 5CASA 2XA4A 2RL5A 3E8DA 3L9NA 3S2PA 5A3XA 4PY1A 4K77A 2B9JA 4YJNA 1PHKA 2PVLA 3UO6A 5M4UA 3QKLA 4CRLA 3ZO1A 2HY0A 4FIFA 3AC4A 3O50A 3HUCA 3NUXA 1NT2A 4FSTA 3FZRA 4UALA 4HJOA 5IH6A 4H3PA 5DRBA 4EHGA 3H0YA 4U5JA 2WTJA 2UZUE 4RC3A 3ZSIA 5JGAA 5T3QA 3Q6UA 2XIZA 4I21A 2C0OA 4EZ7A 4GH2A 1ZY4A 3VBYA 1OIRA 4M15A 5DLSA 4HCUA 3VUKA 4Z55A 4FE2A 4QP9A 2JKMA 3HGKA 4ID7A 4CZYB 2B53A 3P5KA 2PHKA 3A8WA 4XG3A 2G1TA 2X6DA 5AR2A 2Z60A 3VO3A 3DB8A 4UMUA 3HX4A 4TY1A 4YZ9A 1KE5A 4LRJA 5HD7A 3ZFXA 4GT4A 4RSSA 4IB5A 4LOPA 2CNVA 3HV3A 4AOJA 5HX6A 2OXDA 3TUDA 2FSMX 3L8PA 4ONAA 2VV9A 3KRRA 1OPJA 2QOCA 3E8CA 3TN8A 2ITZA 3R8VA 3ID6C 4R1YA 1WBTA 3JPVA 2F7XE 2IW6A 3IG7A 1RJBA 3R6XA 4LGDA 3AQVA 4YJQA 4OTPA 3OWKA 2YM5A 4J53A 3R8MA 1OECA 3N51A 3OEFX 3LLAA 2PTKA 3FMEA 5KMIA 3JY0A 3HV7A 4EH2A 3AMYA 3C4XA 1H1WA 2B0QA 1ZRZA 3HZTA 2PWLA 4ACMA 4I5CA 3BYMA 3RCDA 5HIEA 2BROA 2V5QA 2C3LA 4RJ4A 5HQ0A 3G51A 4QP7A 2P33A 3H30A 3RCJA 3TTIA 1ZZ2A 4ZXTA 2B52A 4AGDA 3MY0A 4ZSGA 4ZY6A 2ZM4A 1BLXA 3VBXA 3LXNA 4DH7A 3KMWA 1HCLA 2X2MA 2CLXA 4TYIA 3S4QA 3R0TA 2J51A 4CKJA 3MPMA 3PIXA 3BU5A 4O81A 2AUHA 3HYHA 3F88A 3F7WA 4MD8E 3NVMB 5J87A 2EXMA 2VTQA 3NW5A 4FNYA 3TNQB 3UIMA 3RJCA 3JS2A 5IH5A 4I41A 3PYYA 4FMQA 3HV6A 1OUYA 4DE4A 1XO2B 2O2UA 5CVFA 4EOJA 3BEAA 4BTKA 2NNWB 4ZP5A 4HGEA 2JBPA 1H1SA 3AD5A 4CFNA 4EHVA 2QOHA 5F95A 4BB4A 3Q4UA 1NY3A 4QYYA 5EH0A 4E4MA 3AT2A 4J7BA 3MH3A 3JVSA 5A4CA 1FOTA 3VRYA 1T45A 1PKDA 3Q9YA 4EC8A 4EOMA 5FM3A 1XH6A 2YN8A 4JS8A 5E7RA 4WG4A 5IQIA 5FRIA 4OBPA 5D9HA 5CEKA 3EZVA 3E8EA 1PJKA 4D2PA 4MD7E 4AX8A 3WIGA 5BYYA 5HBJA 1W83A 3N4TA 5JSMA 2BFXA 2YERA 3ACJA 4DGNA 3R7EA 3HRFA 3WOWA 5E8ZA 2OH4A 4LV5A 3OFMA 1IEPA 4KRCA 2OFVA 2GNHA 3MSSA 4IW0A 4AW5A 4WRGA 4QD6A 4IACA 4W8EA 4YJRA 3TV6A 5AM7A 5CANA 3C51A 3SA0A 4JG8A 3THBA 1OPKA 4YBJA 3TI1A 1FBNA 2JLDA 3KY2A 2Y4IB 3NCGA 4LQMA 4D4YA 2YAKA 4D2VA 3PZHA 1OBGA 2OIDA 2P55A 2I0YA 3DKOA 4M69B 4F64A 1JNKA 4EKKA 4QTEA 3RHKA 3EQDA 4KKEA 1XH8A 5A9UA 5FUTA 3TNPC 2XIRA 3I0QA 3OP5A 1W0XC 5H8BA 5HO6A 3UVQA 3IKAA 3QTWA 3HMOA 3ZBXA 5AAEA 4YSJA 5H9BA 4EWQA 4K11A 4KA3A 3PIZA 5D11A 