1U5QA

Crystal structure of the tao2 kinase domain: activation and specifity of a ste20p map3k
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
309
structure length
308
Chain Sequence
b'DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine/threonine protein kinase TAO2
publication title Crystal Structure of the TAO2 Kinase Domain; Activation and Specificity of a Ste20p MAP3K.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 100
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u5qA01
3VQHA 4ZTMA 3NS9A 1O6LA 1LEWA 2HYYA 2OJGA 1M14A 3C50A 5CEIA 4EOJA 2R0IA 4G5PA 5AP4A 1E1XA 1R3CA 4O7ZA 4FTRA 2WAJA 4W8EA 4R5YA 4FVPA 3Q4TA 4IH8A 5CS6A 5I9VA 3TJDA 3DBCA 2RF9A 3BYSA 2J4ZA 5I9ZA 4MHAA 3QKKA 5EYCA 3KGAA 4J99A 3JVSA 4K18A 1JLUE 4EZ5A 4ZJJA 4FEXA 3G0EA 2O5KA 3N4VA 3PVGA 4TPTA 3QKLA 1PXKA 2ETMA 3FL4A 4GS6A 4AU8A 1NVRA 1XBCA 4XUFA 1YDTE 3GNIB 3WF6A 1BYGA 2XM8A 3PXYA 4S31A 4EUTA 4RSSA 2PUIA 3DDQA 3LFQA 2OFUA 1CKJA 3SKCA 3O7LB 4LV8A 3QLGA 3Q9ZA 4IZYA 3FWQA 4BBFA 4EORA 1KE8A 3NPCA 4TW9A 1M7QA 3EFLA 4BB4A 3VAPA 2W99B 5E1EA 4AN9A 2EXMA 2XRWA 4HVDA 2W17A 3HZTA 5KZ0A 3EQPA 1OUKA 3LQ5A 3EN5A 3E7OA 3LXLA 3AT4A 1ZZLA 3A7HA 4O0RA 3DOGA 1JSVA 4U3ZA 2WU6A 3R6XA 2R0UA 3FYJX 4Y85A 3PE1A 3KEXA 2QC6A 5LMKC 4FG7A 4DEBA 2WQBA 5AWMA 3TV4A 4CD0A 3FJQE 3K3IA 1X8BA 4BDFA 3GB2A 3QRTA 4AX8A 3DFAA 1LR4A 1W83A 4R3PA 1YRPA 1GY3A 3BHTA 3HECA 2BTRA 3KA0A 4H1MA 4QNAA 3KXMA 5FBNC 4CMUA 4O0XA 3ORXA 3O96A 4I21A 4GU9A 4ZLOA 3L9MA 4YBKA 3DTWA 4XG4A 4GH2A 4QTEA 3OCBA 4E4MA 2CCIA 2C6LA 3KULA 4FV2A 3PLSA 2CNUA 5H9BA 1SNXA 1P5EA 3SC1A 4CFFA 5FDPA 4MBLA 4X3FB 4XV2A 3PSBA 4YJQA 3D2IA 4UMRA 3I1AA 3MA6A 4FTOA 3PJCA 4TL0A 4CFNA 3VRZA 5DR9A 2P0CA 5DG5A 4D4YA 4HW7A 2QOHA 2CNVA 3BRBA 4TKSA 5J9LA 1NXKA 3E3PA 2UW5A 5HD4A 3IOKA 3F2NA 3TL8A 1OKVA 1PXJA 2W7XA 4K77A 3ZLYA 4K0YA 4LYNA 1H0WA 5D11A 4CT2A 4CKJA 3FHRA 4NM3A 4PMSA 5ANEA 5B2KA 3FUPA 4JBPA 4LRJA 4YC8A 4PDPA 3R1QA 4ZJIA 2WHBA 4G17A 5CSWA 2I7QA 4RC2A 2C5OA 2VX0A 1CMKE 4CZYB 2EXEA 3IS5A 2XIZA 3O8TA 2BAKA 2R3NA 5FEQA 3O23A 3GVUA 4Y72A 2QOOA 1H01A 4G16A 4IAFA 5T68A 4DT9A 1OKYA 3DBFA 2XNEA 3F3ZA 4EH6A 2GNJA 3AT2A 4FSZA 3MJ1A 5C8KA 3UZRA 3E64A 2WB8A 3CBLA 3VS0A 4I94A 2NNWB 1BI7A 4RQKA 4B99A 5ANKA 4BIBA 5KNJA 4O0WA 5BVEA 3LXNA 4NEUA 2UZEA 4IC7A 2XIXA 3K2LA 1UKIA 3WIGA 5KMIA 3Q60A 5BVDA 3BYVA 3ZZWA 4C34A 2J0LA 5HORA 3FZOA 4Q9SA 3WZKA 2XNNA 3UNZA 4O7TA 4WG4A 2UW3A 4L42A 1PHKA 3DAEA 4UALA 2GQRA 4D4RA 3S0OA 4QRCA 1OKZA 4AW2A 4CSVA 1PJKA 1GIHA 1KUTA 4JAIA 2VTLA 2PZPA 5AM7A 3BIZA 4FSNA 2HY0A 4TYEA 3G33A 4BF2A 4YJVA 5HIEA 3SXRA 2XEYA 3LFDA 4FV8A 1MRVA 4QQCA 4NTTA 3WARA 4EQMA 3KY2A 2VWZA 2CKQA 4P7EA 3MH1A 3UG1A 4PTCA 5IQCA 4HNFA 2XNOA 5BMSA 3BZ3A 4WA9A 3V5PA 1XQZA 1U4DA 4YUQA 5KMMA 4HPUE 3TDVA 2CDZA 3ZO4A 2Z7LA 4EL9A 1P4FA 2J2IB 3FMEA 3LIJA 4GK2A 3B2WA 