4XG4A

Crystal structure of an inhibitor-bound syk
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
264
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 264
sequence length 273
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xg4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xg4A01
4O0XA 2X8EA 3ORPA 4C4GA 4NL0A 3TXOA 5EYDA 2GNIA 2O63A 4C02A 3KVWA 4TN6A 1BUHA 2OSCA 5EM7A 4GIIA 3R8UA 4KD1A 2UV2A 2R3OA 2W96B 4YTCA 1W98A 2XB7A 3VS4A 4D2SA 2OWBA 4ZK5A 3DXPA 1JPAA 5AIKA 3IGOA 4YJTA 4F6SA 3EIDA 3ZO3A 1YI6A 3CEKA 4EQUA 5IA2A 5GJGA 4DH7A 3W16A 3ZO4A 4QNYA 2G01A 4XNEA 4KRDA 4RIOA 4DF3A 4AA4A 4JAIA 3QLGA 4E73A 2HZIA 4C0TA 2V0DA 2J5EA 3PXQA 3OMVA 3VS0A 2XH5A 3D14A 4FX3A 3OOMA 3EFJA 5DYJA 4C3FA 2OU7A 5CVHA 4ZSJA 2YM3A 4C62A 3KA0A 4FZDB 5AJQA 4G1WA 4YZNA 3UTOA 4EC8A 2FA2A 2C1BA 3QZFA 4C33A 5BVFA 1DAYA 2GNLA 4YSMA 2XM8A 4RWJA 4J8NA 2X1NA 5DMZA 4FEXA 5IQBA 4RT7A 3COKA 4JDHA 1OUKA 3FMEA 3GU6A 4F6UA 2WMRA 2XA4A 2I6LA 3IG7A 3AGMA 4DINA 3E8CA 3LCKA 4M8TA 1T45A 3KL8A 4D58A 5CAVA 2XM9A 3RMFA 3UIXA 4DTAA 4QP8A 5ANDA 3AMYA 3QQLA 5FQDC 3LHJA 4GVJA 5ANOA 3LFQA 4RX7A 5A14A 5JSMA 2XF0A 2J50A 2OXXA 2UW6A 2ZM4A 5DT4A 2OFVA 4BDBA 4TYJA 1YHWA 3GU5A 4FA2A 3D5UA 3EN9A 4C2WA 4ZIMA 1WMKA 4FTAA 4H3BA 3U4WA 5IISA 2VWZA 2WMVA 5CQUA 2C5OA 4ZY5A 2VTSA 3SW7A 2C0TA 3GC9A 4O7WA 2OW3A 4DFZE 4BGQA 1Y8YA 4MQ1A 4YLLA 5DWRA 5IMEA 3SG8A 2HY81 5LMBA 3C5IA 4TTHB 3W2PA 3I7BA 2VTIA 4KBCA 4D1ZA 5M57A 5HX8A 4QTDA 5F95A 4MBLA 4N6ZA 4O22A 2PZPA 3G6GA 3ORLA 3OUNB 5EW8A 5AR2A 4FV9A 4YZBA 2UZWE 4JNWA 4RQVA 3VIDA 1FQ1B 4DH3A 4PMPA 1ZOEA 3NYXA 2BILB 4TPTA 3RJCA 4GU9A 2GMXA 2J0JA 3F66A 4U43A 4FIGA 4E4LA 5FG8A 3WF8A 1MP8A 4IACA 2OH4A 2GS6A 3KF7A 4KNBA 2VX3A 3AD5A 5AP7A 4C38A 4GIHA 4K0YA 4CQGA 3U87A 3RWPA 2I0YA 3BQCA 4EH7A 5LVOA 2CDZA 4QMWA 2W4OA 4ACMA 4MXZA 4LFIA 4AFJA 2XBAA 1NA7A 3LFEA 2WOUA 3CQEA 5GIPE 4ERWA 2V22A 5FGKA 3CGOA 3S1HA 5J8IA 3TTIA 3C7QA 1PMUA 4EHEA 2CN5A 5ANKA 5EHOA 3SAYA 5KMJA 4B6LA 2DQ7X 4AT4A 3G0EA 5CU4A 4QP1A 4FZFB 4BTMA 2X6EA 1OL6A 3LE6A 3MWUA 1XKKA 4IZYA 2P4IA 3FMLA 3R1YA 3NYVA 4FKSA 4GRBA 5EI6A 5C8MA 2BRBA 4R7IA 5EW3A 2C6DA 3KXNA 3OF0A 3R8ZA 4U0IA 2C3JA 3NCZA 3OCBA 2EXMA 3GGFA 5AM7A 3UQGA 5B2LA 2PU8A 2R4BA 4M0ZA 3HEGA 2WU6A 3FQEA 2A27A 4S32A 4QMNA 3E93A 3B2WA 3RK9A 4O7RA 4L3LA 1R3CA 3PE2A 4JX3A 3TG1A 3BLQA 1V0BA 2CN8A 2FUMA 2ITYA 1WBPA 2W1FA 1OBDA 4EK3A 2F2UA 5BUIA 3QD2B 5E7RA 5CU6A 4E6CA 1LEZA 4BCIA 4K2RA 4L8MA 3R7EA 4FEVA 3DKOA 3PFQA 5F4NA 4BIBA 5EQEA 2UZNA 4WBOA 5LWMA 2IJMA 3MIAA 3GVUA 4GL9A 3G90X 4FG8A 2R7IA 3LFNA 2IW9A 5JGDA 3DCVA 2IG7A 2ZOQA 3EQPA 4D2WA 3R1NA 4QRCA 5EFQA 2RFEA 4TRLA 3GQLA 2JKMA 4K8AA 2C0IA 2JAMA 4APCA 4DA5A 4GS6A 4ALUA 3OFMA 4GT3A 4J71A 3Q4CA 2BHHA 4PL4A 3QD3A 4CKRA 3QRIA 5CXHA 1PXIA 4BCGA 3FYJX 1UNLA 3FYKX 3QC9A 4O82A 4GJ2A 5C26A 3E88A 2E2BA 4LL0A 4RIXB 3E63A 3V5TA 3TIYA 3BX5A 2NRUA 2R7BA 4R77A 4DTBA 3FE3A 4XOZA 4CD0A 4GG5A 5LVMA 4WG5A 2IVTA 2XK4A 3F69A 4RX5A 4YTFA 3PIZA 4CFWA 3ZRKA 1S9JA 4KIPA 3U9NA 4ANMA 4IAIA 4FKPA 2V62A 1H1RA 3NSZA 3ORIA 4IC8A 1MRVA 1PXOA 4TZRA 3CCNA 5T6KA 3MA6A 4J95A 1DAWA 4KSPA 4B9DA 4USEA 3O8TA 2CKQA 1H07A 1XH9A 2I0EA 3FZ1A 5I0BA 2W7XA 4JRNA 2WMXA 4V01A 5IZFA 3HRFA 5M07A 2PUIA 1AGWA 4EJNA 2CSNA 3IPHA 4F1OA 4YJNA 3T3UA 1Q4LA 2QD9A 5F20A 3VW6A 4CEGA 4I4FA 4HZRA 3SLSA 4E8AA 3H0ZA 4RIYA 5DT0A 2XIYA 5DN3A 4JR7A 5CEKA 3KRJA 3NIEA 3R7GA 3Q60A 1ZMVA 4QYGA 4NFMA 4YPDA 4LL5A 5AR3A 3V5QA 2OZAB 4I23A 3WZUA 4EUUA 4EHZA 3PJ3A 3H30A 1YOJA 4YJOA 3D5VA 2JDTA 5KHXA 1JSVA 5AM6A 4FKWA 4WOVA 5CASA 1B39A 4XS2A 4WNOA 3SRVA 3M2WA 4CLJA 4ERKA 2VO7A 2WNTA 3WILA 2C1AA 3V3VA 4EZ3A 2BAKA 3R1QA 5J5TA 5JFSA 3BHUA 4FTQA 4R7HA 3EKKA 4C35A 4OLIA 2P33A 4MNEA 1JKLA 3FEGA 2XVDA 4QQTA 5J1WA 3QQUA 1V0PA 3MS9A 3OCSA 2WTCA 4WG4A 2R3LA 3EN5A 3VWAA 2YZLA 3GFWA 3NGAA 3VW8A 2BKZA 5JRSA 1X8BA 5EQYA 2PUNA 4ITJA 4E5WA 3DNDA 1OVEA 2W5AA 3NNXA 4GT4A 4WNPA 4E4MA 2RIOA 4FNWA 4F65A 4IVDA 5FP6A 3TWJA 2XNEA 3F5XA 2YDKA 5JH6A 5D41A 2PZIA 2W5BA 4Y83A 3V5LA 3RVGA 2UZDA 2VWWA 4CTCA 4IZ7A 2GQSA 2IW6A 3GOKA 5J7BA 4LV5A 3PVWA 3ET7A 5DG5A 4D5KA 4DGNA 4ZTHA 2P3GX 2RG5A 3D94A 4RFMA 4CCUA 3BI6A 4NH1A 4ANLA 3HUBA 2PE1A 2X39A 5AIRA 4NM0A 2QO2A 4MXAA 3QQKA 4C3RA 5IA3A 1OZ1A 4X0MA 2G1TA 2Y0AA 2O5KA 5KHWA 2H9VA 5D7VA 3PY0A 3VUIA 1YXSA 5M51A 3KN6A 5K5XA 4QT1A 3LCDA 3NCGA 3CTHA 4FSYA 4G6NA 5E8SA 5H8EA 3TKUA 4WKQA 1MRUA 4F1TA 4LGGA 3LMHA 3BHTA 4A9SA 3NYNA 2CLXA 4HGEA 4EK8A 4L6QA 4AFEA 3EQHA 5G1XA 1OIUA 3EZRA 2J9MA 5M08A 3T9TA 2GNGA 4LM5A 1Q99A 3BWJA 4GT5A 3QTRA 1FPUA 3PJ2A 3KXGA 4Q2AA 4FKIA 5E1SA 3OWPA 4UZHA 3ZDIA 4CVAA 1J91A 2GQRA 4UEUA 3FLSA 2WQOA 4M68A 3HRBA 4GEOA 3FBVA 3TIZA 2SRCA 4AQCA 5IEXA 3PVUA 3HDNA 2YISA 3MSSA 3DS6A 2R3IA 3WF5A 4P5QA 3FLZA 4PDOA 4FTOA 4NUSA 3A7GA 1XH4A 2BROA 3PXKA 2YM8A 4W9WA 3G15A 3FV8A 3ALOA 2VWIA 2WQNA 3OEFX 4OBOA 3UO4A 4U6RA 3DTCA 4JQ7A 2WMSA 3RBWA 4R3PA 5AV2A 3I60A 4KRCA 1WBOA 3AG9A 2X81A 4E7WA 4CSVA 3ORZA 1IEPA 4C4JA 4UWYA 5HBEA 4FSUA 2J6MA 4EH8A 5J5SA 3NUAA 4EWQA 2OJIA 5C01A 1JSUA 2H6DA 4YZDA 5HCYA 2QKWB 4LMNA 5KX8A 3VS5A 