2C0IA 4YBKA 3RPSA 2PVHA 3LQ5A 3MVMA 3OW3A 3WF8A 2EU9A 4R77A 3OEZA 5LMBA 3MDYA 1DI8A 4KNBA 1Q4LA 3TZ7A 1JAMA 3PPZA 2R0IA 5BMMA 3C0GA 1S9JA 4M7IA 4WNPA 4HCVA 4M97A 4C3FA 4E4XA 1PXNA 3VF8A 4A7CA 2DUVA 5C4KA 3AT3A 4ZZOA 4YJSA 2Y7JA 4WNOA 3QD0A 4TYGA 4WUNA 5A54A 4XBUA 2PMNX 4LMNA 3SRVB 2C3IB 3O8TA 5LCJA 3C50A 3E87A 5LVLA 4DBXA 2F2CB 4A9YA 4EHZA 4NCTA 3PXYA 5BUJA 2OJJA 3G0FA 5BNJA 5HVYA 4BYIA 4EYMA 1UV5A 1HOWA 4MBIA 5LWNA 4AS0A 1PXIA 4H39A 2PZPA 4YJVA 4RWKA 4ZY5A 4I23A 3R83A 3UOKA 4EOKA 3VN9A 3BBWA 5HTBA 5CT0A 3C0IA 3KXGA 5M53A 4FSWA 1J7LA 2WMVA 2CGWA 3OMVA 1FGIA 2OSCA 3P9JA 5DT3A 3IOKA 3KXNA 4JXFA 4YZBA 1Y6AA 3OD6X 2YDJA 3C5IA 5D41A 3LCTA 4GFGA 4IE9A 4JG7A 5HLPA 5JK3A 2GFCA 3GGFA 2GNJA 5CXHA 4RX5A 3ZFMA 5IF1A 2WZJA 3TT0A 1M2QA 2XJ0A 3UYSA 1JLUE 4DFZE 1QPCA 1UU9A 2BAQA 2YM4A 4KSQA 4BF2A 1IG1A 2C5NA 4QQJA 5DPVA 1TKIA 3P78A 3HDMA 2OXXA 5H8GA 5I9YA 1BI7A 4KIKB 2UW6A 1IA9A 3NDMA 4YU2A 5ETAA 4I6FA 4X2GA 3ATTA 3FLNC 3A8XA 5FTGA 3BPRA 4M68A 3LM0A
chains in the Genus database with same CATH superfamily
3MFSA 3IW5A 4GW8A 5EFQA 2GQRA 2CKEA 2OI4X 2VZ6A 1SVGA 3E63A 1J7IA 2RFDA 3QC4A 3QUEA 2PVRA 2WQMA 4BHZA 3S1HA 4OAVB 1VLRA 5K0KA 3FEGA 4D9UA 4C3PA 3D5UA 2JAMA 3GFWA 4IADA 3PJ1A 5KX8A 5M4FA 4FTAA 4I94A 5FXSA 5KE0A 4FV2A 4KS8A 1Q8YA 3CGOA 4UX9A 3FC1X 4B6LA 2BZHB 3KA0A 2XB7A 3IW4A 5GJGA 5DVRA 4JQEA 4M3QA 2DS1A 3I60A 3I7CA 5EI6A 2JGZA 3NCZA 5EM5A 5EW9A 3RALA 4BY9E 3AD4A 3DZQA 4C4HA 4K1BA 3FZTA 3RM6A 2HW6A 2XK8A 2XEYA 2YM7A 5L4QA 3Q2JA 4BJJA 4YGAA 1ERKA 2OFUA 4OLIA 5HHWA 2G2HA 3EZRA 4BI2A 2ZV7A 5CSHA 2VRXA 4QO9A 4R6VA 3H10A 4XYFA 4B9DA 3FHRA 3BV3A 4O0YA 2OF2A 3OCSA 4KKHA 1CMKE 5CXZA 2PZRA 3GU6A 3NYXA 2REIA 1OL2A 5TE0A 4KBAA 3MBLA 4NM0A 3EL7A 4RFZA 3GC9A 4EQCA 3AXWA 3C9WA 2YCFA 4IX4A 5HO7A 3Q3BA 2EUFB 4AA4A 2C5VA 4XUFA 3SG9A 4IAAA 3PP1A 3MW1A 3MVHA 5KCVA 3ZM9A 4BN1A 3OWLA 3PJ8A 2IVTA 4OTQA 2WMTA 4J52A 5EDQA 1QCFA 5LQFA 2IN6A 2J0IA 3W2QA 4FIIA 3ZRLA 2OK1A 5C01A 4A06A 4FSYA 4KKGA 4UWBA 2QOFA 4GK3A 4BGHA 3AC8A 3FLWA 5EM8A 2XK4A 3D4QA 4HYSA 4RLKA 5HBEA 4G16A 5HNGA 2JIIA 1H28A 1OM1A 4LUDA 2G2FA 2UW4A 