1U5QA

Crystal structure of the tao2 kinase domain: activation and specifity of a ste20p map3k
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords serine/threonine protein kinase TAO2
publication title Crystal Structure of the TAO2 Kinase Domain; Activation and Specificity of a Ste20p MAP3K.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 100
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u5qA01
5DOSA 3DT1A 3OS3A 3Q4TA 3QHRA 2ZDUA 3PSCA 4RLKA 2H34A 5JQ8A 2YWPA 4ACHA 4DA5A 3OWKA 3ZRMA 5BYYA 3NYVA 3FPQA 4FV9A 4TXCA 4DCAA 4FODA 4GFMA 4GIHA 3U8WA 4AGUA 3H3CA 4I0TA 4PP7A 5HKMA 4BZNA 2IVVA 3CY2A 3E7OA 2Y6OA 3QC4A 5FDXA 2OU7A 4KKEA 4MH7A 3ZLXA 3ZSIA 5E92A 4BBEA 3KA0A 4F0GA 3KRWA 1ATPE 3IQ7A 4QP6A 5HGIA 2Y4IC 2QCSA 2ZV7A 3ZO3A 3Q2JA 2GTNA 3DDPA 4AX8A 3E64A 3OCSA 4C0TA 4I0SA 4Q9SA 1PKDA 2C1AA 4FKPA 1JKTA 1JAMA 5GJGA 5JT2A 3QYWA 4QYFA 3MY5A 4CSVA 3ZRKA 3MYGA 4JDHA 3CP9A 3IW7A 4DEBA 2OSCA 1DAYA 5CAUA 4RC4A 3QBNA 2XJ1A 3FMLA 3UIBA 4DYMA 3WYYA 3QLFA 3UQGA 3IW4A 4GL9A 4PDPA 3FHIA 3C4EA 2Q0NA 4IVBA 4D58A 4PF4A 2JFMA 4K9YA 4LM5A 4YHTA 4TYHB 5H9BA 3V5QA 1NVQA 4P4CA 2WFYA 4IFGA 5IQAA 5I9WA 2C5VA 3BV2A 1Q8UA 4C33A 3V8TA 4YZMA 4ZLYA 3I7BA 3PA5A 2PUUA 4GJ2A 4KIOA 3NWWA 5CSWA 3VS2A 3WE8A 4BGGA 2F9GA 4O7NA 3H4JA 1KE5A 4A9SA 2C6DA 2PK9A 5C8NA 2WELA 3C5UA 1E1XA 5DT3A 5ANEA 3D2KA 4HCTA 3LXPA 4I6FA 4LOQA 4RIOA 4ERWA 5LCJA 3SXFA 5EHOA 5EKOA 1A9UA 2RFDA 2X2LA 2XYNA 4YZDA 4FYOA 4S31A 4DG2E 4F9AA 5LOHA 3R9RA 4MXXA 5LVOA 1YXVA 1ZYLA 1XR1A 2UW5A 1WBTA 3EN7A 1OITA 3G0EA 2XNGA 4JG6A 2V22A 4LMNA 3LXNA 4WBOA 2YFXA 3BHVA 4IX6A 4FTQA 4B99A 5HTBA 2OGVA 3UQCA 2ZOQA 5CAQA 2P0CA 5K4JA 3OY3A 4MBIA 2JBPA 3R00A 3VNTA 3IDCA 4JAJA 1T45A 5CT7A 4U8ZA 5HO7A 2O64A 1G8SA 1YW2A 4EKLA 4IZ5A 3ZFXA 3Q9YA 4BCGA 2WZJA 5AV1A 3HKOA 3L8SA 2BZHB 1BI7A 3BU5A 3NPCA 5HG7A 5IQEA 3DOGA 3U6HA 1W0XC 3UNJA 2JDRA 5GZ8A 4MXCA 5D7VA 4O7YA 1SZMA 4FKTA 4DTBA 3ZUVA 1I09A 4Y8DA 4EHZA 2X2KA 4ZTSA 4Z55A 3UZPA 4ITJA 3ZDUA 3PG1A 5K5XA 5CLPA 4MNFA 4P7EA 4FEXA 5B7VA 1YXTA 3DV3A 5A4TA 5A3XA 1HCLA 4DITA 1XH7A 4K77A 3R2BA 3JVSA 1STCE 2XF0A 3EQFA 1J7UA 5JMSA 4FZFB 5KZ0A 2IVTA 5DRDA 3LMGA 3DXPA 3VN9A 3DBFA 3PIZA 4HYIA 3VUKA 3F3TA 2PSQA 4QP7A 4TNDA 3ULZA 3HV6A 5F95A 3WARA 5IISA 1UKHA 3EQCA 5AAEA 4O1PA 4IAKA 3NEWA 4MTAA 4D4SA 3R8VA 4WNOA 5KX8A 4BTKA 3ODYX 4L52A 5EM8A 3D7TB 1R3CA 3G90X 1OUKA 4YU2A 4YLJA 4IADA 4ERKA 3GU8A 3F5GA 2BFYA 4AN2A 1IA8A 2HZ4A 3RNYA 4CFWA 4DCEA 1BL6A 4WUNA 2PVMA 2R3IA 4M14A 3IW8A 4G1WA 1OVEA 4D9UA 5DMZA 2G15A 5LWNA 4DLIA 2IWIA 3CPBA 3NUUA 4QP4A 5CANA 1Q99A 1WVWA 3ORNA 2YHVA 3PWDA 4W4YA 2UZDA 4AT4A 4KB8A 4C3RA 5EKNA 2OXDA 4FEQA 1Z57A 1K9AA 4I4EA 4JG8A 4BL1A 4YJQA 4FIEA 2XK4A 3UO5A 2YLEA 2ZM3A 3W18A 4DHFA 4EHGA 3WZDA 2BIYA 4Y73A 3ZO1A 4AP7A 5D7AA 3QGYA 4EK4A 5KMIA 2UV2A 2BR1A 4GEOA 3RK9A 4DFXE 1ZYJA 4HPTE 3ANQA 1ZOGA 3O50A 5IUGA 5EDRA 2YDIA 4A7CA 3IKAA 4H3PA 3QF9A 4NCTC 2BUJA 4MQ2A 4RWJA 2Y7JA 4BDGA 4BY9E 4ZTLA 4UMUA 2P4IA 4C4EA 4HVSA 1JSVA 3DBEA 2XKEA 5LQFA 1PKGA 3QUEA 2ITPA 3ZXTA 4ARKA 3RAIA 5D11A 3F3ZA 3MW1A 4E4MA 4YR8A 3GOPA 4XBUA 5AR3A 3QD2B 4BYJA 3G9LX 3PLSA 4H58A 4C62A 2XIKA 3UZRA 5IA4A 1FVVA 3QRUA 3WZJA 5K4IA 5IPJA 3HV3A 4H3QA 4PDSA 4IZYA 3R9OA 3MDYA 4L01A 3DZOA 4UXLA 3KF4A 1FMKA 2WNTA 5AR2A 3D83A 5TR6A 5A9UA 2IW8A 1PHKA 3FC1X 5DEWA 5HVKA 2ITTA 5L6OA 4EBVA 5I9UA 2YCFA 4S30A 3Q9XA 3PJ2A 2P55A 4R7BA 5AP4A 1CSNA 3AD6A 3HL7A 3W16A 4A07A 5HU9A 3GQLA 4WSQA 4B0GA 1PXKA 2WQEA 3FMKA 2OG8A 3OROA 4FV0A 3BGPA 3TJDA 1YHVA 5CNNA 5IA5A 3SW7A 3VS4A 4IBMA 4IXPA 3II5A 4FSQA 2EXCX 2FSOX 2X4FA 4MXZA 4C4HA 4W4VA 4XX9A 4UWYA 1AQ1A 1QL6A 4UXQA 4J7BA 3CLYA 3R02A 3UIMA 5BVKA 1UWHA 3EHAA 4YTFA 4IB5A 1BUHA 2X7GA 3DAKA 5EDPA 4RVTA 4DH7A 4ZLZA 3ZC5A 2JDSA 2YM5A 3L8XA 4MWIA 2OXYA 3RPSA 4C4IA 3FV8A 5BVNA 4C57A 4LQMA 3JR1A 3B8RA 3D14A 1H1PA 3NYXA 4O96A 5M55A 4ZY4A 4GV1A 4BI2A 2YAAA 3E8EA 5CI7A 1CKPA 4E6AA 5K0XA 3CJGA 4NM7A 4YMJA 3R7GA 2IN6A 3AC4A 1WBNA 3RALA 4DGNA 4ZZOA 3U6IA 3QFVA 3RCJA 1M2PA 3KB7A 4FKVA 4QTCA 4YC8A 5EFQA 4DBXA 5JN2A 4U44A 1W83A 4ZSJA 3C5IA 3V51A 3AC5A 2HW7A 2C6TA 5HNBA 4GMYA 4IC7A 4F6SA 3DA6A 2VD5A 4XS2A 5M53A 3OF0A 1OL7A 3R8MA 4BDFA 3Q9ZA 4ANBA 2YZAA 4FL3A 3CS9A 4P2KA 1WVXA 4CRSA 4I0RA 2WMTA 4RT7A 3ZLWA 1ZOEA 4NL0A 3BHTA 3KRXA 4WD5A 2X6DA 3FC2A 4EOLA 5KHWA 3CGOA 3QD3A 4GVJA 4FT7A 5HESA 1U54B 2B9FA 4ZSGA 2XBAA 1Q8WA 4QMPA 5AM6A 4USEA 4ORKA 2UW7A 4H36A 5AEPA 4G5PA 4PTCA 1Y8GA 2X2MA 4R6VA 3JY0A 1OL2A 2YDJA 5L8JA 2IO6A 3FXZA 4E5BA 3EZVA 1SNXA 2X39A 3L9MA 3MVMA 2FO0A 4MK0A 5AP3A 5FP5A 5GJDA 3MIYA 2C6EA 4WRSA 5EW9A 3UBDA 4AE6A 4C3FA 1MUOA 4BDJA 5A4LA 2OWBA 5AX9A 4FV8A 4YO6A 3GNIB 3FE3A 5JEBA 2VU3A 5CU0A 3MA3A 5CASA 3D4QA 2PVLA 4G3FA 3SD0A 1QMZA 2ETMA 4DGMA 2QOCA 5I3RA 4U97A 4G34A 3K2LA 5GIPE 1E9HA 1BYGA 1YOMA 4XEYA 3FLSA 2W4JA 4XP3A 4PL5A 3TKIA 4GYIA 3EYHA 2OI4X 3WI6A 3COIA 3QCSA 1W82A 3K5UA 4AA4A 4XG3A 4BCQA 3CQUA 4DH1A 2OIBA 4D2TA 3ZLYA 2XEZA 3FZSA 3CKXA 3DB8A 4OTGA 2CLXA 5D1JA 3TV4A 4MD9E 4H39A 2R9SA 2FA2A 2J0IA 1K3AA 2QO2A 2VTOA 4F70A 1Q8YA 4I5CA 4WUAA 3ROCA 4Y95A 