2KULA 1OIUA 3KK8A 2PYWA 4FOCA 5E8WA 3ET7A 5F1ZA 4DFXE 4DH7A 3SGCA 5ETFA 1KE9A 1UU3A 2CMWA 3DB6A 3DY7A 2CGVA 4EHGA 3EFWA 4BR3A 2CKOA 4FVRA 4QMVA 3RZFA 3KXGA 2XIYA 4L67A 1KV2A 4M8TA 1XH7A 3GCSA 3I79A 3MY5A 4EQCA 4FNZA 1Q24A 3DFCB 4CVAA 3W32A 2XKEA 3QWKA 3SG9A 2O64A 4FSMA 4TYJA 2CN8A 2Q0NA 4BN1A 5HVKA 1ZOHA 4D4VA 5J9ZA 1OUYA 5M51A 2WPAA 3KRJA 4QOXA 5DGZA 4UMUA 2PVNA 2PY3A 5AEPA 3TTJA 2W1DA 2E2BA 3VBWA 3SAYA 3ZTXA 2IW9A 5L2IA 3SXSA 2BR1A 5IA5A 4C3FA 4CFWA 5I9WA 4YPDA 2XBJA 5HOAA 4CLIA 4MCVA 1JKSA 3MPTA 4X2JA 3BU6A 5J5TA 2YM5A 4H58A 5C4KA 3E87A 5HLWA 5G6VA 3NW7A 2ETKA 4D2PA 2CGXA 3AC1A 4FT3A 5AP5A 4NKAA 4DE4A 3NNXA 3H9RA 3DNEA 5TF9A 4D1XA 5AV3A 4BWPA 4YHTA 3CE3A 4O6EA 3PIXA 4JT3A 5BVKA 3I0OA 4R78A 3V04A 3SOAA 3ZC6A 4IADA 3HV6A 4RIWA 5DRBA 1V0PA 3JY9A 4PL5A 3W2OA 4HGTA 4TYIA 4DG2E 5KX8A 4FKQA 4QPSA 4LUEA 3VBYA 3ZLWA 4PMTA 2BZJA 4NCTC 3GC0A 3KN6A 4JIAA 4GJ3A 4EK5A 3F82A 5CF4A 5CASA 4FSRA 4FSTA 3W2SA 3D14A 4ANMA 2YIWA 2P33A 2WQNA 2AC3A 3K5UA 4O2ZA 4CGAA 3O0GA 3EQCA 5CVFA 4YSJA 5AX9A 4UX9A 4A9YA 4BCJA 2QQ7A 1JKTA 4MXZA 4YLKA 4ASXA 3HA8A 2C0OA 2E9PA 4E6DA 2OH4A 2OJ9A 3UMXA 3ZO2A 4KRCA 3JYAA 4N70A 3REPA 4DH8A 3LMIA 4DFUA 2XJ1A 2ONLA 3HLLA 3R9OA 1IR3A 4BL1A 2WMTA 3IK3A 4KNBA 4P90A 4JQEA 4X6RA 3ZMMA 4ANOA 1ZARA 3MYGA 5HVJA 4WNMA 3V6SA 5IUGA 5E4HA 5KMJA 3S1HA 5KMLA 3NMUF 1JOWB 4C4JA 1OPLA 4OTQA 4ANNA 4IAKA 3OBGA 2CSNA 1XR1A 4D1ZA 4Q5HA 1P2AA 3F66A 3LFSA 2GQGA 4FGBA 5FGKA 3CPBA 3MPMA 4I0RA 2Z7RA 4NFNA 1FQ1B 3MI9A 3R7YA 5IDNA 1Y91A 4D2SA 3E8EA 2IJMA 3EOCA 4LM5A 3GCUA 4C2VA 2Z7SA 3AGMA 2QO7A 2WO6A 5EW8A 3D9VA 3O2MA 2NRYA 2GHLA 3F2AA 2VTTA 3F3VA 1U54A 3SLSA 3NDMA 3QYZA 4EOPA 3Q53A 4HGLA 3R8VA 3WYYA 1PKGA 4RJ4A 4I4FA 4O84A 2RFEA 4JX3A 4E73A 3S4QA 5EI6A 4BRXA 2RSVA 4DF3A 1J3HA 4I22A 2XK8A 5TR6A 3RGFA 4FTMA 4QMNA 3P5KA 3DCVA 3VS7A 4IIRA 2XK6A 3RAWA 3JUHA 1BKXA 4EC9A 4W4YA 4RX7A 4GK4A 3ROYA 2WQOA 3PRIA 3LCDA 4FNYA 5A46A 3PP0A 3D5VA 3MV5A 2O63A 4FTLA 4R7IA 5DEYA 4JXFA 4E5AX 3S00A 2HK5A 3AMBA 3EN6A 3P23A 4KSPA 2HXLA 2GDOA 5A54A 4DCAA 4FK6A 3TN8A 5HTBA 4PMMA 3LOKA 3UTOA 5CQWA 4O7YA 2C3IB 2PMIA 4OLIA 5DT4A 3KRLA 4EUUA 5CF6A 3NUXA 3V5JA 2XKDA 2QOLA 1H1WA 3MVJA 5ANOA 3G9LX 4TNBA 3HV3A 2HWOA 3Q04A 4JG6A 2F7EE 4J8MA 4YLJA 3BWFA 5CI7A 1Y57A 5FQDC 2VTHA 3VQUA 4IQ6A 3DLZA 4AG8A 2JDRA 3MS9A 3FPQA 5H8GA 4GVJA 2YJSA 3KU2A 3FSFA 3DXPA 3IW5A 4L45A 3FHIA 3QUDA 4QQJA 4ANBA 3AXWA 4EK6A 5JGAA 4W4VA 4U44A 1NW1A 2OXXA 3ORTA 3OTVA 3HAMA 3LCOA 4U81A 3T9IA 4U7ZA 5GIOE 4I3ZA 4ZTSA 4O38A 1LP4A 4LMUA 5AA8A 3PDTA 5ICPA 4K2RA 2YDIA 5BVWA 3LW0A 3R63A 2RKUA 4BDIA 3BQRA 5EQEA 4S33A 3HL7A 4D9UA 2VWVA 2GNHA 4V01A 5AP1A 2BZKB 4LL0A 4PNKA 3NNUA 4QMMA 3A8WA 3MTFA 4C4EA 1YWVA 2XCKA 3F3UA 4HYHA 5FTOA 4RIXA 4YTCA 4R77A 5LJJA 3F5GA 4BFMA 3P78A 5B2MA 2XIKA 3HMOA 2WMRA 4QYYA 2V5QA 3NSZA 2W5HA 3HMPA 4MF1A 