5E91A 4F6UA 1H1RA 5GIPE 3VNTA 3EQFA 5LCKA 2HOGA 2GNLA 4J98A 1WBWA 4Q5HA 4L45A 1YOJA 3NUAA 3LW0A 4J8MA 1YKRA 4DEAA 4XOYA 3BBTB 4F09A 4QP3A 5DBXA 3Q96A 4BTJA 2BVAA 2HZIA 3FY2A 2I0VA 4L44A 3B8RA 3NNVA 4J1RA 4ACGA 4ITHA 4D1SA 5M44A 3DNDA 3MGYA 1ZLTA 2C3JA 2W99B 1P14A 3O71A 4PF4A 2ZVAA 4AN3A 4FZFB 5CF8A 2UZWE 1FMKA 2W5BA 2WEIA 4LL0A 3ZOSA 3LOKA 1J1CA 2PE1A 4QEBA 4IQ6A 3DAEA 4OGRA 2XM9A 1FVRA 3LJ2A 5FP5A 3CTHA 2E9OA 4YJOA 1KOAA 2WOTA 4U8ZA 2O3PA 4IAFA 5BYZA 4GKHA 3V8TA 3ZLSA 2R4BA 4U80A 3CTQA 3UO4A 4AQCA 4FZ6A 5HIDA 4DH5A 5E8WA 4FSNA 4FIHA 1ND4A 2WTKC 1GZ8A 1VR2A 2X4FA 1G3NA 2QOQA 3UQFA 5IQBA 2EXEA 4FT3A 4FV9A 2FUMA 1IRKA 3TV4A 4FTQA 4GK4A 2R3JA 3LCSA 4QMYA 2X9EA 3DDPA 1M2PA 3FXXA 4DFLA 1YWRA 1DS5A 2Y4PA 3I7BA 4X6QC 3KEXA 3II5A 4JJRA 4IAIA 3NZ0A 2F2UA 2PUNA 2R2PA 4B8LA 3FMNA 2J0JA 1TFFA 2IEWA 4D9TA 1OGYA 4ZTHA 1M14A 5FBNC 2IWIA 3DZOA 2WEVA 1WBVA 2YZAA 5HLNA 3VONA 4IZ5A 3ZSGA 5JGDA 5EYDA 4MWIA 4PX6A 3BL9A 3I81A 4J97A 2OO8X 3CLYA 2QHMA 4B7TA 3N4UA 4Q9SA 2OJIA 4XH6A 5CVGA 1JQHA 1R0EA 2JDVA 2ERKA 4NUSA 2OU7A 2I0EA 4A9RA 2ZOQA 4NIFA 4Z3VA 3HMPA 3AC5A 2ZMDA 2OIBA 3V5TA 2JD5A 3NGAA 4ITJA 4RIWA 3OUKA 3A99A 4YZCA 5ETFA 4USEA 5L2SA 2OLCA 4KBKA 3AT4A 1REKA 3Q32A 5DWRA 2BIKB 3Q9ZA 2RIOA 4OBQA 4HGSA 4QMTA 1B6CB 4I3ZA 4ANQA 3HL7A 3TEIA 4GEOA 4O7NA 4D2TA 2WTWA 4RGJA 2G9XA 4IVCA 2W05A 2Y6OA 2Z7LA 3MPAA 3TUBA 4DF3A 2AC5A 4HPUE 5J8IA 3QTQA 3U51A 2W4OA 1HCKA 4YUQA 2PULA 3LQ8A 4FG9A 5TF9A 2XNNA 2GTNA 3GVUA 3QKMA 3C0HA 1CM8A 4E4XA 1CTPE 1KE8A 2NRUA 3QQGA 3MVJA 3NR9A 4MUQA 2DQ7X 2QKWB 4EZ5A 3W18A 2XAOA 2R7BA 3I4BA 3VS1A 3BU3A 4M13A 3V5PA 4I0RA 4TRLA 3AGMA 3EN5A 2OH0E 3R21A 3DFAA 3LM5A 2WOUA 3SDJA 1QMZA 2A1AB 3BLQA 2BUJA 4L01A 5HE1A 1MRYA 4GRBA 4JVGA 5EYKA 4ARKA 5GZAA 2QNJA 2W5AA 2WU7A 4AT4A 3H9OA 4BVUA 2GTMA 3D15A 5J1VA 1J91A 3KXZA 5DHJA 4BFMA 4LV8A 3AKJA 3NEWA 4E6AA 1GZOA 4PPCA 4PTGA 5AUXA 4PL5A 1RQQA 1UWHA 4O27B 1OL1A 3FMHA 3HDNA 3ANRA 1SVHA 2NYAA 2C5YA 5J7BA 1RDQE 4BCHA 5IQAA 3G0EA 5IUIA 4QP8A 4YR8A 5JKGA 3V5LA 3I5ZA 4O2ZA 2VWBA 4OTHA 2QR8A 4OT5A 4E6QA 2GHLA 2WMRA 1YDTE 4NT4A 5T68A 2XRWA 3SAYA 