5M56A 4QO9A 1Y91A 3I6WA 3COMA 5HNIX 3S95A 3QXOA 1WAKA 4Z16A 2VWXA 3GEQA 5H2UA 1WFCA 3LQ5A 4F7SA 3P4KA 3UIBA 2ZB0A 4XH6A 4E5BA 5HBJA 4M13A 4OW8A 4KIOA 2J5FA 3JUHA 4RA4A 5HE2A 1YXXA 3OCGA 4Q5HA 1VYWA 4XV3A 4BZOA 3FDNA 1REKA 2RFNA 5KMMA 3D2IA 3DJ7A 3UMXA 1M2PA 4QP3A 2E9UA 4GK2A 4OTHA 3UOKA 4AN2A 4PRJA 4QPMA 2ETRA 3FAAA 3OWLA 4KIKB 4MD9E 4O27B 3V5PA 5CAUA 4XBUA 4C4EA 2CJMA 2XJ0A 3GQIA 4NSTA 2CPKE 3LQ3A 3D5XA 4LQMA 2X2LA 3L8VA 4ZJJA 3U51A 4JVGA 3PIXA 2ETMA 4YPSA 3PLAE 4FSNA 3C4EA 3COHA 5L2IA 3VC4A 1DS5A 3OXZA 4L44A 4AE9A 3DT1A 2J0LA 3PG3A 3QHRA 3PUPA 4D28A 1ZYSA 3V8TA 3W2OA 4I5HA 4FK6A 2ITXA 3R7IA 4CCBA 4F0GA 4BCNA 4Y95A 5LCJA 1L8TA 2UZUE 3BKBA 3RAKA 2YZAA 3ROYA 5DE2A 4GFOA 5D10A 3I5ZA 3A7IA 3EWHA 3KK9A 3PA4A 4I0TA 2PUPA 4QNAA 3QUDA 4XUFA 1NVQA 5EKNA 4UMQA 3LJ1A 3RKBA 2GPHA 3HMOA 2UW0A 3MH0A 3QQJA 4LGDA 3QWKA 5ETCA 5AUZA 5CTPA 3TZ7A 5EYCA 3QBNA 4DFXE 1J7LA 3O71A 3IKAA 1PMNA 2F4JA 3DKCA 2JIUA 3Q5IA 3ENHA 4FZ6A 4ANQA 3HA8A 3GCUA 1YXTA 3G51A 2BRNA 3G33A 3NUNA 4DLJA 2UZTA 4YR8A 5GJDA 4QTBA 3LKMA 3MY1A 2CCIA 3FJQE 3ZH8A 3NW6A 4TNBA 1URCA 4ASEA 2A19B 4LYNA 4WNKA 5AX3A 4GH2A 5I9UA 1SMHA 1OPLA 2O2UA 2JITA 2YCFA 2QLUA 2GFSA 4P5ZA 3EYHA 2WMQA 3KU2A 4XG3A 4RZWA 3B8RA 3D5WA 1SVEA 2IO6A 2QKRA 1OKYA 3UIMA 3SA0A 5CF4A 2UW8A 2JKOA 5M55A 3IO7A 2PVFA 1RJBA 2WD1A 4GKIA 2CGUA 2EUFB 4LGHA 5FXSA 5AP1A 4DGLC 4IB1A 5FLFA 3DY7A 3EQDA 4QMXA 3RZBA 2BIYA 3ZXZA 2ZYBA 3QQGA 5A4EA 5BYLA 4RIWB 1PXNA 1YDTE 1UKIA 2XUUA 4ZSAA 3EJ1A 2R3FA 3F5UA 3FI4A 3HV7A 4AU8A 3ID6C 3VF9A 1KE6A 1H00A 4QD6A 3FPQA 4AWIA 5CU3A 3WBLA 4Y72A 3LFBA 5JZNA 4QMMA 4PL3A 1Z5MA 4CT1A 3BEGA 1FMOE 4QMYA 2J0MB 1PY5A 4XV9A 4U42A 3RNIA 5EM5A 2PVHA 4R5SA 3SW4A 5L8LA 3UNKA 1OITA 4PNIA 4CLIA 4CMOA 5HTCA 5A54A 3HNGA 2ITTA 3L8PA 3CKWA 3F9NA 2REIA 5HVJA 5CSPA 5EDRA 3H9OA 4XG6A 2JDSA 2KTYA 1XH5A 4ZTRA 4GKHA 5CANA 3CQUA 2JBPA 3OW3A 2JKQA 4EEVA 4A4XA 4IX4A 1ND4A 4BGGA 3KRXA 5IQEA 4AX8A 2C47A 3L9NA 5EDPA 4IFGA 3ZC6A 4DEAA 2B7AA 3MB7A 4XEYA 1OKWA 1GNGA 4I22A 1UU8A 3PA3A 4RVLA 2IW8A 3RPOA 3G0FA 3ZO2A 3LMIA 4CFXA 4QP9A 4PP9A 2WEIA 4YTHA 4RX9A 4N70A 5D12A 1NY3A 3MH3A 4PTEA 2WOTA 4UY9A 4BL1A 3FKOA 4AN9A 3GB2A 5D7AA 1YRPA 3MI9A 3EQRA 3TNHA 3P7BA 3KK8A 3VUKA 4I5MA 2RKUA 4CKIA 4ORKA 5HG5A 3RP9A 4FT5A 4G9RA 4AXAA 1Q8TA 1OUYA 4HVDA 2J2IB 2ZV7A 3PZEA 5LVPA 4EOMA 2R3NA 3A4PA 3FMJA 4XG4A 5HO8A 5CEPA 3CC6A 2Q83A 5CF6A 4AA5A 2FSTX 1U4DA 3FZTA 4S33A 2Q0BA 4XV1A 3UP7A 4D2VA 5AR5A 3PXZA 3CGFA 1H1PA 5AP0A 3VS6A 2YEXA 4IAZA 4TYHA 5H3QA 1IR3A 3MFRA 1JKTA 1R0PA 2OGVA 1W7HA 4JDJA 4XYFA 5JQ5A 1DI9A 5ITAA 4EL9A 3C4ZA 3OP5A 1Z9XA 3TNPC 3QRTA 1TVOA 3RCDA 5CAQA 4O1PA 3VUDA 3PSDA 4BFMA 3RHKA 3D7ZA 5L2TA 3U54A 4RVTA 5EK7A 2BTSA 3OY1A 4FIJA 2UVZA 2OKRA 5HG8A 2XEZA 3O7LD 2XKFA 2GCDA 3HLLA 4O6LA 3V6SA 4TL0A 2OLCA 4PTCA 3NUYA 1A48A 5IQFA 5EKOA 1OM1A 3CKXA 4O96A 3DZOA 3Q53A 3UNJA 5M4FA 1HCKA 1QPDA 1PKDA 5LOHA 3FY2A 3UVRA 3N4UA 1ZY4A 1YDRE 3LJ0A 3CXWA 4I6FA 1OIYA 3OC1A 3ZM9A 3NNVA 4JXFA 5JQ8A 3DXNA 3ZSGA 2CLQA 4QTCA 5DPVA 4ANSA 2VWYA 3CY2A 5A46A 3D7TA 4KKHA 4I6BA 4D4VA 2CNUA 3BEAA 5FD2A 4O0TA 4A7CA 3R9OA 2LGCA 4FZ7A 4YTIA 3LW0A 1WCCA 1XWSA 2QURA 5I3RA 4BDEA 2CNVA 1YI3A 3CSVA 4KINA 2VWVA 3ZLYA 2BAQA 4QMZA 3ZUUA 2EXCX 2PY3A 3FLYA 3LXPA 1CKIA 3NDMA 4JIKA 3QD4A 5BVWA 4FTIA 4E4XA 4ITHA 4YP8A 4ALVA 4DEDA 5I5ZA 2C3KA 5BX0A 2XK9A 2OI4X 3BPRA 3O23A 4DCAA 3AC5A 3W8LA 3UG1A 1H1QA 4MQ2A 4X2KA 5IH5A 2XRWA 1PMEA 3TM0A 1W8CA 4XX9A 5HU3A 1J7UA 2IZRA 4JR3A 1RW8A 4IADA 5LCKA 1K9AA 1XR1A 3OW4A 3AXWA 4DCEA 3Q5ZA 4IZ5A 5AADA 3ORXA 3UODA 4KB8A 2UW7A 3M11A 4LG4A 2C5NA 4AW1A 4BDKA 5G6VA 4EOQA 1Q8ZA 3TNIA 1L3RE 5EI2A 4BTJA 4O2ZA 3L9LA 2HK5A 2ZDTA 3EL8A 3MY0A 2JKKA 2WQMA 3F82A 3TNWA 5HZNA 2AC3A 4WG3A 4U79A 1GZNA 5M44A 3FLNC 3VBYA 3QD0A 4RX8A 4I1ZA 2P55A 3K3IA 2YM6A 4BCFA 2JAVA 4OT5A 2G2HA 5HD4A 2BDFA 3R9HA 4RJ3A 5CVFA 5HIBA 1W83A 3RPRA 1PJKA 1CDKA 3R8MA 4JG7A 3A7FA 2FSOX 2XCKA 5DBXA 2WU7A 5F9EA 4BIDA 3UBDA 1Q5KA 2F7ZE 4GK4A 4YLKA 1Q24A 1JKSA 5LVNA 3TTJA 5EQPA 3QTSA 2WFYA 3SD0A 3F2AA 4O7NA 3V8WA 2ERKA 4UMUA 1NXKA 1U46A 2W1EA 3RAIA 3H9FA 5JEBA 3SG9A 3DPKA 2XNNA 3KXMA 4KBAA 4PMMA 5D11A 3WE4A 5L2WA 4M12A 2OF4A 5CAPA 1XQZA 2E9VA 1O6KA 3MVHA 2Y4IC 3KREA 2GDOA 4DEIA 3GOPA 2BR1A 2HZNA 4JT3A 4NZWB 5ANEA 3PXRA 2Y9QA 4I41A 4MF0A 4XHKB 4EC9A 2ITZA 3ZSIA 4G34A 5GZAA 4FL2A 4O7VA 5GIOE 4PF4A 2X2KA 2W1CA 4U8ZA 4AS0A 2VTTA 4U3YA 2XK3A 4B4LA 1WVXA 2VD5A 5C1QB 1HOWA 3QCYA 4CG9A 3Q4TA 1WBTA 4D1XA 4BC6A 3NUUA 3QALE 3DAJA 3BGQA 2W1ZA 3PJCA 4GFMA 3QCSA 2GS7A 4HGTA 4MTAA 3IW5A 4XP0A 5HVYA 4ZS4A 3ZBXA 2YAAA 2BTRA 3ZRLA 3BBWA 5KZ0A 3DXQA 4O0UA 2R5TA 3D83A 3F5GA 2ACXA 3PJ8A 4R78A 4FTUA 3ANRA 1XBAA 1MQ4A 2OJJA 2PVRA 1PF8A 5ICPA 4HZSA 3IW7A 3LM5A 3QTWA 1URWA 5KMOA 3DFAA 1BLXA 4FIHA 5EW9A 1H01A 4J98A 4PX6A 2HW6A 3EL7A 2G2IA 3H9RA 5CSXA 4G16A 4E6QA 4FIIA 5A6OA 3HECA 2C5XA 1JQHA 2QU6A 4CRLA 2H34A 3DNEA 3MPAA 4LV8A 3BV3A 3ENMA 4NIFB 3RTPA 3V8SA 4ACCA 5JMSA 4M69B 1FVVA 2YFXA 5L6WL 4IDTA 3W33A 4MF1A 4ZOGA 1EH4A 3Q4UA 4ZZNA 1KUTA 2PUUA 3C4CA 2BVAA 4Y73A 3QKLA 3W32A 4FSQA 4FTNA 4F63A 