1U5QA

Crystal structure of the tao2 kinase domain: activation and specifity of a ste20p map3k
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine/threonine protein kinase TAO2
publication title Crystal Structure of the TAO2 Kinase Domain; Activation and Specificity of a Ste20p MAP3K.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 100
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u5qA01
3VS2A 4PUZA 2I1MA 5KHWA 3TM0A 2YM7A 4ZLOA 3KRWA 4YR8A 3FLQA 2PYWA 3V6SA 4L6QA 1YKRA 2F4JA 3C50A 3H4JA 5E1SA 4GIIA 3UVPA 3U6HA 3MBLA 3BIZA 4HYUA 5CXHA 5DH3A 3O7LD 2XCKA 1G8SA 3FMDA 3WZJA 4RZVA 3U9CA 1ATPE 4ANOA 4O96A 3EOCA 1ZARA 4YJRA 4BYIA 2IPXA 2HW7A 2VD5A 4O91A 4F1OA 1U59A 2R3LA 2H8HA 2QCSA 1ZMVA 2R7BA 4LFIA 3DDPA 3OOMA 2C30A 3VHKA 4KUJA 2PSQA 5FP6A 2PVRA 3MY1A 3VO3A 3MJ1A 5IDNA 3DQXA 5LARA 5IQGA 4BVUA 5AR3A 5HE2A 1OIQA 3R7UA 4D2WA 4F63A 1Q8TA 3R9DA 4E8AA 3EIDA 4FKIA 3SG9A 4FOCA 1XH6A 5AP2A 4CFNA 1FOTA 2PVFA 2WMQA 3N51A 2G1TA 3U8WA 1WBNA 3KULA 4A4OA 5EW3A 5IF1A 4I6BA 4D2RA 3E3BX 2GNFA 1YVJA 4M69A 2GQGA 5BVWA 2VV9A 4I0TA 3TACA 4DLIA 4YC6A 3ORXA 3ZO4A 5ANEA 3E5AA 4TN6A 4X2FA 4L44A 4O0VA 2C5OA 3I7CA 3OY3A 4Z3VA 3KMWA 2UW9A 1K9AA 5BYZA 3PXRA 3S95A 3BU6A 1FBNA 5ANJA 3EQIA 4KIOA 5LXMA 5CY3A 2FH9A 2FYSA 2QO9A 3LPBA 4CZTA 3ZSHA 3R9RA 4USEA 4EHEA 4HCUA 3L8SA 3CTJA 4RWJA 2WOTA 3UNKA 1LUFA 1XBAA 3F3VA 3G0EA 4MXCA 5IQIA 3W8QA 2CDZA 1PMVA 2ITNA 3R8MA 3AT4A 3S1HA 3TIYA 2Q0BA 4FSZA 2Z7SA 3C4FA 2UW8A 2Z2WA 2YIWA 4YHJA 2ZV7A 2C6IA 3ZLWA 3QBNA 3R01A 1ZYSA 3R1SA 4RJ5A 4U7ZA 1BL6A 4R7BA 3DV3A 3ALNA 3F3WA 5AMNA 4OTQA 2X7FA 4CXAA 3QGWA 4FV1A 5AM7A 4I0SA 4EEVA 5DR6A 4NYEA 4FVPA 3CJGA 3DB6A 4PV0A 4G34A 3DJ5A 1W8CA 2UZVA 2OKRA 4V05A 4FV0A 2NPQA 4IX5A 4ZXTA 5EDRA 1H0WA 4X0MA 4OUCA 4RIOA 3JR1A 2CLQA 2VTLA 1H1WA 4PNIA 4DEBA 5AADA 2WTWA 4QYFA 4BCPA 5JFSA 3W55A 4XBRA 1NY3A 4CSVA 4FEVA 1WZYA 4WG4A 4YU2A 4DF3A 2VX0A 2ZDTA 4C2WA 5CAVA 3TNIA 3R7EA 4BB4A 3FZRA 2WMUA 2YIQA 2RG6A 3CY3A 3Q5ZA 4FKWA 4FSNA 4AF3A 4FG8A 4U3YA 4BFMA 2WPAA 2P2HA 4BDCA 4BCQA 3BHHA 4NM3A 2CJMA 1U54B 2X2KA 3AC3A 4XBUA 3ZOSA 4AW2A 4Y5HA 5GZ9A 4QQTA 4H05A 2BAQA 3IW5A 5E8TA 4F7LA 1OL5A 1XWSA 2B9FA 4MK0A 4RLLA 2O65A 3V01A 2BHHA 5M57A 5HD7A 4JLCA 1JWHA 2R3KA 4E4XA 5L6PA 3CD8A 3GU4A 4U9AA 2UZOA 2ERKA 3V5PA 3KQ7A 2VWZA 4APCA 5L4QA 2UW5A 1STCE 4RIWA 1HOWA 1I09A 1PJKA 2GS6A 3ZYAA 4OTWA 4ZTRA 2PMIA 3MVJA 2VAGA 3BYUA 3CKXA 3L9PA 4XOZA 5AX9A 4CTCA 3EQGA 3FKOA 3IW4A 3L1SA 3RHXA 4WKQA 2GHMA 1KE6A 4M12A 3H9OA 2BILB 3TIZA 3TJDA 4I93A 1PMNA 2YIYA 3FZPA 3PVWA 2VX1A 1OL1A 2PZYA 2JGZA 2RFSA 2YJRA 3P7AA 2XIYA 3RP9A 4Y73A 4KBKA 4APPA 4AS0A 3LFEA 2IWIA 2F7EE 5CT7A 2BAJA 2R2PA 4FTRA 3F82A 3JY9A 2CCIA 1S9IA 4S34A 4CRLA 3LXKA 3KULB 1OPJA 4IDTA 4M69B 3DOGA 3ZHPC 4Q9SA 2XJ1A 4YZCA 4E4MA 4N6YA 4IVDA 2B54A 2W96B 4M14A 4DGNA 1WCCA 2QG7A 2X8DA 3OVVA 4M8TA 4D28A 1GJOA 1OI9A 5TO8A 3FQEA 1M2RA 5FTQA 3QX2A 3F9NA 1R39A 5HORA 3N4TA 1M14A 3PXKA 5BYLA 3COKA 5JGBA 5CU2A 4GH2A 5D10A 3BYOA 3I5ZA 4AGUA 2WMAA 1YI3A 5TOZA 5IDPA 2XKDA 2GSFA 4UYAA 4Z7HA 3NNXA 4AT3A 3GU7A 5CVHA 2C1BA 3LCTA 2YZAA 4GRBA 2IVSA 4GV1A 4GK3A 4NSTA 1DS5A 3DAEA 1Q97A 3SRVA 5HG8A 4O27B 2OH0E 3ZONA 2J5FA 4ZZOA 1F3MC 4HVSA 3KXXA 3KN6A 2OO8X 3RAWA 3ZBXA 3RJCA 2VO7A 3TN8A 4P5QA 5DWRA 3DA6A 3V5TA 4QMPA 4O1PA 4C02A 4FT3A 4GKHA 4G2FA 3NUYA 2REIA 1AD5A 4U8ZA 4FSWA 3UJGA 5EHYA 2BVAA 4LOPA 4FTLA 4UMRA 2ETKA 5EQPA 4C3RA 3ORNA 4JAJA 4RRVA 5KHXA 5M4UA 3OUKA 5CQWA 3DLSA 3MGYA 2BZHB 4M0ZA 4ZJIA 4GYGA 1YQJA 5T3QA 2PUPA 2WMWA 3QC4A 2E9UA 1Q5KA 1QMZA 4J8MA 3NWWA 1KWPA 2JDRA 4JL9A 4FIIA 3UIMA 5GJFA 5HCXA 5LMBA 3HMPA 4IHPA 4AW1A 2B1PA 3PDTA 2ITVA 3LHJA 4XV2A 3AGLA 5JGAA 1ZZLA 3GENA 4LRKA 3OCGA 4BWKA 5A4QA 4RVKA 3PG3A 4F0FA 2QR7A 4L01A 4YP8A 3UOJA 2EXMA 3R8PA 1UV5A 1W84A 4JBVA 4AW5A 3T9TA 3VBQA 5J9YA 3EFJA 1Q24A 3TCPA 3AT3A 4HNIA 5LCJA 2BDFA 3PE2A 2HAKA 4RWKA 4FTAA 4L52A 3UNZA 4ZZNA 3H3CA 3PJ3A 4X6RA 1H0VA 1JSVA 2X8IA 4RIWB 4NIFA 3GEQA 4XG6A 2QOHA 4JAIA 4AA0A 3PVBA 2QNJA 3WBLA 5BX0A 4EOMA 2BRNA 3KF7A 4L00A 3B8RA 4N6ZA 1OL2A 3EH9A 4TKSA 2NRYA 3B8QA 5B0XA 2WMVA 2B53A 4YC8A 3JS2A 1WVYA 4D58A 2X39A 3R0TA 1Y91A 2ZOQA 2IG7A 4RT7A 2EU9A 4XG3A 2HZ0A 1ZAOA 3W2CA 3A7FA 4EH9A 1YHVA 4BCIA 2XB7A 3Q96A 5LMKC 5CSPA 2FSOX 2YEXA 1JLUE 4V0GA 2R3PA 4E4LA 1PXPA 2F7XE 2VO3A 2Y9QA 1Q8YA 4XUFA 4XX9A 5M53A 3D5VA 2E9OA 3DKFA 4FV4A 4I5MA 4L67A 4N0SA 1EH4A 5ACBC 3BHYA 2C6EA 4AOTA 3Q4TA 4CLIA 2JKMA 2OXDA 4CZYB 4FIHA 4GU9A 4QMNA 3IECA 5J95A 2JD5A 4KNBA 1K2PA 4G3GA 2EUFB 3A7IA 5IH6A 4F9YA 1J1BA 1SVHA 1W98A 3E62A 3MPMA 4DA5A 2PWLA 4F7NA 1YDTE 3KRRA 3OCBA 2R3RA 4AN3A 2IO6A 3BQRA 4LG4A 3E8NA 3B2WA 3R7GA 4LRMA 5C27A 4IE9A 4JVGA 3ORZA 3IDBA 1PMUA 2RG5A 3CY2A 2FGIA 3ALOA 3ZRMA 3DNEA 4DEEA 3P86A 4IWQA 4KKHA 4H3BA 1YHWA 3OUNB 5J9ZA 3QTXA 4O1OA 4HPTE 3D7TA 3FXZA 4O21A 3DY7A 3SRVB 4H1JA 2I0YA 2BFYA 1YWVA 4HCVA 4F99A 3EKKA 3SHEA 5FRIA 3TDWA 1Y6BA 4IAKA 2W1FA 3FMHA 2XIZA 4EUUA 4F09A 3ACJA 3BBTB 4FEUA 1UKHA 4JBOA 5CSXA 3TEIA 3SXSA 3UOKA 1O6KA 4U5JA 4NM7A 2XM9A 2QOBA 3COMA 5EYDA 3U55A 3QUDA 4L68A 3PYYA 