4I5HA 2XF0A 2XK7A 2XBJA 5KZ0A 3D83A 4FYOA 5EK7A 3PXKA 1YWNA 3FKNA 4O7WA 1CKJA 4MF1A 4ZTMA 3PLSA 4MXYA 5CT7A 4P5ZA 3CBLA 3PXRA 5TR6A 3VHKA 4ALVA 5JMSA 2G2IA 3E5AA 4PMPA 3PSBA 4FTOA 4G9CA 3EFWA 3G9NA 4EK3A 2VWVA 3U87A 2B1PA 5IEXA 4K6ZA 4RJ7A 2YJSA 1YXSA 2J0KA 3D5WA 4Y46A 1Q61A 2UVZA 4YLKA 4DEGA 1XH7A 1FINA 2IZUA 2NRYA 2VTOA 2R3KA 2HK5A 5CQWA 1WVYA 1Q41A 3ZYAA 4P2KA 2WMAA 3PPJA 3ZXTA 4CT2A 3QAME 1YWVA 1ZYCA 4IAZA 4YTCA 1ZY5A 4A9SA 1R78A 4BCKA 2GHMA 4S2ZA 3DAKA 4HPTE 3QQHA 1UNHA 3PVWA 4TWNA 4W4VA 2WB8A 4JNWA 1M17A 3N4VA 2VTAA 2BDFA 2HCKA 3C4EA 3ORNA 4KD1A 3W55A 5HE2A 5K3YA 4JBVA 3RBWA 4MF0A 4X6RA 3W32A 5F9EA 4Y85A 2CCHA 3E92A 3M2WA 3VBWA 3IW7A 3E8NA 4GS6A 3LCOA 3M1SA 3VIDA 3WF6A 3ORLA 1GIJA 2JDOA 4YJTA 4IDVA 4F0IA 3FPMA 3PE2A 1L3RE 3DKFA 3P1AA 3EQBA 4RPVA 4U7ZA 4U44A 4AE6A 1YDSE 5BVOA 5CI6A 2GS7A 3KULB 3OROA 5AR4A 3BLRA 5FTQA 3V5QA 4GMYA 2PMLX 3T8OA 2CGXA 2E9NA 4HYHA 4KIPA 3F66A 1S9IA 3G6HA 4XV9A 1YHWA 4D2SA 4TWPA 3V6SA 4DDGA 2ZB0A 4TW9A 5DA3A 5GNKA 3S3IA 2UVXA 5F20A 4JL9A 1SZMA 2ITXA 4FV8A 5L6PA 2E9UA 3ZSHA 2FSOX 4I24A 3P7CA 4EBWA 2A27A 2OICA 4U3YA 5HG5A 2XVDA 4D55A 4ZTQA 4ZZMA 2IF8A 4DA5A 3LCDA 2O65A 5BYLA 5LVNA 5DE2A 4GL9A 4CZTA 5L2IA 3GNIB 3MN3A 1R0PA 3QX4A 4XG8A 2BHHA 1BL6A 3IDBA 3CE3A 4OTWA 4S32A 3F2RA 1XJDA 2BAJA 2XALA 4DGMA 3UZPA 2C1AA 2ITYA 4FKUA 4EJNA 4IJPA 4QOXA 5HICA 4RIYA 1PXMA 4O7RA 1H8FA 3V5JA 3UIUA 3LMHA 1XKKA 4OTDA 2FO0A 2AQXA 3R71A 3RPVA 4WBBB 5AJQA 3F5GA 4ZSAA 2W4JA 2PVYA 5AUTA 5E8YA 4D0WA 1H08A 2X8EA 5DR9A 2I0HA 4AN9A 2QKRA 3VBTA 1CSNA 2GNFA 2PVJA 2QO9A 2WIPA 4KIOA 1GJOA 5K0XA 2X4ZA 3MS9A 4BBFA 1U5RA 4U97A 3ZH8A 2VU3A 3E62A 2NP8A 2F4JA 3NPCA 4YJPA 3DQWA 1ZMWA 5IA1A 3TKHA 4U40A 1F0QA 2OJGA 4S31A 3B2TA 3CIKA 4HVDA 2VWXA 3O5AA 4IJ9A 1O6KA 4FG7A 4FT9A 4BI1A 4ZTLA 4GVJA 1UU7A 4L3PA 4UN0C 4MCVA 4BTFA 4I6QA 1U5QA 4QDEA 5HOAA 1KV2A 4H3BA 4FV7A 2CPKE 4FNZA 4FTRA 5E1EA 1Q8WA 3QCXA 5CNNA 3SRVA 3UPXA 4F9CA 4DCAA 2WMWA 5H8EA 4XP3A 3T9TA 3ZZWA 5CAOA 1YVJA 1YXXA 3QFVA 4FYNA 4O38A 4AW0A 2BRNA 5HE3A 4C59A 2JKOA 2VX1A 4IVBA 2G01A 2VGOA 2V7OA 3TTJA 4E7WA 4DTBA 4GG7A 4ZTNA 