4FODA 1VR2A 2UVXA 1GZ8A 4PPBA 5C8NA 2QOQA 4NKSA 5JZJA 1VJYA 3AT4A 3QGYA 4IM0A 2XNOA 3P78A 3EOCA 4XP3A 4K11A 4S31A 3ALNA 2GHGA 2QQ7A 3QL8A 4L46A 5TKDA 4UMRA 1YW2A 3VUHA 3BU5A 4CV9A 3DLZA 3REPA 1SM2A 2X7FA 5B2KA 5BUEA 2XMYA 2CHLA 1ZYDA 5AP6A 3QYWA 1O6YA 3PVGA 3NVMB 2PE0A 3ZU7A 5JFVA 4UWCA 3GCPA 3U6IA 3VS1A 3R8LA 5I9VA 5FDXA 4TT7A 3MGYA 4ZZOA 1JWHA 3BE9A 3D15A 3KFAA 5E8XA 4ZY4A 5M53A 5HCXA 4M3QA 2QHMA 5AAGA 3EN7A 4Y5QA 4RFYA 3TT0A 3DK7A 2VTOA 3FXWA 4NM3A 4NM5A 3VS3A 3OWJA 4GVAA 4PPCA 4XJ0A 3HV3A 3IW6A 4QYFA 3IQ7A 2C68A 4K18A 4MXYA 4QTAA 1UVRA 1CSNA 2PL0A 4O7YA 5I9YA 5EOLA 4P7EA 3RNYA 3RI1A 4GJ3A 3P86A 4EHGA 3PDTA 5HICA 3QU0A 3ULZA 1UNGA 4AAAA 2YWVA 4D4SA 1QCFA 3MBLA 4OAUC 1Q97A 4FT9A 4I3ZA 4YJQA 3VJOA 2R3HA 4PWNA 1IG1A 3L9MA 3ZS5A 1G8SA 4PTGA 4C3PA 2WZJA 4EH3A 5CWZA 4ENXA 4U97A 2BIKB 1UWHA 1E1VA 4IJPA 3N4TA 3PYYA 5GJFA 1CKPA 2IWIA 2JDRA 4TW9A 3VVHA 4H1JA 3BRBA 2Y6MA 4NCTA 5KUPA 2Z02A 4R1VA 2YCSA 4DGGA 2VGPA 4FKJA 3P7CA 1OI9A 2I0HA 3BYMA 3DJ6A 3MYGA 2O64A 4G6OA 4L9IA 3ZO1A 4AT3A 4BDJA 2OK1A 4BDFA 5CSWA 5CU2A 1WBVA 1IAHA 4G3FA 4MD8E 5HO6A 4ZMFA 4G9CA 1UKHA 4EQMA 2W1GA 4IH8A 2W99B 1YOMA 4QPAA 3G6HA 4FF8A 3Q2JA 5GHVA 5AUTA 2R3GA 4EH5A 2CNQA 2OF2A 4ZLOA 2RL5A 2ZAZA 3OWKA 4I21A 3NYOA 5KNJA 3RPVA 2VRXA 4MHAA 4M14A 1IA8A 3A4OX 1F5QA 3FWQA 3QQHA 2GSFA 2AC5A 4YC8A 2ITPA 3D9VA 4FI1A 4PY1A 5AEPA 4IHPA 2WTIA 5HG7A 5EI8A 4AT5A 4M84A 5KMKA 5HVKA 1REJA 5AUXA 2UW4A 4USDA 2BZKB 4TYEA 4LOOA 3VBQA 3FQSA 4M15A 1OL7A 3R9NA 4AUAA 3KY2A 5DI1A 1Q8UA 4JBVA 1GIIA 4RWLA 3F2NA 4JS8A 3NNUA 4FNXA 3TV4A 5LXMA 4H3PA 5J9ZA 5K4IA 4O83A 3QC4A 4CRSA 2IZUA 1Y57A 3FSKA 1WBWA 4UB7A 2YA9A 2VO6A 3W2SA 3CD8A 3LVPA 1H24A 3MVMA 2QG7A 5HLNA 2QODA 1KV1A 5AFVA 2GNFA 5AP5A 2DS1A 1R78A 5ACKA 3WIGA 2B54A 4AACA 5IA1A 3P08A 3K2LA 5IQCA 3BZ3A 2W05A 4BR3A 2HELA 2PE2A 4FV1A 1BMKA 1J7IA 2J0KA 5E8UA 3AT3A 4RGJA 5ANJA 2W5HA 5LVLA 4WIHA 3KMMA 4M0YA 1M14A 4IFCA 4F9AA 3ULIA 4W4VA 4BVUA 4Z7GA 3JR1A 1IA9A 3MPTA 4IAFA 4RIXA 3PWDA 4BI0A 4ANBA 3EN4A 1H26A 3POZA 2DYLA 4XMOA 4EZ7A 4G6LA 2BZHB 2XNMA 4J99A 1CMKE 5M4IA 4CZYB 3I7CA 1FMKA 3MW1A 5E1EA 4PUZA 3IW4A 4YZCA 2G15A 5E8TA 4IB5A 4EOPA 5IU2A 5HO7A 3QZHA 3WF9A 1XH8A 2WQBA 3QRUA 3DK3A 1NVRA 2QHNA 2W9ZB 2X6DA 1YWNA 4UBAA 4X3FB 2PYWA 5IKWA 5AP2A 3FKLA 3QRKA 5FWKK 5TT7A 2XK7A 4HCTA 4QMUA 3ZLWA 4DGOA 2OZOA 4ACHA 5EH0A 3RALA 5M09A 5JN2A 4DN5A 3LPBA 4PNKA 1YWVA 2C30A 5JGAA 2QOIA 2XIZA 3MN3A 3R04A 4ZTSA 5FP5A 3QTUA 4J1RA 5A3XA 1G8AA 4L67A 1RDQE 3E5AA 3ZOSA 3EZVA 4FV5A 2R64A 3Q9YA 4B8MA 4FG7A 3DKGA 4CKJA 4NTTA 3DU8A 2X9FA 3IDPA 4HPUE 3RK5A 3R9DA 4DG2E 1ZMUA 4RFZA 2OFUA 2WQEA 3LFSA 4FVPA 4C8BA 4JI9A 2O0UA 3SOCA 3BGPA 4DITA 4BWPA 2WPAA 4XG8A 3I0OA 3F3TA 2YERA 4KS8A 4GG7A 5K0XA 4HYHA 2BZJA 1YQJA 5CI6A 1PXLA 4C61A 1U54B 5HG9A 5FDPA 2Y4IB 2R0UA 4F9BA 2QOLA 3CTJA 1P4OA 2FSMX 4O6EA 4YO6A 3UJGA 5HTIA 5J1VA 3GC7A 4D4RA 3NAYA 3TNQB 4XG7A 3WF7A 5L3AA 2WEVA 2I40A 4QMOA 4QMLA 2XKCA 3COIA 2HYYA 2WXVA 3ZM4A 4QQCA 2Z8CA 5J7HA 3HAMA 3OROA 4YZ9A 3HP2A 4FV4A 3F3WA 5EM6A 3PSCA 4CFNA 5HEZA 2PVMA 3R28A 3VHKA 4RJ8A 1M7NA 3R7UA 4F09A 4K77A 2WO6A 1PKGA 4UXLA 3DB6A 2B9FA 3UVPA 2QVSE 3RZFA 3P23A 1OB3A 1W0XC 3AT2A 3ORNA 4GUEA 3BCEA 1OL5A 4GV1A 4F9YA 3GCVA 4RPVA 3FMDA 5AR4A 3R9RA 4JX7A 3UG2A 5L8KA 3K5VA 3SDJA 3JVRA 4P2KA 4S2ZA 4LRMA 4FYOA 2EB2A 3R02A 3W8QA 1P2AA 3HV4A 3Q04A 4V0GB 3QXPA 2IVVA 3WARA 4U5JA 2F57A 4FL1A 4I4EA 4QYHA 2WGJA 1RE8A 3AC3A 4N4SA 4RZVA 2PVNA 2F49A 4GW8A 1QPCA 3F7ZA 4I93A 5CX9A 3W2QA 5KMNA 5FXQA 3LCTA 3C4XA 2C0OA 2YDJA 2ZB1A 3BBTB 4FK3A 4TYIA 5BYZA 3UGCA 4QP2A 1ZY5A 3HV5A 1ERKA 3G9LX 2ETKA 2XYUA 4OTGA 1XH6A 3NX8A 4WNMA 3GI3A 3FLWA 2EVAA 2H96A 5HD7A 4FL3A 4W9XA 3PA5A 3O51A 3GXLA 2VTLA 5F1ZA 2OJ9A 4I0SA 2XS0A 5HLPA 2XRUA 3CE3A 4V04A 3I6UA 3BU6A 3EFKA 4Z9LA 5DEYA 4EYMA 3GNIB 4A07A 1KE7A 3TJDA 3FMKA 3GBZA 4I6HA 4FSMA 4KAOA 3LCSA 4CYIA 1XO2B 3HMNA 4A9RA 1PXMA 3KRRA 5JT2A 1T46A 4HYUA 5KCVA 4ZJVA 3VNTA 4R7BA 2FYSA 3DAEA 3R1SA 3QX4A 5L2SA 4G3DA 3BGZA 4HVIA 4EJ7A 3KGAA 3UQCA 1PW2A 3GENA 5CT7A 3VUGA 3VS2A 2ITOA 4RLKA 3WZJA 5IEYA 2C6KA 1H0VA 2FVDA 4QPSA 4BGHA 5HX6A 4JL9A 3E7VA 1CTPE 1KV2A 4A4LA 4Z7HA 2WMAA 3ZXTA 3OTVA 4O91A 5AP4A 5BNJA 2BZIB 3OBGA 4D0WA 4DFUA 4F9WA 3M42A 2QG5A 4IW0A 2YDIA 3V5WA 3VN9A 3OCTA 3HAVA 1RQQA 4RRVA 3AD6A 3FL5A 5EYMA 3E7OA 3D0EA 4HVHA 1OIRA 4I24A 3E3BX 3HKOA 4D9TA 1ZXEA 1UU7A 5HGIA 4KIKA 2UW5A 3ZC5A 2YAKA 4G3GA 2WB8A 5HKMA 3U55A 4IVAA 3RK7A 3EQGA 4DGMA 4I92A 2FO0A 4LRJA 4FBXA 3ODYX 4FV7A 3IECA 5BVEA 4YURA 2C6LA 5ANGA 2R3PA 4ITIA 2ZM1A 3NEWA 5HNGA 5KO1A 2ESMA 3MB6A 4FOCA 5M4UA 4KKEA 2I7QA 2ITUA 4USFA 5CVGA 4OTIA 5I3OA 5BMSA 1MUOA 2CKOA 4IE9A 2Q0NA 3KXZA 4ZP5A 1OIQA 2OIDA 4E6DA 4RA5A 3TDVA 5I9ZA 2CCHA 3DB8A 4XG9A 1ATPE 3FUPA 2BRHA 2I0VA 3TZ8A 3PZHA 5HESA 4H36A 4W8DA 4WO5A 4WA9A 3NVKI 1IRKA 2PPQA 4OBQA 2C69A 1LP4A 3QYZA 3AC8A 4H58A 3MJ1A 3VBXA 5CU0A 3R83A 3Q6UA 5HHWA 4BYJA 4DT8A 4ACGA 5B7VA 1YKRA 4UYAA 4I20A 5TR6A 4IWDA 3NMUF 3NNWA 3BHVA 5KKRB 5J87A 2QONA 3MIYA 2XYNA 3ZFMA 1M7QA 3CTQA 2V7OA 4UWBA 3OOGA 3WZEA 3TV6A 4QMTA 3MPMA 4JBPA 