4PQNA 4FC0A 3R7OA 4YSMA 1H1RA 1VZOA 2GSFA 3V5LA 5H8EA 4RFZA 3ZRKA 4GMYA 2A27A 4ZSEA 3CGFA 3QA8A 3PPKA 4G31A 3WZDA 2YERA 3CSVA 2YIXA 5A14A 2YEXA 3FI8A 4CZTA 3TZMA 1WVYA 3QXOA 4FTTA 4QMYA 3FI3A 5H8BA 4S30A 4AP7A 3P79A 5HU9A 2QURA 2I0YA 3ZC5A 3U55A 1ZMWA 2WTKB 5CAPA 3K54A 3MY0A 4HGEA 4JL9A 2UZTA 4FTCA 5JN2A 3H30A 4FKLA 1OIQA 3V5QA 4DGGA 3V6RA 3C7QA 3NAYA 2W1GA 4PL4A 3QD3A 2B7AA 4YJTA 4C0TA 3HYHA 4ZY4A 4JBQA 2BKKA 4P4CA 1PY5A 2X2KA 2BRMA 1MQBA 3FLQA 3FEGA 5JT2A 2BHHA 1ATPE 4DLJA 4QMXA 4UWYA 3BEGA 5DIAA 4HCVA 3MSSA 4IJPA 3VS5A 3A7FA 4FIGA 1YDSE 3ORKA 5FDXA 3RAKA 5CNNA 2YIQA 2IW6A 4RQVA 3AD5A 1JQHA 2Y7JA 3V8TA 3FXXA 3S2PA 4WO5A 4ENXA 4B8LA 2C3JA 2HELA 3NCZA 3KREA 4E20A 4RA4A 4K1BA 3UQFA 2PVYA 5AUXA 1MRUA 4F9BA 4N6YA 2JIUA 3RCJA 2OH0E 4GYIA 2OZOA 3QL8A 3QBNA 1J7IA 1TQIA 4AOIA 4IXPA 1S9JA 3DV3A 5FEDA 5CT0A 5EM7A 2O8YA 3DQWA 3ZLSA 5FEEA 2UZLA 5LVNA 3CQEA 1IG1A 4EC8A 1VEBA 1ZYLA 2F57A 1IAJA 1DS5A 2VTNA 3VBTA 4AT3A 1V1KA 2XMYA 4JS8A 5DI1A 3KB7A 3TEIA 4E1ZA 2F7XE 1YI4A 3H0ZA 4U42A 5E7RA 2WEIA 2VX3A 1OBDA 3A4OX 2X7GA 2BAJA 2QVSE 2XYNA 4C8BA 3R21A 2C5VA 4F99A 2LGCA 2OIBA 4EOOA 2ZMCA 4F7NA 3WYXA 4D9TA 2FB8A 4JNWA 4YO6A 1OM1A 3PRFA 2WTWA 2PMOX 4M15A 4HVIA 5DYJA 4EHZA 4DFBA 3UNJA 4NIFB 1MRYA 3HNGA 3U6IA 2E9NA 4U9AA 2B9JA 4CG9A 4O81A 3UO6A 1URWA 4ZEGA 5DLSA 3FC1X 3ZUUA 3TG1A 1XBBA 3D0EA 4GKHA 5HBHA 4MXXA 2JEDA 5EQYA 1PF8A 3QX4A 3AOXA 5JRSA 3U4WA 3MB6A 5HHWA 2IO6A 1YHWA 3H4JA 2VGOA 2J9MA 3HV4A 3R00A 2IW8A 2PHKA 4L7SA 2W1FA 2AUHA 4PL3A 3RWQA 3SHEA 2GPHA 4AW5A 3FC2A 4DFYA 2GHMA 3A61A 4BWKA 2UW6A 3FL5A 4NWMA 5D10A 3F2RA 3VHKA 4CV9A 2GFCA 4MQ1A 5JGDA 3WI6A 2UZVA 4X3FA 3P7AA 2OXYA 1SVEA 3TKUA 4DINA 3LKMA 4O0YA 3OXTA 4FX3A 3BEAA 5EI8A 1YXUA 2QLQA 5E8UA 5IQHA 4DH5A 2C3LA 4W8DA 4ERWA 4AFEA 3KMWA 4XEYA 4EEVA 1Q62A 2X7OA 3KQ7A 4YU2A 3RI1A 1W82A 3Q4UA 3QLFA 3EKKA 4QQ5A 3TZ9A 3ZXTA 4D5KA 3BYUA 4Q5EA 2B1PA 4XP0A 3NGAA 5HVYA 3V5WA 4AF3A 5AFVA 3OHTA 3IO7A 5FM3A 5M09A 3KXNA 2X1NA 3I60A 5L2WA 1YXSA 2JLDA 4IB3A 3KKVA 4J95A 2W1HA 5HCXA 2BIKB 3NNWA 2EB2A 3QUEA 5CU0A 3R02A 3COHA 3TNQB 4D58A 2X39A 2OW3A 5IUHA 4JG8A 2O3PA 4GK3A 4TZRA 3WIKA 5AADA 5IQAA 5EKNA 5JFVA 2GU8A 4IDTA 2QOIA 4F70A 5BUJA 1PXNA 3F5XA 4I20A 4KIQA 4YTHA 3U9CA 5CSPA 5TE0A 5DEWA 3BYMA 5CXZA 5JEBA 2VU3A 3O17A 3LFFA 2QOKA 4NU1A 3RK5A 1OL1A 2VO7A 1PMVA 2F7ZE 2HCKA 3KMUA 3NIZA 4QP4A 5CTPA 4TYHB 4C35A 4UZHA 3ZCLA 4B4LA 5CAOA 4RVTA 2XRUA 2IN6A 2VAGA 4LOPA 1J7LA 3RJCA 1K2PA 2YFXA 2WTDA 4ZY5A 2WZJA 3BU5A 2VGPA 2JDVA 1H1PA 5HX8A 3LAUA 2P2IA 3MH0A 5HE0A 1WBOA 4HJOA 1R1WA 4IACA 5AAEA 4BCKA 4YZNA 5LMKA 1DAYA 4MAOA 1CSNA 5K0KA 1GZOA 5HNBA 3FKOA 2WEVA 3LCKA 5E90A 4HPTE 4FTKA 4BDBA 3UNKA 4TXCA 3NRMA 2UVYA 4I5CA 1SM2A 4KD1A 1RQQA 5K5XA 5L2SA 4I92A 4YGAA 1OL2A 1UVRA 3MFUA 5EYKA 3V8SA 2B9IA 4ZZMA 3FMMA 3NNVA 5FP5A 4BDGA 4UBAA 5E92A 4JDIA 