1PXNA 4DAWA 2WQNA 3UOLA 4I94A 3G15A 3M2WA 1OB3A 3ZCLA 3LFNA 3BLRA 3KXZA 5BVOA 3QTXA 1M14A 4TYIA 3DBDA 5CU6A 4K2RA 1PYXA 3FAAA 3OCTA 4ZJIA 5DNRA 3N51A 3OUKA 2PYWA 2H9VA 2VX0A 4AQCA 4OTDA 3DCVA 2GHGA 2OIQA 4GCJA 4ZIMA 3ZZWA 4PPBA 2FYSA 2XEYA 1S9JA 3MY1A 5LVLA 4C4FA 4Q9ZA 4XOYA 3F2RA 4BWKA 4F1OA 1XBBA 4CNHA 1NT2A 1GJOA 4U6RA 4FIGA 4QMSA 4ASXA 5CQUA 5AUTA 1XWSA 5EHLA 4DGGA 5EYDA 5FGKA 3GCPA 3TNHA 1BKXA 3GU7A 4A4XA 5M51A 3ZHPC 2CJMA 2QR7A 2R3LA 4FTMA 3KU2A 4X2FA 4O84A 2UW8A 3CQWA 1BX6A 1JNKA 2QU5A 3TN8A 5IH5A 2ONLC 2HIWA 2RFNA 3P7BA 4Y46A 5ETIA 1JWHA 5C03A 4Q5EA 4GYGA 2WIHA 2WTWA 4EH5A 4JR7A 2GHMA 1LUFA 4DEHA 4ZS4A 5GZ9A 2WEIA 4BCMA 1PMNA 1J7LA 3MFSA 4F0FA 1YHSA 3ACJA 4KKHA 4I92A 3PSBA 4CCBA 3PRIA 3KKVA 3SXRA 3VHKA 3QTRA 4ZJVA 3ORIA 4MBLA 5BVFA 3PVBA 1B39A 4DBNA 1UVRA 1DAWA 4DEEA 1H0WA 3EQGA 3PJCA 3WZKA 4QQJA 3OTVA 4UMTA 5LVMA 3R9HA 5I0BA 2G9XA 2XKCA 4CFNA 1PMEA 1CKJA 5KKRB 5IKWA 2ITXA 3FQEA 4NU1A 3NVMB 1YDTE 4U41A 4D28A 4BF2A 3KK9A 5GJFA 2GCDA 4RZWA 3OVVA 3NYNA 4EH3A 3VVHA 3V8WA 1FQ1B 3QA0A 3O0GA 4IJ9A 4IX4A 4EOOA 4CG8A 4FVQA 4CZYB 5KHXA 4KSQA 2REIA 3RM7A 1JLUE 3E87A 3Q32A 1Y91A 2VTIA 3AC8A 4O7VA 4RWLA 3Q6WA 4GT4A 5DPVA 1NVRA 3AMBA 1WCCA 1R1WA 3ATTA 2BMCA 3DB6A 3QXOA 4N70A 1YWVA 1O6KA 2ETRA 1A48A 3LE6A 2YJSA 2XZSA 1Q61A 5CEIA 2DQ7X 4FGRA 3OCBA 2PE0A 3MPAA 2B53A 4IX3A 2EVAA 4IWPA 4L00A 4NT4A 4IQ6A 2CNVA 2ZMDA 3FQHA 5DG5A 4XG2A 3UJGA 5FP6A 3JVRA 3EN5A 4AZVA 3EZRA 3CIKA 4RWKA 4W9XA 3RPYA 4AXAA 3D5WA 4FTIA 2C3JA 4O0WA 3ZMMA 4YP8A 2F4JA 4KS7A 1SVHA 4A9YA 2DWBA 3VJOA 3UG1A 5LMKA 3BYUA 4OTIA 2WU7A 4QYEA 5DN3A 4D1SA 3LMIA 2F7ZE 4ACGA 1MQBA 2HZNA 3ID6C 2XIXA 4RQVA 5F94A 3SGCA 1JKSA 5M4UA 3W10A 3GGFA 5HZNA 3AC3A 4E7WA 5IEYA 1GY3A 4N57A 4PDOA 3P86A 2UZBA 4FKWA 2PU8A 3FMDA 5HD7A 4DE4A 5D10A 3OWPA 3BQCA 1U5QA 4Z9LA 4IW0A 4NJ3A 4ANQA 3QL8A 5HG8A 3FKOA 3E7VA 3QQFA 4IAYA 3ULIA 4AAAA 3RZFA 1ZRZA 5CU2A 1SVEA 2XM8A 3LCKA 3VS7A 2PVHA 3TCPA 4AN9A 3D5UA 3U51A 5C1QB 1GNGA 2JIUA 2Z7RA 5E1SA 1U59A 3EQIA 4F1TA 4J8NA 4IHPA 4DTAA 5IF1A 1Q24A 2SRCA 3LMHA 2XIYA 3BLHA 4MKCA 4Q5HA 4DFBA 2XNMA 3OBJA 3Q6UA 5J9YA 3ZBFA 2YIWA 3BWFA 3O8UA 3I7CA 3EIDA 4R1YA 2I1MA 4F9CA 3I4BA 2UZVA 4R8QA 2QG5A 5L6PA 4EZ3A 4YTIA 2X7OA 4U5JA 3FMHA 3MPMA 4AOIA 4F6WA 2R7BA 1YI6A 4FTAA 3SAYA 3QLGA 4X3FA 1L3RE 3HRCA 2CCHA 4MQ1A 5CYIA 4BVUA 2HXLA 4YGAA 2C6KA 4EH6A 2ZAZA 4KIQA 4UN0C 5AV4A 1J7IA 2CLQA 4UEUA 4QP3A 5A4CA 3BYVA 3KRRA 2J5EA 3ENMA 3R63A 4TWCA 5HG9A 2J2IB 4YTCA 4BGHA 2JC6A 1OPLA 3CJFA 4I5HA 4FL2A 1TQPA 4ENXA 2XRUA 3R7OA 2C0OA 4RQKA 2CKOA 2JAMA 5K0KA 5JFXA 4AGWA 3FKLA 5GNKA 5CI6A 3ALNA 2WMAA 4RJ7A 5M4FA 3PP0A 3PXZA 5JK3A 4IFCA 3U4UA 1H25A 2GFCA 3OW3A 3ZC6A 2IW9A 4EOSA 2G1TA 3RZBA 4GS6A 4IWQA 2W9FB 3UVPA 5CU3A 1UNHA 3PZEA 3TZ9A 4USFA 3QWJA 5GHVA 4LUDA 1UV5A 5HD4A 2ERZE 3L8PA 3VF9A 1V1KA 4QMZA 1S9IA 2ACXA 4FZ7A 3W2QA 3O8TA 4BKJA 3LLAA 4UYAA 2A0CX 2VTHA 3GCQA 4QTDA 4UBAA 2QURA 3VBVA 3AT2A 3KK8A 3HV7A 5FWKK 1FGIA 2F57A 4R5YA 2Y6MA 3HMPA 3JYAA 1H24A 3RJCA 4P5ZA 1HOWA 2RG5A 4HGTA 4QMWA 3DZQA 3P7CA 5LWMA 3VF8A 3G9NA 3AGMA 3F5UA 3ZEPA 4QPMA 3LCSA 3C51A 4H05A 4IZAA 3BBWA 4RRVA 2YIQA 2BCJA 2XNBA 3KXNA 5JRSA 3EN6A 3GB2A 3T9IA 3UP2A 4BCFA 5AP5A 4GH2A 1ZZLA 3OZ6A 4RX5A 4FV4A 4MCVA 1TKIA 2J0JA 1PW2A 4X3FB 4X7QA 5DH3A 3OT3A 2QODA 4HOKA 5CEPA 2ITZA 4BGQA 4X2NA 3R7EA 4BTFA 4XRLA 4C7TA 4GK3A 4EKKA 4FV2A 3OT8A 4KS8A 2XYUA 3FLQA 3PP1A 4DGLC 3QAME 2XK7A 2I7QA 4AU8A 4JX3A 2YISA 5FTGA 4TN6A 4XUFA 3R83A 3PVUA 4U42A 3FLNC 4GG5A 3PXRA 4ZS0A 2PTKA 5H3QA 4EEVA 3R71A 5CY3A 4FE2A 3UOJA 4JT3A 5AP6A 3SG8A 5CSXA 1DS5A 3HX4A 2C6OA 2UZLA 4XG4A 4GT3A 3OG7A 5CVHA 1H26A 1VR2A 3L1SA 3OBGA 5ANOA 2V55A 3OD6X 1H0VA 3RKBA 4YPDA 5E8VA 4HVDA 3CTJA 4UMQA 1XBAA 3AGLA 5HOAA 2UUEA 5FXRA 2YA9A 1OZ1A 2E9VA 3KVXA 4FZDB 2X8IA 3KULA 3G2FA 2ZMCA 3SXSA 2GFSA 2JKMA 4JBPA 4PUZA 5DHJA 4L46A 2C0IA 2J9MA 3QX2A 2W7XA 3R6XA 1SYKA 5D12A 2IW6A 3BRBA 3TNWA 3UDBA 4GUBA 2CKQA 5CENA 4BC6A 4BBFA 4BCOA 3NCGA 2WMQA 3UNKA 3U54A 3PSDA 2XK6A 4FVRA 5C27A 3AC1A 3PTGA 3RINA 2WMSA 4E4XA 4D4RA 4EWHA 4ALVA 3ORPA 3V5JA 3U55A 1H4LA 1YOJA 5J1WA 2JDVA 5M06A 5JGAA 3BE2A 4KIKB 4B6LA 3QKLA 3HAVA 3NDMA 4FR4A 1LP4A 2GS6A 4HVIA 3FYJX 3BHYA 3E5AA 2P2HA 4JDKA 2W1ZA 3CXWA 4QP9A 3IOPA 2W17A 4RFYA 3MBLA 3R22A 4WNKA 4WG3A 1FPUA 2VUWA 4DEGA 5L8LA 2WMXA 2OO8X 3E8DA 5HEZA 4YUQA 2NO3A 4AGDA 4ZMEA 4NM3A 4RJ3A 4AW1A 1YRPA 2KULA 2PL0A 3E63A 3FYKX 4NTTA 4PX6A 2OH4A 4EOKA 4DT9A 4HJOA 1SM2A 3R1QA 4UALA 5HCZA 3F66A 4BTMA 3MVHA 3UODA 4JXFA 1JVPP 5EM6A 3R8UA 1ZXEA 2WMWA 5M4IA 3GC7A 5T3QA 3C7QA 1MP8A 4FSRA 3RPOA 4O86A 3SOAA 1WBWA 4J71A 5IH6A 1H1WA 3BX5A 3GFWA 3OP5A 1W7HA 5AUZA 2QONA 3SLSA 3VS0A 1LEWA 3DAJA 3MY0A 4F7JA 3MFRA 2V0DA 3TTJA 1H28A 4CKRA 4WO5A 5M07A 4R3RA 1RQQA 1YDSE 3F7WA 3KULB 4I93A 4CVAA 4FSYA 2VTAA 3ALOA 4L42A 4QPAA 4PPAA 3TNPC 4HYSA 1ZYCA 4N6YA 4RMZA 4AS0A 2OLCA 2ITNA 2NRYA 4YZCA 2Z7QA 4RA5A 1H08A 4FEWA 4OTPA 3C4WA 2OICA 5DR2A 3AC2A 3KRJA 1P4FA 1KOAA 3DKCA 3LQ8A 4O0VA 2P2IA 1YQJA 5FEQA 4XV3A 3EQBA 1YI4A 3MH3A 4FV3A 2VRXA 5IQIA 2QOQA 4RIYB 4RVMA 1UKIA 4ITHA 3DPKA 