3FE3A 1JVPP 4GU9A 5IUHA 2XAMA 2XARA 3KK9A 3QTIA 1J7UA 3I6UA 2VNWA 1ZAOA 4RWIA 4N70A 5DT4A 5C8KA 4L67A 3GCVA 1H1PA 4LMUA 4NCTC 3ORIA 2UZDA 4DEIA 3UODA 3MB6A 2J5EA 5DEYA 2V0DA 3FYKX 4CEGA 2KTYA 5K5XA 2WD1A 3HAVA 4UYNA 4L52A 4CRSA 4BI0A 5KKRC 4OT6A 3KRXA 3R9OA 3GCSA 3COHA 4ASDA 1YOLA 4DGOA 3BHYA 4N0SA 5JEBA 4N4SA 5M55A 4M8TA 3TZ8A 2FSTX 5CY3A 3SW7A 4KIKA 3FMDA 1O6LA 4L68A 4U41A 5EOBA 4Y83A 3ZUVA 4DFNA 2X0OA 3F2NA 3UNZA 3REPA 3BHUA 3FMLA 3P23A 4UB7A 4BYJA 1BKXA 4C33A 4EKLA 4WA9A 3VBQA 4BKYA 4BTMA 2WPAA 5CAPA 4E4NA 2ITPA 3F3WA 3Q53A 5F1ZA 5LMAA 1ZYJA 1OIQA 3R7YA 4O96A 3IGGA 5HBHA 5HORA 4Y95A 2QG7A 4N57A 3KVXA 5CZHA 1TQIA 3G90X 3UP7A 2I6LA 3MFRA 2FVDA 1KUTA 4XX9A 4O86A 1U54B 3CQWA 2VN9A 2IVUA 3IPHA 3OTUA 4YHJA 3H4JA 4LRMA 4ZJJA 3FZOA 3RVGA 5L8JA 5ANEA 3GQIA 3KQ7A 2Z02A 3MB7A 2JIUA 1OMWA 4FT0A 2LAVA 4G3FA 3OXTA 3GI3A 3HLLA 3VUMA 5C8NA 2ZV9A 2W0JA 3JY9A 4GV1A 4MX9A 1OZ1A 3TCPA 1OL7A 5AUWA 4BC6A 4RFMA 4M14A 3KU2A 4EH6A 4ACCA 3OCTA 4X2FA 1GOLA 2ZB1A 3WZUA 4FZDB 4ENYA 5I5ZA 3E64A 5CSWA 1MQBA 4Y8DA 4R5SA 5IQEA 1QPJA 1MRVA 3OBJA 3RK5A 2ZMCA 3QU0A 3FI3A 4XHKB 2B4SB 3OTVA 5AR7A 3SHEA 1R3CA 3ZO4A 2XYUA 3HKOA 3F5PA 4ZSLA 4AU8A 4BDAA 4L3LA 2WKMA 2J5FA 2GMXA 4FTKA 3LJ1A 3NNUA 1Z9XA 4MQ1A 4WNKA 5HCYA 3RPRA 3R9HA 4TL0A 4AGWA 5FWKK 4I0SA 2XUUA 3FBVA 4X2KA 4BCFA 4PUZA 3P08A 4YZMA 5FXQA 4Q2AA 2PUPA 3NFFB 5IPJA 4XG4A 4CLIA 2F7ZE 2YFXA 4O0WA 4PWNA 4D5KA 2H8HA 5J9YA 5CU4A 3MY5A 3EKKA 4J99A 5M57A 4RRVA 5KHWA 1V0BA 2YHVA 1KV1A 2VO3A 3SKCA 3ZU7A 5AR8A 2UZVA 1H00A 4PL4A 2CCIA 4PPAA 3F7ZA 4QMMA 4DC2A 3PY1A 3OCGA 3FKLA 1YRPA 2QOLA 2R3MA 1L8TA 3MESA 3NYVA 4BDIA 3ZHPC 2PZYA 4NFMA 3KCKA 3ZLYA 4H1MA 5E92A 2VUWA 3IW6A 4AE9A 3IDCA 5L2TA 3R9RA 5CF6A 4X3FA 1H24A 4EOSA 4P7EA 4H05A 4M66A 1G8SA 2Y0AA 4BWXA 4H3QA 3DFCB 1XBCA 4O6LA 3ML1A 2QO2A 4FKSA 5JFSA 5EM7A 1KSWA 1NVQA 4UMRA 4ZMEA 1FMOE 3GC7A 4EOQA 2ZDUA 5IDNA 4RA5A 3RZBA 4A07A 3QZGA 3UNKA 2WTCA 3UMXA 5FEEA 4NM3A 4FC0A 3UBDA 4AF3A 4QTAA 4F1OA 5IDPA 4FTLA 3UYTA 4FV3A 4TYJA 2PVFA 4JAJA 4ITIA 4PTEA 1MRUA 4DFXE 2Y8OA 2JAVA 5K4IA 1PF8A 3P0MA 4DFYA 3SVVA 3R1QA 3EN9A 