4E4XA 4IB5A 3T9TA 4IB1A 2JKQA 3GU4A 5AUVA 5HE1A 2Y4IB 5JKGA 3GGFA 4IJ9A 3O51A 3PG1A 4YNOA 3AD6A 3QA0A 1YXXA 4J8NA 4EH4A 1QPDA 3PA4A 4FYNA 4CTCA 3PIZA 4DFNA 1YOJA 3ENMA 2VTSA 3CY2A 2PULA 4F09A 2IWIA 3IDBA 3R8MA 3W33A 1Y8YA 5HZNA 5EYDA 2OF2A 4FG9A 4W9XA 5JK3A 4BCFA 4NH1A 3VO3A 1ZAOA 3RPYA 3E7VA 3K3JA 1Y8GA 5FUTA 3TNIA 4PPAA 2Q0BA 2OSCA 3NVKI 3UGCA 3U6JA 5LCJA 4IHPA 4L44A 4L3JA 4BYJA 4XV9A 5IEVA 5KMOA 4AZFA 1OIYA 4RC3A 2W1IA 2QI8A 1F3MC 3F7WA 1Q8TA 2BILB 4FZ6A 4B8MA 5C01A 3UVQA 2FO0A 3HUCA 4R3CA 2ITQA 4C38A 1NA7A 1FPUA 2C6OA 2OI4X 4OTIA 4U8ZA 5EM8A 5GHVA 4CV8A 4E4NA 4F4PA 3RHKA 1PW2A 3R7UA 4PRJA 1MUOA 3TKIA 3UIUA 4FKOA 1GZ8A 3UDBA 2B52A 1XKKA 1WBTA 2ITUA 1G5SA 3ZXZA 4C3PA 2BUJA 2PUUA 5J95A 5LOHA 2PPQA 3VWAA 3CQUA 1DI9A 3NZ0A 2XKCA 3MFSA 4QTCA 4Y73A 5CU2A 1XH9A 4IX6A 3ULIA 2ZM3A 1P4OA 3UYTA 4BKZA 4XNEA 3BWJA 1LPUA 3BQCA 2GS6A 3EKNA 3BU3A 4BI2A 5GINE 2J0IA 2JC6A 3OTUA 3UIBA 2FH9A 2BHEA 3P4KA 4RPVA 4RVLA 5JRQA 1REKA 2UZNA 5JZNA 3S3IA 4QMQA 4GT5A 4DGOA 2R3MA 2B9FA 2PMNX 4E8AA 4RX5A 4BIEA 4EQUA 4MKCA 2YAKA 3IPHA 2CLXA 5HG5A 2O2UA 5FD2A 4AOTA 3FZRA 3UJGA 3WF7A 3QQLA 5CT7A 4Y5QA 2QD9A 3A7GA 1GIJA 2PK9A 5CU6A 2QCSA 4KAOA 5BVNA 2WIPA 4LL5A 3E3BX 4UMTA 3ZYAA 4MD8E 3MH3A 3LXKA 1BL7A 4EH8A 5LWMA 3QZGA 3DS6A 4BYIA 2XYUA 5M53A 1FBNA 3DGKA 2F4JA 4GRBA 4XG6A 1YQJA 4AN2A 1VJYA 4DG0E 5D1JA 3U6HA 3F5PA 3PY1A 3QQUA 3VW8A 3OOMA 3Q52A 4UYNA 5DMZA 5HIBA 1E1VA 3AGLA 3LVPA 3FLWA 4GW8A 4XG7A 2QODA 5A6NA 3OZ6A 4CEGA 3OWLA 1G8AA 5GIPE 4KIPA 4KBAA 2P2HA 3PWYA 4JDKA 5D12A 4RC4A 3ZBFA 1H00A 3H3CA 4KBKA 4MEDA 1XJDA 4XRLA 2C6KA 4IBMA 4NW5A 5BYZA 4F1MA 3ANRA 2C1BA 5C9CA 4N57A 5HNGA 3FQEA 1Z9XA 2OIQA 3ALOA 1WFCA 3OCGA 4LG4A 1JKKA 4HYUA 4IB0A 4QYGA 3BBWA 4L46A 4MBIA 4EYJA 3DBDA 3MFTA 5CAUA 4QYEA 1STCE 4C59A 3F61A 4M67A 3F7ZA 4A9SA 4H3PA 4H3QA 1UWJA 3MW1A 3PA3A 5GJGA 1JWHA 4BCOA 4CFUA 1FVVA 2VX1A 4TN6A 3R0TA 4XBRA 3D7ZA 4M0YA 1UU9A 4ZIMA 3QQHA 2UVXA 4I1ZA 3G90X 3KXXA 3VS6A 3FQSA 4JQ7A 2F2UA 4ZTNA 4M14A 3KK9A 4RWJA 5F95A 2J0JA 4XG8A 2R3GA 1IA9A 2W96B 4RIYA 4JLCA 5EHLA 3RPVA 3UIXA 3ZSGA 4BGHA 5JQ5A 1ZZ2A 3CXWA 1PXOA 3VBVA 4AZEA 1HCKA 4WRGA 1ZMUA 3EL8A 3Q4CA 4FKUA 5T3QA 5JGBA 2HWPA 2QONA 3QQFA 2ZJWA 2PVHA 4DEAA 1Q41A 4P5QA 4I6BA 5D9HA 2IZTA 4YJRA 4ALVA 5AAFA 2GS7A 4WNPA 4NSTA 2Y6OA 4CYJA 4EZ7A 2Z02A 1XH6A 3G51A 1WVXA 5M4CA 3QC9A 3LJ2A 1CTPE 3ZRMA 3H0YA 4D0XA 4F6WA 2W1ZA 3L8PA 3MDYA 2C68A 5B7VA 1CKIA 5HICA 5HQ0A 3LFCA 2R3OA 5KMNA 4O7RA 3IW6A 4XX9A 3EFJA 4RMZA 4XP3A 5DA3A 5E91A 4W4XA 2SRCA 3QTQA 4BGQA 3DNDA 4QMZA 1U5QA 2GCDA 1ZY4A 2ZM4A 3H9OA 3KL8A 3QWJA 4FV5A 5AJQA 3V3VA 4RZWA 2RL5A 5LMAA 4I5MA 4D55A 5BUEA 2ZVAA 3OXIA 2BFYA 4Z7HA 4IE9A 4ZSJA 5IKWA 1J7UA 2V0DA 3FZTA 3CY3A 2X4ZA 3C0HA 4JQ8A 2HOGA 5CNOA 1M2RA 3ACJA 1M52A 3S95A 3KC3A 1WBPA 2W4OA 2OZAB 3GC7A 1OZ1A 1K3AA 4ITJA 4MWHA 4XLVA 3GFEA 