4YHTA 5J79A 3P7AA 1GZKA 4NW5A 3FZPA 2YLFA 1P5EA 3DQXA 3BYOA 3UIUA 4ALWA 4X21A 4YNOA 1K2PA 5AV1A 1ZYLA 2VTMA 3ZUTA 5IA4A 5GINE 3P1AA 3QZGA 4K9YA 5JK3A 3KN5A 3RM7A 2UZLA 3ZSHA 2Z7LA 5EDQA 2JD5A 4C4FA 1ZYCA 2RFSA 1WZYA 2GHLA 2NNWB 3DKFA 3A8WA 3DLSA 3L9PA 3N9XA 3TCPA 3VBVA 4U80A 2CKPA 5DH3A 1AQ1A 3UOJA 4MBIA 4MD7E 1JVPP 3WZDA 2C5YA 4IJ9A 3SVVA 2QI8A 2PVYA 1PXJA 2X8DA 2YHVA 5FEDA 3V5JA 4HGSA 4ID7A 3OS3A 3S3IA 4DE4A 3HL7A 4X6RA 1P14A 2XIKA 4WRGA 3EMGA 4XRLA 5IUIA 3UC3A 4DAWA 5IH4A 3KMUA 1MRYA 5CEOA 1Q3WA 4FOBA 1SNXA 5C8KA 4X2GA 4CFUA 3FKNA 3RAHA 1W84A 2RSVA 3BHHA 5BUJA 1OKZA 4BN1A 3TV7A 2ZDUA 3KVXA 4F7NA 4HW7A 3ERKA 2WMWA 5HI2A 2VTAA 3GCQA 3BELA 3S0OA 3LXNA 1BI8A 2WELA 3DBFA 1G3NA 3OTUA 4NJDA 1ZWSA 3ROCA 4EHVA 3SQQA 5BQ0A 3IOKA 4IB3A 4M97A 4YHJA 4MWHA 2VZ6A 3NUPA 3OT3A 4RJ7A 1I44A 4YO4A 4AGDA 5IA0A 4MX9A 4YBKA 3K3JA 3OUKA 3ELJA 3O50A 3SXFA 1O6LA 3A7HA 4FKLA 1Y6BA 1PXPA 4JRVA 5BVDA 4DFYA 5BVNA 4FTJA 1Q8YA 3IS5A 3AMAA 3BQRA 4OBPA 4YJRA 4C34A 2HXQA 1XHAA 4Y46A 1JLUE 1H1WA 4BDGA 1Z57A 3RGFA 2O8YA 2E9OA 1H28A 4CNHA 2CMWA 4EOLA 2J7TA 3UQFA 2PULA 3TEIA 1Q3DA 4W4XA 5EOBA 3CJGA 2GTMA 4PP7A 4BBFA 2C4GA 5FBOA 3CP9A 3F6XA 5CI7A 1OECA 3D7TB 4FNZA 1H0WA 2IN6A 3EN6A 2YIWA 1NW1A 3A62A 3UYSA 4DEBA 5IUHA 3C4FA 1H1SA 5CZHA 4CFFA 5AUVA 3KULB 4ZTQA 1E9HA 2Y7JA 5H8BA 4BF2A 2HXLA 2JDOA 3R30A 1H8FA 4ACDA 4FUXA 5E8VA 2IVSA 4AZFA 3A7JA 4XLVA 2C6IA 3IDBA 3R22A 4G17A 4RMZA 2UZBA 2R2PA 5H8GA 5IQDA 2NRYA 3ZYAA 4BCKA 2C3LA 4NW6A 4P4CA 3G2FA 2XKEA 5DFPA 2HWOA 4F64A 3F5PA 3TL8A 3MFTA 4CYJA 4Z55A 4TWNA 2JBOA 3ETAA 3K54A 2P2HA 4NT4A 3QUEA 3QZIA 2C5VA 4C59A 2HCKA 4Q9ZA 5A4TA 1GY3A 3R2BA 2YCQA 3DGKA 3W10A 2I1MA 2PMLX 2IPXA 1XBBA 5J9LA 3SXRA 3SGCA 4A9YA 4OTFA 1ZRZA 3R8PA 5H9BA 4YHFA 4IIRA 3FZOA 1BL7A 2CGWA 2G9XA 4BWKA 5I4NA 4XLIA 2VO0A 4M67A 3KRLA 2CKEA 4GUBA 2G2FA 2ONLC 2OXYA 3ZHPC 5JRQA 4QMSA 4ZAUA 3R8VA 3E8EA 4HNFA 4IWQA 4X3FC 4DBNA 4PV0A 3MH1A 4NM7A 4B8LA 2R3MA 4HVSA 2JDVA 4PDSA 4R8QA 5KBRA 4HYIA 2OJFE 4DHFA 1FGKA 4L3JA 3L8XA 3KXXA 1PXKA 5LQFA 4FEUA 3FMNA 3OBJA 4LUDA 3GUBA 2YM7A 4BTKA 2BAJA 2W06A 3PJ1A 1ZMWA 1M17A 4I94A 1KE5A 2R3KA 4HNIA 4IAAA 4MK0A 5IDNA 3L8SA 5IA5A 5CSHA 3UNZA 5EM8A 1A9UA 3N4VA 3PG1A 2PVLA 1S9IA 3E92A 3QTZA 4IM3A 5TF9A 3S4QA 2B9HA 4FVRA 3ZBFA 4O81A 2QC6A 3A8XA 4TWCA 4FGBA 2WTVA 2R9SA 2XJ2A 3DDQA 3Q32A 1YXUA 4YJVA 2QCSA 3WIKA 3MVJA 4A9UA 3EYGA 5DRBA 4BI1A 3C13A 4E6AA 3MDYA 4JDKA 4C36A 1SZMA 2PWLA 3W1FA 4EK5A 5ETIA 4DEEA 4LOPA 4FNYA 4FTKA 4U3ZA 3PRFA 4O0YA 3VAPA 4UYNA 2XZSA 2BKKA 2PTKA 4IX3A 5CYIA 4TWOA 2VX1A 3DK6A 3Q9XA 2X2MA 4WD5A 5IG1A 4DT9A 3L1SA 3FXXA 4ZTMA 4CFMA 4YZMA 4DH1A 4O7TA 4U40A 3IONA 5LARA 4EUTA 4APPA 2F2CB 4CXAA 3VQHA 4QMQA 3F2RA 4RBLA 1SNUA 2BCJA 3HZTA 3ZRMA 4BZNA 5A6NA 2QOCA 3Q52A 1JAMA 3GC0A 1P4FA 5CF8A 1V0OA 4L3PA 4ASDA 3P5KA 3GCSA 4NTSA 2VTJA 3NLBA 4XOYA 4D4YA 4ENYA 3W2CA 3IW8A 3CS9A 3F3VA 3DTWA 4O84A 4IX5A 4R1YA 1H25A 4EZ5A 1APME 4G2FA 1U59A 4NFNA 5E8YA 4RC2A 4WUAA 3TKHA 3FC1X 4H1MA 4A06A 4W4YA 3SOAA 4OTWA 4BCJA 3AGLA 4F7JA 2YM5A 4IAKA 4DG3E 4IVBA 3QWJA 5FM2A 1PYEA 2B1PA 4BCMA 2QOOA 1JBPE 1M52A 1R39A 2VWUA 4N6YA 4B99A 1BI7A 4YSJA 4MXCA 3TZMA 3UZPA 4Y5HA 3LLTA 2VU3A 2ZMDA 3MJ2A 5J95A 3SKCA 3W55A 5HE1A 1LR4A 2XK6A 1H4LA 3M1SA 5CT0A 4D55A 2Z7RA 1M2RA 2A0CX 3PP1A 4L7FA 4BDHA 2V55A 5CEQA 3DDPA 5DR6A 1F0QA 3I5NA 3LIJA 4L53A 4RWKA 4YBJA 1ZZ2A 4R3RA 3JS2A 2BDWA 3CY3A 3LOKA 3PY1A 3E3PA 4WUNA 1ZOGA 5ETAA 4QQJA 4RG0A 3ZZWA 4EONA 5FUTA 2UVYA 4AW2A 3LCOA 4O38A 3VF8A 2UW3A 3QKKA 5L2QA 4ZY6A 5C27A 4F08A 1OL1A 2O3PA 3UDBA 3CLYA 1JOWB 2AUHA 3ORMA 4IZAA 5M06A 3POOA 1OPKA 2C3IB 4HJOA 4BIEA 5FEQA 3HYHA 2BRGA 3ZTXA 4JBQA 2HZ4A 3ORKA 1STCE 4CTBA 2Z7QA 2X0GA 1YWRA 1TQPA 2IVUA 2HOGA 3LQ8A 4I0RA 4NIFA 2WMTA 5E8ZA 4CQEA 3PWYA 4ASXA 4M69A 3P0MA 2JFMA 3QCQA 2Y6OA 4X3JA 3UOHA 4G5PA 3TUCA 4IM2A 3F7WA 3OT8A 4BBEA 2WTWA 4KSQA 3U9CA 3O17A 4LUEA 1QPEA 2C6OA 2GTNA 3MFSA 1KOBA 2BFXA 4RJ6A 3KCKA 3O8PA 3CBLA 5IPJA 4PL5A 3WI6A 2PVJA 3C0GA 5CAOA 4IEBA 3MFUA 4MNFA 1UNHA 2EB3A 4XP2A 4EH6A 2OIQA 3BV2A 1PMVA 2GNJA 4JQEA 5FTGA 2JIVA 3CPBA 2JEDA 2OICA 2VV9A 3WOWA 2VUWA 3Q2MA 1G5SA 2BFYA 4FIFA 4JJRA 3OXTA 2JFLA 2WMBA 3QAME 5AA8A 2VN9A 4MAOA 2JLDA 4Z3VA 3LZBA 3TZ9A 4AZTA 3O8UA 4YMJA 4DFNA 5AR7A 3FMHA 4FT7A 2WKMA 2GS2A 4YNEA 3UP2A 3NW5A 4JOAA 2HAKA 4U41A 4E3CA 3GFEA 4LRKA 5IQGA 2VGOA 5JGBA 3CQWA 4DEGA 3OVVA 4R3CA 2XIXA 3VULA 4AW5A 4FEQA 3LFCA 3OXIA 3FXZA 4CT2A 2UUEA 3R71A 3V6RA 4FEWA 4JG8A 2B0QA 4MBJA 4W4WA 3O7LB 3QRJA 3QTXA 5IQAA 4I5PA 4J8MA 4CFVA 3FHRA 1SVGA 5AA9A 4HPTE 3RM6A 4OTQA 4KS7A 1OGUA 3WF6A 2QO7A 4XG2A 3MH2A 4FIEA 5DT3A 5IDPA 3IDCA 4O7SA 2HW7A 3IOPA 4FG9A 2OH0E 5CZIA 5FRIA 3RINA 4BHNA 4IQ6A 4UN0C 2ZJWA 2OXDA 2XJ1A 2Y8OA 4FYNA 4FSWA 1SYKA 2ITNA 3BIZA 1WVYA 3BYUA 4FSRA 4AE6A 3C4WA 1W82A 2A1AB 4WT6A 2PZRA 4QYEA 3QTIA 4J7BA 2XBJA 4H3QA 3DBEA 4FTCA 4MXOA 5CS6A 4WRSA 4D9UA 2VWBA 3E64A 3HX4A 1WVWA 3KEXA 3PXFA 3GP0A 1O9UA 5KKRC 4FV8A 4G3CA 2E9NA 4D2TA 4GCJA 1Y6AA 1IAJA 4Y85A 4QQ5A 1BKXA 1ZYJA 3NIZA 3ODZX 2W9FB 5EYKA 4MH7A 2QR7A 3CR0A 5IQIA 4O86A 4QMPA 