2GPHA 3C4ZA 4FTTA 5HCXA 4F65A 3TUCA 4FTOA 2XNPA 2Z8CA 4ZK5A 3EWHA 1A06A 3K3IA 2B7AA 4FKIA 1WZYA 2W0JA 2KTYA 3GCSA 2FGIA 3KCKA 2GQSA 3PXYA 5E8WA 3F2AA 3LAUA 2WMUA 2GS2A 3A7JA 2VO3A 3BBTB 4X3FC 3GVUA 4QMVA 3F82A 4AW5A 3H10A 4QP1A 4ALUA 1OIQA 2WQBA 4DFUA 4FTKA 1WFCA 2F49A 2HOGA 3NCZA 4GK4A 3QX4A 3Q4ZA 5FBOA 5C01A 4ASZA 2O0UA 3DBCA 3KF7A 2GTMA 1OKZA 2PMNX 3OXZA 4J1RA 4M68A 3ZEWA 5I5ZA 4AA0A 3LFFA 2YCQA 4BIBA 3JPVA 2R3HA 4CQEA 4O2ZA 4W4WA 3U9NA 4E6CA 5DLSA 4BCPA 2RF9A 2YCRA 3UIUA 4QMLA 3N4TA 1IA9A 4D2WA 4KUJA 2YLFA 4I24A 3HUBA 3PJ8A 3S00A 3FJQE 3ODZX 3DXQA 5E8ZA 4OTHA 3UYSA 3WIGA 2VWWA 3R8ZA 1QCFA 5A4QA 4X2JA 4O91A 4EH2A 3T3VA 2QOFA 3F3WA 4MVFA 5FTQA 2WB8A 5CF4A 4TY1A 3QYZA 5I9VA 1GZNA 2WAJA 3QZIA 3PG3A 4MXAA 4AZWA 4M97A 4GIIA 1YOLA 4U40A 2UVYA 2WTDA 1GOLA 3F6XA 5AR5A 5BYZA 2R3OA 5G6VA 4EORA 5AADA 5M08A 4Y5HA 2A27A 2XK3A 4X2KA 1OKVA 3D15A 4EQMA 4KBKA 1GAGA 4MYGA 2QC6A 5AR4A 5HVJA 4TWOA 2OIDA 2BTSA 2OJIA 1M7QA 4AG8A 2C47A 3FXWA 2H8HA 3FUPA 3KGAA 3PA3A 4PWNA 2J4ZA 4XP2A 5JGDA 5HX6A 3EN9A 3VBTA 3MTLA 4M3QA 4FZ6A 4CKIA 5LJJA 3FLZA 2C0TA 5FXQA 3O7LD 4OUCA 4AA5A 4F63A 1W98A 2QOKA 4IB1A 4BDHA 3MH1A 3TNQB 3NNVA 4GVAA 5HX8A 3D5VA 5IQBA 4YO4A 5A46A 1ZWSA 2W1IA 5CF8A 1JSTA 4KA3A 5CSHA 3T3UA 5JFSA 3GC9A 4FK3A 4M69A 4MWHA 1ZARA 2JKOA 2R3JA 3QZGA 4J98A 4O0UA 4QPSA 2R3RA 4CFFA 4EBWA 3GOKA 3RAKA 1ZYSA 2JD5A 4ENYA 4G2FA 4BDBA 4QTEA 4MXYA 5JRQA 2UZNA 3CPCA 3V5TA 5C4LA 2BDWA 4IAZA 5KMKA 1OM1A 2X0GA 4JAIA 3A8XA 4KRDA 3D5XA 5T68A 4ASEA 3W8QA 2W5HA 3OY1A 3KFAA 4NJDA 5FD2A 3VC4A 4DG3E 1PMVA 4FV5A 4ZXTA 2LAVA 4AW0A 4EJNA 4EYJA 2C3KA 5IQDA 3RVGA 4YSMA 4FA2A 4JIAA 4ID7A 4DN5A 4B4LA 2OJFE 1JOWB 4FSZA 5L4QA 1WBOA 3B8QA 5IQCA 4M8TA 5DIAA 1ZOHA 5EQPA 1CM8A 3A2CA 3KMWA 2VO6A 3MH0A 3QA8A 4MBJA 4LL5A 2VTTA 3VS1A 4QQ5A 4FSMA 4RVKA 1JKLA 4MXOA 3FLYA 4AFEA 1H1RA 4BZDA 2PZYA 2VN9A 5J7HA 3LHJA 5AUUA 5KMMA 5BX0A 4V01A 1V0BA 2ERKA 2ZB0A 4BCNA 3L9LA 3VBYA 3L9NA 5T6KA 2PZIA 3REPA 4CEGA 5TKDA 1Q41A 2V5QA 5AX3A 1H8FA 4I23A 4U45A 2R3QA 3DKGA 3I1AA 4U81A 3PIYA 1IASA 1K2PA 3WF7A 3DK6A 4E6DA 2EB3A 2VO7A 3ZU7A 5IA1A 3VBQA 3ZTXA 4ANLA 3WZEA 3GU4A 3R7UA 2BZKB 3HECA 4G9RA 4EC9A 2IVUA 3IW6A 5C8MA 4FUXA 3UNZA 4ACCA 2PY3A 4TPTA 3HAMA 5LMAA 5DT0A 3LFSA 3VUHA 3D2IA 2IVSA 4C37A 4NIFA 2FB8A 2PVRA 3ERKA 5AUXA 1XHAA 4TZRA 4ANSA 5AP7A 3S4QA 4C34A 4A9TA 3D94A 1M2QA 4HPUE 3O2MA 4RA4A 2PPQA 3PPJA 3KRLA 5BYLA 3QTQA 3GQIA 1Q62A 2ZYBA 4E20A 2A2AA 3FSFA 4W8EA 3VUGA 2CN8A 4AOJA 4GSBA 1GZKA 4EQUA 4WIHA 4NM0A 4YZBA 3PE2A 4MD8E 4EOPA 2VAGA 3ZO2A 3Q04A 2EUFB 2YM4A 3OOGA 4LV8A 3EFLA 1RDQE 3IGGA 3VJNA 4M15A 2C5NA 3RK7A 4E5AX 4F9YA 4JI9A 5GIOE 3G5DA 1AD5A 4DT8A 2W1EA 4OGRA 4I20A 1W84A 2PULA 5ANIA 3MVLA 3V6SA 3N9XA 2NPQA 3VBWA 5F1ZA 3HA6A 2CHLA 4GK2A 4EWQA 3P79A 4FTNA 4FV6A 4TWPA 3RGFA 2VWYA 5KMNA 4OT6A 4M66A 1KOBA 1KV1A 2G2FA 1O6YA 4RGJA 3E93A 3SHEA 3ZM9A 4EH8A 2G2HA 3BCEA 2VNYA 3QD0A 2B9JA 4OR5A 3PRFA 4JL9A 4XNEA 3UC4A 3VRZA 4D2PA 2ZJWA 4GJ3A 3S0OA 2CGWA 4BDCA 3RI1A 4FV1A 3UTOA 4WHZA 3G51A 3THBA 1OUYA 2QO9A 5AUVA 5IQHA 4EOMA 3OEFX 1B38A 1PY5A 4DFYA 2R3NA 4NIFB 2C69A 1YXXA 5HICA 3IDPA 5CQWA 1ND4A 2GNJA 4XP0A 1DI8A 3E8CA 3VRYA 3BWJA 2B54A 3TIYA 4JR3A 4X2GA 4FTJA 5HE1A 4G6OA 4CXAA 4D2SA 1YVJA 1J3HA 4QQTA 3AMYA 4BHZA 5HTCA 3DKFA 5DR9A 3DJ6A 3A61A 3OUNB 3MTFA 4FT3A 3RP9A 4L7FA 2R3GA 4QO9A 4R7HA 4WA9A 5DFPA 4ZSEA 3HYHA 3QU0A 2WTKB 2PE1A 3K54A 4HZRA 5DT4A 2XVDA 1X8BA 3WF8A 4RLLA 2I0EA 5BVWA 2BRGA 3HV4A 4AZEA 1OECA 2YM7A 4EC8A 4ZTQA 2X9FA 3R73A 4LMUA 4IH8A 4BIDA 4G6NA 3VBXA 3KXGA 1G3NA 4RJ8A 4UYNA 4RJ4A 4A4OA 3DFCB 1NY3A 4EK6A 1PXOA 5FRIA 2QKWB 4O38A 2P3GX 4CTCA 3QTIA 2RKUA 3BGZA 3QCYA 4IDVA 4X6RA 3SQQA 3ZYAA 3DU8A 3CGFA 5FM2A 2GHLA 4RIWA 4AUAA 1RJBA 4X3JA 1L8TA 5E9EA 5E91A 4K18A 4DINA 3HGKA 2BFXA 2JIVA 3ORLA 5L6WL 3UIXA 5ETAA 3E88A 4E26A 2W1HA 4RWIA 5C26A 2ZDTA 3BI6A 4EZ7A 3LCOA 3TZ7A 3FY2A 4C35A 3GC0A 3NNWA 3BYOA 3HUCA 5L2QA 4QMQA 1WMKA 5IZFA 3DS6A 4L44A 5DA3A 4TYEA 4QD6A 4CZTA 4Y72A 3IPHA 3TDVA 4NUSA 1F3MC 1ZMWA 3QQJA 2QNJA 3PXFA 3KN5A 1IR3A 3NUSA 4F9BA 3WZUA 3PY3A 4G3CA 4LYNA 1ZMVA 3ZZEA 4XH6A 5DYJA 2BAQA 4G6LA 4I22A 4FK6A 5CU4A 1R39A 2V62A 3UZTA 2GNIA 2B52A 2VZ6A 3F7ZA 1OBGA 2CNUA 1Q3DA 2GSFA 1Q5KA 4UWCA 1H1SA 2ITVA 2ITWA 4PL3A 3UPXA 3L9PA 2QQ7A 4IACA 4NZWB 3FL5A 3LXLA 4IWOA 3NAYA 4PMPA 2XJ2A 2R5TA 1RW8A 3IONA 4CRLA 1Y6AA 2X81A 1YXSA 4JDIA 3NUAA 2BTRA 4ZSAA 3GBZA 1YHWA 5HLNA 2XKFA 3U87A 3R2YA 4CGAA 4FIHA 4IVCA 3U4WA 2YCSA 4FG7A 4B8MA 2HWPA 4AFJA 2J0MB 4IANA 1PXLA 4L3PA 2F7EE 4XV9A 5FQDC 5L2IA 5J5TA 2NNWB 1OIUA 3IG7A 4K0YA 4DFNA 1QPJA 3PVGA 4IB0A 1XQZA 4M12A 5EH0A 2IPXA 3I5NA 1OKWA 3HDNA 3WF9A 4ONAA 1VYWA 1ZY4A 4RIWB 4FTUA 3PXQA 2W5BA 4OTQA 2BDJA 4PTGA 4RBLA 4D2VA 4EZ5A 3BEAA 3GENA 3HMMA 4FSUA 2JITA 5M44A 1FVRA 4MF0A 4G31A 5AV2A 2HYYA 4FKOA 5J87A 5ETFA 5B2KA 4O7WA 3QCQA 3W2CA 2OF2A 2UZWE 4QMUA 3W1FA 3KREA 2R0UA 3BV3A 4YZNA 3HRBA 3M42A 4O7ZA 1ZY5A 4AZFA 4O7SA 2WIPA 3PXKA 3LVPA 4WKQA 2O8YA 3W55A 2F7XE 4BKYA 1XH4A 1YWNA 3Q53A 4YJRA 3FI8A 4FKSA 4AN3A 4GKHA 3VS5A 2J6MA 3W2OA 4D4YA 5K3YA 1XO2B 