5FLFA 1URWA 3HX4A 2ZM1A 2ESMA 2UW4A 4OW8A 2H34A 4HNFA 4IANA 5AUWA 1TQMA 3MB7A 4B8MA 4BTKA 3KCKA 4LMUA 4ZLYA 2QQ7A 3EN5A 4FT9A 2WIHA 4JI9A 5I3OA 2W1EA 1JSUA 1ZWSA 2FO0A 2B7AA 2VUWA 4IVBA 4A9UA 3ENHA 2FB8A 2JIUA 3KB7A 5CYIA 4QMXA 4ZZMA 4ANQA 3O8UA 4F0IA 3OC1A 5AV3A 4S33A 4BI2A 4NWMA 4IACA 5J1WA 3NVMB 2XNBA 2KTYA 1H01A 1NVRA 4AN9A 4CKRA 3ATTA 1JQHA 4KB8A 5GIPE 1P4FA 3S4QA 1H24A 2CKEA 3DFCB 2OWBA 3VC4A 5E8ZA 5M06A 3KF4A 2VTAA 3KRJA 2W7XA 3FYJX 4E6CA 3HAVA 1DM2A 4ASXA 3R22A 3UQFA 5KMIA 3MTFA 4NT4A 3ORMA 5D12A 3TNQB 3SW4A 5IKWA 1H4LA 4O82A 3FQSA 2J90A 3OBGA 4W4VA 3C4WA 3C51A 3W2RA 4NIFB 1E1VA 3K5VA 4C57A 2XBJA 4IX6A 1V0OA 3MFUA 4JBQA 4QP9A 2W4KA 5DRDA 4HW7A 2XK6A 1Q41A 2YAKA 4GCJA 4E73A 4WNOA 5T68A 4FUXA 3UBDA 4IB3A 4O81A 3OD6X 3F69A 3NUAA 3TZ9A 1UU9A 4JR7A 3LCKA 3FC2A 2CHLA 2GU8A 4D55A 3Q4CA 4PF4A 4FEWA 4AFJA 4AUAA 2WELA 2XEZA 3NDMA 5EI2A 4L46A 4ZY6A 4FTTA 3HV4A 1W83A 3OXTA 4V0GB 3D14A 4RX5A 5FTGA 2JEDA 5DNRA 3FEGA 4FTQA 5IA3A 5GJDA 3NMUF 1JOWB 2QODA 4NKAA 3FI2A 3HA8A 4R5YA 3K2LA 5H8BA 1IAJA 2W05A 1A9UA 1BMKA 2HELA 2ITZA 3D5WA 2GMXA 3E93A 3GQIA 2O63A 4K0YA 4UBAA 3ULIA 2X81A 2OF2A 4F6UA 2C0IA 5CF4A 2XYNA 4R1YA 1O6YA 5G1XA 3HV3A 5DR9A 4FA2A 5FEQA 3Q4UA 2WTKB 3NIEA 4M7IA 4O86A 4RQKA 3HV7A 3UYTA 3F66A 1WMKA 4TWPA 3KK8A 5IQAA 5DRBA 4AE6A 4O0RA 3D7TB 4I22A 4QP2A 3QWJA 2IZRA 4GT4A 2OXYA 5AP0A 2IN6A 4O7VA 3ZH8A 3DTWA 3S2PA 2DQ7X 5LQFA 3R8UA 3GCVA 3FY0A 4CFVA 2PHKA 3F3TA 3UVQA 4PDPA 2ITYA 3PRFA 2HY0A 4I5PA 4L3LA 3K54A 3GOKA 3DTCA 4BKYA 2WAJA 2IJMA 3SOCA 3PLAE 3U51A 2ACXA 4YTFA 2GDOA 4ACMA 5K9IA 4MYGA 3DGKA 3C4ZA 1R78A 4ID7A 1B39A 3ZSIA 2DWBA 3SAYA 3FWQA 3Q6UA 3QYZA 5EI8A 1IRKA 5DGZA 1PXOA 5E8YA 5FQDC 3ANQA 4MF1A 2R64A 4TYHA 5ANGA 3HMMA 3GC0A 3Q9ZA 1SNUA 3G0FA 3BEAA 4PDOA 4RC4A 4X21A 2W9ZB 2ZB1A 3P1AA 4F4PA 1IA8A 3G5DA 4OBPA 3EZRA 5F4NA 3ZFYA 3R9HA 3UO6A 3T3UA 4RGJA 3WZEA 1UVRA 2WZJA 2PL0A 1PRYA 2V7AA 3BHUA 3ZDIA 4GUBA 2QVSE 3CLYA 4R7IA 1XHAA 1J1CA 4R5SA 3LXNA 4LL5A 1H1PA 4K77A 4UMTA 4EWQA 2ZVAA 2JAMA 2OJJA 4ALVA 5F20A 4M15A 1L3RE 3KRXA 1MQ4A 3C0GA 3NW7A 5E91A 2WMSA 4RFZA 4EC9A 2RKUA 3C9WA 3LFBA 5K4IA 3MFTA 3UODA 5AUYA 3P5KA 3T9IA 2JLDA 5IQEA 5BVFA 4BIBA 4FICA 4AFEA 2B0QA 2BIKB 2WEVA 2F9GA 4DG3E 5AA9A 4HGEA 3FJQE 4I5CA 2IZSA 4FSRA 2R0IA 4V01A 5CWZA 3ATSA 3NLBA 3BU3A 4BYJA 3LAUA 5F94A 4C37A 2VWWA 3EN7A 3HRBA 5EHOA 2CPKE 3GBZA 5TKDA 3VUMA 1W82A 4TYJA 4ANLA 3QUPA 4XOYA 2WD1A 2WFYA 4UWCA 4D4YA 5CALA 1SNXA 5AP4A 5KMOA 3F2RA 3R9NA 3PTGA 1GOLA 2VTRA 2ZMDA 4LI5A 5T6KA 3QLFA 2JKQA 4ZLZA 3NAXA 4YO4A 5EDPA 3QQHA 2W1HA 3CSVA 3JY0A 2WMTA 3ZEWA 2BROA 1R1WA 3KY2A 3QTSA 4LYNA 4DGOA 5J5SA 3QLGA 5E8SA 3RK5A 2UZUE 2YITA 2I7QA 3CJFA 2QOKA 3FMEA 3U9NA 4QRCA 4XV9A 5BUJA 4WG5A 3MY0A 5AUZA 2OJFE 5CF8A 4BHZA 4FVQA 4J53A 5FXSA 4BDEA 5BPYA 5IA5A 4CT1A 4DFZE 4QOXA 3WF6A 3HP2A 3EN9A 3OFMA 4OT6A 5LMKA 1RJBA 2HWPA 4GMYA 4H1MA 3QL8A 1QCFA 2XS0A 5DOSA 5HI2A 3QQUA 5FEDA 1SM2A 3TG1A 4DFYA 3NSZA 4PTCA 2BHEA 3LFAA 4K6ZA 3A7GA 4TRLA 3IGGA 4JDJA 4I21A 2OIQA 2Z60A 2B4SB 4DHFA 3BBWA 3POOA 3PFQA 2JFMA 3IOKA 3L9MA 4QQ5A 4LQMA 3SDJA 4FSMA 4ZEGA 2SRCA 4RG0A 2J5EA 4N57A 1CKJA 3VQUA 1Z9XA 4BKZA 2JDVA 3A8WA 3LCSA 3R9OA 2UZDA 1QL6A 4DCEA 2IZUA 2OH4A 1OMWA 5DFPA 1FVVA 2OZAA 3V04A 5BVNA 3F5UA 4BC6A 1H1QA 3RZBA 3V8TA 2VTPA 4O0XA 4CYJA 4PMPA 1YHSA 1IEPA 2C3JA 4TYHB 4NCTA 5CEPA 2W0JA 3BHTA 3LCOA 4L7SA 5HKMA 5C03A 4QYYA 5E9EA 5DT3A 2WTVA 4XS2A 2PMLX 4HZSA 3RNYA 5BQ0A 4FNXA 4C38A 5HHWA 5EM8A 5HBJA 4PL4A 4FTIA 4ZSEA 1J7UA 3PJCA 2PZRA 4ENYA 2V62A 4FUYA 2QURA 5HTBA 1OPLA 3QC9A 5IEYA 4L45A 1PHKA 5I9XA 3TUDA 4ERKA 4FT0A 4KIPA 3FLZA 4NTTA 2I0EA 4F9AA 4P7EA 4PX6A 4FI1A 5HO7A 3UO5A 2UW7A 2VWVA 4XLIA 2C6OA 2WQNA 5HOAA 1OIUA 2GS2A 4EKLA 3DXQA 1OKYA 4EOQA 4J95A 4U3ZA 5HO6A 1OITA 2P4IA 4C4EA 5GIOE 3PY3A 3I60A 4WHZA 1GZKA 3NEWA 4C61A 4ZTQA 5BYYA 5HNIX 4QQJA 3ORIA 5CNNA 3U4WA 5KZ0A 2AUHA 2B9JA 3TV4A 3LOKA 1Z5MA 3LZBA 3ANRA 2YA9A 2Y4IB 2GCDA 5JQ5A 1ZOHA 4BDIA 4DBNA 4K11A 3G51A 5C1QB 5K5NA 5IQDA 5EM5A 5CENA 3OWJA 5LVOA 3P23A 4J96A 4C4FA 3HYHA 1W0XC 4U97A 4EJNA 2HXLA 5KMNA 3TTIA 3ZLXA 3DJ6A 4U0IA 3LMHA 1VYZA 4BGHA 1ZYJA 3FLWA 2Z7RA 3BCEA 3QCQA 4XP2A 3PY0A 3HUBA 2CKOA 4OTRA 3PZHA 4DN5A 4YO6A 4MAOA 4JX7A 2XMYA 4G31A 4X3FA 3N4UA 4IX4A 3POZA 4MF0A 3EB0A 3ZLYA 3ZXZA 4EJ7A 5AUXA 2B55A 5L8KA 3UZRA 4JQEA 1E9HA 5KX8A 3GCQA 1Q8WA 4PTEA 5H2UA 4JR3A 4JOAA 3OXIA 2UZEA 3FSKA 4DG0E 3EMGA 3QYWA 1Y57A 4PDYA 3DPKA 2PK9A 1FVRA 3QKLA 4MD7E 5JFWA 2PVMA 1J7LA 4TWNA 5KNJA 4YNOA 4EH3A 1JSTA 3BZ3A 1BKXA 2VTMA 3WZKA 2HIWA 4UXQA 2QU6A 4QMQA 3OP5A 4KKGA 4J97A 4II5A 3SXRA 3UIBA 3F3ZA 4W4XA 4PL3A 2FUMA 4FTUA 5AR7A 3R83A 4DEGA 3BWJA 1VZOA 2G01A 2WTKC 2YWPA 4GU6A 1PW2A 4PMSA 4ZSGA 2W17A 4IJPA 3E63A 5TE0A 3NW6A 3NYOA 3P79A 4D2PA 2BCJA 2VTOA 4PPBA 3QFVA 1TQIA 5IZFA 1O6LA 2OJGA 4O7YA 1QPDA 5CAQA 4AZTA 4RWLA 1HCKA 4DH7A 4FEQA 2O2UA 2VX3A 3LM5A 4LGGA 4WSYA 3W33A 2CNVA 5CSVA 3TKUA 3EL8A 5CVGA 1KE8A 1FGIA 3LM0A 2OZAB 3O51A 1UWJA 2HZIA 4AGWA 5CEKA 3QA8A 4ZTNA 1MRVA 4D1XA 5KBRA 3KVXA 4U40A 1FVTA 1PYXA 3MFSA 3OT3A 4B6LA 4R78A 5CSWA 3SW7A 