3C0IA 4YLJA 1VZOA 4I5CA 1LEWA 3LFFA 4IXPA 4RSSA 2YN8A 4FTRA 4QP7A 1FVRA 2EU9A 3JY9A 5L8JA 5IMXA 5FEEA 1J1CA 1DI8A 1H27A 4FT3A 5HIDA 1J1BA 5KE0A 3GU4A 3BYVA 3KC3A 3O0GA 3RHXA 4EKLA 5BVOA 3ITZA 4RVMA 3R00A 2PSQA 3SXSA 2VTQA 5FXRA 4RIYB 1PHKA 5AUWA 2RG6A 5C9CA 2W4JA 1M2QA 3A99A 1UU3A 1I09A 4G3EA 4YJUA 3AC4A 4NK9A 4BDCA 2CGXA 4BWXA 4ARKA 3Q9ZA 1DM2A 2W17A 3IK3A 3QFVA 2OO8X 1FINA 3A2CA 5KZIA 2HZ0A 4BI2A 3EQBA 4FKTA 4RWIA 5I9WA 3MESA 2B4SB 2ZV8A 1QL6A 3SRVB 5HU9A 4L00A 2H8HA 5DIAA 3C0HA 3LFAA 5IH6A 2E9PA 3QTQA 3QLFA 2XP2A 5BMMA 3ZMMA 4BCHA 2P2IA 4Y8DA 4DEHA 3F3ZA 4ZEGA 4MNEB 5T3QA 5IEVA 3MVLA 4C7TA 3QUPA 4H05A 1UV5A 3FMMA 2BUJA 3EFWA 3HA6A 1R0EA 4O2PA 2LAVA 5HBHA 5ETFA 4BKJA 3PLSA 3P9JA 5HOAA 3KCFA 3NR9A 4AGWA 1LUFA 2DWBA 4KA3A 5DA3A 4ZJIA 1Q41A 3UMWA 4M66A 3T8OA 2Z2WA 4S30A 4BDDA 3EFLA 3WZKA 2RF9A 3ZEWA 1GZOA 2VTRA 3FI2A 4O0RA 3SC1A 4MVFA 4IX6A 4WSQA 4GSBA 3RCJA 1XH7A 3EKNA 4PDYA 1TQMA 5K3YA 4AP7A 5AMNA 3RPYA 3TACA 2YLEA 5ANIA 4PDPA 3PRIA 1AD5A 3ANQA 4F9CA 3ORTA 5CQWA 4MWIA 4TNDA 4PMTA 2OZAA 4JQ8A 4KABA 2PZ5A 4N0SA 5JKGA 4D2PA 3LLAA 2HWPA 2ERZE 4O0WA 4LOQA 5K9IA 4EOOA 4AN3A 1KWPA 5KBQA 1CKJA 2A4LA 4L43A 5E90A 5AUYA 2V5QA 4QP6A 4UALA 2QOFA 3D2KA 2ONLA 3MTLA 3Q9WA 3TJCA 4F6WA 3QF9A 4C57A 4D2RA 4FKGA 4FICA 4BCQA 4X3FA 4H39A 4MCVA 1U5QA 2VTPA 2XIRA 2YM4A 3C50A 2YWPA 3ZZEA 1YOLA 2B53A 2GU8A 1NVSA 3MTFA 2XNBA 4WBBB 5A4CA 3VJNA 3KRWA 4FKRA 1YDSE 4IAYA 4EH9A 3VQUA 3DA6A 4FV2A 1OPJA 3C1XA 4KWPA 4ZTNA 3WE8A 3FZSA 3HUCA 3ATSA 3UE4A 3VRZA 1JSTA 2R0IA 4OGRA 2VX0A 5K4JA 3PTGA 1Q62A 2C6EA 4Q5EA 2PK9A 1Q61A 4C4IA 2HY0A 2PMNX 2QO9A 4U44A 1OMWA 4BYIA 5TOZA 4AGUA 3A61A 1KE9A 5CF5A 3LJ2A 5B0XA 5A4QA 3EHAA 5EHYA 4O7LA 5TO8A 4BBMA 4HGLA 4EOKA 4UX9A 5K5NA 2V7AA 5DNRA 4V05A 2YACA 4FUYA 4KBKA 1GAGA 3Q4ZA 2NP8A 3VRYA 3AD4A 3KB7A 3O96A 1JNKA 4E20A 4R5YA 3NZ0A 1ZARA 1U54A 3Q3BA 3VBTA 4FT0A 4GFGA 3F3UA 3THBA 2YIYA 4EORA 4GMYA 3VS7A 4OAVB 3VBWA 2X4FA 4ZSEA 3OEZA 2PZYA 5DOSA 5CSVA 5DVRA 5TE0A 3ZFYA 4BKYA 5LMKC 3I79A 2PVKA 2JC6A 5AUUA 3U6HA 4O21A 2BRMA 2WHBA 4IANA 3KKVA 3PPKA 3NUXA 1ZZLA 5JFWA 2R3RA 4ASZA 4JBOA 2BPMA 4AOTA 4AZEA 4UMPA 3R7VA 1VYZA 4XCUA 2O65A 2OBJA 1UA2A 2WTKC 3DZQA 4AGCA 3Q6WA 3NUSA 5FBNC 1ZAOA 2XEYA 1YHVA 3HGKA 1YXVA 2UZVA 3FQHA 3GT8A 4DFLA 3N51A 1WBNA 3HP5A 1KE8A 4J53A 4L52A 3T3VA 1HCLA 3PE1A 4L7SA 4AF3A 5E8WA 4CMUA 5JFXA 3K5UA 3TN8A 3FI3A 5DHJA 3R63A 4V0GA 5LMAA 4EYJA 2YIXA 4EOJA 2FSLX 4O1OA 3BLRA 1YHSA 1LPUA 5DRDA 1FBNA 1OBGA 4TKSA 1NT2A 3F88A 4NEUA 5AV4A 5GZ8A 4TWPA 5CNNA 2VTHA 1QMZA 2YCRA 4YJPA 2NO3A 3T9IA 2RGPA 3RWQA 4UXQA 5C03A 5CEMA 2VAGA 2IZSA 2QOHA 3UZRA 4G5JA 3R21A 4BTFA 3CIKA 2QU5A 2CGVA 2ZV9A 3R7YA 3E87A 2X8IA 3QGWA 4XBRA 4JG6A 2W1HA 3PVBA 4FVQA 4FTLA 3GC8A 4GYGA 3EQIA 4CG8A 4FKUA 3PPZA 3VUMA 3SHEA 3FI8A 4BCOA 4UMTA 3U4UA 3FL4A 1GOLA 5AV0A 4TYGA 2FGIA 3IGGA 4J97A 2OIBA 2PHKA 4FV3A 1E1XA 3LM0A 4J96A 5BPYA 2ITWA 3MY5A 4FKQA 3WYXA 5LWNA 1VEBA 2F9GA 4ZS0A 4FV0A 4UV0A 4OTRA 4PQNA 1QPJA 2EWAA 3KF4A 2QOKA 3R7OA 3H10A 2YJSA 1PRYA 4X2NA 4U81A 4IDVA 4YC3A 1V1KA 4A9TA 4CMTA 4J52A 4QP4A 3ZUVA 3UPXA 3FLQA 4AOIA 2WIHA 5CNOA 4AA0A 4FTTA 2W1DA 2BDJA 3I1AA 1WBSA 4JLCA 5AWMA 2B9IA 4L45A 3VHEA 1BX6A 5CALA 4F0FA 2DUVA 3NS9A 3U6JA 4MKCA 2XKDA 3FSFA 4X2JA 3QHWA 3VO3A 3VUTA 4EK6A 3W2RA 4NKAA 4IB0A 2Z7SA 3PIYA 3R0TA 1H08A 4GK3A 3I81A 4NWMA 4R6VA 4NYEA 4U9AA 3H0YA 3E8NA 3JVSA 2YIQA 3R2YA 4HOKA 5DR9A 5C4KA 1U5RA 3E62A 3RPSA 3DOGA 4E5AX 4BDAA 3WYYA 4C4HA 4CV8A 4D0XA 4FGRA 2UZEA 3Q96A 5AX9A 4XRJA 1GJOA 2GFCA 2GHMA 2YJRA 4JIAA 2F7EE 1OKVA 1TKIA 5IF1A 3A60A 3HRCA 1XBCA 2RFDA 4DFBA 1YI4A 2J51A 4JAJA 5IQHA 5E91A 4BB4A 2UZOA 4AG8A 2GNHA 1MQBA 4GYIA 1KSWA 1Y8GA 4FSTA 1GIHA 4FR4A 1FOTA 4XV2A 5J9YA 3D4QA 4ZSLA 2QOBA 4HYSA 4TY1A 3R73A 4OTDA 3C51A 3LMGA 3C5UA 4RVKA 3ZLXA 4BRXA 4IBMA 4FSZA 2YIRA 5E9EA 3ZFXA 2Z60A 3DJ5A 2ZMCA 4DTKA 4DH5A 1B6CB 2JIIA 3JXWA 3BU3A 4NU1A 3B8QA 4OTPA 2X9EA 2ZV2A 5DLSA 5D1JA 3G5DA 3H3CA 2P0CA 5HLWA 4CGAA 5DEWA 3UYTA 2NPQA 1XJDA 4FTMA 4BICA 5HORA 4QYYA 2W1IA 4O7ZA 2VNWA 2QLQA 4F0IA 1ZLTA 2R3QA 2VO3A 4E1ZA 3EH9A 3TKIA 2ZM3A 4AZWA 4F4PA 1FGIA 3LXLA 2EXEA 5HTBA 4QTEA 4ZLYA 5L4QA 4IC7A 5AAFA 3AOXA 4BCPA 2B52A 4G31A 2F7XE 3UO6A 2HENA 4QOXA 2A2AA 4RIWA 2QR8A 4RJ4A 4BKZA 4YC6A 4ANOA 4EWHA 3PPJA 3V04A 4WHZA 4JDIA 4I6QA 4OT6A 4EK4A 1OL2A 2C6TA 4DG0E 3DBCA 1A06A 3FPMA 3MA3A 3OG7A 2BALA 2PMIA 2UW9A 4HCVA 4L42A 2BHEA 2ITQA 4WSYA 3DFCB 3JYAA 4NCTC 3NRMA 2W4KA 5F94A 4FE2A 4DBXA 3UVQA 3F61A 5T68A 3II5A 3CPCA 3HMPA 2YITA 3FY0A 2R3JA 4P90A 4YGAA 5FTOA 3B2TA 2OJGA 4AZSA 4KUJA 2X7GA 4NJ3A 3O2MA 4BDIA 3GU7A 1JKKA 4ANNA 5HCZA 2HIWA 3AC2A 3QCXA 4TYHB 2FB8A 4RJ5A 3LXKA 5E4HA 2J4ZA 4KIQA 3PSBA 3DBQA 5CLPA 3PXYA 4EH4A 1UWJA 4W8EA 1ZOHA 5E92A 5EG3A 3ZDUA 4HVGA 4BY9E 3UC4A 3OY3A 3TUBA 3LAUA 1F3MC 2GQGA 3I0QA 4EOSA 2JGZA 4RLLA 4C58A 4RC3A 1J3HA 3GU8A 3P79A 3FHIA 3DQWA 5BVKA 4X7QA 4N57A 4IVCA 4ZXTA 2VNYA 2W0JA 1R1WA 3HV6A 3KXHA 5CY3A 2QNJA 2J90A 2B9JA 3NW7A 4O0SA 1YVJA 2ITVA 1K3AA 3HDMA 4OUCA 1B38A 3UOLA 4GU6A 2B55A 4HCUA 4ZTLA 3BLHA 3R6XA 5A9UA 4KKGA 4E26A 