4YLLA 4ASDA 5M08A 1M2PA 2Z60A 1B39A 3QQKA 4MH7A 4NK9A 4L3PA 5EW3A 4CKRA 2BROA 2PE0A 4AA5A 1YW2A 3L9NA 4UN0C 4IWDA 1IEPA 1NY3A 3PVWA 3TACA 4M84A 4IX4A 1Q8WA 2HZNA 4APCA 3FLYA 1LUFA 3NUNA 4LGHA 1XBAA 1GNGA 3MJ2A 3ANQA 4XHKB 4XP2A 3TWJA 5CEOA 3LCTA 3O8UA 1URCA 2VTOA 4FBXA 4U40A 3OWPA 3FAAA 4EOIA 1GIIA 4QD6A 4O2PA 2JDTA 5J79A 4EH3A 5EOLA 5M57A 3DK3A 3LE6A 3QTXA 5A4CA 4CYIA 4DFLA 5HCZA 3EQRA 4DGLC 5IH4A 1JAMA 4FV6A 4RZVA 2J0KA 3OWJA 1Q8YA 3QCQA 3QD0A 2IPXA 2X6EA 2B9HA 2HENA 2A19B 2QOCA 2UW8A 3EJ1A 3QTZA 3AC8A 4IM3A 4PPBA 3W2CA 2X7FA 3KCKA 4DLIA 1PRYA 2JDSA 3E63A 4M3QA 2BAQA 2X0GA 4TWCA 4ZXTA 4BDJA 4RFMA 5CU4A 3ZH8A 3PXFA 4R1YA 3UVRA 3KN5A 2UW4A 2UW0A 2QO2A 3A99A 3TUBA 5CVGA 2XBAA 4A4XA 3TDWA 2R3QA 3BE9A 1H4LA 1YXTA 2YDJA 4L00A 4AACA 2XNGA 2ZB0A 4CQGA 4U3YA 4FK3A 4Q2AA 5CSHA 2CGWA 2F9GA 3SXFA 1YOMA 5A3XA 4B9DA 2WTVA 4G6OA 3CS9A 3CJFA 4FKIA 4BCQA 4JI9A 4C61A 4L43A 4G3DA 1TVOA 4Y5HA 4I23A 3NEWA 3RTPA 1I44A 5JFWA 5ETAA 4OAVB 5CX9A 4GU6A 4KRDA 4M69B 2NP8A 2JBOA 4ZTHA 2WTCA 2CLQA 4C33A 5DBXA 5EFQA 5CXHA 4NJDA 4O7LA 2J51A 1H28A 3LLAA 1A48A 4FKTA 4XV1A 3SW7A 2JAMA 3WF8A 1M17A 1FMKA 3TT0A 5AIRA 3ZDUA 1YHVA 3UODA 4OTGA 3PPZA 3LFEA 4RJ8A 5KHWA 3QZIA 4EHEA 4JBVA 4E93A 3OXZA 3P1AA 4FUYA 3E8NA 4NIFA 2YA9A 3DKGA 4UMQA 3I5ZA 1QPCA 3C4XA 5FXQA 3R9HA 3VC4A 4BI1A 2XK4A 5A4TA 2IZUA 4ACGA 1UNHA 4CRLA 4O96A 1Q97A 2QO9A 4QP1A 5KBRA 4DEDA 3BELA 4F65A 4Z55A 4BIDA 1ND4A 4FKVA 3TV6A 4TTHB 3KFAA 4FKJA 4YJSA 4BZDA 3BLRA 2ZOQA 1A9UA 5AUTA 4A4LA 2HZ4A 5E8SA 3RM6A 4G9CA 3UOHA 5CEPA 5ANDA 2NRUA 3VS3A 5AV2A 5DVRA 1P14A 4PNIA 4RA5A 2ITVA 4YC3A 5EI2A 5KCVA 4D5HA 2JDOA 1WVWA 4L68A 4FL2A 4PPCA 2X8EA 3DKOA 4M12A 2VO6A 3BHUA 4JDJA 4P2KA 4V05A 3UQGA 1K9AA 5HNIX 3OVVA 2YM6A 5TKDA 1OL7A 2OF4A 4FKRA 5BYLA 3UQCA 3FZSA 3BHVA 3NUAA 1WBVA 2C0TA 2W0JA 3IW8A 4AWIA 3AMYA 3BYOA 5IMEA 1OGUA 1UU7A 3AC4A 5L2QA 3I81A 1FVRA 5CWZA 1IASA 4F7JA 2Y9QA 1H1SA 3FYKX 3LXPA 3C9WA 2QOFA 2XEZA 4WT6A 4OR5A 4LOQA 3ACKA 3DXNA 5I3OA 4QPAA 3PJ2A 5DRDA 5EHOA 4E6QA 3E92A 2RFSA 2UZWE 2WTIA 2PZIA 3C0IA 3EQBA 2CKEA 3PIYA 1YI6A 1FMOE 2A0CX 4BVUA 5H3QA 2FYSA 3OD6X 2WGJA 4YZCA 4XG9A 3QXPA 4WG3A 3QZFA 2PVRA 3T8OA 3EIDA 1VYZA 3PWDA 4GG5A 2WD1A 2UZDA 4KKHA 5KE0A 3W16A 5C26A 2BCJA 2F2CB 3QGYA 1OL6A 4BDEA 5A4LA 3C1XA 3QHRA 4G3EA 3BGZA 3OCTA 4M13A 3VN9A 3ATSA 4YJPA 4K8AA 4PTGA 4TYHA 4PX6A 2Y4PA 3EQFA 2BKZA 5HI2A 3ZM4A 4IZAA 2EU9A 3ZLXA 3FBVA 5CSXA 3COKA 1JVPP 2YLEA 1YXVA 5E8XA 1ZOGA 4FV9A 4QTBA 1KOBA 3DZQA 4ACDA 2J50A 1UA2A 3WZEA 4EH9A 3EWHA 4HCTA 3RPRA 3KCFA 3RCDA 5DFPA 2VTRA 5AR2A 4E5BA 4YJUA 4QNYA 2V7AA 4L52A 4FE2A 3LM0A 2W4JA 3QTSA 3LJ0A 4CT1A 5AUUA 4F08A 2C3KA 3SX9A 4BCHA 2G9XA 3A62A 4C4HA 2ZV8A 4EOMA 3Q5IA 3HMNA 4S2ZA 3SVVA 3ZZEA 2XK7A 4YPSA 4CKIA 2BTSA 3R7VA 3CQWA 3Q2MA 4R7HA 4BTMA 3BI6A 5ACBC 5CYIA 1BLXA 2LAVA 3UC4A 3QTUA 2G2IA 