2J90A 2VTNA 3BYVA 3I5NA 2OBJA 3GCQA 4Z9LA 1ZYLA 5FEQA 5EDPA 4WSYA 4F70A 3FC2A 5DN3A 2P4IA 3ROYA 4IM3A 4NSTA 1PMEA 2P2IA 3B8QA 3DGKA 3GU4A 4IC8A 4E26A 3K5VA 4QDVA 3PY0A 5CTPA 3WZEA 2ITOA 4WIHA 4G3GA 1XH9A 3UNJA 2J2IB 5EQPA 3QTXA 4PMMA 2WTKB 2H6DA 5I9VA 5JZNA 4CFFA 1CKIA 3D5XA 2O63A 4YPDA 4BZNA 4FKOA 5FDPA 3QF9A 3HA8A 4Q9ZA 3WZKA 1SM2A 4HZSA 3W0SA 4RJ6A 4FX3A 3DAJA 5BVDA 3LFEA 1OPLA 3QHRA 4FT5A 3RWQA 4WO5A 2QOOA 4K2RA 4O1OA 4A4XA 3I1AA 2IZTA 3ANQA 4LYNA 2QO7A 5J95A 3R22A 4R7BA 3DB6A 3A7JA 3LFDA 3A4OX 3CEKA 2RGPA 2B55A 3DBDA 2YA9A 3OT3A 4FUXA 4U81A 1J3HA 3E88A 3ET7A 4DCEA 3Q9WA 5ANJA 4QTBA 4CLJA 4GSBA 1PXPA 3PXZA 5EYCA 4A9UA 3BZ3A 2PYWA 4RJ8A 3FMJA 2VTTA 4JAIA 3QRKA 4AT5A 3RAIA 4EK4A 5IQDA 3TNIA 5I9XA 4FKQA 2WELA 2CJMA 5J5SA 2VWZA 2QOIA 3TIZA 2O5KA 4IWQA 4MBJA 4ZLZA 3TDWA 2BZKB 3TWJA 3H3CA 1QL6A 2XZSA 4YHFA 4AXFA 3KB7A 5AA9A 2HZ4A 4O0VA 1Q97A 4YLLA 4LG4A 4OAUC 4LRKA 4O1PA 4BWKA 5A4EA 4O7YA 4L8MA 4S34A 2XMYA 4CFVA 3BKBA 5E90A 4FGBA 3EIDA 5B2KA 4U3ZA 2J6MA 3R8ZA 4EH5A 4XP2A 4EH7A 3ZMMA 3CSVA 1GY3A 4G6LA 4M84A 4IAYA 4U79A 4WG5A 4CKIA 2GS2A 4XCUA 4HW7A 5JH6A 5KBQA 4UZHA 4IFCA 3QQKA 3E3BX 5HESA 1PW2A 1M7QA 4PDSA 4UV0A 2VTJA 2YM6A 4XOZA 3CY2A 4RBLA 3D2KA 3W1FA 4JBOA 3FLQA 4O7TA 3LCKA 3AKLA 2XNBA 3G2FA 3RKBA 5CAUA 2BIYA 4E4LA 3HP5A 3VS2A 1UVRA 2QCSA 4HGLA 3C4ZA 1Z57A 3GEQA 4FICA 1TQMA 4IFGA 5A4LA 2VAGA 3NYOA 2Z8CA 3V01A 4G31A 3V5WA 4E20A 2JEDA 3F3VA 5E8VA 4BBMA 3FAAA 1AGWA 2X6EA 3F2AA 4FG8A 4FZ7A 4G6NA 4GT3A 5EOLA 3FY0A 1OBDA 1DI9A 5EDRA 2WQBA 4N6YA 4BZOA 1XHAA 3QGWA 4NW5A 5LWMA 5AUVA 3F3ZA 1WBOA 3FZSA 2QU6A 2W1CA 1WVWA 4NFNA 1ATPE 2C30A 4J71A 4RQKA 3ZM4A 4AACA 5CSXA 2Q83A 3SXFA 3LZBA 3SOAA 4F7SA 4RX8A 2R64A 2W06A 1U4DA 2PUUA 3G6GA 3OOGA 4TTHB 4MEDA 4YNOA 4L7FA 4ANOA 4EC9A 1Q24A 2O64A 2WGJA 2WTVA 5ANDA 3W0OA 3R1NA 5ANKA 1URWA 2BDWA 4HZRA 4BCMA 2NO3A 3UG2A 5CENA 3HUBA 4R1VA 3VJOA 3D0EA 3OC1A 5FTOA 2X7FA 4P5QA 3UZTA 3NSZA 4GK2A 4ANMA 3QUPA 4YZNA 4YNEA 5L6OA 2AYPA 2QC6A 4CZUA 3TJCA 3NRMA 3O17A 3UE4A 4IWPA 3FXZA 4QMNA 4BDFA 5HG8A 2BRBA 2CNQA 1JPAA 3PG3A 3DPKA 4AA0A 3PG1A 4QPSA 4FEUA 