5ICPA 2HW6A 2IZRA 4CG9A 4AGCA 1T46A 3JY9A 4O81A 1IRKA 2BHEA 4KWPA 1OGUA 3KMMA 5ACKA 3RBWA 3IOKA 3OC1A 4HVHA 4C38A 3P1AA 3EMGA 4QTAA 2QI8A 2QHMA 4AE9A 3P0MA 4OTWA 3LFDA 2BZIB 5EYCA 4N0SA 3NLBA 3UOHA 5J5SA 4FNXA 2OW3A 2WTKC 4PMTA 3TWJA 3FSKA 1NVSA 3FI2A 4NW6A 1OIYA 3H0ZA 2B1PA 2VWIA 3NNXA 3OXTA 2JLDA 2C3IB 2VTLA 3ANRA 3KVWA 4QQCA 3E3PA 3QQUA 5HLPA 4UMPA 1CDKA 5KMLA 3A7IA 4BFMA 1HCKA 2R3FA 3Q52A 5IUIA 4QMXA 2WPAA 4DC2A 1KWPA 4XLVA 2CDZA 4L53A 3NVKI 3NAXA 2ZM4A 2PE2A 3ZRLA 2QOLA 3EFWA 3FPMA 1OPKA 2FSTX 3R7IA 3TI1A 3WYXA 4BICA 5FDPA 3ENHA 5JFVA 3LZBA 1P2AA 2R4BA 3C9WA 2Q0BA 5F20A 4C2VA 1UU3A 4C2WA 5CAVA 4QRCA 3PIXA 4AW2A 4CMTA 3HVCA 2HCKA 2W05A 4G5JA 5HLWA 3Q4UA 2GMXA 2GS7A 2FVDA 3I0OA 3PJ3A 3QZHA 4RJ5A 4BWXA 4CFVA 4FI1A 4G3DA 3UQFA 5HBEA 3AQVA 1UU8A 5CSVA 4YNOA 4FIFA 5CF6A 3COKA 2BRMA 2W4OA 2VNWA 1ZMUA 4K8AA 1ZZ2A 1UU7A 3ZS5A 2NP8A 3OWLA 3LJ0A 1YDRE 4ZMFA 3DLSA 5C9CA 3HNGA 3DKOA 3PDTA 2WOTA 1UA2A 3DXNA 4B7TA 4FEUA 4M67A 3QQKA 4L45A 3Q2MA 4RVLA 4DH3A 4CMOA 2XBJA 3R04A 1FMOE 3ZSGA 1U46A 4LFIA 1KE6A 5DRBA 4HNFA 4W9WA 4LGDA 1CKIA 3ZH8A 4HCVA 3MFUA 2XJ0A 2YITA 3DTCA 3HLLA 1M2RA 3DBQA 4IZ7A 4PMSA 5E90A 5AA8A 1PF8A 2C5OA 2WTIA 4C59A 3EKNA 3NX8A 3QKKA 4LOOA 3R9NA 1REJA 5CNOA 4ZY6A 4TW9A 2C6MA 1JSUA 4IEBA 2EWAA 3VUMA 2RGPA 5ANGA 1LR4A 2VGPA 3EL8A 4JBOA 3GT8A 3S3IA 5BNJA 2Y8OA 3S2PA 4CMUA 1J1CA 2BALA 2ITUA 2QU6A 4J95A 3RPVA 4FOBA 3DJ5A 5EYKA 2AYPA 2QD9A 3ORKA 2C68A 3AD5A 4MNEA 3E8NA 4MAOA 3RAHA 4DFLA 2UVZA 3VS3A 5J7BA 3LKMA 4I6QA 3SW4A 1QPCA 3GI3A 5AAFA 2HENA 3LQ3A 3WF5A 4BRXA 4D9TA 3UE4A 5FM3A 1O9UA 4NFNA 4QMNA 3ORZA 4FL1A 4AF3A 1G8AA 4Q2AA 4Z3VA 3O8PA 4XG7A 4Z7GA 2BHHA 3AD4A 5H8BA 5KKRC 1M17A 4B8LA 3FDNA 4EK8A 1GZ8A 2XP2A 3V5LA 4C58A 3ZFYA 3EN4A 2JAVA 5KNJA 5M57A 2WMRA 3OEZA 4CT2A 3DQXA 3JXWA 2CNQA 4WSYA 4O0SA 5DR6A 2Y4IB 5HO6A 5AV3A 4D5KA 4WOVA 3NUYA 4I5PA 2W96B 3MB7A 4A9UA 3DTWA 4EK5A 2HAKA 4JDJA 3BPRA 2E9NA 2OZOA 2XIZA 3A7GA 4R3PA 3Q5ZA 3C0IA 5CVGA 1MQ4A 4WNPA 3CTQA 5LXMA 2B9HA 4A06A 3CKWA 4PNKA 3FZ1A 2VWZA 2LGCA 4UV0A 5CZIA 5LMBA 1M7NA 3O51A 3SC1A 4BN1A 3PY1A 3IGOA 4FNYA 4UY9A 3F2NA 3LFQA 3NGAA 4YHFA 3F3VA 5CALA 3EL7A 1OIRA 4CFXA 2ZV2A 4WT6A 4EH4A 4BYIA 2X6EA 2AUHA 2RSVA 4MNEB 4O0YA 4D0XA 3SVVA 2WQOA 3I6WA 4OLIA 3C13A 3V5PA 5J8IA 2G2IA 3OMVA 1GZOA 5H8EA 5LVPA 4FC0A 4QP8A 5HCYA 3W32A 3Q9WA 2Z2WA 5HO8A 2E9UA 4LGGA 4I3ZA 3CTHA 2UVXA 3FMJA 3KMUA 1APME 3OCGA 2UW0A 2QO7A 4JS8A 3U6JA 4J96A 4NWMA 2Z60A 3VQUA 3Q60A 5IA0A 2OJGA 4M0YA 2WO6A 2JDOA 2I0HA 4FKQA 4UZDA 1URCA 4RFMA 3A7FA 2BRBA 3EQDA 3W2RA 4C36A 4Z16A 1J1BA 4DEAA 3R8PA 4WNMA 3IO7A 4CLIA 3MPTA 5AUYA 2ITQA 5HVYA 1XH9A 4FKGA 4LGHA 2EB2A 4U7ZA 3MV5A 5E7RA 4IC8A 3TT0A 3M11A 4V0GA 3EOCA 3FMEA 4P90A 4NKAA 4XG9A 3NR9A 5G1XA 4QMOA 3UC3A 4LG4A 5IUHA 4O27B 3NRMA 4O82A 4OW8A 2JKQA 3DK3A 3H9RA 4IAIA 4O0TA 3TV6A 3LM0A 3R28A 2H6DA 2WGJA 3MH2A 3R1NA 2O65A 4FEVA 2X9EA 4YJSA 5L8KA 4FG8A 5CEQA 2R64A 1ZAOA 2BVAA 4O6LA 4EH9A 5C4KA 1GIJA 4QYYA 1BI8A 1MRUA 3WBLA 4JNWA 4YJVA 3GU5A 5H2UA 1R78A 2EU9A 4NCTA 4YC6A 4O7LA 2Y4PA 4DFZE 4W8DA 2BAJA 3OHTA 1OL5A 4FKUA 1ERKA 3P7AA 2P33A 2W1FA 4I1ZA 4DGOA 5L2SA 3AOXA 4TYHA 2W4KA 4FSNA 3CCNA 4OBQA 5LMKC 4L68A 4X21A 5EI6A 4ZTHA 4XRJA 4KSPA 4HYHA 1Q8TA 4F08A 4NM5A 5DEYA 4FKRA 5CXHA 4CZUA 3EQHA 3O7LB 4BBMA 2BKKA 1WBSA 3D9VA 5TOZA 3WE4A 2VX1A 4EOJA 1H00A 2GNFA 2GQGA 3FLWA 3MWUA 3NUNA 3LFEA 4GUEA 3A8WA 5CEOA 4EHVA 3KXMA 2RFSA 3VW8A 3FHRA 3VIDA 2AC3A 4L3JA 2YABA 2C1BA 4BTJA 1OBDA 3SA0A 2XCHA 4YLLA 4ANOA 4JQ8A 5CEMA 5F9EA 4QTBA 3FI4A 4OBOA 4TKSA 5AP1A 1I44A 1KE7A 3VO3A 3I5ZA 2BPMA 3ACKA 4FKJA 4FX3A 4RC3A 5EYMA 3SX9A 4C3PA 5IDPA 5I9YA 2UW9A 2VO0A 4R5SA 3MJ1A 5HE3A 4O7TA 4I6BA 2A19B 4XYFA 5M4CA 2UZOA 3IECA 4EK3A 3JS2A 3QRJA 5EHYA 1OL1A 4V0GB 2BRNA 2VTNA 2C6IA 5HNGA 2VGOA 3RWPA 4BIEA 4BHNA 3V8SA 3D0EA 3BU3A 2ESMA 4O1OA 4YBJA 5JKGA 3RTPA 2EXEA 2X4ZA 4OTFA 3VUIA 4OTRA 4NFMA 3IW5A 3NUPA 3NYOA 2JBOA 3NW6A 4U0IA 4MF1A 2O5KA 4N4SA 5J1VA 3AT4A 3EB0A 3GCVA 3FEGA 4F7SA 4TL0A 4TYGA 2YM3A 4Y5QA 4RIXA 3WIKA 4APPA 4XV2A 3CD8A 4EUTA 2QLUA 2C4GA 4LV5A 4FT9A 1SNUA 3LOKA 3ORMA 4JQ7A 4M84A 2VWXA 4YTHA 1U4DA 1OPJA 4IB3A 4FOCA 4YSJA 4RG0A 2W1CA 5A14A 2PUPA 5AR7A 1JPAA 2FH9A 5DVRA 3RAWA 1MRVA 2GNLA 4KD1A 2PWLA 4QP2A 3F69A 2XRWA 5AP2A 2HZ0A 4G16A 3FMMA 5EM7A 4BCJA 4YNEA 4CFUA 3TDWA 3HMIA 2B9IA 2GNGA 4YJTA 3QTSA 1OL6A 4FF8A 4XLIA 2UW4A 4R7IA 3HP2A 3IK3A 4BB4A 4J8MA 3D7TA 3G33A 1PXIA 3Q5IA 5AAGA 5FEDA 3BU6A 4C8BA 4RJ6A 2VWVA 4MHAA 2EXMA 2UZEA 3Q3BA 3R1YA 3LFAA 1NXKA 3ZO4A 3LFBA 1JKKA 1G5SA 3ITZA 4U43A 2I0YA 3CE3A 4DTKA 2PVJA 3TUDA 3MVJA 5LARA 5FTOA 4EHEA 1P5EA 4U79A 5BMSA 3O23A 3LCTA 4CYIA 4QNAA 1Y6BA 4S2ZA 1VJYA 5HTIA 4PMMA 3K5VA 4JOAA 4JIKA 3PPZA 2PUIA 2IG7A 1UNGA 4WRGA 4ZSLA 4U3YA 3ZFMA 2ETKA 2CKEA 2VX3A 1FVTA 2YERA 5M56A 3RM6A 4CD0A 3O17A 3UP7A 4E8AA 4Z7HA 4RIXB 2QLQA 3UO4A 3W2PA 3EQPA 2YEXA 3HRFA 4ANNA 2B55A 2UW6A 5CVFA 5CTPA 1KE8A 1Z9XA 3LFCA 4ZTMA 4GFOA 4QMMA 5HBHA 3NUXA 3I60A 2XA4A 3EQRA 1WAKA 5HIBA 1F5QA 2VTQA 4IVAA 3EKKA 4NEUA 4ZY5A 2WU6A 4O0RA 4LRKA 4EONA 5E8UA 5AR8A 3C0GA 