3EZVA 3OEFX 1REJA 4MWIA 3GI3A 4NTSA 2R4BA 4F9YA 4BTJA 4J53A 4FKWA 3R71A 1XH4A 2R3KA 3R01A 4Z9LA 4IVBA 3R8PA 3D5WA 4AUAA 4FSWA 3UO4A 3IECA 2WIHA 3VNTA 4A9RA 3DT1A 2HW6A 4PMPA 5FTQA 4WG5A 5HG9A 4HCUA 2XK9A 3MFRA 5EG3A 3R9RA 2ETRA 5TO8A 4FZDB 2BALA 4AZVA 4RGJA 3KRRA 3EH9A 5D7VA 1Q5KA 3WZUA 4A7CA 4DITA 5BYYA 5IQEA 4AE9A 2IZSA 4ITHA 4GT3A 4LFIA 4O83A 1R0EA 3DBQA 4IVCA 2ZMDA 1B6CB 4GJ2A 5BMMA 2P55A 4BBMA 3COMA 3JR1A 2XA4A 4CFXA 4RJ7A 2ZV9A 4MXYA 5HO8A 5J5SA 4MNEA 4J71A 2WTJA 4AOJA 5AR5A 1XWSA 2V22A 4W4WA 5G1XA 3UIMA 2V62A 4IVDA 4TWOA 5LWNA 4HYIA 4RWIA 4X2NA 4QMSA 5LVOA 4KS8A 4BDAA 1YWRA 4KKEA 3NYNA 1F0QA 3SDJA 3V8WA 3MESA 3QRJA 4NZWB 4E6CA 4CG8A 5AV0A 4DH3A 3ZBXA 1IAHA 1DM2A 3IOPA 3NUYA 2W1EA 1PMNA 1JSUA 4YO4A 5M55A 4O7VA 4YNEA 5AM6A 4IAYA 3EHAA 4MF0A 1H1QA 2DS1A 4Y46A 3UPXA 5IA0A 1WBWA 3OCSA 2YJRA 3AC2A 2AYPA 5M44A 2WMBA 3FQHA 4EK3A 3UG2A 4U79A 2OWBA 1M7NA 5GZ8A 1PKDA 4MQ2A 3EMGA 4AZWA 4J98A 4G9RA 3EFKA 3DK6A 3OWKA 4Y83A 3THBA 3TNPC 5I5ZA 3ELJA 4XMOA 4KIOA 1WBNA 4LOOA 5FXRA 5LXMA 4PTEA 2JBPA 2XS0A 4IX5A 4QP6A 4FTUA 4DCEA 3FXZA 4EONA 2GHGA 2X2LA 4EOKA 4AGCA 2VTIA 4H39A 4M7IA 4ZS0A 2JGZA 3ZDIA 1WCCA 3LHJA 4FTNA 4E3CA 4EWHA 1O6YA 2YCRA 3JS2A 3LLTA 2GS2A 4BGGA 2RGPA 5ACKA 2C5XA 5M06A 4XS2A 3VUMA 4BWXA 5EM6A 1OL5A 2C6EA 4G3FA 4QP7A 5HO6A 2R3RA 2X8IA 4FIIA 4R1VA 1DI8A 4UEUA 5HESA 4ZZOA 4QMLA 4QMTA 2R2PA 4ZOGA 3N9XA 3RP9A 2VWUA 3BE2A 3VF8A 2XB7A 2HW7A 1SYKA 4H05A 4BDCA 5DN3A 1ZYCA 4FV7A 4D4SA 1J1CA 3BCEA 4ALWA 3IQ7A 2VD5A 4NM5A 4EBVA 4U45A 4JOAA 2V7OA 4TWPA 2I40A 3PLAE 3UVPA 2E9VA 2YIYA 5CANA 3FSKA 4O1OA 2OU7A 5AIKA 2WOUA 3L8SA 5C8NA 3BV2A 1SMHA 5GJFA 2Y6MA 2PZRA 3R22A 4BDKA 1OVEA 5DH3A 4WNOA 4O91A 3W55A 4F64A 4IAAA 2W5BA 4LGGA 4PP7A 5HG7A 4DFZE 3D7TB 3A4PA 5IA4A 4ZTRA 4F7LA 4WHZA 4AAAA 2R3LA 3FKNA 3GU8A 2YM4A 3OT8A 3AC3A 5DR2A 3IG7A 3PA5A 3HEGA 4I0TA 4OTFA 4R8QA 3VJNA 3TUDA 3QALE 3R28A 3GOPA 1UU8A 2P4IA 3N4UA 3QC4A 4IZ7A 3ZUVA 4FKGA 1YHSA 5KO1A 4E4LA 4G1WA 1YVJA 4RIOA 1YWNA 4Y8DA 2C4GA 3ZS5A 5L8KA 2XNBA 1V0OA 2OGVA 1H0VA 4FSQA 4FODA 5L6PA 4BBEA 3NVMB 2W1CA 4G3CA 3PJ3A 1AGWA 4F6SA 1RJBA 3C13A 3D5UA 5HKMA 3TNWA 2OJIA 3F88A 4F9AA 4EYMA 5KZIA 3I6WA 4CLJA 5IQDA 1ZOEA 2WELA 4ZTQA 3MIYA 3KVWA 2ERZE 2I0EA 5I9XA 5HD7A 3NR9A 2OFVA 3N4TA 3RVGA 4GIHA 2FUMA 4MTAA 3ZONA 1FGIA 4G2FA 5IG1A 5FLFA 2R3FA 3AC5A 3C5UA 3BGPA 4HGSA 4ZSLA 3ZSIA 3GBZA 2CNQA 3WF5A 4OAUC 3RINA 1Q61A 5FG8A 3M11A 3CCNA 2H96A 2JIVA 4PF4A 3ZOSA 3FMLA 2YLFA 2HY81 2C6MA 3KMMA 4ANQA 2QOBA 5AR4A 4S32A 4NYEA 1KWPA 3ORNA 2CJMA 2VWYA 3EB0A 4FZAB 5ITAA 3RPSA 3V01A 4GV1A 2OZAA 5FM2A 4KIKB 1BMKA 1J91A 4IFGA 2JD5A 2VTJA 3B8QA 1JSTA 5E8VA 4PY1A 5IQBA 3CKXA 4NM7A 3V5TA 5ANGA 3ZUTA 1YI3A 4LV5A 3HDNA 3LFBA 3BHHA 1GAGA 3LFAA 4JJRA 3T3VA 2ITTA 4K11A 4NFMA 5GNKA 2Z8CA 5I9UA 2YZAA 2XZSA 3EZRA 4BCIA 4DGMA 5I9YA 1RW8A 4FV4A 