3ALNA 4F78A 4FKRA 4XNEA 2X8DA 3FZ1A 3QUDA 3F6XA 3PUPA 4QMLA 4IVDA 1Y57A 3ORMA 4QPMA 3U8WA 4BDCA 1UNLA 2QOKA 3DXPA 2ZDTA 4BCOA 5BPYA 2OXYA 1PXLA 3QA0A 5ANOA 3HEGA 3IS5A 3EWHA 3VVHA 4QMWA 3SQQA 2XJ2A 3LFSA 3O96A 4P4CA 5GZ8A 5ITAA 3R04A 3LXPA 4NK9A 3OT8A 2I40A 4O7LA 3R9DA 3MIAA 4C61A 1GZKA 2YEXA 4Y73A 4NW6A 4C0TA 2XIKA 3F3UA 5EQEA 2ITUA 3GB2A 2C6LA 3FLYA 4FSMA 4D5HA 4FKLA 2VWWA 3TDVA 4JDJA 4IZYA 3DJ5A 4OTRA 3LQ3A 2QG5A 4APPA 4EZ3A 3VJNA 3C1XA 5GJDA 3TKUA 2R3LA 1G5SA 1WCCA 2C69A 2HZ0A 4LFIA 3RK7A 5GIOE 3CR0A 1IAJA 4DGGA 3BLAA 1J1BA 4AZVA 3OZ6A 1JKSA 4QTCA 2WTIA 2CHLA 3U9NA 2DYLA 3BEGA 3LAUA 3EN7A 4W9WA 4X2JA 3L8XA 2R3PA 1PMVA 3N9XA 3R8PA 3BHVA 4D58A 3SXSA 3PFQA 4FKGA 3RMFA 4G17A 3G33A 3BGQA 1BX6A 2OZOA 3RPOA 3ZDIA 4AFJA 5K5NA 4V0GA 2R5TA 2GDOA 3CXWA 5AP2A 1OITA 4MXZA 4C36A 2ITTA 5L2QA 2OZAA 1ZMUA 5IZFA 3TACA 2HAKA 4I0TA 4AXEA 1XH4A 3V6RA 2XIYA 1OGUA 3UDBA 4Z16A 5BMSA 5CEMA 4YC6A 5K9IA 2GFSA 4IB1A 4WT6A 5KKRB 3M11A 2A2AA 2QLUA 3NUSA 3G15A 4CTCA 4MAOA 5BVKA 1JSVA 2HY81 4FTIA 1ZOEA 3QXPA 3LKMA 2Y9QA 1W82A 4FIEA 5D10A 3DS6A 4CGAA 1H4LA 2ONLA 3R30A 2OJFE 3HECA 3PZEA 2W1FA 5IA2A 4DFUA 2ITQA 1CDKA 4CG8A 1ZZLA 2VO7A 2GQGA 2Y4IC 4BCQA 2A4LA 2WTDA 3ODZX 3PJ3A 5TT7A 1OL5A 5ICPA 5CI7A 3WE8A 4DTKA 1K2PA 3PSDA 4RIXB 3NVKI 5L8LA 4BDKA 3NIZA 5EKOA 2YABA 1Q99A 3FPQA 3OOMA 5AV1A 4PDOA 4ERKA 4DH3A 3ENMA 3TM0A 3D7TB 1MP8A 1TZDA 2HXLA 3KF4A 1OL6A 3EOCA 3OWJA 3EFJA 4EI4A 3MFUA 4KINA 5DOSA 5CEPA 3O8UA 4O0UA 4F7JA 4TWCA 2YIQA 3GUBA 2BZIB 3C4CA 4UWCA 3IGOA 4D4RA 3Q9XA 4RZVA 4TT7A 5LVOA 4B99A 3PJ2A 4U9AA 3PA4A 2CGUA 4MBLA 4ZMFA 1O9UA 1UA2A 4O4EA 3VAPA 3VW8A 2CMWA 2VTPA 5H3QA 4C8BA 3CTJA 4EOPA 2CNUA 5M06A 4DYMA 4FR4A 2UV2A 3TV7A 2PZIA 4L7SA 3AD6A 2A98A 5LMKA 3VULA 3NAXA 2NPQA 3O8PA 3ZO2A 3IQ7A 3DJ7A 1PXOA 4FKIA 3HA6A 5IG1A 3R7GA 3MTLA 3A61A 4FIGA 5EKNA 3HMMA 2IO6A 4F08A 4EOIA 2BRGA 2YCQA 3AKKA 3ATSA 2CLQA 3QRUA 4FKJA 3MTFA 5CSPA 3DV3A 1ZYSA 4L42A 4PV0A 4RG0A 4BIBA 1H0WA 2LGCA 4EORA 5HTCA 5KMLA 1VYWA 4EQUA 3A62A 4BGQA 3QYZA 2XYNA 2R7IA 3U55A 3RTPA 3PRIA 3DNEA 2XNEA 5AV4A 4K18A 2RKUA 3ORTA 1BL7A 3QTZA 5D7VA 