2R7IA 3FY0A 2X8DA 3UMXA 3F3UA 2WTJA 3P23A 3HA8A 4GW8A 1KUTA 3ATSA 3RHKA 2YIRA 4NH1A 4RZVA 4MD7E 3G6GA 4IJPA 4BCKA 2XCKA 2YAKA 1BL7A 2JFLA 3KL8A 5M09A 4M0ZA 5HE2A 2E2BA 1SMHA 5AMNA 4WG5A 3VUDA 1GIIA 5K5NA 4QMYA 1Q4LA 3Q96A 2VWBA 4RSSA 3QTUA 5E4HA 2VV9A 2YJRA 2PUNA 2YM8A 1O6LA 5J79A 1KV2A 2WKMA 4J52A 3OWJA 3BQRA 5J95A 3R7YA 3A62A 4QYHA 3V04A 4BWPA 4YJUA 2WXVA 3DNDA 2HXQA 3RMFA 5AA9A 4PQNA 3VUTA 5CXZA 4EI4A 4B9DA 3UVRA 2ONLA 4L43A 5DWRA 2R0IA 3LPBA 3SRVA 5AIRA 3B2WA 5HBJA 4IDTA 2J0LA 3MI9A 3P5KA 4GRBA 4IX5A 4J99A 4M69B 4E73A 4ZZMA 5EW3A 3LLTA 4WBBB 3TXOA 3FZOA 2YIYA 5HI2A 4O22A 4HVGA 4RX7A 2IJMA 3QALE 3BE9A 3F88A 4YHJA 5BPYA 1FINA 3GCUA 4LRJA 4D55A 4R78A 1Y57A 3A99A 4NYEA 3KC3A 2PZRA 4TRLA 5JZNA 4AACA 3R0TA 2HZIA 5IMXA 5L3AA 3TZMA 2XMYA 3VQHA 2O3PA 5AV0A 2C6LA 3NW7A 3RHXA 2W99B 3DJ7A 4E4LA 2XM9A 1UWJA 1VYZA 2WD1A 4AT3A 5JQ5A 4OT5A 3QKMA 3LQ5A 4APCA 4DG0E 4MX9A 2GDOA 4EYMA 5TE0A 3BKBA 2HY81 3NNUA 1EH4A 4PTEA 5ETCA 3TUBA 1XH6A 1BMKA 3GUBA 1Q8ZA 4IMYA 2QOHA 3U9CA 3I0QA 2VTMA 4HGSA 5BVEA 3VHEA 1U54A 3C50A 5IEVA 2ZB1A 4FICA 3NSZA 5KZIA 4DH5A 5BUJA 4K33A 3FI3A 4FKLA 4J97A 3C0HA 4ASDA 1Y8YA 2PVNA 1R0PA 2I0VA 2XS0A 4JBVA 5JZJA 5IQFA 3QRTA 4C02A 3HP5A 5D9HA 4DEDA 4HGLA 2HELA 2FSMX 3N4UA 2VTJA 1PXPA 2J7TA 1IEPA 2YIXA 1V0PA 5EI8A 2UZTA 3NIEA 4TT7A 4H1JA 2V7OA 1AGWA 4E93A 5CSPA 4FSTA 2C5YA 5IG1A 2FUMA 3SRVB 2R3MA 2Z7LA 1XJDA 3TV7A 3QRIA 1MRYA 2W1DA 5AWMA 4IM2A 4EUUA 4E4NA 2ZM1A 3UO6A 3C4XA 3KEXA 3MFTA 1H07A 3OFMA 3POZA 5CZHA 5HG5A 2DUVA 2A4LA 3C4FA 4XOZA 5BQ0A 4F7LA 5KO1A 2Z02A 3T9TA 5I9ZA 4FYNA 4CYJA 3TTIA 4BCIA 1GIHA 4BDEA 2OF4A 2H96A 2WTCA 4TYJA 1H01A 4CV9A 2OZAA 3E3BX 4I4FA 4KBCA 3F5PA 5FBNC 3ORTA 4PRJA 2RL5A 2JDTA 4G3GA 4ITIA 3MIAA 4CFMA 3F9NA 2O63A 4LRMA 4CKJA 5EI2A 3LCDA 3RK5A 4HNIA 4I5MA 2C3LA 3V5WA 4QT1A 5HQ0A 4IIRA 2Y9QA 3F61A 3ZUTA 3MB6A 3BYSA 3CC6A 4KKGA 4IM0A 3I6UA 5HIDA 3ORXA 5ANJA 3S95A 5AM7A 2CN5A 4K6ZA 4O6EA 4FV7A 2G01A 2IZUA 4E1ZA 2F2UA 5CT0A 5FXSA 1P14A 4ZLOA 2V7AA 4H3BA 3TL8A 4RX9A 5DGZA 4EOQA 4EQCA 5BVDA 3COMA 2XNNA 3QRKA 4X6QC 4BI0A 5IU2A 3S1HA 4NKSA 2BROA 5IDNA 3POOA 5KE0A 3R7VA 4X0MA 3TZ8A 2R2PA 4BCHA 4HGEA 4BDDA 3R21A 4FNWA 3BELA 4Y83A 3FMNA 4IE9A 2Q83A 4LI5A 2WMBA 2OJ9A 4YBKA 4O21A 4QYGA 2CGUA 3W8LA 1WBPA 4KINA 4QMTA 4FIJA 4C61A 5ANDA 1P4OA 2Y0AA 3ZUUA 4F09A 3WF6A 4BR3A 3UGCA 4D1XA 2CMWA 1CMKE 2J0KA 4LUEA 3K3JA 4D0WA 4OBPA 1ZLTA 3SOCA 3H0YA 4YC3A 3R9DA 2XNOA 4BDAA 3TG1A 2RIOA 5HU3A 3ETAA 3RWQA 3BYMA 3DFAA 2VTRA 4CTBA 4IWDA 4PV0A 3DNEA 3CR0A 5ACBC 4NK9A 3RNIA 4CT1A 3PYYA 2OZAB 3PUPA 4L6QA 5ITAA 3MJ2A 4G3EA 4S34A 2XH5A 4XV1A 5E8XA 3RCDA 3MN3A 3BHUA 3P4KA 5C8KA 3EFKA 1XH8A 2BKZA 4Y85A 3CEKA 2GU8A 4QOXA 4JRVA 4O7RA 4ZP5A 5I9XA 3QGWA 5KUPA 2DYLA 3OOMA 4J53A 5BUIA 2X7FA 5IA2A 2QOOA 1KE9A 2F2CB 3TKHA 4GT5A 3QTZA 4CLJA 4F99A 3V3VA 4HW7A 3PFQA 1PJKA 2W06A 4FIIA 4G9CA 4JVGA 4U9AA 5BUEA 2CGXA 3PPKA 4E3CA 3NZ0A 4USDA 3H9OA 4CV8A 1PXJA 2VTSA 1XBCA 1TQMA 2PMOX 3B2TA 4WG4A 4XHKB 5KMOA 4UX9A 4YJPA 3R01A 3MESA 1FBNA 3HEGA 2WHBA 3GXLA 4S32A 5JSMA 3VULA 4L67A 3TM0A 4IAFA 3FZPA 3NS9A 1ZYDA 4KAOA 2UW3A 2XNEA 4F0IA 4F1MA 1LPUA 1F0QA 4U80A 3VWAA 4ALWA 3QC9A 3GC8A 4F4PA 5CEKA 2FSLX 3PZHA 3QXPA 3M1SA 3MA6A 5GINE 5DBXA 1J91A 4KBAA 4KIPA 3SV0A 2I40A 4RFZA 2QOBA 5JGBA 3MS9A 5A6OA 4LOPA 3ROYA 4ANMA 3CQEA 4XBRA 2HK5A 5AP0A 4EOIA 2W9ZB 2BIKB 3EFJA 3SKCA 2QKRA 3H9FA 4YJNA 4FNZA 4L9IA 2OJJA 2IZSA 3KN6A 3KXHA 5IA3A 5EQEA 3I79A 2I6LA 2QVSE 2RFEA 3FXXA 5D41A 4D1ZA 2X8EA 2ZV9A 3HMNA 1R0EA 3NIZA 3PY0A 4UB7A 2CGVA 1DI9A 2BRHA 3BHHA 3DY7A 4IM3A 5B2MA 3O96A 4YJOA 2BILB 2A1AB 4V05A 3Q4CA 2AC5A 3CD3A 4PPCA 4M13A 3TEIA 3ZM4A 4TWNA 4ZAUA 3CBLA 3KCFA 2ITOA 3QQHA 2CCIA 4DEIA 3D7ZA 4G17A 5AUWA 1CTPE 5AIKA 2ZVAA 3G6HA 4H1MA 1W8CA 2R3PA 2BZJA 2RG6A 2YM6A 3FQSA 1RE8A 3OW4A 5CX9A 4FZAB 3UYTA 5EDQA 4C4JA 5GZAA 2YWVA 2OFUA 4ZOGA 2UZUE 5EOBA 1JQHA 2JKKA 4IVDA 4P5QA 4DH8A 2WEVA 2C30A 3ZOSA 4F6UA 4GFGA 3LM5A 4ZTRA 1PRYA 3GU6A 2XB7A 5FUTA 5B0XA 5FEEA 4QNYA 5EW8A 3IS5A 3UPZA 4GU6A 4JRNA 4TTHB 3ZDIA 2JIIA 4ZTNA 4ACDA 4M7IA 1KSWA 3DAEA 4II5A 4FG9A 3MGYA 3JUHA 3WOWA 2BAKA 3A7HA 5F4NA 4MEDA 3PE1A 5H8GA 1Z5MA 2GNHA 2QHNA 2QR8A 5EQYA 2JEDA 3QQGA 2ZV8A 4O83A 1OMWA 5JH6A 3C4CA 5L2WA 5L2TA 2XK9A 3FL4A 3GP0A 2XK8A 1IAJA 1YKRA 3V01A 4FBXA 4XCUA 2GQRA 3R1SA 5BMMA 2VTPA 1UU9A 2OKRA 4BI1A 2YZLA 5K9IA 1YWRA 4JJRA 3N4VA 4R1VA 5ANKA 3KY2A 1REKA 4XG6A 3P08A 1NW1A 3P9JA 4S33A 1Q97A 3AMAA 2PVFA 3EH9A 4I41A 2XIRA 2WMVA 1YXUA 3EJ1A 5CAOA 3QUPA 5EK7A 3DQWA 4HYUA 3LIJA 3P78A 2B0QA 1NA7A 3FBVA 1M52A 4PDYA 3UOKA 3O71A 5J9ZA 4IAAA 3W2SA 5A6NA 3LJ2A 2QG7A 5HE0A 3BZ3A 1JBPE 2PVKA 4E6QA 4GG7A 5AJQA 1PYEA 3QZFA 3WILA 2DS1A 5TO8A 3SDJA 4FTRA 3FKNA 4AZSA 4EL9A 2IZTA 3ELJA 4AOTA 1IG1A 3CY3A 5E8YA 3KXXA 3L8VA 3OXIA 3HV5A 1IAHA 3FZRA 4OAUC 4YLKA 3G0FA 5CWZA 3AXWA 4YPSA 2YACA 4K1BA 4LL0A 3I81A 4L3LA 3DK7A 1V0OA 2J90A 4KABA 2OH0E 1BLXA 4N6ZA 3MSSA 5E8TA 1URWA 3QD4A 1E1VA 5A54A 4GKIA 1WBVA 5FLFA 4E5WA 1DM2A 5KBRA 3PLAE 1VEBA 1XKKA 4KNBA 3FZTA 4NW5A 3ZSHA 4PY1A 2OXXA 4V04A 5LVNA 4FTCA 5EG3A 3CSVA 