2JBOA 4AZEA 5KKRB 1IR3A 1SVGA 2QU5A 3F2NA 4M0YA 4RC2A 5CEMA 4G3FA 3FZTA 1XBCA 2CSNA 2YERA 4OTDA 1WBVA 4DH5A 4YLKA 4RX8A 3VF8A 4S32A 1R0EA 3R30A 3W10A 3FBVA 1YRPA 1BI7A 3PZEA 3EQBA 3QRIA 3MH1A 4M3QA 4WNPA 5IUHA 3R8LA 5KMMA 5LCKA 5HLWA 5EDQA 5CEQA 4N4SA 4AU8A 4AGCA 2XKCA 3CPBA 5TT7A 1UU7A 4TZRA 5HG5A 4E6QA 2QOIA 5A14A 5AUUA 4RPVA 2V22A 2VNWA 4PQNA 3VRZA 3OY1A 3RMFA 3HUCA 4NM0A 5M44A 5JQ8A 2GNLA 2YM6A 5JK3A 3V5LA 4GVAA 3ZBFA 2QHNA 3WILA 3IW6A 3JUHA 3NR9A 4NFNA 3EQRA 4H58A 4QQCA 3QQGA 3RK9A 3RPOA 4AZVA 1FQ1B 4YZDA 4DFUA 3GC7A 2ZJWA 2C6TA 3DFAA 4IC7A 4CYIA 4USFA 4XG9A 4BZDA 4YPSA 5L3AA 5AA8A 5TR6A 3Q04A 1UU3A 3MY5A 5M4FA 1JAMA 4I4EA 5CAUA 2VWUA 2ZV2A 5AR5A 4XG4A 2RFEA 4KS7A 3W2QA 2PVLA 3AC1A 2OGVA 3SC1A 1ZLTA 4X3FB 2EB3A 4S31A 2CN8A 4ZIMA 4GS6A 3U54A 4FV9A 5HNGA 3GVUA 2YLFA 5J9LA 1Q61A 3A60A 3DCVA 4KD1A 3FI3A 3UPZA 3TI1A 4QMMA 3MYGA 4FZ6A 4GFOA 2X0GA 4L3JA 4QMWA 3V5WA 5IUGA 3U6IA 3D15A 2XNMA 3CTHA 1KV2A 2BRBA 3C0HA 4JX3A 2QHMA 1J3HA 2RL5A 3IOPA 2WQOA 3F2AA 5CU3A 2AC3A 2VWXA 2A1AB 4QMTA 4X2GA 4U41A 5DEYA 3OWKA 1O9UA 2ZB0A 4Z55A 5M51A 3V8SA 3B2TA 3I81A 5EYKA 3VS0A 3GU5A 5HESA 4O38A 2R4BA 3DS6A 4IAAA 5CS6A 5IA2A 1BX6A 3LFFA 4D5HA 2X2LA 4XCUA 5EYMA 3M42A 3PA4A 2ZV8A 5HGIA 2ZM4A 1CMKE 2R5TA 1M7NA 2YCSA 2VN9A 4L42A 3Q6WA 4GG7A 4RJ8A 5E8UA 1SZMA 4GK4A 5B7VA 5CTPA 3CQUA 3NIZA 4XG8A 1SMHA 4BDHA 3PPZA 3FY2A 4FV2A 3C0IA 3QHRA 3PXYA 3P7BA 3VBXA 3VS1A 1A06A 2XF0A 4GIHA 4MBLA 4MWIA 3IKAA 2HZNA 3FI4A 3MFRA 5HG9A 3S00A 1OBDA 4UMUA 4R77A 4E5BA 3SLSA 3BGQA 2J50A 3VBWA 3COIA 5FP5A 1OKVA 3QZIA 4F7JA 2XBAA 3AD6A 3E7OA 4FKQA 4XYFA 3RK7A 3AMAA 4XG2A 4WA9A 5CU0A 4X3JA 5AP3A 3D2IA 4WBBB 5HE0A 3I6UA 3LVPA 4UN0C 3FI8A 3CEKA 4RJ7A 5C8MA 3VS3A 3ZLSA 5AAEA 1H07A 3UPXA 4DAWA 4YBJA 5HCYA 1H8FA 2XIKA 3NX8A 4FV6A 4W9WA 4XNEA 4RJ4A 5AUTA 4CG8A 5KUPA 3PIYA 3MPAA 3QQKA 3QX4A 1OBGA 4I4FA 3D9VA 3E7VA 3A99A 3FLNC 3HECA 4OTFA 4B0GA 4QTEA 4XV1A 1PF8A 5M07A 4O7ZA 1Q3DA 2R3JA 2WB8A 3FHIA 4XV3A 4UMPA 3FLSA 3QZHA 1AGWA 4A4LA 3KXGA 4FMQA 4YZBA 4NJ3A 1Y8YA 3QQJA 4DTAA 4MVFA 3Q2MA 3P0MA 2JBPA 5IEVA 2G2FA 3ULZA 1P5EA 4FT7A 1GNGA 4J71A 3OMVA 3NAYA 2PUNA 4O0SA 3OBJA 4IDVA 3DDQA 4ZJVA 2B9IA 4ZOGA 5EM6A 5AV0A 4D4SA 4FKVA 3U87A 5J7BA 2GTNA 2JAVA 4G16A 4IMYA 3G90X 4M13A 5FG8A 1JVPP 4LM5A 3QA0A 4LOQA 1G3NA 3RWQA 2R3GA 4AZSA 4IVCA 3H10A 3R7YA 4MXYA 4I6HA 4RZWA 4MQ2A 3HGKA 2Y4IC 5EFQA 2FA2A 3G6GA 1V1KA 3RZFA 5BVKA 2XNGA 4GJ3A 3UIUA 3PWDA 4YZ9A 5A4EA 3OEZA 3ZS5A 4BCMA 5IU2A 2C0OA 2PZIA 3FSFA 4TYGA 3RPSA 3KXZA 5L2WA 2H96A 3MN3A 4H3PA 3VVHA 4B7TA 4CGAA 4KSQA 2EXEA 5KO1A 4F0GA 2DUVA 3QRTA 3OZ6A 4HYIA 2ETMA 2WQMA 4QYEA 3I7BA 3H0YA 5KBQA 3TV6A 3TV7A 3AOXA 5HX8A 3MS9A 4RIYA 5AR8A 3NZ0A 2GQSA 1ZY4A 2DS1A 5IUIA 5IMEA 3UZPA 2VGPA 3DKOA 4I92A 2I40A 2Y6OA 3AD4A 1CKPA 2H9VA 4YZNA 5LVNA 3UE4A 5H8EA 2Q83A 3BEGA 3I0OA 5FEEA 4ORKA 3O71A 3VBYA 4YBKA 4EH6A 2J7TA 3PJ2A 2VGOA 4AX8A 4F6SA 1BUHA 3KVWA 3HDMA 5D7VA 4FKLA 3WI6A 3LXLA 2OW3A 2CGVA 3HLLA 5HLNA 2HOGA 3HMIA 4G5PA 3G2FA 3KMUA 1ZRZA 3PE1A 4R1VA 4BN1A 5J79A 5B2LA 3BGZA 4IAZA 3COHA 3OTVA 3LJ2A 3ROYA 2C5XA 4QMYA 3Q4ZA 3Q60A 3KL8A 4PP7A 3D83A 3VHEA 2GPHA 1Q62A 4EHGA 2XYUA 4MX9A 5JRQA 5HLPA 3P08A 1LR4A 4EONA 1B6CB 5CZIA 3AG9A 2BZIB 2WU6A 4QMVA 2QKWB 4UB7A 2W06A 3RKBA 2UVZA 1JNKA 4FIGA 3IO7A 5E4HA 4NCTC 4G3CA 5EYCA 4YJTA 4BDKA 4XRJA 4RQVA 4F64A 4ZY4A 5KKRC 1YXUA 4U81A 4PMTA 2YLEA 3CIKA 4D2VA 4DH8A 5EW9A 4DG2E 4DTBA 3UOLA 4AACA 4DH3A 2PVHA 3D7ZA 1FMOE 4XG7A 4BHNA 4JDIA 4DTKA 1OIRA 1S9JA 2F57A 5AP6A 4JXFA 5ANIA 3SGCA 2P2IA 4EK4A 3PSBA 2UZWE 2HXQA 2F49A 2QOLA 4RX7A 4WD5A 2AYPA 1HCLA 3I1AA 2W1DA 4GT3A 4DCAA 4QYHA 4FKTA 3WF9A 3R21A 4O7LA 2CKQA 1OZ1A 2XJ0A 5M55A 4Q5EA 3A61A 4F9WA 1ZMWA 3FMJA 3K3IA 2C1AA 3CGOA 3ROCA 4GJ2A 3RHKA 4RX9A 3VW6A 4O7RA 4FIEA 3HNGA 4ITHA 5HICA 4BDJA 5DN3A 4FNZA 5EKNA 4UMQA 5GJGA 4FBXA 4YSJA 4DFBA 1YOLA 4KA3A 2HYYA 5AP7A 1PXMA 2PE1A 2ZAZA 4ZK5A 3PJ8A 3TZMA 3MA3A 4ITJA 5C8KA 4ZTLA 3LCDA 4Y72A 3UGCA 3MIYA 4LMNA 4O6LA 3NVKI 3AMBA 3F7ZA 3AC4A 4OR5A 4RIYB 5EI6A 5JRSA 4X3FC 2IW8A 1QPEA 1GZ8A 4CG9A 4JG6A 1UNGA 4AWIA 4A7CA 3BYSA 5ANOA 3QCSA 5BUEA 2CMWA 2OZOA 4CMTA 3GOPA 2YIXA 2X4FA 4IFGA 4AAAA 1H27A 3RAIA 5DVRA 3QZFA 1U5QA 2P33A 1PKGA 1VR2A 3CCNA 4CQGA 4EOPA 3OROA 4KIKB 4TYEA 2BFXA 4CFWA 3VUTA 2OFVA 4GFGA 3BLRA 4WSQA 3ZXTA 1OIYA 4C7TA 4F08A 4C2VA 4YJPA 2ITTA 4G6LA 4U6RA 4CZUA 5JFVA 5L2TA 2J6MA 5I9ZA 1G8AA 4R8QA 2WTIA 1E1XA 4CEGA 5AEPA 2QO2A 3VF9A 3VN9A 3GFEA 3RPRA 3PP1A 4FZAB 4S30A 4O7NA 3ZO3A 3GXLA 2VO0A 5CX9A 3GCPA 2GS7A 3DT1A 4IB0A 4YTHA 3SQQA 5CAPA 3W2OA 3I0QA 4WRSA 1Y6AA 3CR0A 4FODA 4EYMA 3FL4A 1ZMUA 2VWYA 4J8NA 3MVLA 4PMMA 3SA0A 2R7IA 2W1GA 5ETCA 4AW0A 3ZZEA 1ZOGA 3PA5A 3HA6A 2E2BA 4EK6A 3PPKA 5CAOA 5CQUA 5A4TA 3QRUA 5LMAA 1JKTA 5HVJA 2P3GX 4BCFA 4YJQA 4EBVA 3F61A 2R3HA 4I3ZA 2O5KA 3P7CA 2PZPA 4EBWA 3C4EA 3LMGA 4HJOA 4JT3A 3C5UA 3EJ1A 4R6VA 3DXNA 2O8YA 4J1RA 3R7OA 5CI6A 2VTIA 3ZO2A 3IDPA 3VUHA 3BQCA 3IGOA 4FG9A 3RCJA 4BI0A 3FQHA 3O2MA 1UNHA 4O2PA 4Q5HA 2F2UA 3EQDA 4A9RA 3QD0A 4D0XA 3N4VA 4ZTHA 4ZJJA 4ACGA 2OSCA 1U4DA 4JQ8A 