3DU8A 1Q62A 4IB0A 3SX9A 3PVBA 3TZ9A 1B39A 3FUPA 1G8KA 4MNFA 1APME 5FGKA 1X8BA 3L9LA 4F7LA 2ZJWA 2HW7A 3T3VA 4CMUA 5IQCA 4MH7A 4RWJA 3PPKA 4HVSA 5AIKA 4CYIA 4MVFA 4TPTA 4M0ZA 3BI6A 5L6WL 2PE2A 2IW9A 4KUJA 4QP6A 2VTHA 3VC4A 4ANBA 4ZJVA 4I5MA 3NAYA 2WQEA 4FIJA 3DLSA 4G5JA 2XKCA 4RVTA 2FGIA 4D2WA 2JIVA 3OVVA 1WVXA 4IBMA 4NM5A 3RK9A 3TMOA 2YIXA 3QQJA 2CDZA 3ITZA 3KXXA 4BDJA 2BKKA 3O23A 5HNBA 1URCA 3ORKA 4GFMA 4ASEA 2ETRA 4BCJA 4RIOA 4QMVA 4QP1A 3C4FA 3VRZA 4PRJA 1G8JA 3WIKA 4L3JA 3ODYX 2W9FB 5HG7A 5DYJA 2VTLA 4GKIA 3DK6A 3W8QA 1Y8YA 2XIXA 1PMUA 3JYAA 2FA2A 3FQSA 2BCJA 5JRQA 5JFXA 3PVGA 5KMNA 3EQRA 4YZDA 2WXVA 2CKQA 4AA5A 1E1XA 2J0MB 2BDJA 5J5TA 5M07A 1YDRE 4O4DA 2XNMA 5AEPA 2YISA 3I0OA 4D1ZA 1UWJA 4O22A 1T46A 5JFWA 3R2YA 3FWQA 3ORXA 5CF5A 3WF7A 4X0MA 3ZRMA 3PY3A 2UZEA 1Q3DA 2IZSA 4FJVA 4RQVA 4DDIA 3L9MA 2YITA 5L8KA 3QX2A 1FQ1B 2HWOA 5HO8A 2Z7RA 2C6KA 2JKQA 3CJFA 2E9VA 3EQPA 4O21A 5A4QA 4E5AX 2OF4A 3K3IA 4YO6A 4LDTA 4RJ5A 1UNGA 3KRWA 5D12A 3V51A 4ZS4A 1Y6BA 3C5UA 3D5VA 4BIEA 5IQHA 2XNPA 5CLPA 1STCE 3CS9A 3WBLA 1H0VA 2C3KA 3MI9A 3Q4ZA 1ZOHA 3DK3A 3W16A 5BVNA 1BMKA 4UEUA 3PDTA 3KN5A 4RVLA 3DLZA 4L9IA 3ZUTA 4I6HA 1WBPA 5KO1A 4FKVA 5AUZA 3ZBFA 5AUUA 4GYGA 1BYGA 3TNWA 4CV9A 3AC2A 1Q8UA 2RFNA 4IM0A 4IM2A 4MXAA 2HXQA 2GS6A 3GC8A 4PPBA 4QYHA 3LVPA 2ZYBA 2EWAA 4FV0A 2W7XA 4BCIA 4AZSA 2J0LA 3EYHA 4G3CA 2Q0BA 3W33A 5JRSA 3DCVA 3FXWA 2BKZA 3L9PA 3KKVA 2XRUA 4QMXA 5ETCA 4ENXA 2QHNA 4GJ2A 3FV8A 4IANA 2VNYA 4X3FC 3W2SA 1MQ4A 2HIWA 2W1HA 4PMTA 2OGVA 2ITWA 2IJMA 4TKSA 4AAYA 2BTRA 3UQCA 5J7HA 4U45A 4IHPA 2J9MA 4CTBA 4A4LA 5CAVA 2VTMA 4MQ2A 3UTOA 3U6IA 4PMSA 5EI2A 3EQGA 3VW6A 4RFYA 5IEYA 3WZJA 2PVKA 2B9HA 4M69A 3HMIA 3SOCA 5AADA 3VS4A 4WNMA 3ZZEA 2X8IA 4JIKA 1SNUA 4RWLA 1NXKA 1H1QA 4IWDA 1JKLA 4A4OA 4DFBA 1PY5A 4NKSA 1PYEA 4C37A 4R5YA 3ZRKA 4W9XA 3UIXA 4E6DA 5E8XA 4Q5EA 4UMQA 4O7ZA 4E93A 4F9BA 4BCGA 2P0CA 3JVRA 4GIHA 4APCA 3LHJA 4HOKA 4BDGA 3OF0A 2X39A 4EOOA 3D9VA 4F65A 4A9TA 2X7GA 4UMPA 4R3RA 1R39A 1ZARA 2G15A 1PYXA 2WQNA 3ELJA 3LXKA 4KIQA 3MJ1A 3UMWA 2Z2WA 3MFTA 4C4IA 2V55A 4CFWA 4O0RA 4TYHB