3QTWA 5HIEA 2QOIA 2E9OA 5CS6A 3F5XA 4PNIA 4I21A 4FVPA 3UVQA 4ACMA 3DLZA 1FOTA 1PXMA 3QHWA 4HZSA 5DE2A 4UZHA 3QQLA 4A4LA 2VWUA 2W1GA 4U3ZA 5EOLA 3BEGA 5KMJA 3C1XA 4I6HA 5B2LA 3ET7A 4JBQA 4W4XA 4JLCA 3GEQA 2YDKA 2OBJA 5HORA 3TACA 4F9WA 3VS6A 2JGZA 3PWYA 2WQMA 2Z7SA 5KBQA 2C5XA 2PHKA 4ZEGA 2YN8A 4FMQA 3GFEA 5I3OA 3LXKA 5HHWA 4ZJJA 2HY0A 3TNIA 3A4OX 4F7NA 3PA4A 4FSWA 4F64A 4JX7A 4OAVB 2OK1A 2PZPA 5TT7A 3NW5A 2NRUA 4L8MA 4BKZA 3EYGA 5HNIX 2PMLX 3ZONA 4AWIA 1Q3WA 2J50A 4KIKA 3HZTA 4RC2A 3FWQA 4FTLA 4PP9A 4BDKA 5CF5A 3QCXA 2W5AA 2XUUA 3HDMA 3TKUA 3AT3A 3UMWA 2HWOA 3W33A 4R77A 3DDQA 3UG2A 1B6CB 1OKYA 5KCVA 5E8SA 2CKPA 4DF3A 1SVGA 3QUDA 3R30A 4CCUA 3LW0A 1FGKA 3TIZA 2ITYA 5DI1A 4JG7A 5LCKA 2CPKE 4C4GA 4ZZNA 1U5RA 3HMOA 4HCUA 4EJ7A 3DGKA 4FT5A 1WVYA 3BGQA 3H30A 1OI9A 3KQ7A 3ZXZA 5E1EA 3E62A 5J9LA 4RPVA 2J51A 5A4EA 4R3CA 5FG8A 3T8OA 4AT5A 3BLQA 3RPRA 4L7SA 4AZTA 5CAPA 2R3KA 4XG8A 3E92A 4NTSA 2O2UA 3ZBXA 4BDIA 4D2RA 4BZOA 4JQEA 4O2PA 4EH7A 5IEXA 5IQGA 2PMIA 2WTVA 3A60A 4DLJA 2OFVA 4YZ9A 4TNBA 5AFVA 4XJ0A 1PMUA 5JFWA 2B4SB 3VW6A 1H1QA 1XH5A 3COHA 3PVWA 4PL4A 5I4NA 5TF9A 3A4PA 2X1NA 3NMUF 2WOUA 1TVOA 1QPEA 4O0XA 4A9RA 4YURA 5IMEA 3LJ1A 1LEZA 2J5FA 2PZ5A 2XKDA 2CSNA 3R8LA 4KRCA 3VAPA 4RX8A 2E9PA 1YI3A 5IH4A 4GU9A 4FGBA 4D5HA 3TJCA 4RIYA 4XMOA 1H27A 4K11A 4NSTA 4CQGA 4UMRA 5EM5A 4FT0A 1QPDA 3IDBA 2PVYA 3BIZA 4UWBA 3ZLSA 3SG9A 1TQIA 2BDFA 1VZOA 1UNLA 3AG9A 3QWKA 3OTUA 4D4VA 3PJ1A 3V6RA 4FUYA
chains in the Genus database with same CATH superfamily
5DOSA 3DT1A 3OS3A 3Q4TA 3QHRA 2ZDUA 3PSCA 4RLKA 2H34A 5JQ8A 2YWPA 4ACHA 4DA5A 3OWKA 3ZRMA 5BYYA 3NYVA 3FPQA 4FV9A 4TXCA 4DCAA 4FODA 4GFMA 4GIHA 3U8WA 4AGUA 3H3CA 4I0TA 4PP7A 5HKMA 4BZNA 2IVVA 3CY2A 3E7OA 2Y6OA 3QC4A 5FDXA 2OU7A 4KKEA 4MH7A 3ZLXA 3ZSIA 5E92A 4BBEA 3KA0A 4F0GA 3KRWA 1ATPE 3IQ7A 4QP6A 5HGIA 2Y4IC 2QCSA 2ZV7A 3ZO3A 3Q2JA 2GTNA 3DDPA 4AX8A 3E64A 3OCSA 4C0TA 4I0SA 4Q9SA 1PKDA 2C1AA 4FKPA 1JKTA 1JAMA 5GJGA 5JT2A 3QYWA 4QYFA 3MY5A 4CSVA 3ZRKA 3MYGA 4JDHA 3CP9A 3IW7A 4DEBA 2OSCA 1DAYA 5CAUA 4RC4A 3QBNA 2XJ1A 3FMLA 3UIBA 4DYMA 3WYYA 3QLFA 3UQGA 3IW4A 4GL9A 4PDPA 3FHIA 3C4EA 2Q0NA 4IVBA 4D58A 4PF4A 2JFMA 4K9YA 4LM5A 4YHTA 4TYHB 5H9BA 3V5QA 1ST4A 1NVQA 4P4CA 2WFYA 4IFGA 5IQAA 5I9WA 2C5VA 3BV2A 1Q8UA 4C33A 3V8TA 4YZMA 4ZLYA 3I7BA 3PA5A 2PUUA 4GJ2A 4KIOA 3NWWA 5CSWA 3VS2A 3WE8A 4BGGA 2F9GA 4O7NA 3H4JA 1KE5A 4A9SA 2C6DA 2PK9A 5C8NA 2WELA 3C5UA 1E1XA 5DT3A 5ANEA 3D2KA 4HCTA 3LXPA 4I6FA 4LOQA 4RIOA 4ERWA 5LCJA 3SXFA 5EHOA 5EKOA 1A9UA 2RFDA 2X2LA 2XYNA 4YZDA 4FYOA 4S31A 4DG2E 4F9AA 5LOHA 3R9RA 4MXXA 5LVOA 1YXVA 1ZYLA 1XR1A 2UW5A 1WBTA 3EN7A 1OITA 3G0EA 2XNGA 4JG6A 2V22A 4LMNA 2XAOA 3LXNA 4WBOA 2YFXA 3BHVA 4IX6A 4FTQA 4B99A 5HTBA 2OGVA 3UQCA 2ZOQA 5CAQA 2P0CA 5K4JA 3OY3A 4MBIA 2JBPA 3R00A 3VNTA 3IDCA 4JAJA 1T45A 5CT7A 4U8ZA 5HO7A 2O64A 1G8SA 1YW2A 4EKLA 4IZ5A 3ZFXA 3Q9YA 4BCGA 2WZJA 5AV1A 3HKOA 3L8SA 2BZHB 1BI7A 3BU5A 3NPCA 5HG7A 5IQEA 3DOGA 3U6HA 1W0XC 3UNJA 2JDRA 5GZ8A 4MXCA 5D7VA 4O7YA 1SZMA 4FKTA 4DTBA 3ZUVA 1I09A 4Y8DA 4EHZA 2X2KA 4ZTSA 4Z55A 3UZPA 4ITJA 3ZDUA 3PG1A 5K5XA 5CLPA 4AXCA 4MNFA 4P7EA 4FEXA 5B7VA 1YXTA 3DV3A 5A4TA 5A3XA 1HCLA 4DITA 1XH7A 4K77A 3R2BA 3JVSA 1STCE 2XF0A 3EQFA 1J7UA 5JMSA 4FZFB 5KZ0A 2IVTA 5DRDA 3LMGA 3DXPA 3VN9A 3DBFA 3PIZA 4HYIA 3VUKA 3F3TA 2PSQA 4QP7A 4TNDA 3ULZA 3HV6A 5F95A 3WARA 5IISA 1UKHA 3EQCA 5AAEA 4O1PA 4IAKA 3NEWA 4MTAA 4D4SA 3R8VA 4WNOA 5KX8A 4BTKA 3ODYX 4L52A 5EM8A 3D7TB 1R3CA 1W2FA 3G90X 1OUKA 4YU2A 4YLJA 4IADA 4ERKA 3GU8A 3F5GA 2BFYA 4AN2A 1IA8A 2HZ4A 3RNYA 4CFWA 4DCEA 1BL6A 4WUNA 2PVMA 2R3IA 4M14A 3IW8A 4G1WA 1OVEA 4D9UA 5DMZA 2G15A 5LWNA 4DLIA 2IWIA 3CPBA 3NUUA 4QP4A 5CANA 1Q99A 1WVWA 3ORNA 2YHVA 3PWDA 4W4YA 2UZDA 4AT4A 4KB8A 4C3RA 5EKNA 2OXDA 4FEQA 1Z57A 1K9AA 4I4EA 4JG8A 4BL1A 4YJQA 4FIEA 2XK4A 3UO5A 2YLEA 2ZM3A 3W18A 4DHFA 4EHGA 3WZDA 2BIYA 4Y73A 3ZO1A 4AP7A 5D7AA 3QGYA 4EK4A 5KMIA 2UV2A 2BR1A 4GEOA 3RK9A 4DFXE 1ZYJA 4HPTE 3ANQA 1ZOGA 3O50A 5IUGA 5EDRA 2YDIA 4A7CA 3IKAA 4H3PA 3QF9A 4NCTC 2BUJA 4MQ2A 4RWJA 2Y7JA 4BDGA 4BY9E 4ZTLA 4UMUA 2P4IA 4C4EA 4HVSA 1JSVA 3DBEA 2XKEA 5LQFA 1PKGA 3QUEA 2ITPA 3ZXTA 4ARKA 3RAIA 5D11A 3F3ZA 3MW1A 4E4MA 4YR8A 3GOPA 4XBUA 5AR3A 3QD2B 2X0QA 4BYJA 3G9LX 3PLSA 4H58A 4C62A 2XIKA 3UZRA 5IA4A 1FVVA 3QRUA 3WZJA 5K4IA 5IPJA 3HV3A 4H3QA 4PDSA 4IZYA 3R9OA 3MDYA 4L01A 3DZOA 4UXLA 3KF4A 1FMKA 2WNTA 5AR2A 3D83A 5TR6A 5A9UA 2IW8A 1PHKA 3FC1X 5DEWA 5HVKA 2ITTA 5L6OA 4EBVA 5I9UA 2YCFA 4S30A 3Q9XA 3PJ2A 2P55A 4R7BA 5AP4A 1CSNA 3AD6A 3HL7A 3W16A 4A07A 5HU9A 3GQLA 4WSQA 4B0GA 1PXKA 2WQEA 3FMKA 2OG8A 3OROA 4FV0A 3BGPA 3TJDA 1YHVA 5CNNA 5IA5A 4QEBA 3SW7A 3VS4A 4IBMA 4IXPA 3II5A 4FSQA 2EXCX 2FSOX 2X4FA 4MXZA 4C4HA 4W4VA 4XX9A 4UWYA 1AQ1A 1QL6A 4UXQA 4J7BA 3CLYA 3R02A 3UIMA 5BVKA 1UWHA 3EHAA 4YTFA 4IB5A 1BUHA 2X7GA 3DAKA 5EDPA 1W2DA 4RVTA 4DH7A 4ZLZA 3ZC5A 2JDSA 2YM5A 3L8XA 4MWIA 2OXYA 3RPSA 4C4IA 3FV8A 5BVNA 4C57A 4LQMA 3JR1A 3B8RA 3D14A 1H1PA 3NYXA 4O96A 5M55A 4ZY4A 4GV1A 4BI2A 2YAAA 3E8EA 5CI7A 1CKPA 4E6AA 5K0XA 3CJGA 4NM7A 