4W4YA 4KABA 5F9EA 2PE2A 3P4KA 4NTSA 2A27A 4DEAA 4QMZA 2XJ2A 3HMNA 4YPDA 3DAJA 4AXAA 4A4XA 1BLXA 1TVOA 2W4JA 3HV6A 3DNDA 3ZUVA 3WZDA 1M2PA 3D4QA 3R8ZA 4TT7A 2OXXA 2WNTA 3E3PA 4AA4A 2Q0NA 4QP3A 4BWPA 3BHVA 1QPCA 3BI6A 5AIRA 4BBMA 3TNHA 4ZSAA 4JJRA 1TKIA 3LQ3A 3ZTXA 5E8VA 4P90A 3UG1A 2B9HA 4RVMA 5FD2A 3TNWA 3TTJA 4M68A 3SXFA 3L8XA 3DXPA 3SX9A 3VWAA 4PY1A 2BKKA 4RJ3A 5HIDA 3LLAA 3ZEPA 2QONA 3ODYX 4FTCA 2UW3A 3C4XA 4JIAA 2J51A 3LLTA 2XVDA 4HGTA 3RALA 2RF9A 1P4OA 5JFXA 4YUQA 3BELA 4DINA 3W8LA 4Y83A 4E26A 4IH8A 5AAGA 3ZRKA 1Q3WA 4RJ6A 4BGQA 4E4NA 5GZ8A 5JEBA 1X8BA 3V5JA 1F5QA 4CMOA 4U80A 4K8AA 4ASZA 3FMLA 3NYVA 4UWBA 4BTFA 2YZLA 4W4WA 3ZDUA 2ITPA 4TXCA 1XQZA 1JKSA 5H8GA 5DE2A 4RWIA 3BX5A 4OT5A 4D4VA 5FWKK 5CANA 3O23A 4D2TA 2JIIA 3ZFXA 4NH1A 4EZ5A 3DZQA 4XMOA 3GC8A 4ONAA 2JKOA 3P78A 3NCZA 4GG5A 2E9NA 3DKGA 3NPCA 4HYSA 2UVXA 5CEIA 3TL8A 4PNKA 4PPAA 2QC6A 2R3FA 2XRUA 2GFSA 2OI4X 2UW6A 3JVSA 3GI3A 4C4HA 4PDSA 4RFMA 5ANDA 1ZXEA 2IZTA 3MW1A 4IADA 2YM5A 3F5GA 4IAFA 5I9UA 3CTQA 3ITZA 3MI9A 4AA5A 4R3PA 4C3FA 1T45A 3GCUA 4ITIA 3LIJA 2RGPA 4IM3A 1OM1A 4L7FA 4JG8A 4AG8A 3RVGA 4KSPA 2RFDA 4R3RA 1BI8A 4QMSA 3IS5A 5E1EA 2EVAA 2PZ5A 3CE3A 4E93A 5FDPA 3I6WA 2NNWB 2A0CX 3HMOA 5DYJA 4HVIA 1XBBA 2UZNA 3LFNA 1YXXA 1QPJA 2GQRA 1LP4A 2ITUA 5IQBA 2BR1A 3OHTA 2JDTA 4TWCA 4FL2A 4G17A 4TY1A 5EQEA 4C59A 5HTCA 4TTHB 3ZM9A 4IM2A 2W1CA 2JC6A 5AV1A 4EK8A 4FT5A 2C6KA 4NKSA 4IX3A 1YXTA 4FZFB 1URCA 3QUEA 4G1WA 5ANKA 3ZZWA 2FSLX 4FC0A 4FV8A 3VAPA 4C36A 4D9TA 3MESA 5A3XA 1GIJA 2XCHA 3PG1A 3M11A 5DHJA 3KGAA 1YXVA 4EQMA 3IW7A 3LE6A 4DEDA 2QO7A 3WF8A 1REKA 4YMJA 4CQEA 1DI9A 3HAMA 2PVKA 3WYXA 4AN2A 5JH6A 1GIHA 3QZGA 3PXQA 3RAKA 3TT0A 4EH4A 2Z8CA 2W1IA 3KMMA 2YCRA 3PA3A 1A48A 2ETRA 3R63A 3L8VA 3R8VA 4KAOA 3R7IA 2HCKA 3V8WA 4EH2A 4FV7A 4LV5A 3F3UA 4IZ5A 3MH0A 5E8XA 3UVRA 4KBAA 2X1NA 3ACKA 3C13A 4EHZA 1IA9A 3A62A 3FLYA 2QOOA 2OJ9A 5J87A 2BDWA 4JNWA 4DEIA 2V7OA 2YJSA 3THBA 3AD5A 2YN8A 5AWMA 3NCGA 3TKIA 4FGRA 1ZYLA 4G9CA 4GK2A 4Y46A 4Y85A 4O83A 3GGFA 5AUVA 3UMWA 1PXLA 4FTKA 5M09A 4GVJA 3FPMA 4D2SA 3E64A 2JKKA 4IB5A 3VIDA 1KOBA 4EZ3A 4DYMA 3OOGA 1VEBA 2YFXA 3QGYA 3VBTA 4JQ7A 1H00A 2X6EA 2R0UA 1B38A 1WFCA 2C68A 4TYIA 4YC3A 3OS3A 3KN5A 3OT8A 3BYMA 4PWNA 4FKSA 4IM0A 4F1TA 4ZMFA 2UZBA 4HOKA 3PSCA 4Q2AA 5DI1A 1WBWA 4BBFA 4I6FA 4CV8A 5CF6A 4BICA 3JVRA 3W16A 4QO9A 1BL7A 4WIHA 5CU4A 3SD0A 5IPJA 1CTPE 4RA5A 2J0MB 4ACHA 4UEUA 3DBQA 5CLPA 2BZJA 4Y5QA 4A07A 2PUIA 2QOCA 3HEGA 5CZHA 1WBOA 3PWYA 5EM7A 4A9YA 2VTQA 3FC1X 4FSTA 4GL9A 5AAFA 1IAHA 3VQHA 3DK7A 3UOHA 5JKGA 5KCVA 2FSTX 3NNWA 2PVNA 2FSMX 2WHBA 3C7QA 3QCYA 4QP4A 4AT5A 4C58A 2JITA 2VTSA 5JMSA 5E8WA 5J5TA 4J98A 3KU2A 2UVYA 1YI6A 4KIQA 1PXIA 3TDVA 3CS9A 3D2KA 3ERKA 2JDSA 1APME 2PMOX 4TWOA 4X2NA 4G3EA 2HK5A 5JZNA 3TKHA 2CGWA 4I1ZA 4F9CA 5KMLA 2Y4PA 2W5BA 3OWLA 5C9CA 4WUNA 1UWHA 4EOJA 3EYHA 3A2CA 3VS7A 3V6RA 2ZYBA 2PULA 3FE3A 2HZ4A 2X8EA 2ZMCA 3Q9YA 4H3QA 1OUYA 4AT4A 2R3IA 2GNIA 3ZSGA 3QCXA 4TNDA 3GT8A 2WQBA 5M08A 1AQ1A 1M17A 1R0PA 5ETFA 3E8DA 3BRBA 3EN4A 4KKEA 3KA0A 2FVDA 5L6OA 3EQHA 5AV2A 4EKKA 3UDBA 1DI8A 3C4CA 1Q8ZA 4EH5A 3KREA 3BV3A 3HRFA 2YDKA 3G6HA 4FSYA 5BVDA 4BDDA 5JT2A 4OTIA 4FF8A 4CT2A 4C35A 1FPUA 4H36A 1JBPE 5FDXA 3K5UA 3UC4A 3CD3A 4FKUA 3UG2A 5IG1A 5L2IA 4FKOA 3EKNA 4C0TA 4DC2A 3DZOA 4FNWA 5LOHA 1PXKA 5D1JA 3G33A 2E9PA 2W9FB 3QXOA 5AFVA 3H9RA 4QT1A 4FL3A 2BRMA 2E9VA 2NO3A 1OUKA 1MUOA 4OLIA 4AQCA 4C33A 5I5ZA 3DJ7A 4JDKA 4JRVA 1LPUA 1VYWA 3W18A 2R9SA 3E8CA 3QD4A 3RGFA 5I3RA 3R6XA 1OKZA 4G6OA 4WBOA 4PTGA 3R1QA 4C8BA 4E6AA 2OLCA 5HG7A 2WEIA 5A46A 4QD6A 3ZFMA 3AC8A 1NVQA 5GINE 2JFLA 2UV2A 4YLJA 4ZTMA 2HWOA 4LUEA 4ANBA 2B52A 2XNPA 5KMKA 3QXPA 5J1VA 4NL0A 4RIXA 4F7SA 4NFMA 5BVOA 2J4ZA 5HQ0A 5DBXA 2BUJA 4YHFA 5DIAA 3LW0A 5ACKA 2ITOA 4M66A 4AZWA 2EWAA 3L9NA 2Y6MA 1YXSA 2R3MA 5M4IA 1GZNA 1XKKA 2C69A 2GNGA 4EL9A 5IH4A 3E88A 5E7RA 4EORA 3U4UA 4UY9A 3ET7A 3O8TA 4QTBA 1PKDA 3ZU7A 1XH4A 5DT4A 4BIDA 4OTGA 3HZTA 5CASA 4IC8A 4GKIA 2BAKA 1Q99A 4ACCA 5AV4A 1CM8A 3C5IA 5EOLA 1FINA 4HYHA 1XJDA 3FYKX 4DH1A 4EQCA 3NRMA 1WAKA 3EFLA 3ZRLA 2QI8A 5A6OA 1OKWA 2WTJA 4WG3A 3ZUTA 2GTMA 5FGKA 5FBNC 1OL7A 3O8PA 2W5HA 4I6QA 4E20A 4FZ7A 3BLQA 3ENMA 1H28A 3R71A 5LJJA 4FTJA 1NA7A 4YTIA 1GZOA 1PY5A 3IK3A 3BPRA 1JKKA 4BCJA 5HIEA 2GNJA 2J0KA 2UW0A 3DBEA 3RPYA 4K18A 5AP1A 5HVKA 4C34A 2O64A 4RFYA 1J91A 1XH8A 4JS8A 4ASDA 4NZWB 2CNUA 3VNTA 4LGHA 5HBHA 5C8NA 4FTOA 5H9BA 4KS8A 5HEZA 4C62A 2BMCA 1RDQE 3ORKA 3RAHA 3NUPA 1OECA 3FZSA 3GC9A 4ZSLA 4D5KA 2J0IA 4ZMEA 3EFKA 4JG7A 3KXNA 1XR1A 2ZV9A 3OEFX 5CU6A 3RCDA 4IQ6A 1R3CA 2OBJA 4XLVA 4ALUA 3MSSA 3HV5A 3KCFA 4EWHA 2I0HA 2PU8A 4D1SA 3E87A 4UALA 4D4RA 5IEXA 3LFQA 2XKEA 3OWPA 4IZYA 4ARKA 4P2KA 4E5WA 3H9FA 5L2QA 3UO4A 5IQCA 3DKCA 5M56A 3AQVA 3DBDA 1UKIA 1ZOEA 1DAYA 2VNYA 2WMRA 1KE7A 2RSVA 3F88A 3LJ0A 1GY3A 4U42A 4RVLA 5HNBA 5B2MA 3CGFA 2W5AA 3UYSA 2BZKB 5EH0A 3II5A 4BY9E 5HBEA 2JIVA 4DE4A 5KE0A 3F5XA 4KBCA 4ZTSA 4A06A 5AR4A 3D94A 1H1SA 3WF5A 4O2ZA 3ZMMA 4EH8A 4HVGA 4CLJA 4Q9ZA 5EW8A 2CGXA 4MTAA 4YJNA 3O0GA 4ANNA 