1EH4A 3OUNB 4J97A 4BKYA 3FI2A 4ZAUA 3HX4A 4PDOA 3RBWA 2QU6A 4FNXA 4KBCA 3QAME 3HV7A 1H27A 1WZYA 3CC6A 3MA3A 3QFVA 4M66A 3DA6A 5E8YA 3C4WA 4AA0A 3HGKA 3I7CA 5HBJA 5FTGA 4TWNA 2RFNA 3OW4A 4YMJA 4K33A 4I41A 2H6DA 3IONA 3PUPA 1QCFA 4OGRA 1JPAA 2WKMA 4UV0A 3HA6A 3PSDA 1OMWA 4X21A 3BLHA 3GC8A 4FVQA 2EUFB 3EQHA 1HOWA 4GYGA 4MXCA 4ZK5A 4F63A 2A1AB 2WQMA 4D2RA 4G6LA 5CF5A 3NYOA 4XV3A 4PV0A 3L9LA 5IQIA 4J52A 4GEOA 4MNFA 2BZHB 2PTKA 4S34A 1Q8UA 2C6IA 3E8DA 3KF7A 4BHNA 4EKLA 4EI4A 1H07A 4FTAA 2YITA 1W0XC 1KE7A 3NCGA 2R3JA 3QX2A 1R78A 2VWWA 3CIKA 5IDPA 3QRIA 3C0GA 3KRWA 3FDNA 4M0ZA 4EH7A 4JR3A 1S9IA 5AR3A 5IUIA 4CTBA 4A07A 3ZFXA 4QMPA 3AG9A 3CD8A 3FZ1A 4AT5A 3KXZA 4ONAA 4GIIA 4DA5A 2C1AA 3QTRA 5A4EA 4C2WA 4ZSGA 2R7IA 3ZRLA 2GTMA 3NYXA 1M2QA 2X81A 1OITA 3SV0A 1A06A 1OBGA 4JDHA 5T6KA 2XH5A 4M69A 2PL0A 3DB8A 4OTDA 3NW6A 2GNGA 3UPZA 3VS2A 4ORKA 5HIDA 1SVGA 3UMWA 3AQVA 4DN5A 2OG8A 4CRSA 4C4IA 4EKKA 2HZIA 3R2BA 3AMAA 5IH5A 2UZOA 3FMKA 2OIDA 4JBOA 4YR8A 4MD7E 3HP2A 3PTGA 5C03A 4X2KA 3R8LA 3MN3A 1I09A 4QP9A 5EHYA 4X3FC 2VWIA 3QYWA 3W2QA 4BCGA 4YURA 2W5AA 2BIYA 5IA1A 3B8RA 1KE6A 4ZTLA 3VUIA 4OBQA 2WFYA 1GZNA 4U0IA 4A9UA 4D28A 5JMSA 5KBQA 3F6XA 5FRIA 3F3WA 1GJOA 2ITPA 2VRXA 4UYAA 3C5IA 3AT3A 3TUCA 3FI4A 2ITWA 3RMFA 2QLUA 4QTAA 3P7CA 2OLCA 3DJ7A 2PVMA 4JVGA 4TT7A 3EQGA 3TKHA 3E93A 5AX3A 4J1RA 3NUUA 4HZSA 1FOTA 4ITIA 2J5FA 4X2FA 3GOKA 3HV5A 5DWRA 5GZAA 3OS3A 3POOA 3OROA 3QUPA 4RRVA 4XCUA 2I1MA 3O7LD 3Q9WA 3R1NA 2OK1A 2C5NA 5M56A 4FOBA 4BICA 4E6AA 3ALNA 4LUDA 4ANSA 3RK7A 1SZMA 3C51A 3N51A 4L3LA 3CTJA 2AC5A 2FVDA 2Y0AA 5L3AA 4X2GA 3MY1A 2C69A 3JXWA 3CTQA 3PE2A 3SA0A 5EDRA 2BPMA 3QHWA 4U5JA 3VJOA 4HVSA 3DAJA 3VUKA 2RG6A 3BBTB 4G5JA 4DEIA 4ZJVA 5BX0A 3TXOA 1CM8A 3VUDA 4O7SA 2WU7A 3LMGA 4I6QA 3QKMA 4XJ0A 3D5XA 2VUWA 3R83A 3DPKA 3Q3BA 4IW0A 1MQ4A 5IA2A 3Q4ZA 3MH2A 1ERKA 3R9DA 4DAWA 4EOQA 3Q9XA 5AV4A 3UZTA 5CI6A 4BTKA 2ITXA 4K9YA 2VV9A 5J1WA 4FEQA 5CSVA 4O22A 4TY1A 3OT3A 3PXZA 3RNIA 3VF9A 3ZEWA 3DKFA 3MB7A 4RJ3A 4EOSA 4JG7A 3VBQA 4ZSAA 3DDPA 4NCTA 3PY0A 4KABA 4WKQA 2WMWA 5CQUA 4AZTA 2YIRA 4XOYA 4AS0A 2CPKE 2P3GX 2QKWB 3O50A 3CGOA 3EN7A 2B53A 3FMNA 4UB7A 4WD5A 4CQEA 3RPOA 4OUCA 4YZDA 2HAKA 4CZUA 3OFMA 4P5ZA 3VHEA 4OTWA 1ZYDA 5HTIA 3MPAA 2VWXA 2WMSA 1UKHA 3FZPA 3L8VA 4KKGA 2XCHA 4G3GA 4Q9ZA 4BY9E 5I3RA 4X0MA 5ETCA 4AQCA 3P08A 3W8QA 4BTFA 4DEGA 5JZJA 5AUYA 1PYEA 4RWLA 5CU3A 3WILA 4AN3A 4FL3A 4ARKA 1XHAA 5HBEA 3R2YA 5E8ZA 4I0SA 2BDFA 4BI0A 1ZLTA 1PXIA 2ITZA 4XBUA 5LVMA 2GQSA 4FR4A 1NT2A 2NO3A 3E8CA 5AAGA 5K3YA 3GQLA 4IWPA 1PXLA 1E9HA 5AUWA 2EB3A 3M2WA 4JIKA 2R3PA 4BCNA 2WMAA 4BCPA 4C4GA 4F1TA 1Q3DA 3HRCA 3ORPA 4MYGA 2OBJA 2W05A 4X7QA 2W9ZB 2ZYBA 3PP1A 4RFYA 5FBOA 3ORMA 2OXDA 3ORLA 1F5QA 1VYWA 4V0GB 5CY3A 4UXQA 4WRSA 3GP0A 3PSCA 3VUHA 2FSMX 3HMMA 3RHXA 2X6DA 3BGQA 3RALA 3UP7A 2B0QA 