3OHTA 3OZ6A 5HNBA 4II5A 4F70A 4AOJA 4F7LA 5IUGA 2KULA 3EB0A 4FKOA 2C6MA 5GNKA 4DH8A 4F1MA 5ACBC 3S00A 5L6PA 3UO5A 3PY3A 4CZTA 4EBVA 4U7ZA 5I9XA 3W18A 4E4NA 5B2MA 4LMUA 3CJFA 2OG8A 4TXCA 2XNPA 4E93A 4FMQA 3BWFA 5CEIA 5BYYA 4L68A 4D5HA 4PMSA 3ZEPA 3UPZA 4FV6A 2WTDA 4YJSA 5DGZA 4CZUA 5C4LA 3MV5A 2YABA 5AP3A 3ACJA 4IWPA 4AW0A 1TQIA 2XK8A 2VTNA 3HMMA 3JPVA 5KMIA 3ATTA 4D1SA 1Q8WA 3CD3A 3HMIA 3JY0A 1BYGA 4O0VA 3ZLSA 4L01A 2J0IA 2X4ZA 3ZCLA 5A4LA 3AMBA 2XCHA 4MYGA 5LJJA 3TUDA 3V01A 3U8WA 1SVHA 2AYPA 2WIPA 3I4BA 3EQFA 4OR5A 5CXZA 4U45A 5AR8A 3OD6X 5HE0A 3BYSA 3DV3A 4EBWA 4BZDA 4AZVA 3KULA 4Q9SA 5EHLA 3QKMA 5AV3A 3LFDA 5K0KA 1CM8A 2WTJA 4M7IA 3AC1A 3C9WA 4X2FA 3QA8A 4RQKA 4ZZMA 4EOIA 4ZMEA 4QMVA 4C2VA 4RC4A 2PMOX 5KMLA 3ACKA 4K6ZA 3KQ7A 4EKKA 5CENA 3QQFA 4ZLZA 5DR2A 3SX9A 5HIEA 3UZTA 4PPAA 5GZ9A 3H4JA 4FC0A 3S2PA 5HE3A 2XNGA 2IZTA 3BE2A 3FZRA 4DLIA 3AQVA 1UU9A 4K33A 2X7OA 4FKVA 4ONAA 3FC2A 3ZONA 4MEDA 4B0GA 4EQCA 4YUQA 2WTKB 3HVCA 3SV0A 4EI4A 1IASA 4EH2A 1PYXA 4S34A 1BL6A 4MXXA 1GIJA 3E8DA 2ZVAA 4F99A 5AAEA 3NAXA 3R01A 3EQCA 5D9HA 4FZAB 3PP0A 1KOAA 3TI1A 3RAWA 4A4OA 5HQ0A 4X6QC 4BHZA 4LI5A 4IWOA 3TDWA 3NWWA 3QA0A 2FH9A 2Y4PA 2WMUA 5L6OA 5M4CA 4C37A 2BMCA 3BHYA 3DAKA 4UZDA 3DBDA 3KMWA 4ZSGA 5FM3A 5FTQA 3NPCA 3QX2A 5LMKA 4DC2A 4DYMA 2WAJA 3G9NA 4K1BA 4IMYA 3V51A 1FVTA 4YU2A 4B7TA
chains in the Genus database with same CATH superfamily
4O0XA 2X8EA 3ORPA 4C4GA 4NL0A 3TXOA 3W0OA 5EYDA 2GNIA 2O63A 4C02A 3KVWA 4TN6A 1BUHA 2OSCA 5EM7A 4GIIA 3R8UA 4KD1A 2UV2A 2R3OA 2W96B 4YTCA 1W98A 2XB7A 3VS4A 4D2SA 2XARA 2OWBA 4ZK5A 3DXPA 1JPAA 3AKJA 5AIKA 3IGOA 4YJTA 4F6SA 3EIDA 3ZO3A 1YI6A 3CEKA 4EQUA 5IA2A 5GJGA 4DH7A 3W16A 3ZO4A 4QNYA 2G01A 4XNEA 4KRDA 4RIOA 4DF3A 4AA4A 4JAIA 3QLGA 4LV7A 4E73A 2HZIA 4C0TA 2V0DA 2J5EA 3PXQA 4F78A 3OMVA 3VS0A 2XH5A 3D14A 4FX3A 3OOMA 3EFJA 5DYJA 4C3FA 2OU7A 5CVHA 4ZSJA 2YM3A 4C62A 3KA0A 4FZDB 5AJQA 4G1WA 4YZNA 3UTOA 4EC8A 2FA2A 2C1BA 3QZFA 4C33A 5BVFA 1DAYA 2GNLA 4YSMA 2XM8A 4RWJA 4J8NA 2X1NA 5DMZA 4FEXA 5IQBA 4RT7A 3COKA 4JDHA 3BLAA 1OUKA 3FMEA 3GU6A 4F6UA 2WMRA 2XA4A 2I6LA 3IG7A 3AGMA 4DINA 3E8CA 3LCKA 4M8TA 1T45A 3KL8A 4D58A 5CAVA 2XM9A 3RMFA 3UIXA 4DTAA 4DHZA 4QP8A 5ANDA 3AMYA 3QQLA 5FQDC 3LHJA 4GVJA 5ANOA 3LFQA 4RX7A 5A14A 5JSMA 2XF0A 2J50A 2OXXA 2UW6A 2ZM4A 5DT4A 2OFVA 4BDBA 4TYJA 1YHWA 3GU5A 4FA2A 3D5UA 3EN9A 4C2WA 4ZIMA 1WMKA 4FTAA 4H3BA 3U4WA 5IISA 2VWZA 2IEWA 2WMVA 2C5OA 5CQUA 2VTSA 4ZY5A 2C0TA 3SW7A 3GC9A 4O7WA 2OW3A 4DFZE 4BGQA 1Y8YA 4MQ1A 4YLLA 5DWRA 5IMEA 3SG8A 2HY81 5LMBA 3C5IA 4TTHB 3W2PA 3I7BA 2VTIA 4KBCA 4D1ZA 5M57A 5HX8A 4QTDA 5F95A 4MBLA 4N6ZA 4O22A 2PZPA 3G6GA 3ORLA 3OUNB 5EW8A 5AR2A 4FV9A 4YZBA 2UZWE 4JNWA 4RQVA 3VIDA 1FQ1B 4DH3A 4PMPA 1ZOEA 3NYXA 2BILB 4TPTA 3RJCA 4GU9A 2GMXA 2J0JA 3F66A 4U43A 4FIGA 4E4LA 3UDTA 5FG8A 3WF8A 1MP8A 4IACA 2OH4A 2GS6A 3KF7A 4KNBA 2VX3A 3AD5A 5AP7A 4C38A 4GIHA 4K0YA 4CQGA 3U87A 3RWPA 2I0YA 4AAYA 3BQCA 4EH7A 5LVOA 2CDZA 4QMWA 2W4OA 4ACMA 4MXZA 4LFIA 4AFJA 2XBAA 1NA7A 3LFEA 2WOUA 3CQEA 5GIPE 4ERWA 2V22A 5FGKA 3CGOA 3S1HA 5J8IA 3TTIA 3C7QA 1PMUA 4EHEA 2CN5A 5ANKA 5EHOA 3SAYA 5KMJA 4B6LA 2DQ7X 4AT4A 3G0EA 5CU4A 4QP1A 4FZFB 4BTMA 2X6EA 1OL6A 3LE6A 3MWUA 1XKKA 4IZYA 2P4IA 3FMLA 3R1YA 3NYVA 4FKSA 4GRBA 5EI6A 5C8MA 2BRBA 4R7IA 5EW3A 2C6DA 3KXNA 3OF0A 3R8ZA 4U0IA 2C3JA 3NCZA 3OCBA 2EXMA 3GGFA 5AM7A 3UQGA 5B2LA 2PU8A 2R4BA 4M0ZA 3HEGA 2WU6A 3FQEA 2A27A 4S32A 4QMNA 3E93A 3B2WA 3RK9A 4O7RA 4L3LA 1R3CA 3PE2A 4JX3A 3TG1A 3BLQA 1V0BA 2CN8A 2FUMA 2ITYA 1WBPA 2W1FA 1OBDA 4EK3A 2F2UA 5BUIA 3QD2B 5E7RA 5CU6A 4E6CA 1LEZA 4BCIA 4K2RA 4L8MA 3R7EA 4FEVA 3DKOA 3PFQA 4I6LA 5F4NA 4BIBA 5EQEA 2UZNA 4WBOA 5LWMA 2IJMA 3MIAA 3GVUA 4GL9A 3G90X 4FG8A 2R7IA 3LFNA 2IW9A 5JGDA 3DCVA 2IG7A 2ZOQA 3EQPA 4D2WA 3R1NA 4QRCA 5EFQA 2RFEA 4TRLA 3GQLA 2JKMA 4K8AA 3AKLA 2C0IA 2JAMA 4APCA 4DA5A 4GS6A 3BL7A 4ALUA 3OFMA 4GT3A 4J71A 3Q4CA 2BHHA 4PL4A 3QD3A 4CKRA 3QRIA 5CXHA 1PXIA 4BCGA 3FYJX 1UNLA 3FYKX 3QC9A 4O82A 4GJ2A 5C26A 3E88A 2E2BA 4LL0A 4RIXB 3E63A 3V5TA 3TIYA 3BX5A 2NRUA 2R7BA 4R77A 4DTBA 3FE3A 4XOZA 4CD0A 4GG5A 5LVMA 4WG5A 3W0RA 2IVTA 2XK4A 3F69A 4RX5A 4YTFA 3PIZA 4CFWA 3ZRKA 1S9JA 4KIPA 3U9NA 4ANMA 4IAIA 4FKPA 2V62A 1H1RA 3NSZA 3ORIA 4IC8A 1MRVA 1PXOA 4TZRA 3CCNA 5T6KA 3MA6A 4J95A 4BJJB 1DAWA 4KSPA 4B9DA 4USEA 3O8TA 2CKQA 1H07A 1XH9A 2I0EA 3W0MA 3FZ1A 5I0BA 2W7XA 4JRNA 2WMXA 4V01A 5IZFA 3HRFA 5M07A 2PUIA 1AGWA 4EJNA 2CSNA 3IPHA 4F1OA 4YJNA 3T3UA 1Q4LA 2QD9A 5F20A 3VW6A 4CEGA 4I4FA 4HZRA 3SLSA 4E8AA 3H0ZA 4RIYA 5DT0A 2XIYA 5DN3A 4JR7A 5CEKA 3KRJA 3NIEA 3R7GA 3Q60A 1ZMVA 4QYGA 4NFMA 4YPDA 4LL5A 5AR3A 3V5QA 2OZAB 4I23A 3WZUA 4EUUA 4EHZA 3PJ3A 3H30A 1YOJA 4YJOA 3D5VA 2JDTA 5KHXA 1JSVA 5AM6A 4FKWA 4WOVA 5CASA 1B39A 4XS2A 4WNOA 3SRVA 3M2WA 4CLJA 4ERKA 2VO7A 2WNTA 3WILA 2C1AA 3V3VA 4EZ3A 2BAKA 3R1QA 5J5TA 5JFSA 3BHUA 4FTQA 4R7HA 3EKKA 4C35A 4OLIA 2P33A 4MNEA 1JKLA 3FEGA 2XVDA 4QQTA 5J1WA 3QQUA 1V0PA 3MS9A 3OCSA 2WTCA 4WG4A 2R3LA 3EN5A 3VWAA 2YZLA 3GFWA 3NGAA 3VW8A 2BKZA 5JRSA 1X8BA 5EQYA 2PUNA 