4EUTA 2I0VA 3O7LB 3R2YA 3AMYA 3MDYA 4O7TA 4IFCA 4CCUA 4ZS0A 5ICPA 2YIRA 4QP6A 2F7ZE 3RPVA 4QTDA 3G15A 3A8XA 3S0OA 3WE8A 2WTDA 3MJ2A 4RIXB 3TZ8A 3R28A 3UMXA 3ZC6A 2YM8A 2DYLA 4QTCA 2XK9A 5HCZA 3JPVA 4OAUC 4DT8A 4CMUA 4OBOA 5CVFA 5I9VA 4I41A 4EI4A 3QWKA 3GFWA 1V0PA 3TJCA 2BTRA 3QKKA 5HE3A 2QOFA 3R1YA 5HE1A 4YTCA 4L3PA 5IQHA 3NNUA 3QHWA 5CI7A 2QKRA 4MXZA 4BI1A 4EOOA 5C26A 4K2RA 3UP2A 2OF4A 3EYGA 2ONLA 3FDNA 3FL5A 3HP5A 4JIKA 2W4OA 2CNQA 3LQ8A 2RIOA 3PLSA 3VJNA 4HPUE 5LWMA 4Y95A 4BCGA 5AX3A 4C3PA 2XRWA 5BMMA 2VRXA 3CKWA 1I44A 3W2PA 4C4JA 4F9BA 2OIDA 2CCHA 1RQQA 3AC2A 5BNJA 5CXZA 4IZ7A 3PUPA 3UIXA 4MXXA 4DFXE 4F6WA 1Y8GA 3QKMA 4O0YA 4QP7A 1KSWA 4MWHA 4PL5A 4X2JA 5GNKA 4YURA 3L8PA 1DAWA 2CKPA 1YDSE 2WIPA 4F70A 5F95A 1OPKA 2WOUA 4KWPA 4YNEA 4BZOA 4FEXA 4RLKA 4BIEA 3HRCA 3EQCA 4HVDA 2HENA 5LVLA 3R04A 4OTHA 2A4LA 2YHVA 3Q3BA 5EKOA 1MRYA 3NUNA 2YACA 3R00A 4LL0A 4LOOA 4M84A 2ITQA 4FYNA 3QD2B 3U6JA 4BWXA 4YSMA 4PP9A 2XK3A 4ANSA 4EC8A 1CSNA 1OB3A 3ORLA 5DLSA 4ANMA 4C4IA 3GCSA 2HY81 3HL7A 3Q5IA 3W1FA 4BGGA 2CGUA 5BMSA 5I9WA 1H25A 3A4PA 4PPCA 4MD8E 4RC3A 1H1RA 5FBOA 2V5QA 3Q9XA 1M2QA 2PPQA 3DQWA 4KIKA 4L9IA 3QRKA 1PYEA 2J9MA 4HVHA 4GYIA 2VO6A 3KXHA 2QD9A 4BF2A 1WVXA 3GU6A 2OICA 4CV9A 4JDHA 5JN2A 2C6LA 1NW1A 3UP7A 4XH6A 4QNYA 5EOBA 5ETIA 3TWJA 4O0TA 5G6VA 4CKIA 4ZP5A 3R2BA 2VWIA 5HZNA 2Z7LA 3FMMA 2J0LA 2XEYA 4R7HA 2OIBA 1V0BA 4IWOA 4UYNA 1WBPA 4BDAA 4HGLA 5IH5A 1XH7A 4AOJA 4DITA 2G15A 4MEDA 1CDKA 4S2ZA 4NM5A 3G9LX 2XNEA 3CPCA 3CC6A 3CQWA 4OGRA 4UXLA 4BTMA 4Z16A 5LVPA 2Y7JA 4J7BA 2G2IA 1YOJA 3R73A 1F0QA 2BDJA 2YCFA 4DLJA 4ASEA 2PUUA 3MIAA 5A4LA 1WBSA 4IBMA 2ZM3A 4CNHA 1T46A 4EYJA 5HX6A 2UUEA 4YHTA 3M1SA 1GAGA 3NNVA 2WMBA 5FM3A 4BCNA 2XIXA 2Y0AA 3RNIA 3FKNA 4FVRA 4ALWA 3QTWA 4GEOA 4MKCA 3N9XA 5FXQA 3QU0A 5DEWA 3W32A 4AP7A 1YOMA 2XK4A 4NJDA 3TZ7A 4GW8A 4AGDA 2W99B 1LEWA 3PIXA 3Q2JA 1RW8A 3CBLA 4FKPA 4P5ZA 1YWRA 3Q9WA 2YDIA 2ZDUA 4UV0A 4O7SA 4GUEA 2O0UA 4D0WA 4K33A 3MVHA 3FV8A 4LGDA 4UWYA 3TNPC 2XNNA 2C5NA 2WQEA 1ZY5A 1OVEA 4BDGA 4B99A 1PXJA 3ZC5A 5JSMA 3QTQA 2PMNX 2GFCA 5H3QA 3PVUA 3SOAA 2BRHA 3NGAA 3BWFA 3FMNA 3FZOA 3A7JA 3IPHA 2WMXA 4BCHA 3FZ1A 4C4GA 4XRLA 5AP5A 3VRYA 4R3CA 4B4LA 3GUBA 3BE2A 4XEYA 4CD0A 4B9DA 4G9RA 5FXRA 3MB6A 2IW6A 3NYXA 4HZRA 5J8IA 2PVYA 2XKFA 4CCBA 2R3NA 2YISA 4QP1A 4O84A 1FGKA 2JDOA 5HIBA 3R02A 4EOSA 2C5VA 2GHGA 3LQ5A 3F6XA 3WOWA 4ZS4A 3OG7A 3FXWA 3MA6A 5DPVA 4XHKB 4YLLA 3JXWA 4FIFA 4GT5A 4J52A 2OJIA 4XP3A 5AR2A 2VTTA 5DA3A 4DBXA 4DGGA 4YJOA 3ORTA 3DK6A 5K0XA 3PPJA 1REJA 2P0CA 2IVTA 1YW2A 2LAVA 3BYVA 4O7WA 2XM8A 3MV5A 3O17A 3F5PA 2C47A 3DK3A 4ENXA 1YWNA 4IAIA 3IONA 4MNFA 4Y8DA 4E5AX 4E7WA 2C3IB 2J2IB 4FSQA 3WARA 4FK6A 3EQFA 4KINA 2YAAA 4QNAA 4O0UA 5ITAA 4DFNA 3WIGA 4JRNA 3DBFA 2QR8A 4IZAA 4J99A 4O22A 2QG5A 3ID6C 2YM4A 4QMLA 3IW8A 4Z9LA 4MHAA 3MH3A 2IVVA 4I94A 1XH5A 2R3QA 4RMZA 4AE9A 2C6DA 2C0TA 3PVGA 3Q32A 2BPMA 4IEBA 5CSHA 5L8JA 4FK3A 4PRJA 1XO2B 3UC3A 4EOIA 5I0BA 3SKCA 4UZDA 1NT2A 3VJOA 5L2SA 3PSDA 5DR2A 3V51A 2C3LA 3GB2A 3VUGA 1ZYCA 5J7HA 5K4JA 5DMZA 4QP8A 4WT6A 2GNHA 4XJ0A 2Z02A 3CQEA 4ZSJA 1M52A 5D41A 2I6LA 5C01A 4MQ1A 2Z7QA 1U46A 5ETAA 4MNEA 3VUDA 5JZJA 2VWBA 3QQLA 2XK7A 4CFUA 1TQPA 5HVYA 2C6MA 3QQFA 4BTJA 5HU9A 3TUCA 3IQ7A 4EZ7A 1GIIA 5BVEA 4DGLC 2GHLA 2WTCA 1NXKA 2X9FA 2OG8A 3FKLA 4FKJA 4OBQA 3RWPA 4WO5A 2ITXA 2W1ZA 3ZCLA 2NP8A 3DU8A 4NW5A 4BKJA 2OU7A 1KE9A 1H08A 3KK9A 3QTRA 3AGMA 3FAAA 4U44A 4UZHA 3VW8A 3CP9A 5FM2A 3PIZA 5FTOA 3H0ZA 5L8LA 4AZFA 2WO6A 3HDNA 4NEUA 1ERKA 4G6NA 3PP0A 1IASA 3GQLA 1P14A 1WBTA 2NRUA 2X2MA 4IW0A 4YJSA 3AC5A 4YZMA 4YJUA 4DT9A 5KZIA 3HVCA 4DGMA 3PY1A 1YI4A 5JGDA 4MBJA 4FGBA 4X7QA 4V04A 2J0JA 4X2KA 1JKLA 2PY3A 2EXCX 2LGCA 3LFDA 3Q52A 4FTMA 3E8EA 1IG1A 2A19B 5D9HA 4Z7GA 1ZZ2A 5IQFA 4WUAA 3OXZA 2XIRA 4CRSA 3VS4A 4H39A 3NW5A 3IG7A 1J7IA 4TL0A 2KULA 3RM6A 3WZUA 2UZLA 3QRJA 1CKIA 1JPAA 3ORPA 4FYOA 5EG3A 3T8OA 1ND4A 2OK1A 4IJ9A 5I9YA 5EQYA 5C4LA 3MH2A 2XP2A 5M4CA 4CTBA 5FUTA 3ELJA 3OCTA 1XH9A 3LJ1A 3RBWA 3AT2A 2VTJA 1YDRE 5E92A 5HU3A 4EQUA 3SG8A 3W2SA 5IA0A 4LRJA 4OTPA 4G3DA 1PMEA 3H30A 1MP8A 4U43A 2X9EA 3KC3A 2XZSA 2XA4A 3OF0A 3TUBA 3ODZX 2YWVA 5HTIA 4L8MA 2ITWA 5HD4A 2O3PA 4CFXA 1FMKA 3QF9A 3P9JA 4E1ZA 3WE4A 2A2AA 4FZDB 3SVVA 3NUSA 5CEOA 4QPAA 2Y8OA 3TXOA 2PTKA 2WXVA 3A4OX 3T3VA 3QAME 3UZTA 4L53A 2QOQA 5CNOA 3I79A 3QTIA 4EOKA 3QD3A 2F2CB 2CN5A 3EN6A 4NK9A 4IXPA 3ZM4A 4ERWA 2V0DA 4QTAA 3ZUUA 4BDFA 2VTNA 3MPTA 1KUTA 2R3OA 5DG5A 3CXWA 4W9XA 1OGUA 5HO8A 4FNYA 5A54A 4BCOA 4MD9E 4TNBA 1BYGA 4WNMA 3FXXA 2BRGA 1ZYDA 3SV0A 3NS9A 4I23A 4I5HA 4P4CA 4W8EA 5IA1A 3VBVA 4OAVB 3V3VA 4A9TA 5AJQA 1Z57A 5EK7A 4BBEA 2YDJA 4I0RA 3EL7A 4FOBA 3VS6A 1UU8A 4GSBA 4BCKA 4CFFA 5K5XA 1H26A 3MVMA 3PRIA 2VU3A 4FKGA 4EHVA 3BV2A 4CKJA 4NUSA 2RFNA 2PVJA 3BKBA 4IWPA 3EZVA 3REPA 3GP0A 2XUUA 3E92A 5I4NA 3MTLA 2QLQA 3RM7A 4MNEB 3RI1A 2IVUA 3V5QA 3ETAA 4ACDA 4F1MA 2XK8A 5A6NA 4KRDA 3WIKA 3LFSA 3UTOA 4FR4A 4QPSA 4QYGA 1P2AA 4N70A 1L8TA 3DAKA 4EOLA 4FE2A 3GNIB 2YCQA 5BUIA 4BRXA 3BE9A 1MRUA 3DB8A 4E3CA 3EFWA 4LV8A 