4YMJA 3R7GA 2IN6A 3AC4A 1WBNA 4O4DA 3RALA 4DGNA 4ZZOA 3U6IA 3QFVA 3RCJA 1M2PA 3KB7A 4FKVA 4QTCA 4YC8A 5EFQA 4DBXA 5JN2A 4U44A 1W83A 4ZSJA 3C5IA 3V51A 3AC5A 2HW7A 2C6TA 5HNBA 4GMYA 4IC7A 4F6SA 3DA6A 2VD5A 4XS2A 5M53A 3OF0A 1OL7A 3R8MA 4BDFA 3Q9ZA 4ANBA 2YZAA 4FL3A 3CS9A 4P2KA 1WVXA 4CRSA 4I0RA 2WMTA 4RT7A 3ZLWA 1ZOEA 4NL0A 3BHTA 3KRXA 4WD5A 2X6DA 3FC2A 4EOLA 5KHWA 3CGOA 3QD3A 4GVJA 4FT7A 5HESA 1U54B 2B9FA 4ZSGA 2XBAA 1Q8WA 4QMPA 5AM6A 4USEA 4ORKA 2UW7A 4H36A 5AEPA 4G5PA 4PTCA 1Y8GA 4FRFA 2X2MA 4R6VA 3JY0A 1OL2A 2YDJA 5L8JA 2IO6A 3FXZA 4E5BA 3EZVA 1SNXA 2X39A 3L9MA 3MVMA 2FO0A 4MK0A 5AP3A 5FP5A 5GJDA 3MIYA 2C6EA 4WRSA 5EW9A 3UBDA 4AE6A 4C3FA 1MUOA 4BDJA 5A4LA 2OWBA 5AX9A 4FV8A 4YO6A 3GNIB 3FE3A 5JEBA 2VU3A 5CU0A 3MA3A 5CASA 4F78A 3D4QA 2PVLA 4G3FA 3SD0A 1QMZA 2ETMA 4DGMA 2QOCA 5I3RA 4U97A 4G34A 3K2LA 5GIPE 1E9HA 2IEWA 1BYGA 1YOMA 4XEYA 1ST0A 3FLSA 2W4JA 3ML1A 4XP3A 4PL5A 3TKIA 4GYIA 3EYHA 2OI4X 3WI6A 3COIA 3QCSA 1W82A 3K5UA 4AA4A 4XG3A 4BCQA 3CQUA 4DH1A 2OIBA 4D2TA 3ZLYA 2XEZA 3FZSA 3CKXA 3DB8A 4OTGA 2CLXA 5D1JA 3TV4A 4MD9E 4H39A 2R9SA 2FA2A 2J0IA 1K3AA 2QO2A 2VTOA 4F70A 1Q8YA 4I5CA 4WUAA 3ROCA 4Y95A 1PXNA 4DAWA 2WQNA 3UOLA 4I94A 3G15A 3M2WA 1OB3A 3ZCLA 3LFNA 3BLRA 3KXZA 5BVOA 3QTXA 1M14A 4TYIA 3DBDA 5CU6A 4K2RA 1PYXA 3FAAA 3OCTA 4ZJIA 5DNRA 3N51A 3OUKA 2PYWA 2H9VA 2VX0A 4AQCA 4OTDA 3DCVA 2GHGA 2OIQA 4GCJA 4ZIMA 3ZZWA 4PPBA 2FYSA 2XEYA 1S9JA 3MY1A 5LVLA 4C4FA 4Q9ZA 4XOYA 3F2RA 4BWKA 4F1OA 1XBBA 4CNHA 1NT2A 1GJOA 4U6RA 4FIGA 4QMSA 4ASXA 5CQUA 5AUTA 1XWSA 5EHLA 4DGGA 5EYDA 5FGKA 3GCPA 3TNHA 1BKXA 3GU7A 4A4XA 5M51A 3ZHPC 2CJMA 2QR7A 2R3LA 4FTMA 3KU2A 4X2FA 4O84A 2UW8A 3CQWA 1BX6A 1JNKA 2QU5A 3TN8A 5IH5A 2ONLC 2HIWA 2RFNA 3P7BA 4Y46A 5ETIA 1JWHA 5C03A 4Q5EA 4GYGA 2WIHA 2WTWA 4EH5A 4JR7A 2GHMA 1LUFA 4DEHA 2IF8A 4ZS4A 5GZ9A 2WEIA 4BCMA 1PMNA 1J7LA 3MFSA 4F0FA 1YHSA 3ACJA 4KKHA 4I92A 3PSBA 4CCBA 3PRIA 3KKVA 3SXRA 3VHKA 3QTRA 4ZJVA 3ORIA 4MBLA 5BVFA 3PVBA 1B39A 4DBNA 1UVRA 1DAWA 4DEEA 1H0WA 3EQGA 3PJCA 3WZKA 4QQJA 3OTVA 4UMTA 5LVMA 3R9HA 5I0BA 2G9XA 2XKCA 4CFNA 1PMEA 1CKJA 5KKRB 5IKWA 2ITXA 3FQEA 3NFGB 4NU1A 3NVMB 1YDTE 4U41A 4D28A 4BF2A 3KK9A 5GJFA 2GCDA 4RZWA 3OVVA 3NYNA 4EH3A 3VVHA 3V8WA 1FQ1B 3QA0A 3O0GA 4IJ9A 4IX4A 4EOOA 4CG8A 4FVQA 4CZYB 5KHXA 4KSQA 2REIA 3RM7A 1JLUE 3E87A 3Q32A 1Y91A 2VTIA 3AC8A 4O7VA 4RWLA 3Q6WA 4GT4A 5DPVA 1NVRA 3AMBA 1WCCA 1R1WA 3ATTA 2BMCA 3DB6A 3QXOA 4N70A 1YWVA 1O6KA 2ETRA 1A48A 3LE6A 2YJSA 2XZSA 1Q61A 5CEIA 2DQ7X 3O5AA 4FGRA 3OCBA 2PE0A 3MPAA 2B53A 4IX3A 2EVAA 4IWPA 4L00A 4NT4A 4IQ6A 2CNVA 2ZMDA 3FQHA 5DG5A 4XG2A 3UJGA 5FP6A 3JVRA 3EN5A 4AZVA 3EZRA 3CIKA 4RWKA 4W9XA 3RPYA 4AXAA 3D5WA 4FTIA 2C3JA 4O0WA 3ZMMA 4YP8A 2F4JA 4KS7A 1SVHA 4A9YA 2DWBA 3VJOA 3UG1A 5LMKA 3BYUA 4OTIA 2WU7A 4QYEA 5DN3A 4D1SA 3LMIA 2F7ZE 4ACGA 1MQBA 2HZNA 3ID6C 2XIXA 4RQVA 5F94A 3SGCA 1JKSA 5M4UA 3W10A 3GGFA 5HZNA 3AC3A 4E7WA 5IEYA 1GY3A 4N57A 4PDOA 3P86A 2UZBA 4FKWA 2PU8A 3FMDA 5HD7A 4DE4A 5D10A 3OWPA 3BQCA 1U5QA 4Z9LA 4IW0A 4NJ3A 4ANQA 3QL8A 5HG8A 3FKOA 3E7VA 3QQFA 4IAYA 3ULIA 4AAAA 3RZFA 1ZRZA 5CU2A 1SVEA 2XM8A 3LCKA 3VS7A 2PVHA 3TCPA 4AN9A 3D5UA 3U51A 5C1QB 1GNGA 2JIUA 2Z7RA 5E1SA 1U59A 3EQIA 4F1TA 4J8NA 4IHPA 1W2CA 4DTAA 5IF1A 1Q24A 2SRCA 3LMHA 2XIYA 3BLHA 4MKCA 4Q5HA 4DFBA 2XNMA 3OBJA 3Q6UA 5J9YA 3ZBFA 2YIWA 3BWFA 3O8UA 3I7CA 3EIDA 4R1YA 2I1MA 4F9CA 3I4BA 2UZVA 4R8QA 2QG5A 5L6PA 4EZ3A 4YTIA 2X7OA 4U5JA 3FMHA 3MPMA 4AOIA 4F6WA 2R7BA 1YI6A 4FTAA 4FJVA 3SAYA 3QLGA 4X3FA 1L3RE 3HRCA 2CCHA 4MQ1A 5CYIA 4BVUA 2HXLA 4YGAA 2C6KA 4EH6A 2ZAZA 4KIQA 4UN0C 5AV4A 1J7IA 2CLQA 4UEUA 4QP3A 5A4CA 3BYVA 3KRRA 2J5EA 3ENMA 3R63A 4TWCA 5HG9A 2J2IB 4YTCA 4BGHA 2JC6A 1OPLA 3CJFA 4I5HA 4FL2A 1TQPA 4ENXA 2XRUA 3R7OA 2C0OA 4RQKA 2CKOA 2JAMA 5K0KA 5JFXA 4AGWA 3FKLA 5GNKA 5CI6A 3ALNA 2WMAA 4RJ7A 5M4FA 3PP0A 3PXZA 5JK3A 4IFCA 3U4UA 1H25A 2GFCA 3OW3A 3ZC6A 2IW9A 4EOSA 2G1TA 3RZBA 4GS6A 4IWQA 2W9FB 3UVPA 5CU3A 1UNHA 3PZEA 3TZ9A 4USFA 3QWJA 5GHVA 4LUDA 1UV5A 5HD4A 2ERZE 3L8PA 3VF9A 1V1KA 4QMZA 1S9IA 2ACXA 4FZ7A 3W2QA 3O8TA 4BKJA 3LLAA 4UYAA 2A0CX 2VTHA 3GCQA 4QTDA 4UBAA 2QURA 3VBVA 3AT2A 3KK8A 3HV7A 5FWKK 1FGIA 2F57A 4R5YA 2Y6MA 3HMPA 3JYAA 1H24A 3RJCA 4P5ZA 1HOWA 2RG5A 4HGTA 4QMWA 3DZQA 3P7CA 5LWMA 3VF8A 3G9NA 3AGMA 3F5UA 3ZEPA 3BLAA 4QPMA 3LCSA 3C51A 4H05A 4IZAA 3BBWA 4RRVA 2YIQA 2BCJA 2XNBA 3KXNA 4I6LA 5JRSA 3EN6A 3GB2A 3T9IA 3UP2A 4BCFA 5AP5A 4GH2A 1ZZLA 3OZ6A 4RX5A 4FV4A 4MCVA 1TKIA 2J0JA 1PW2A 4X3FB 4X7QA 5DH3A 3OT3A 2QODA 4HOKA 5CEPA 2ITZA 4BGQA 4X2NA 3R7EA 4BTFA 4XRLA 4C7TA 4GK3A 4EKKA 4FV2A 3OT8A 4KS8A 2XYUA 3FLQA 3PP1A 4DGLC 3QAME 2XK7A 2I7QA 4AU8A 4JX3A 2YISA 5FTGA 4TN6A 4XUFA 3R83A 3PVUA 4U42A 3FLNC 4GG5A 3PXRA 4ZS0A 2PTKA 5H3QA 4EEVA 3R71A 5CY3A 4FE2A 3UOJA 4JT3A 5AP6A 3SG8A 5CSXA 1DS5A 3HX4A 2C6OA 2UZLA 4XG4A 4GT3A 3OG7A 5CVHA 1H26A 1VR2A 3L1SA 3OBGA 5ANOA 2V55A 3OD6X 1H0VA 3RKBA 4YPDA 5E8VA 4HVDA 3CTJA 4UMQA 1XBAA 3AGLA 5HOAA 2UUEA 3W0SA 5FXRA 2YA9A 1OZ1A 2E9VA 3KVXA 4FZDB 2X8IA 3KULA 3G2FA 2ZMCA 3SXSA 2GFSA 2JKMA 4JBPA 4PUZA 