4ITJA 4E5WA 3DNDA 1OVEA 2W5AA 3NNXA 4GT4A 4WNPA 4E4MA 2RIOA 4FNWA 4F65A 4IVDA 5FP6A 3TWJA 2XNEA 3F5XA 2YDKA 5JH6A 5D41A 2PZIA 2W5BA 4Y83A 3V5LA 4O7SA 4DDIA 3RVGA 2UZDA 2XALA 2VWWA 4CTCA 4IZ7A 2GQSA 2IW6A 3GOKA 5J7BA 4LV5A 3PVWA 3ET7A 5DG5A 4D5KA 4DGNA 4ZTHA 2P3GX 2RG5A 3D94A 4RFMA 4CCUA 3BI6A 4NH1A 4ANLA 3HUBA 2PE1A 2X39A 5AIRA 4NM0A 2QO2A 4MXAA 3QQKA 4C3RA 5IA3A 1OZ1A 4X0MA 2G1TA 2Y0AA 2O5KA 5KHWA 2H9VA 5D7VA 3PY0A 3VUIA 1YXSA 5M51A 3KN6A 5K5XA 4QT1A 3LCDA 3NCGA 3CTHA 4FSYA 4G6NA 5E8SA 5H8EA 3TKUA 4WKQA 1MRUA 4F1TA 4LGGA 3LMHA 3BHTA 4A9SA 3NYNA 2CLXA 4HGEA 4EK8A 4L6QA 4AFEA 3EQHA 5G1XA 1OIUA 3EZRA 2J9MA 5M08A 3T9TA 2GNGA 4LM5A 1Q99A 3BWJA 4GT5A 3QTRA 1FPUA 3PJ2A 3KXGA 4Q2AA 4FKIA 5E1SA 3OWPA 4UZHA 3ZDIA 4CVAA 1J91A 2GQRA 4UEUA 3FLSA 2WQOA 4M68A 3HRBA 4GEOA 3FBVA 3TIZA 2SRCA 4AQCA 5IEXA 3PVUA 3HDNA 2YISA 3MSSA 3DS6A 2R3IA 3WF5A 4P5QA 3FLZA 4PDOA 4FTOA 4NUSA 3A7GA 1XH4A 2BROA 3PXKA 2YM8A 4W9WA 3G15A 3FV8A 3ALOA 2VWIA 2WQNA 3OEFX 4OBOA 3UO4A 4U6RA 3DTCA 4JQ7A 2WMSA 3RBWA 4R3PA 5AV2A 3I60A 4KRCA 1WBOA 3AG9A 2X81A 4E7WA 4CSVA 3ORZA 1IEPA 4C4JA 4UWYA 5HBEA 4FSUA 2J6MA 4EH8A 5J5SA 3NUAA 4EWQA 2OJIA 5C01A 1JSUA 2H6DA 4YZDA 5HCYA 2QKWB 4LMNA 5KX8A 3VS5A 5M56A 4QO9A 1Y91A 3I6WA 3COMA 5HNIX 3S95A 3QXOA 1WAKA 4Z16A 2VWXA 3GEQA 5H2UA 1WFCA 3LQ5A 4F7SA 3P4KA 3UIBA 2ZB0A 4XH6A 4E5BA 5HBJA 4M13A 4OW8A 4KIOA 2J5FA 3JUHA 4RA4A 5HE2A 1YXXA 3OCGA 4Q5HA 1VYWA 4XV3A 4BZOA 3FDNA 1REKA 2RFNA 5KMMA 3D2IA 3DJ7A 3UMXA 1M2PA 4QP3A 2E9UA 4GK2A 4OTHA 3UOKA 4AN2A 4PRJA 4QPMA 2ETRA 3FAAA 3OWLA 4KIKB 4MD9E 4O27B 3V5PA 5CAUA 4XBUA 4C4EA 2CJMA 2XJ0A 3GQIA 4NSTA 2CPKE 3LQ3A 3D5XA 4LQMA 2X2LA 3L8VA 4ZJJA 3U51A 4JVGA 3PIXA 2ETMA 4YPSA 3PLAE 4FSNA 3C4EA 3COHA 5L2IA 3VC4A 1DS5A 3OXZA 4L44A 4AE9A 3DT1A 2J0LA 3PG3A 3QHRA 3PUPA 4D28A 4LDTA 1ZYSA 3V8TA 3W2OA 4I5HA 4FK6A 2ITXA 3R7IA 4CCBA 4F0GA 4BCNA 4Y95A 5LCJA 1L8TA 2UZUE 3BKBA 3RAKA 2YZAA 3ROYA 5DE2A 4GFOA 5D10A 3I5ZA 3A7IA 3EWHA 3KK9A 3PA4A 4I0TA 2PUPA 4QNAA 3QUDA 4XUFA 1NVQA 5EKNA 4UMQA 3LJ1A 3RKBA 2GPHA 3HMOA 2UW0A 3MH0A 3QQJA 4LGDA 3QWKA 5ETCA 5AUZA 5CTPA 3TZ7A 5EYCA 3QBNA 4DFXE 1J7LA 4QEBA 3O71A 3IKAA 1PMNA 2F4JA 3DKCA 2JIUA 3Q5IA 3ENHA 4FZ6A 4ANQA 3HA8A 3GCUA 1YXTA 3G51A 2BRNA 3G33A 3NUNA 4DLJA 2UZTA 4YR8A 5GJDA 4QTBA 3LKMA 3MY1A 2CCIA 3FJQE 3ZH8A 3NW6A 4TNBA 1URCA 4ASEA 2A19B 4LYNA 4WNKA 5AX3A 4GH2A 5I9UA 1SMHA 1OPLA 2O2UA 2JITA 2YCFA 2QLUA 2GFSA 4P5ZA 3EYHA 2WMQA 3KU2A 4XG3A 4RZWA 3B8RA 3D5WA 1SVEA 2IO6A 2QKRA 1OKYA 3UIMA 3SA0A 5CF4A 2UW8A 2JKOA 5M55A 3IO7A 2PVFA 1RJBA 2WD1A 4GKIA 2CGUA 2EUFB 4LGHA 5FXSA 5AP1A 4DGLC 4IB1A 5FLFA 3DY7A 3EQDA 4QMXA 3RZBA 2BIYA 3ZXZA 2ZYBA 3QQGA 5A4EA 5BYLA 4RIWB 1PXNA 1YDTE 1UKIA 2XUUA 4ZSAA 3EJ1A 2R3FA 3F5UA 3FI4A 3HV7A 4AU8A 3ID6C 3VF9A 1KE6A 1H00A 4QD6A 3FPQA 4AWIA 5CU3A 3WBLA 4Y72A 1ST0A 3LFBA 5JZNA 4QMMA 4PL3A 1Z5MA 4CT1A 3BEGA 1FMOE 4QMYA 2J0MB 1PY5A 4XV9A 4U42A 3RNIA 5EM5A 2PVHA 4R5SA 3SW4A 5L8LA 3UNKA 1OITA 4PNIA 4CLIA 4CMOA 5HTCA 1OGYA 5A54A 3HNGA 2ITTA 3L8PA 3CKWA 3F9NA 2REIA 5HVJA 5CSPA 5EDRA 3H9OA 4XG6A 2JDSA 2KTYA 1XH5A 4ZTRA 4GKHA 5CANA 3CQUA 2JBPA 3OW3A 2JKQA 4EEVA 4A4XA 4IX4A 1ND4A 4BGGA 3KRXA 5IQEA 4AX8A 2C47A 3L9NA 5EDPA 4IFGA 3ZC6A 1XMMA 4DEAA 2B7AA 3MB7A 4XEYA 1OKWA 1GNGA 4I22A 1UU8A 3PA3A 2AQXA 4RVLA 2IW8A 3G0FA 3RPOA 3ZO2A 4DDGA 4CFXA 4QP9A 4PP9A 2WEIA 4YTHA 4RX9A 4N70A 5D12A 1NY3A 3MH3A 4PTEA 2WOTA 4UY9A 4BL1A 3FKOA 4AN9A 3GB2A 5D7AA 1YRPA 3MI9A 3EQRA 3TNHA 3P7BA 3KK8A 3VUKA 4I5MA 2RKUA 4CKIA 4ORKA 5HG5A 3RP9A 4FT5A 4G9RA 4AXAA 1Q8TA 1OUYA 4HVDA 2J2IB 2ZV7A 3PZEA 5LVPA 4EOMA 2R3NA 3A4PA 3FMJA 4XG4A 5HO8A 5CEPA 3CC6A 2Q83A 5CF6A 4AA5A 1TZDA 1U4DA 2FSTX 3FZTA 4S33A 2Q0BA 4XV1A 3UP7A 3PUFC 4D2VA 5AR5A 3PXZA 3CGFA 1H1PA 2X0PA 5AP0A 3VS6A 2YEXA 4IAZA 4TYHA 5H3QA 1IR3A 3MFRA 1JKTA 1R0PA 2OGVA 1W7HA 4JDJA 4XYFA 5JQ5A 1DI9A 5ITAA 4EL9A 3C4ZA 3OP5A 1Z9XA 3TNPC 3QRTA 1TVOA 3RCDA 5CAQA 4O1PA 3VUDA 3PSDA 4BFMA 3RHKA 3D7ZA 5L2TA 3U54A 4RVTA 5EK7A 2BTSA 3OY1A 4FIJA 2UVZA 2OKRA 5HG8A 2XEZA 3O7LD 2XKFA 2GCDA 3HLLA 4O6LA 3V6SA 4TL0A 2OLCA 4PTCA 3NUYA 1A48A 5IQFA 5EKOA 1OM1A 3CKXA 4O96A 3DZOA 3Q53A 3UNJA 5M4FA 1HCKA 4QDVA 1QPDA 1PKDA 5LOHA 3FY2A 3UVRA 3N4UA 1ZY4A 1YDRE 3LJ0A 3CXWA 4I6FA 1OIYA 3OC1A 3ZM9A 4JMQA 3NNVA 4JXFA 5JQ8A 3DXNA 3ZSGA 2CLQA 4QTCA 5DPVA 4ANSA 2VWYA 3CY2A 5A46A 3D7TA 4KKHA 4I6BA 4D4VA 2CNUA 3BEAA 5FD2A 4O0TA 4A7CA 3R9OA 2LGCA 4FZ7A 4YTIA 3LW0A 1WCCA 1XWSA 2QURA 5I3RA 4BDEA 2CNVA 1YI3A 3CSVA 4KINA 2VWVA 3ZLYA 2BAQA 1ST4A 4QMZA 1W2DA 3ZUUA 2EXCX 2PY3A 3FLYA 3LXPA 1CKIA 3NDMA 4JIKA 3QD4A 5BVWA 4FTIA 4E4XA 4ITHA 4YP8A 4ALVA 4DEDA 5I5ZA 2C3KA 5BX0A 2XK9A 2OI4X 3BPRA 3O23A 4DCAA 3AC5A 3W8LA 3UG1A 1H1QA 4MQ2A 2AEGA 4X2KA 5IH5A 2XRWA 1PMEA 2ZFYA 3TM0A 1W8CA 4XX9A 5HU3A 1J7UA 2IZRA 4JR3A 1RW8A 4IADA 5LCKA 1K9AA 1XR1A 3OW4A 3AXWA 4DCEA 3Q5ZA 4IZ5A 5AADA 3ORXA 3UODA 4KB8A 2UW7A 3M11A 4LG4A 2C5NA 4AW1A 4BDKA 5G6VA 4EOQA 1Q8ZA 3TNIA 1L3RE 5EI2A 4BTJA 4O2ZA 3L9LA 2HK5A 2ZDTA 3EL8A 3MY0A 2JKKA 2WQMA 3F82A 3TNWA 5HZNA 2AC3A 4WG3A 4U79A 1GZNA 5M44A 3FLNC 