5EHLA 1KV1A 2C5YA 2X4ZA 5DT0A 4M97A 3DBCA 3R7VA 4FKRA 3PJ1A 1Q4LA 5D7AA 4FL1A 3PXZA 3GU8A 2BTSA 1U5RA 2P55A 4ZY5A 3RINA 3I4BA 4QMUA 5CT0A 4HCTA 3VUKA 3ZO1A 2EB2A 1W7HA 4NW6A 2VTHA 3QALE 4RVTA 3WYYA 4E6DA 2G2HA 5LVMA 4RBLA 4K9YA 4QMOA 2AC5A 3VUIA 3BU5A 4LUDA 4AOIA 5K3YA 2ERZE 5LWNA 1M7QA 4I20A 5C4KA 3BGPA 2X7GA 2BALA 4CVAA 1UA2A 2BKZA 5AM6A 1RE8A 3VS5A 3FUPA 4IVAA 1WVWA 4W8DA 4X6QC 2XH5A 3EHAA 1MQBA 4MXAA 2UZTA 3AXWA 4U45A 4O0WA 5GZAA 3VULA 3KRLA 2PE0A 2ONLC 1OL6A 4EH7A 4O6EA 1NVSA 1Q8UA 4U79A 4FTNA 3S3IA 4BR3A 5B2KA 2IW9A 4IAYA 2VZ6A 5AIKA 5IMXA 4KRCA 4D9UA 5GHVA 3I5NA 3C1XA 2BIYA 3O96A 4F65A 4JBPA 3A7HA 4MH7A 3NYNA 3UQCA 4MXOA 3UQGA 3K3JA 4FSUA 2H6DA 4WNKA 3D5XA 4IIRA 5D11A 4M67A 4K1BA 4A9SA 2X7OA 4D1ZA 1UNLA 5A4CA 2YABA 4HGSA 2QLUA 3QTUA 3L9LA 3FMKA 2OFUA 4FV3A 3D5UA 3QTZA 2X6DA 4BDBA 3O50A 4FIJA 3KFAA 5CF5A 4FG7A 2C4GA 2WKMA 3WF7A 4G5JA 4UX9A 3OTUA 4USDA 3KEXA 3LKMA 4YGAA 3KKVA 4BL1A 5IA4A 3MWUA 5KMJA 4TW9A 3NUUA 3FPQA 2CLXA 3DLZA 4FV5A 4RA4A 5L6WL 3D0EA 1KE5A 1PXNA 5K0KA 1G5SA 3EWHA 3NUXA 2G9XA 3FHRA 4B8LA 3OW4A 3HKOA 4GFMA 4MBIA 5TF9A 3UNJA 1K3AA 3LFCA 4TPTA 4NU1A 4WOVA 5A9UA 3IDCA 3BLHA 4IWDA 3OCSA 1VJYA 4DEHA 4IB1A 1KOAA 2WGJA 2HW6A 4XP0A 5IISA 4I24A 4L43A 3G9NA 3LMIA 3RTPA 1SVEA 4EK3A 2WU7A 3Q53A 5F1ZA 3F7WA 4BZNA 4WRGA 1SYKA 3R1NA 3PXFA 4EK5A 4CFMA 3KXMA 1LEZA 5E90A 4FX3A 4YJVA 3M2WA 2V55A 4MCVA 4QPMA 4DFLA 2YM3A 1U54A 2XNOA 3OW3A 3EQPA 3JYAA 4RSSA 4ZAUA 2C3KA 3LXPA
chains in the Genus database with same CATH superfamily
3VS2A 4PUZA 2I1MA 5KHWA 3TM0A 2YM7A 4ZLOA 3KRWA 4YR8A 3FLQA 2PYWA 3V6SA 4L6QA 1YKRA 2F4JA 3C50A 3H4JA 5E1SA 4GIIA 3UVPA 3U6HA 3MBLA 3BIZA 4HYUA 5CXHA 4AXDA 5DH3A 3O7LD 2XCKA 1G8SA 3FMDA 3WZJA 4RZVA 3U9CA 2IF8A 1ATPE 4ANOA 4O96A 3EOCA 1ZARA 4YJRA 4BYIA 2IPXA 2HW7A 2VD5A 4O91A 4F1OA 1U59A 2R3LA 2H8HA 2QCSA 1ZMVA 2R7BA 4LFIA 3DDPA 3OOMA 2C30A 3VHKA 4KUJA 2PSQA 5FP6A 2PVRA 3MY1A 3VO3A 3MJ1A 5IDNA 3DQXA 5LARA 5IQGA 4BVUA 5AR3A 5HE2A 1OIQA 3R7UA 4D2WA 4F63A 1Q8TA 3R9DA 4E8AA 3EIDA 4FKIA 3W0NA 3SG9A 4FOCA 1XH6A 5AP2A 4CFNA 1FOTA 2PVFA 2WMQA 3N51A 2G1TA 3U8WA 1WBNA 3KULA 4A4OA 5EW3A 5IF1A 2XAOA 4I6BA 4D2RA 3E3BX 2GNFA 1YVJA 4M69A 2GQGA 5BVWA 2VV9A 4I0TA 3TACA 4DLIA 4YC6A 3ORXA 3ZO4A 3W0RA 5ANEA 3E5AA 4TN6A 4X2FA 4L44A 4O0VA 2C5OA 3I7CA 3OY3A 4Z3VA 3KMWA 2UW9A 1K9AA 5BYZA 3PXRA 3S95A 3BU6A 1FBNA 5ANJA 3EQIA 4KIOA 5LXMA 5CY3A 2FH9A 2FYSA 2QO9A 3LPBA 4CZTA 3ZSHA 3R9RA 4USEA 4EHEA 4HCUA 3L8SA 3CTJA 1ST0A 4RWJA 2WOTA 3UNKA 1LUFA 1XBAA 3F3VA 3G0EA 4MXCA 5IQIA 3W8QA 2CDZA 1PMVA 2ITNA 3R8MA 3AT4A 3S1HA 3TIYA 2Q0BA 4FSZA 2Z7SA 3C4FA 2UW8A 2Z2WA 2YIWA 4YHJA 2ZV7A 2C6IA 3ZLWA 3QBNA 3R01A 1ZYSA 3R1SA 4RJ5A 4U7ZA 1BL6A 4R7BA 3DV3A 3ALNA 3F3WA 1OGYA 5AMNA 4OTQA 2X7FA 4CXAA 3QGWA 4FV1A 5AM7A 4I0SA 4EEVA 5DR6A 3NFFB 4NYEA 4FVPA 3CJGA 3DB6A 4PV0A 4G34A 3DJ5A 1W8CA 2UZVA 2OKRA 4V05A 4FV0A 2NPQA 4IX5A 4ZXTA 5EDRA 1H0WA 4X0MA 4OUCA 4RIOA 3JR1A 2CLQA 2VTLA 1H1WA 4PNIA 4DEBA 5AADA 2WTWA 4QYFA 4BCPA 5JFSA 3W55A 4XBRA 1NY3A 4CSVA 4FEVA 1WZYA 4WG4A 4YU2A 4DF3A 2VX0A 2ZDTA 4C2WA 5CAVA 3TNIA 3R7EA 4BB4A 3FZRA 2XARA 2WMUA 2YIQA 2RG6A 3CY3A 3Q5ZA 4FKWA 4FSNA 4AF3A 4FG8A 4U3YA 4BFMA 2WPAA 2P2HA 4BDCA 4BCQA 3BHHA 4NM3A 2CJMA 1U54B 2X2KA 3AC3A 4XBUA 3ZOSA 4AW2A 4Y5HA 5GZ9A 4QQTA 4H05A 2BAQA 3IW5A 5E8TA 4F7LA 1OL5A 1XWSA 2B9FA 4MK0A 4RLLA 2O65A 3V01A 2BHHA 5M57A 5HD7A 4JLCA 1JWHA 2R3KA 4E4XA 5L6PA 3UDTA 3CD8A 3GU4A 4U9AA 2UZOA 2ERKA 3V5PA 3KQ7A 2VWZA 4APCA 5L4QA 2UW5A 1STCE 4RIWA 1HOWA 1I09A 1PJKA 2GS6A 3ZYAA 4OTWA 4ZTRA 2PMIA 3MVJA 2VAGA 3BYUA 3CKXA 3L9PA 4XOZA 5AX9A 4CTCA 3EQGA 3FKOA 3IW4A 3L1SA 3RHXA 4WKQA 2GHMA 1KE6A 4M12A 3H9OA 2BILB 3TIZA 3TJDA 4I93A 1PMNA 2YIYA 3FZPA 3PVWA 2VX1A 1OL1A 2PZYA 2JGZA 2RFSA 2YJRA 3P7AA 2XIYA 3RP9A 4Y73A 4KBKA 4APPA 4AS0A 3LFEA 2IWIA 2F7EE 5CT7A 2BAJA 2R2PA 4FTRA 3F82A 3JY9A 2CCIA 1S9IA 4S34A 4CRLA 3LXKA 3KULB 1OPJA 4IDTA 4M69B 3DOGA 3ZHPC 4Q9SA 2XJ1A 4YZCA 4E4MA 4N6YA 4IVDA 2B54A 2W96B 4M14A 4DGNA 1WCCA 2QG7A 2X8DA 3OVVA 4M8TA 4D28A 1GJOA 1OI9A 5TO8A 3FQEA 1M2RA 5FTQA 3QX2A 3F9NA 1R39A 5HORA 3N4TA 1M14A 3PXKA 5BYLA 3COKA 5JGBA 5CU2A 4GH2A 5D10A 3BYOA 3I5ZA 4AGUA 2WMAA 1YI3A 5TOZA 5IDPA 2XKDA 2GSFA 4UYAA 4Z7HA 3NNXA 4AT3A 3GU7A 5CVHA 2C1BA 3LCTA 2YZAA 4GRBA 2IVSA 4GV1A 4GK3A 4NSTA 1DS5A 3DAEA 1Q97A 3SRVA 5HG8A 4O27B 2OH0E 3ZONA 2J5FA 4ZZOA 1F3MC 4HVSA 3KXXA 3KN6A 2OO8X 3RAWA 3ZBXA 3RJCA 2VO7A 3TN8A 4P5QA 5DWRA 3DA6A 3V5TA 4QMPA 4O1PA 4C02A 4FT3A 4GKHA 4G2FA 3NUYA 2REIA 1AD5A 4U8ZA 4FSWA 3UJGA 5EHYA 2BVAA 4LOPA 1VLRA 4FTLA 4UMRA 2ETKA 5EQPA 4C3RA 3ORNA 4JAJA 4RRVA 5KHXA 5M4UA 3OUKA 5CQWA 3DLSA 3MGYA 2BZHB 4M0ZA 4ZJIA 4GYGA 1YQJA 5T3QA 2PUPA 2WMWA 3QC4A 2E9UA 1Q5KA 1QMZA 4J8MA 3NWWA 1KWPA 2JDRA 4JL9A 4FIIA 3UIMA 5GJFA 5HCXA 5LMBA 3HMPA 4IHPA 4AW1A 2B1PA 3PDTA 2ITVA 3LHJA 4XV2A 2XALA 3AGLA 5JGAA 1ZZLA 3GENA 4LRKA 3OCGA 4BWKA 5A4QA 4RVKA 3PG3A 4F0FA 2QR7A 4L01A 4YP8A 3UOJA 1W2CA 2EXMA 2A98A 3R8PA 1UV5A 1W84A 4JBVA 4AW5A 3T9TA 3VBQA 5J9YA 3EFJA 1Q24A 3TCPA 3AT3A 3UDZA 4HNIA 5LCJA 2BDFA 3PE2A 