5DHJA 4L46A 2C0IA 2J9MA 3QX2A 2W7XA 3R6XA 1SYKA 5D12A 2IW6A 3BRBA 3TNWA 3UDBA 4GUBA 2CKQA 5CENA 4BC6A 4BBFA 4BCOA 3NCGA 2WMQA 3UNKA 3U54A 3PSDA 2XK6A 4FVRA 5C27A 3AC1A 3PTGA 3RINA 2WMSA 4E4XA 4D4RA 4EWHA 4ALVA 3ORPA 3V5JA 3U55A 1H4LA 1YOJA 5J1WA 2JDVA 5M06A 5JGAA 3BE2A 4KIKB 4B6LA 3QKLA 3HAVA 3NDMA 4FR4A 1LP4A 2GS6A 4HVIA 3FYJX 3BHYA 3E5AA 2P2HA 4JDKA 2W1ZA 3CXWA 4QP9A 3IOPA 2W17A 4RFYA 3MBLA 3R22A 4WNKA 4WG3A 1FPUA 2VUWA 4DEGA 5L8LA 2WMXA 2OO8X 3E8DA 5HEZA 4YUQA 2NO3A 4AGDA 4ZMEA 4NM3A 4RJ3A 4AW1A 1YRPA 2KULA 2PL0A 3E63A 3FYKX 4NTTA 4PX6A 2OH4A 4EOKA 4DT9A 4HJOA 1SM2A 3R1QA 4UALA 5HCZA 3F66A 4BTMA 3MVHA 3UODA 4JXFA 1JVPP 5EM6A 3R8UA 1ZXEA 2WMWA 5M4IA 3GC7A 5T3QA 3C7QA 1MP8A 4FSRA 3RPOA 4O86A 3SOAA 3UDTA 1WBWA 4J71A 5IH6A 1H1WA 3BX5A 3GFWA 3OP5A 1W7HA 5AUZA 2QONA 3SLSA 3VS0A 1LEWA 3DAJA 3MY0A 4F7JA 3MFRA 2V0DA 3TTJA 1H28A 4CKRA 4WO5A 5M07A 4R3RA 1RQQA 1YDSE 3F7WA 3KULB 4I93A 4CVAA 4FSYA 2VTAA 3ALOA 4L42A 4QPAA 4PPAA 3TNPC 4HYSA 1ZYCA 4N6YA 4RMZA 4AS0A 2OLCA 3W0MA 3KIOC 2ITNA 2NRYA 4YZCA 2Z7QA 4RA5A 1H08A 4FEWA 4OTPA 3C4WA 2OICA 5DR2A 3AC2A 3KRJA 1P4FA 1KOAA 3DKCA 3LQ8A 4O0VA 2P2IA 1YQJA 5FEQA 4XV3A 3EQBA 1YI4A 3MH3A 4FV3A 2VRXA 5IQIA 2QOQA 4RIYB 4RVMA 1UKIA 4ITHA 3DPKA 2GPHA 3C4ZA 4FTTA 5HCXA 4F65A 3TUCA 4FTOA 2XNPA 2Z8CA 4ZK5A 3EWHA 1A06A 3K3IA 2B7AA 4FKIA 1WZYA 2W0JA 2KTYA 3GCSA 2FGIA 3KCKA 2GQSA 3PXYA 5E8WA 3F2AA 3LAUA 2WMUA 2GS2A 3A7JA 2VO3A 3BBTB 4X3FC 3GVUA 4QMVA 3F82A 4AW5A 3H10A 4QP1A 4ALUA 1OIQA 2WQBA 4DFUA 4FTKA 1WFCA 2F49A 2HOGA 3NCZA 4GK4A 3QX4A 3Q4ZA 5FBOA 5C01A 4ASZA 2O0UA 3DBCA 3KF7A 2GTMA 1OKZA 2PMNX 3OXZA 4J1RA 4M68A 3ZEWA 5I5ZA 4AA0A 3LFFA 2YCQA 4BIBA 3JPVA 2R3HA 4CQEA 4O2ZA 4W4WA 3U9NA 4E6CA 5DLSA 4BCPA 2RF9A 2YCRA 3UIUA 4QMLA 3N4TA 1IA9A 4D2WA 4KUJA 3W0PA 2YLFA 4I24A 3HUBA 3PJ8A 3S00A 3FJQE 3ODZX 3DXQA 5E8ZA 4OTHA 3UYSA 3WIGA 2VWWA 3R8ZA 1QCFA 5A4QA 4X2JA 4O91A 4EH2A 3T3VA 2QOFA 3F3WA 4MVFA 5FTQA 2WB8A 5CF4A 4TY1A 3QYZA 5I9VA 1GZNA 2WAJA 3QZIA 3PG3A 4MXAA 4AZWA 4M97A 4GIIA 1YOLA 2XANA 4U40A 2UVYA 2WTDA 1GOLA 3F6XA 5AR5A 5BYZA 2R3OA 5G6VA 4EORA 5AADA 2XALA 5M08A 4Y5HA 2A27A 2XK3A 4X2KA 1OKVA 3D15A 4EQMA 4KBKA 1GAGA 4MYGA 2QC6A 5AR4A 5HVJA 4TWOA 2OIDA 2BTSA 2OJIA 1M7QA 4AG8A 2C47A 3FXWA 2H8HA 3FUPA 3KGAA 3PA3A 4PWNA 2J4ZA 4XP2A 5JGDA 5HX6A 3EN9A 3VBTA 3MTLA 4M3QA 4FZ6A 4CKIA 5LJJA 3FLZA 2C0TA 5FXQA 3O7LD 4OUCA 4AA5A 4F63A 1W98A 2QOKA 4IB1A 4BDHA 3MH1A 3TNQB 3NNVA 4GVAA 2AQXA 5HX8A 3D5VA 5IQBA 4YO4A 5A46A 4DDGA 1ZWSA 2W1IA 5CF8A 1JSTA 4KA3A 5CSHA 3T3UA 5JFSA 3GC9A 4FK3A 4M69A 4MWHA 1ZARA 2JKOA 2R3JA 3QZGA 4J98A 4O0UA 4QPSA 2R3RA 4CFFA 4EBWA 3GOKA 3RAKA 1ZYSA 2JD5A 4ENYA 4G2FA 4BDBA 4QTEA 4MXYA 5JRQA 2UZNA 3CPCA 3V5TA 5C4LA 2BDWA 4IAZA 5KMKA 1OM1A 2X0GA 4JAIA 3A8XA 4KRDA 3D5XA 5T68A 4ASEA 3AKJA 3W8QA 2W5HA 3OY1A 3KFAA 4NJDA 5FD2A 3VC4A 4DG3E 1PMVA 4FV5A 4ZXTA 2LAVA 4AW0A 4EJNA 4EYJA 2C3KA 5IQDA 3RVGA 3TMOA 4YSMA 4FA2A 4JIAA 4ID7A 3NFFB 4DN5A 4B4LA 2OJFE 1JOWB 4FSZA 5L4QA 1WBOA 3B8QA 5IQCA 4M8TA 5DIAA 1ZOHA 5EQPA 1CM8A 3A2CA 3KMWA 2VO6A 3MH0A 3QA8A 4MBJA 4LL5A 2VTTA 3VS1A 4QQ5A 4FSMA 4RVKA 1JKLA 4MXOA 3FLYA 4AFEA 1H1RA 4BZDA 2PZYA 2VN9A 5J7HA 3LHJA 5AUUA 5KMMA 5BX0A 4V01A 1V0BA 2ERKA 2ZB0A 4BCNA 3L9LA 3VBYA 3L9NA 5T6KA 2PZIA 3REPA 4CEGA 5TKDA 4BJJA 1Q41A 2V5QA 5AX3A 1H8FA 4I23A 4U45A 2R3QA 3DKGA 3I1AA 4U81A 3PIYA 1IASA 1K2PA 3WF7A 3DK6A 4E6DA 2EB3A 2VO7A 3ZU7A 5IA1A 3VBQA 3ZTXA 4ANLA 3WZEA 3GU4A 3R7UA 2BZKB 3HECA 4G9RA 4EC9A 2IVUA 3IW6A 5C8MA 4FUXA 3UNZA 4ACCA 2PY3A 4TPTA 3HAMA 5LMAA 5DT0A 3LFSA 3VUHA 3D2IA 2IVSA 4C37A 4NIFA 2FB8A 2PVRA 3ERKA 5AUXA 1XHAA 2X0PA 4TZRA 5AP7A 3S4QA 4ANSA 4A9TA 4C34A 3D94A 1M2QA 4HPUE 3O2MA 4RA4A 2PPQA 3PPJA 3KRLA 5BYLA 3QTQA 3GQIA 1Q62A 2ZYBA 4E20A 2A2AA 3FSFA 1TFFA 4W8EA 3VUGA 4JMQA 2CN8A 4AOJA 4GSBA 1GZKA 4EQUA 4WIHA 4NM0A 4YZBA 3PE2A 4MD8E 4EOPA 2VAGA 3ZO2A 3Q04A 2EUFB 2YM4A 3OOGA 4LV8A 3EFLA 1RDQE 3IGGA 3VJNA 4M15A 2C5NA 3RK7A 4E5AX 4F9YA 4JI9A 5GIOE 3G5DA 1AD5A 4DT8A 2W1EA 4OGRA 4I20A 4O4FA 1W84A 2PULA 5ANIA 3MVLA 3V6SA 3N9XA 2NPQA 3VBWA 5F1ZA 3HA6A 2CHLA 4GK2A 4EWQA 3P79A 4FTNA 4FV6A 4TWPA 3RGFA 2VWYA 5KMNA 4OT6A 4BJJB 4M66A 1KOBA 1KV1A 2G2FA 1O6YA 4RGJA 3E93A 3SHEA 3ZM9A 4EH8A 2G2HA 3BCEA 2VNYA 3QD0A 2B9JA 4OR5A 3PRFA 4JL9A 4XNEA 3UC4A 3VRZA 4D2PA 2ZJWA 4GJ3A 3S0OA 2CGWA 4BDCA 3RI1A 4FV1A 3UTOA 4WHZA 3G51A 3THBA 1OUYA 2QO9A 5AUVA 5IQHA 4EOMA 3OEFX 1B38A 1PY5A 4DFYA 2R3NA 4NIFB 2C69A 1YXXA 5HICA 3IDPA 4LV7A 5CQWA 1ND4A 2GNJA 4XP0A 1DI8A 3E8CA 3VRYA 3BWJA 2B54A 3TIYA 4JR3A 4X2GA 4FTJA 5HE1A 4G6OA 4CXAA 4D2SA 1YVJA 1J3HA 4QQTA 3AMYA 4BHZA 5HTCA 3DKFA 5DR9A 3DJ6A 3A61A 3OUNB 3MTFA 4FT3A 3RP9A 4L7FA 2R3GA 4QO9A 4R7HA 4WA9A 5DFPA 4ZSEA 3HYHA 3QU0A 2WTKB 2PE1A 3K54A 4HZRA 5DT4A 2XVDA 1X8BA 3WF8A 4RLLA 2I0EA 5BVWA 2BRGA 3HV4A 4AZEA 4DHJA 1OECA 2YM7A 4EC8A 4ZTQA 2X9FA 3R73A 4LMUA 4IH8A 4BIDA 4G6NA 3VBXA 3KXGA 1G3NA 4RJ8A 4UYNA 4RJ4A 4A4OA 3DFCB 1NY3A 4EK6A 1PXOA 5FRIA 2QKWB 4O38A 2P3GX 4CTCA 3QTIA 2RKUA 3BGZA 3QCYA 4IDVA 4X6RA 3SQQA 3ZYAA 3DU8A 3CGFA 5FM2A 2GHLA 4RIWA