3VBYA 3QD0A 4RX8A 4I1ZA 2P55A 3K3IA 2YM6A 4BCFA 2JAVA 4OT5A 2G2HA 5HD4A 2BDFA 3R9HA 4RJ3A 5CVFA 5HIBA 1W83A 3RPRA 1PJKA 1CDKA 3R8MA 4JG7A 3A7FA 2FSOX 2XCKA 5DBXA 2WU7A 5F9EA 4BIDA 3UBDA 1Q5KA 2F7ZE 4GK4A 4YLKA 1Q24A 1JKSA 5LVNA 3TTJA 5EQPA 3QTSA 2WFYA 3SD0A 3F2AA 4O7NA 3V8WA 2ERKA 4UMUA 1NXKA 1U46A 2W1EA 3RAIA 3H9FA 5JEBA 3SG9A 3DPKA 2XNNA 3KXMA 4KBAA 4PMMA 5D11A 3WE4A 5L2WA 4M12A 2OF4A 5CAPA 1XQZA 2E9VA 1O6KA 3MVHA 2Y4IC 3KREA 2GDOA 4DEIA 3GOPA 2BR1A 2HZNA 4JT3A 4NZWB 5ANEA 3PXRA 2Y9QA 4I41A 4MF0A 4XHKB 4EC9A 2ITZA 3ZSIA 4G34A 5GZAA 4FL2A 4O7VA 5GIOE 4PF4A 2X2KA 2W1CA 4U8ZA 4AS0A 2VTTA 4U3YA 2XK3A 4B4LA 1WVXA 2VD5A 5C1QB 1HOWA 3QCYA 4CG9A 3Q4TA 1WBTA 4D1XA 4BC6A 3NUUA 3QALE 3DAJA 3BGQA 2W1ZA 3PJCA 4GFMA 3QCSA 2GS7A 4HGTA 4MTAA 3IW5A 4XP0A 5HVYA 4ZS4A 3ZBXA 2YAAA 2BTRA 3ZRLA 3BBWA 5KZ0A 3DXQA 4O0UA 2R5TA 3D83A 3F5GA 2ACXA 3PJ8A 4R78A 4FTUA 3ANRA 1XBAA 1MQ4A 2OJJA 2PVRA 1PF8A 5ICPA 4HZSA 3IW7A 3LM5A 3QTWA 1URWA 5KMOA 3DFAA 1BLXA 4FIHA 5EW9A 1H01A 4J98A 4PX6A 2HW6A 3EL7A 2G2IA 3H9RA 5CSXA 4G16A 4E6QA 4FIIA 5A6OA 3HECA 2C5XA 1JQHA 2QU6A 4CRLA 2H34A 3DNEA 3MPAA 4LV8A 3BV3A 3ENMA 4NIFB 3RTPA 3V8SA 4ACCA 5JMSA 4M69B 1FVVA 2YFXA 5L6WL 4IDTA 3W33A 4MF1A 4ZOGA 1EH4A 3Q4UA 4ZZNA 1KUTA 2PUUA 3C4CA 2BVAA 4Y73A 3QKLA 3W32A 4O4BB 4FSQA 4FTNA 4F63A 4FODA 1VR2A 2UVXA 1GZ8A 4PPBA 5C8NA 2QOQA 4NKSA 5JZJA 1VJYA 3AT4A 3QGYA 4IM0A 2XNOA 3P78A 3EOCA 4XP3A 4K11A 4S31A 3ALNA 2GHGA 2QQ7A 3QL8A 4L46A 5TKDA 4UMRA 1YW2A 3VUHA 3BU5A 4CV9A 3DLZA 3REPA 1SM2A 2X7FA 5B2KA 5BUEA 2XMYA 2CHLA 1ZYDA 5AP6A 3QYWA 1O6YA 3PVGA 3NVMB 2PE0A 3ZU7A 5JFVA 4UWCA 3GCPA 3U6IA 3VS1A 3R8LA 5I9VA 5FDXA 4TT7A 3MGYA 4ZZOA 1JWHA 3BE9A 3D15A 3KFAA 5E8XA 4ZY4A 5M53A 5HCXA 4M3QA 2QHMA 5AAGA 3EN7A 4Y5QA 3NFGB 4RFYA 3TT0A 3DK7A 2VTOA 3FXWA 4NM3A 4NM5A 3VS3A 3OWJA 4GVAA 4PPCA 4XJ0A 3HV3A 3IW6A 4QYFA 3IQ7A 2C68A 4K18A 4MXYA 4QTAA 1UVRA 1CSNA 2PL0A 4O7YA 5I9YA 5EOLA 4P7EA 3RNYA 3RI1A 4GJ3A 3P86A 4EHGA 3PDTA 5HICA 3QU0A 3ULZA 1UNGA 2XANA 4AAAA 2YWVA 4D4SA 1QCFA 3MBLA 4OAUC 1Q97A 4FT9A 4I3ZA 4YJQA 3VJOA 2R3HA 4PWNA 1IG1A 3L9MA 3ZS5A 1G8SA 4PTGA 4C3PA 2WZJA 4EH3A 5CWZA 4ENXA 4U97A 2BIKB 1UWHA 1E1VA 4IJPA 3N4TA 3PYYA 5GJFA 1CKPA 2IWIA 2JDRA 4TW9A 3VVHA 4H1JA 3BRBA 2Y6MA 4NCTA 5KUPA 2Z02A 4R1VA 2YCSA 4DGGA 2VGPA 4FKJA 3P7CA 1OI9A 2I0HA 3BYMA 3DJ6A 3MYGA 2O64A 4G6OA 4L9IA 3ZO1A 4AT3A 4BDJA 2OK1A 4BDFA 5CSWA 5CU2A 1WBVA 1IAHA 4G3FA 4MD8E 5HO6A 4ZMFA 4G9CA 3TYKA 1UKHA 4EQMA 2W1GA 4IH8A 2W99B 1YOMA 4QPAA 3G6HA 4FF8A 3Q2JA 5GHVA 5AUTA 2R3GA 4EH5A 2CNQA 2OF2A 4ZLOA 2RL5A 2ZAZA 3OWKA 4I21A 3NYOA 5KNJA 4MUQA 3RPVA 2VRXA 4MHAA 4M14A 1IA8A 3A4OX 1F5QA 3FWQA 3QQHA 2GSFA 3W0PA 2AC5A 4YC8A 2ITPA 3D9VA 4FI1A 4PY1A 5AEPA 4IHPA 2WTIA 5HG7A 5EI8A 4AT5A 4M84A 5KMKA 5HVKA 1REJA 5AUXA 2UW4A 4USDA 2BZKB 4TYEA 4LOOA 3VBQA 3FQSA 4M15A 1OL7A 3R9NA 4AUAA 3KY2A 5DI1A 1Q8UA 4JBVA 1GIIA 4RWLA 3F2NA 4JS8A 3NNUA 4FNXA 3TV4A 5LXMA 4H3PA 5J9ZA 5K4IA 4O83A 3QC4A 4CRSA 2IZUA 1Y57A 3FSKA 1WBWA 4UB7A 2YA9A 2VO6A 3W2SA 3CD8A 3LVPA 1H24A 3MVMA 2QG7A 5HLNA 2QODA 1KV1A 5AFVA 2GNFA 5AP5A 2DS1A 1R78A 5ACKA 3WIGA 2B54A 4AACA 5IA1A 3P08A 3K2LA 5IQCA 3BZ3A 2W05A 4BR3A 2HELA 2PE2A 4FV1A 1BMKA 1J7IA 2J0KA 5E8UA 3AT3A 4RGJA 5ANJA 2W5HA 5LVLA 4WIHA 3KMMA 4M0YA 1M14A 4IFCA 4F9AA 3ULIA 4W4VA 4BVUA 4Z7GA 3JR1A 1IA9A 3MPTA 4IAFA 4RIXA 3PWDA 4BI0A 4ANBA 3EN4A 1H26A 3POZA 2DYLA 4XMOA 4EZ7A 4G6LA 2BZHB 2XNMA 4J99A 1CMKE 5M4IA 4CZYB 3I7CA 1FMKA 3MW1A 5E1EA 4PUZA 3IW4A 4YZCA 2G15A 5E8TA 4IB5A 4EOPA 5IU2A 5HO7A 3QZHA 3WF9A 1XH8A 2WQBA 3QRUA 4BJJA 3DK3A 1NVRA 2QHNA 2W9ZB 2X6DA 1YWNA 2XAMA 4UBAA 4X3FB 2PYWA 5IKWA 5AP2A 3FKLA 3QRKA 5FWKK 5TT7A 2XK7A 4HCTA 4QMUA 3ZLWA 4DGOA 2OZOA 4ACHA 5EH0A 3RALA 5M09A 5JN2A 4DN5A 3LPBA 4PNKA 1YWVA 2C30A 5JGAA 2QOIA 2XIZA 3MN3A 3R04A 4ZTSA 5FP5A 3QTUA 4J1RA 5A3XA 1G8AA 4L67A 1RDQE 3E5AA 3ZOSA 3EZVA 4FV5A 2R64A 3Q9YA 4B8MA 4FG7A 1G8JA 3DKGA 4CKJA 4NTTA 3DU8A 2X9FA 3IDPA 4HPUE 3RK5A 3R9DA 4DG2E 2X0OA 1ZMUA 4RFZA 2OFUA 2WQEA 3LFSA 4FVPA 4C8BA 4JI9A 2O0UA 3SOCA 3BGPA 4DITA 4BWPA 2WPAA 4XG8A 3I0OA 3F3TA 2YERA 4KS8A 4AXCA 4GG7A 5K0XA 4HYHA 2BZJA 1YQJA 5CI6A 1PXLA 4C61A 1U54B 5HG9A 5FDPA 2Y4IB 2R0UA 4F9BA 2QOLA 3CTJA 1P4OA 2FSMX 4O6EA 3AKKA 4YO6A 3UJGA 5HTIA 5J1VA 3BL9A 3GC7A 4D4RA 3NAYA 3TNQB 4XG7A 3WF7A 5L3AA 2WEVA 2I40A 4QMOA 4QMLA 2XKCA 4AXDA 3COIA 2HYYA 2WXVA 3ZM4A 4QQCA 2Z8CA 5J7HA 3HAMA 3OROA 4YZ9A 3HP2A 4FV4A 3F3WA 5EM6A 3PSCA 4CFNA 5HEZA 2PVMA 3R28A 3VHKA 4RJ8A 1M7NA 3R7UA 4F09A 4K77A 2WO6A 1PKGA 4UXLA 1G8KA 3DB6A 2B9FA 3UVPA 2QVSE 2XAOA 3RZFA 3P23A 1OB3A 1W0XC 3AT2A 3ORNA 4GUEA 3BCEA 1OL5A 4GV1A 4F9YA 3GCVA 4RPVA 3FMDA 5AR4A 3R9RA 4JX7A 3UG2A 5L8KA 3K5VA 3SDJA 3JVRA 4P2KA 4S2ZA 4LRMA 4FYOA 3LMIA 2EB2A 3R02A 3W8QA 1P2AA 3HV4A 3Q04A 4V0GB 3QXPA 2IVVA 3WARA 4U5JA 2F57A 4FL1A 4I4EA 4QYHA 2WGJA 1RE8A 3AC3A 4N4SA 4RZVA 2PVNA 2F49A 4GW8A 1QPCA 3F7ZA 4I93A 5CX9A 3W2QA 5KMNA 5FXQA 3LCTA 2A98A 2C0OA 2YDJA 2ZB1A 3BBTB 3C4XA 4FK3A 4TYIA 5BYZA 3UGCA 4QP2A 1ZY5A 3HV5A 1ERKA 3G9LX 2ETKA 2X0QA 2XYUA 4OTGA 1XH6A