2HAKA 4RWKA 4FTAA 4L52A 3UNZA 4ZZNA 3H3CA 3PJ3A 4X6RA 1H0VA 1JSVA 2X8IA 4RIWB 4NIFA 3GEQA 4XG6A 2QOHA 4JAIA 4AA0A 3PVBA 2QNJA 3WBLA 5BX0A 4EOMA 2BRNA 3KF7A 4L00A 3B8RA 4N6ZA 1OL2A 3EH9A 4TKSA 2NRYA 3B8QA 5B0XA 2WMVA 2B53A 4YC8A 3JS2A 1WVYA 4D58A 2X39A 3R0TA 1Y91A 2ZOQA 2IG7A 4RT7A 2EU9A 4XG3A 2HZ0A 1ZAOA 3W2CA 3A7FA 4EH9A 1YHVA 4BCIA 2XB7A 3Q96A 5LMKC 5CSPA 2FSOX 2YEXA 1JLUE 4V0GA 2R3PA 4E4LA 1PXPA 2F7XE 2VO3A 2Y9QA 1Q8YA 4XUFA 4XX9A 5M53A 3D5VA 2E9OA 3DKFA 4FV4A 4I5MA 4L67A 4N0SA 1EH4A 5ACBC 3BHYA 2C6EA 4AOTA 3Q4TA 4CLIA 2JKMA 2OXDA 4CZYB 4FIHA 4GU9A 4QMNA 3IECA 5J95A 2JD5A 4KNBA 1K2PA 4G3GA 2EUFB 3A7IA 5IH6A 4F9YA 4DDIA 1J1BA 1SVHA 1W98A 3E62A 3MPMA 4DA5A 2PWLA 4F7NA 1YDTE 3KRRA 3OCBA 2R3RA 4AN3A 2IO6A 3BQRA 4LG4A 3E8NA 3B2WA 3R7GA 4LRMA 5C27A 4IE9A 4JVGA 3ORZA 3IDBA 1PMUA 2RG5A 3CY2A 2FGIA 3ALOA 3ZRMA 3DNEA 4DEEA 3P86A 4IWQA 4KKHA 4H3BA 1YHWA 3OUNB 5J9ZA 3QTXA 4O1OA 4HPTE 3D7TA 3FXZA 4O21A 3DY7A 3SRVB 4H1JA 2I0YA 2BFYA 1YWVA 4HCVA 4F99A 3EKKA 3SHEA 5FRIA 3TDWA 1Y6BA 4IAKA 2W1FA 3FMHA 2XIZA 4EUUA 4F09A 3ACJA 3BBTB 4FEUA 1UKHA 4JBOA 5CSXA 3TEIA 3SXSA 3UOKA 1O6KA 4U5JA 4NM7A 2XM9A 2QOBA 3COMA 5EYDA 3U55A 3QUDA 4L68A 3PYYA 5FLFA 1URWA 3HX4A 2ZM1A 2ESMA 2UW4A 4OW8A 2H34A 4HNFA 3VONA 4IANA 5AUWA 1TQMA 3MB7A 4B8MA 4BTKA 3KCKA 4LMUA 4ZLYA 2QQ7A 3EN5A 2X0QA 2WIHA 4FT9A 4JI9A 5I3OA 2W1EA 1JSUA 1ZWSA 2FO0A 2B7AA 2VUWA 4IVBA 4A9UA 3ENHA 2FB8A 2JIUA 3KB7A 5CYIA 4QMXA 4ZZMA 4ANQA 3O8UA 4F0IA 3OC1A 5AV3A 4S33A 4BI2A 4NWMA 4IACA 5J1WA 3NVMB 2XNBA 2KTYA 1H01A 1NVRA 4AN9A 4CKRA 3ATTA 1JQHA 4KB8A 5GIPE 1P4FA 3S4QA 1H24A 2CKEA 3DFCB 2OWBA 3VC4A 5E8ZA 5M06A 3KF4A 2VTAA 3KRJA 2W7XA 3FYJX 4E6CA 3HAVA 1DM2A 4ASXA 3R22A 3UQFA 5KMIA 3MTFA 4NT4A 3ORMA 5D12A 3TNQB 3SW4A 5IKWA 1H4LA 4O82A 3FQSA 2J90A 3OBGA 4W4VA 3C4WA 3C51A 3W2RA 4NIFB 1E1VA 3K5VA 4C57A 2XBJA 4IX6A 1V0OA 3MFUA 4JBQA 4QP9A 2W4KA 5DRDA 4HW7A 2XK6A 4DHZA 1Q41A 2YAKA 4GCJA 4E73A 4WNOA 5T68A 4FUXA 3UBDA 4IB3A 4O81A 3OD6X 3F69A 3NUAA 1G8JA 3TZ9A 1UU9A 4JR7A 1G8KA 3LCKA 3FC2A 2CHLA 2GU8A 4D55A 3Q4CA 4PF4A 4FEWA 4AFJA 4AUAA 2WELA 2XEZA 3NDMA 5EI2A 4L46A 4ZY6A 4FTTA 3HV4A 1W83A 3OXTA 4V0GB 3D14A 4RX5A 5FTGA 2JEDA 5DNRA 3FEGA 4FTQA 5IA3A 5GJDA 3NMUF 1JOWB 2QODA 4NKAA 3FI2A 3HA8A 4R5YA 3K2LA 5H8BA 1IAJA 2W05A 1A9UA 1BMKA 2HELA 2ITZA 3D5WA 2GMXA 3E93A 3GQIA 2O63A 4K0YA 4UBAA 3ULIA 2X81A 2OF2A 4F6UA 2C0IA 5CF4A 2XYNA 4R1YA 1O6YA 5G1XA 3HV3A 5DR9A 4FA2A 5FEQA 3Q4UA 2WTKB 3NIEA 4M7IA 4O86A 4RQKA 3HV7A 3UYTA 3F66A 1WMKA 4TWPA 3KK8A 5IQAA 5DRBA 4AE6A 4O0RA 3D7TB 4I22A 4QP2A 3QWJA 2IZRA 4GT4A 2OXYA 5AP0A 2IN6A 4O7VA 3ZH8A 3DTWA 4AXFA 3S2PA 2DQ7X 5LQFA 3R8UA 3GCVA 3FY0A 4CFVA 2PHKA 3F3TA 3UVQA 4PDPA 2ITYA 3PRFA 2HY0A 4I5PA 4L3LA 3K54A 3GOKA 3DTCA 4BKYA 2WAJA 2IJMA 3SOCA 3PLAE 3U51A 2ACXA 4YTFA 2GDOA 4ACMA 5K9IA 4MYGA 3DGKA 3C4ZA 1R78A 4ID7A 1B39A 3ZSIA 2DWBA 3SAYA 3FWQA 3Q6UA 3QYZA 5EI8A 1IRKA 5DGZA 4QEBA 1PXOA 5E8YA 5FQDC 3ANQA 4MF1A 2R64A 4TYHA 5ANGA 3HMMA 3GC0A 3Q9ZA 1SNUA 3G0FA 3BEAA 4PDOA 4RC4A 4X21A 2W9ZB 2ZB1A 3P1AA 4F4PA 1IA8A 3G5DA 4OBPA 3EZRA 5F4NA 3ZFYA 3R9HA 3UO6A 3T3UA 4RGJA 3WZEA 1UVRA 2WZJA 2PL0A 1PRYA 2V7AA 3BHUA 3ZDIA 4GUBA 2QVSE 3CLYA 4R7IA 1XHAA 1J1CA 4R5SA 3LXNA 4LL5A 1H1PA 4K77A 4UMTA 4EWQA 2ZVAA 2JAMA 2OJJA 4ALVA 5F20A 4M15A 1L3RE 3KRXA 1MQ4A 3C0GA 3NW7A 5E91A 2WMSA 4RFZA 4EC9A 2RKUA 3C9WA 3LFBA 5K4IA 3MFTA 3UODA 5AUYA 3P5KA 3T9IA 2JLDA 5IQEA 5BVFA 4BIBA 4FICA 4AFEA 2B0QA 2BIKB 2WEVA 2F9GA 4DG3E 5AA9A 4HGEA 4MUQA 3FJQE 4I5CA 2IZSA 4FSRA 2R0IA 4V01A 5CWZA 3ATSA 3NLBA 3BU3A 4BYJA 3LAUA 5F94A 4C37A 2VWWA 3EN7A 3HRBA 5EHOA 2CPKE 3GBZA 5TKDA 3VUMA 1W82A 4TYJA 4ANLA 3QUPA 4XOYA 2WD1A 2WFYA 4UWCA 4D4YA 5CALA 1SNXA 5AP4A 5KMOA 3F2RA 3R9NA 3PTGA 1GOLA 2VTRA 2ZMDA 4LI5A 5T6KA 3QLFA 2JKQA 4ZLZA 3NAXA 4YO4A 5EDPA 3QQHA 2W1HA 3CSVA 3JY0A 2WMTA 3ZEWA 2BROA 1R1WA 3KY2A 3QTSA 4LYNA 4DGOA 5J5SA 3QLGA 5E8SA 3RK5A 2UZUE 2YITA 2I7QA 3CJFA 2QOKA 3FMEA 3U9NA 4QRCA 4XV9A 5BUJA 4WG5A 3MY0A 5AUZA 2OJFE 5CF8A 4BHZA 4FVQA 4J53A 5FXSA 4BDEA 5BPYA 4QDVA 5IA5A 4CT1A 4DFZE 4QOXA 3WF6A 3HP2A 3EN9A 3OFMA 4OT6A 5LMKA 1RJBA 2HWPA 4GMYA 4H1MA 3QL8A 1QCFA 2XS0A 5DOSA 5HI2A 3QQUA 5FEDA 1SM2A 3TG1A 4DFYA 3NSZA 4PTCA 2BHEA 3LFAA 4K6ZA 3A7GA 4TRLA 4AAYA 3IGGA 4JDJA 4I21A 2OIQA 2Z60A 2B4SB 4DHFA 3BBWA 3POOA 3PFQA 2JFMA 3IOKA 3L9MA 4QQ5A 4LQMA 3SDJA 4FSMA 4ZEGA 2SRCA 4RG0A 2J5EA 4N57A 1CKJA 3VQUA 1Z9XA 4BKZA 2JDVA 3A8WA 3LCSA 3R9OA 2UZDA 1QL6A 4DCEA 2IZUA 2OH4A 1OMWA 5DFPA 1FVVA 2OZAA 3V04A 5BVNA 3F5UA 4BC6A 1H1QA 3RZBA 3V8TA 2VTPA 4O0XA 4CYJA 4PMPA 1YHSA 1IEPA 2C3JA 4TYHB 4NCTA 5CEPA 2W0JA 3BHTA 3LCOA 4L7SA 5HKMA 5C03A 4QYYA 5E9EA 5DT3A 2WTVA 4XS2A 2PMLX 4HZSA 3RNYA 5BQ0A 4FNXA 4C38A 5HHWA 5EM8A 5HBJA 4PL4A 4FTIA 4ZSEA 1J7UA 3PJCA 2PZRA 4ENYA 2V62A 4FUYA 2QURA 2XANA 5HTBA 1OPLA 3QC9A 5IEYA 4L45A 1PHKA 5I9XA 3TUDA 4ERKA 4FT0A 4KIPA 3FLZA 4QDEA 4NTTA 2I0EA 4F9AA 4P7EA 4PX6A 4FI1A 5HO7A 3UO5A 2UW7A 2VWVA 4XLIA 2C6OA 2WQNA 5HOAA 1OIUA 2GS2A 4EKLA 3DXQA 1OKYA 4EOQA 4J95A 4U3ZA 5HO6A 1OITA 2P4IA 4C4EA 5GIOE 3PY3A 3I60A 4WHZA 1GZKA 3NEWA 4C61A 4ZTQA 5BYYA 5HNIX 4QQJA 3ORIA 5CNNA 3U4WA 5KZ0A 2AUHA 2B9JA 3TV4A 3LOKA 1Z5MA 3LZBA 3ANRA 2YA9A 2Y4IB 2GCDA 5JQ5A 1ZOHA 4BDIA 2IEWA 4K11A 3G51A 4DBNA 5C1QB 5K5NA 5IQDA 5EM5A 5CENA 3OWJA 5LVOA 3P23A 4AQKA 4J96A 4C4FA 3HYHA 1W0XC 4U97A 4EJNA 2HXLA 5KMNA 3TTIA 3ZLXA 3DJ6A 4U0IA 3LMHA 1VYZA 4BGHA 1ZYJA 3FLWA 2Z7RA 3BCEA 3QCQA 4XP2A 3PY0A 3HUBA 2CKOA 4OTRA 3PZHA 4DDGA 4DN5A 4YO6A 4MAOA 4JX7A 2XMYA 4G31A 4X3FA 3N4UA 4IX4A 3POZA 4MF0A 3EB0A 3ZLYA 3ZXZA 4EJ7A 5AUXA 2B55A 5L8KA 3UZRA 4JQEA 1E9HA 5KX8A 3GCQA 1Q8WA 4PTEA 5H2UA 4JR3A 4JOAA 3OXIA 2UZEA 3FSKA 4DG0E 3EMGA 3QYWA 1Y57A 4PDYA 3DPKA 2PK9A 1FVRA 3QKLA 4MD7E 5JFWA 2PVMA 1J7LA 3W0PA 4TWNA 5KNJA 4YNOA 4EH3A 1JSTA 3BZ3A 1BKXA 2VTMA 3WZKA 2HIWA 4UXQA 2QU6A 4QMQA 3OP5A 4KKGA 4J97A 4II5A 3SXRA 3UIBA 3F3ZA 4W4XA 4PL3A 2FUMA 4FTUA 5AR7A 3R83A 4DEGA 3BWJA 1VZOA 2G01A 2WTKC 2YWPA 4GU6A 1PW2A 4PMSA 4ZSGA 2W17A 4IJPA 3E63A 5TE0A 3NW6A 3NYOA 3P79A 4D2PA 2BCJA 2VTOA 4PPBA 3QFVA 1TQIA 5IZFA 1O6LA 2OJGA 4O7YA 1QPDA 5CAQA 4AZTA 4RWLA 1HCKA 4DH7A 4FEQA 2O2UA 3P5JC 3PUFC 2VX3A 3LM5A 4LGGA 4WSYA 3W33A 2CNVA 5CSVA 3TKUA 3EL8A 5CVGA 1KE8A 1FGIA 3LM0A 2OZAB 3O51A 1UWJA 2HZIA 4AGWA 5CEKA 3QA8A 4ZTNA 1MRVA 4D1XA 5KBRA 3KVXA 4U40A 1FVTA 1PYXA 3MFSA 2XAMA 3OT3A 4B6LA 4FJVA 5CSWA 3SW7A 4R78A 2JBOA 4AZEA 5KKRB 1IR3A 1SVGA 2QU5A 3F2NA 4M0YA 4RC2A 5CEMA 4G3FA 3FZTA 1XBCA 2CSNA 2YERA 4OTDA 1WBVA 4DH5A 4YLKA 4RX8A 3VF8A 4S32A 1R0EA 3R30A 3W10A 3FBVA 1YRPA 1BI7A 3PZEA 3EQBA 3QRIA 3MH1A 4M3QA 4WNPA 5IUHA 3R8LA 5KMMA 5LCKA 5HLWA 5EDQA 5CEQA 4N4SA 4AU8A 4AGCA 2XKCA 3CPBA 5TT7A 1UU7A 4TZRA 5HG5A 4E6QA 2QOIA 5A14A 5AUUA 4RPVA 2V22A 2VNWA 4PQNA 3VRZA 3OY1A 3RMFA 3HUCA 4NM0A 5M44A 5JQ8A 2GNLA 2YM6A 5JK3A 3V5LA 4GVAA 3ZBFA 2QHNA 3WILA 3IW6A 3JUHA 3NR9A 4NFNA 3EQRA 4H58A 4QQCA 3QQGA 3RK9A 3RPOA 4AZVA 1FQ1B 4YZDA 4DFUA 3GC7A 2ZJWA 2C6TA 3DFAA 4IC7A 4CYIA 4USFA 4XG9A 4BZDA 4YPSA 5L3AA 5AA8A 5TR6A 3Q04A 1UU3A 3MY5A 5M4FA 1JAMA 4I4EA 3TYKA 5CAUA 2VWUA 2ZV2A 5AR5A 4XG4A 2RFEA 4KS7A 3W2QA 2PVLA 3AC1A 2OGVA 3SC1A 1ZLTA 4X3FB 2EB3A 4S31A 2CN8A 4ZIMA 4GS6A 3U54A 4FV9A 5HNGA 3GVUA 2YLFA 5J9LA 1Q61A 3A60A 3DCVA 4KD1A 3FI3A 3UPZA 3TI1A 4QMMA 3MYGA 4FZ6A 4GFOA 2X0GA 4L3JA 4QMWA 3V5WA 5IUGA 3U6IA 3D15A 2XNMA 3CTHA 1KV2A 2BRBA 3C0HA 4JX3A 2QHMA 1J3HA 2RL5A 3IOPA 2WQOA 3F2AA 5CU3A 2AC3A 2VWXA 2A1AB 4QMTA 4X2GA 4U41A 5DEYA 3OWKA 1O9UA 2ZB0A 4Z55A 5M51A 3V8SA 3B2TA 3I81A 5EYKA 3VS0A 3GU5A 5HESA 4O38A 2R4BA 3DS6A 4IAAA 5CS6A 5IA2A 1BX6A 3LFFA 4D5HA 2X2LA 4XCUA 5EYMA 3M42A 3PA4A 2ZV8A 5HGIA 2ZM4A 1CMKE 2R5TA 1M7NA 2YCSA 2VN9A 4L42A 3Q6WA 4GG7A 4RJ8A 5E8UA 1SZMA 4GK4A 5B7VA 5CTPA 3CQUA 3NIZA 4XG8A 1SMHA 4BDHA 3PPZA 3FY2A 4FV2A 3C0IA 3QHRA 3PXYA 3P7BA 3VBXA 3VS1A 1A06A 2XF0A 4GIHA 4MBLA 4MWIA 3IKAA 2HZNA 3FI4A 3MFRA 5HG9A 3S00A 1OBDA 4UMUA 4R77A 4E5BA 3SLSA 3BGQA 2J50A 3VBWA 3COIA 5FP5A 1OKVA 3QZIA 4F7JA 2XBAA 3AD6A 3E7OA 4FKQA 4XYFA 3RK7A 3AMAA 4XG2A 4WA9A 5CU0A 4X3JA 5AP3A 3D2IA 4WBBB 5HE0A 3I6UA 3LVPA 4UN0C 3FI8A 3CEKA 4RJ7A 5C8MA 3VS3A 3ZLSA 5AAEA 1H07A 3UPXA 4DAWA 4YBJA 5HCYA 1H8FA 2XIKA 3NX8A 4FV6A 4W9WA 4XNEA 4RJ4A 5AUTA 4CG8A 5KUPA 3PIYA 3MPAA 3QQKA 3QX4A 1OBGA 4I4FA 3D9VA 3E7VA 3A99A 3FLNC 3HECA 4OTFA 4B0GA 4QTEA 4XV1A 1PF8A 5M07A 4O7ZA 1Q3DA 2R3JA 2WB8A 3FHIA 4XV3A 4UMPA 3FLSA 3QZHA 1AGWA 4A4LA 3KXGA 4FMQA 4YZBA 4NJ3A 1Y8YA 3QQJA 4DTAA 4MVFA 3Q2MA 3P0MA 2JBPA 5IEVA 2G2FA 3ULZA 1P5EA 4FT7A 1GNGA 4J71A 3OMVA 3NAYA 2PUNA 4O0SA 3OBJA 4IDVA 3DDQA 4ZJVA 2B9IA 4ZOGA 5EM6A 5AV0A 4D4SA 4FKVA 3U87A 5J7BA 2GTNA 2JAVA 4G16A 4IMYA 3G90X 4M13A 5FG8A 1JVPP 4LM5A 3QA0A 4LOQA 1G3NA 3RWQA 2R3GA 4AZSA 4IVCA 3H10A 3R7YA 4MXYA 4I6HA 4RZWA 4MQ2A 3HGKA 2Y4IC 5EFQA 2FA2A 4I6LA 3G6GA 1V1KA 3RZFA 5BVKA 2XNGA 4GJ3A 3UIUA 3W0MA 3PWDA 4YZ9A 5A4EA 3OEZA 3ZS5A 4BCMA 5IU2A 2C0OA 2PZIA 3FSFA 4TYGA 3RPSA 3KXZA 5L2WA 2H96A 3MN3A 4H3PA 3VVHA 4B7TA 4CGAA 4KSQA 2EXEA 5KO1A 4F0GA 2DUVA 3QRTA 3W0QA 3OZ6A 4HYIA 2ETMA 2WQMA 4QYEA 3I7BA 3H0YA 5KBQA 3TV6A 3TV7A 3AOXA 5HX8A 3MS9A 4RIYA 5AR8A 3NZ0A 2GQSA 1ZY4A 2DS1A 5IUIA 5IMEA 3UZPA 2VGPA 3DKOA 4I92A 2I40A 2NYAA 2Y6OA 3AD4A 1CKPA 2H9VA 4YZNA 5LVNA 3UE4A 5H8EA 2Q83A 3BEGA 3I0OA 5FEEA 4LV7A 3O71A 4ORKA 3VBYA 4YBKA 4EH6A 2J7TA 3PJ2A 2VGOA 4AX8A 4F6SA 1BUHA 3KVWA 3HDMA 5D7VA 4FKLA 3WI6A 3LXLA 2OW3A 2AQXA 2CGVA 3HLLA 5HLNA 2HOGA 3HMIA 4G5PA 3G2FA 3KMUA 1ZRZA 3PE1A 4R1VA 4BN1A 5J79A 5B2LA 3BGZA 4IAZA 3COHA 3OTVA 3LJ2A 3ROYA 2C5XA 4QMYA 3Q4ZA 3Q60A 3KL8A 4PP7A 3D83A 3VHEA 2GPHA 3BL7A 1Q62A 4EHGA 2XYUA 4MX9A 5JRQA 5HLPA 3P08A 1LR4A 4EONA 1B6CB 5CZIA 3AG9A 2BZIB 2WU6A 4QMVA 2QKWB 4UB7A 2W06A 3RKBA 2UVZA 1JNKA 4FIGA 3IO7A 5E4HA 4NCTC 4G3CA 5EYCA 4YJTA 4BDKA 4XRJA 4RQVA 4F64A 4ZY4A 5KKRC 1YXUA 4U81A 4PMTA 2YLEA 3CIKA 4D2VA 4DH8A 5EW9A 4DG2E 4DTBA 3UOLA 4AACA 4DH3A 2PVHA 3D7ZA 1FMOE 4XG7A 4BHNA 4JDIA 4DTKA 1OIRA 1S9JA 2F57A 5AP6A 4JXFA 5ANIA 3SGCA 2P2IA 4EK4A 3PSBA 2UZWE 2HXQA 2F49A 2QOLA 4RX7A 4WD5A 2AYPA 1HCLA 3I1AA 2W1DA 4GT3A 4DCAA 4QYHA 4FKTA 3WF9A 3R21A 4O7LA 2CKQA 1OZ1A 2XJ0A 5M55A