1UNGA 3I7BA 4GFOA 1JBPE 2OO8X 5LQFA 3R73A 4U43A 3ENHA 3FMHA 4O0TA 3PPJA 3SOCA 4FYOA 4ZY6A 5C27A 5IEYA 1TQPA 5LCKA 2DYLA 4EWQA 3WZJA 4GG7A 3OG7A 4A06A 4ASZA 2ZB1A 3QRKA 4WNKA 4O0VA 5A9UA 2VZ6A 5DT0A 3LQ8A 1KV1A 2DQ7X 3DTCA 4R6VA 3VS4A 2VWBA 3O8PA 5F4NA 2WXVA 3CKWA 3R8UA 3DK7A 5KKRC 1VR2A 4XRJA 2HIWA 4HNIA 2B55A 3CD3A 3SRVB 3GT8A 3ORZA 3ZO1A 3RKBA 4HVGA 4NT4A 4GFMA 3CLYA 4IEBA 4LRKA 5BVFA 1U5RA 5IA3A 2Z7QA 2DWBA 1XO2B 2H8HA 4D0WA 5DT3A 3GUBA 5TOZA 5B0XA 4IM2A 4RVMA 3ULZA 4DH1A 4Z7GA 1KSWA 1PMEA 2YAAA 4F0FA 3ITZA 3Q32A 4ZLZA 3OY3A 2R9SA 3COIA 4BKJA 3Q5ZA 2GMXA 3P7BA 5I4NA 3A7JA 2UZBA 2YCQA 2ZDUA 3QGWA 5M4UA 4XH6A 1BX6A 1XH5A 5J87A 2ITYA 3HVCA 3PXQA 2Z2WA 3MGYA 5CAQA 3SG8A 4BDHA 4DT8A 4RLKA 4LQMA 3D83A 3OBJA 5CEQA 4D1SA 3L1SA 3PY3A 2BRBA 2R3IA 4IWQA 4ZZNA 5IZFA 2XK3A 2QOQA 2QR8A 2ERKA 3UYSA 1YKRA 4CCBA 3FMJA 1DAWA 1G3NA 5AP6A 4DC2A 3EL7A 4Z16A 2EWAA 5KHXA 3JPVA 2WMXA 3DQXA 3Q2JA 5AR8A 1Q4LA 3G15A 4OW8A 4TRLA 4ACHA 4O7WA 5IPJA 3E88A 2CGUA 2B4SB 2HXQA 5DHJA 5LVPA 2QNJA 1IRKA 3ZSHA 3LFNA 4QQTA 3C4EA 4WBBB 4FICA 4FZFB 4QT1A 1Z5MA 4UMPA 2PVLA 4MXOA 4EHVA 1U59A 4BC6A 3GENA 4HOKA 5EOBA 4C3RA 3Q6UA 4TNDA 4C02A 3BLQA 5L2TA 3E5AA 2GNLA 3TI1A 5HX6A 4GUEA 2XUUA 4RWKA 4YJOA 3HMIA 3W2RA 3JY0A 2PWLA 4N4SA 4KSQA 2YCFA 5FXSA 4AA4A 2GFSA 4IZ5A 3WOWA 4FKPA 2BRHA 4GSBA 1OKWA 4I5HA 2VTPA 5EKOA 3DXQA 3DAKA 1QL6A 4JAJA 4R3RA 3T3UA 3FY2A 2REIA 3QU0A 4DTKA 1H26A 3PVBA 3D2KA 3QCSA 2YISA 3SD0A 4CMOA 2DUVA 2CHLA 1H25A 3TIYA 3FPMA 2XM9A 5KKRB 3L8XA 2VNYA 3QZHA 2G2FA 1V0BA 4RX9A 4YP8A 2QG5A 3G6GA 2X8DA 3IDPA 4GUBA 4F7SA 4I24A 1IA8A 3A7IA 4GT4A 1UWHA 4I4EA 4YTIA 4CXAA 4IM0A 3U8WA 3D7TA 3MTLA 4OTPA 3GEQA 4XG3A 3R7IA 4BDDA 4L8MA 4ZP5A 5AP2A 3ZHPC 3I4BA 3R7EA 2YWVA 2O65A 5KUPA 3FXWA 3DJ5A 4NM0A 4RLLA 3Q6WA 5HGIA 4F9WA 3W1FA 3QCYA 2X9FA 1JKLA 2PVKA 4EBWA 4EK4A 3WF9A 2VTAA 2UW7A 4H1JA 3W8LA 4I5PA 2VTMA 3ATTA 3IGGA 2R5TA 3NWWA 4O6LA 4EJNA 3LJ1A 4O7NA 1W7HA 3LM5A 3E62A 3P86A 3G0FA 3VUGA 4E5WA 5E1SA 2C0IA 4TYGA 5AV1A 4ZS4A 1GOLA 3UO5A 4IWOA 2PE2A 4FV1A 5M4FA 3UC3A 5M07A 3R04A 2JFMA 3R9NA 5ANJA 4E7WA 2C30A 3L9PA 5I0BA 3QQGA 2XKFA 4L9IA 1QMZA 1H24A 2VN9A 1OI9A 3DZOA 4CMTA 2GTNA 3A2CA 5DR6A 3GU5A 4D2TA 3O71A 4AT4A 4KUJA 2BVAA 4G6NA 4ACMA 3UZPA 3R30A 4FUXA 3RK9A 4GKIA 5K9IA 2G01A 1ZXEA 4QMWA 2WNTA 5HLNA 5DNRA 4WUNA 3ODZX 3QQJA 2OKRA 2JITA 5IQFA 3LZBA 4XG2A 5L8JA 4QP8A 3GU7A 3ID6C 4KINA 1Y6BA 1TKIA 3G2FA 3IKAA 4OT6A 4BZOA 3C4CA 4RJ5A 4F0GA 5IMXA 2WTKC 2A4LA 1H08A 1TQMA 5GJDA 3TTIA 3KULB 4AGUA 1J1BA 5L6WL 2WMVA 3HRBA 3GXLA 3IW7A 3U87A 1CDKA 5GZ9A 3DJ6A 4FTIA 5HCYA 3TIZA 4KIKA 4O0UA 4DHFA 2E9UA 5K0XA 4RVKA 4UY9A 3IW4A 1O6KA 4KS7A 1ZYSA 3VRYA 4RX8A 2X9EA 4RIYB 3UE4A 2YHVA 2QG7A 4B7TA 4USFA 3OMVA 1ZYJA 2YN8A 5HLPA 2ITNA 2PVFA 3MIAA 3IGOA 1JNKA 4PDYA 1QPJA 4BHZA 1QPEA 3ZU7A 4I93A 2QU5A 3FLSA 4DTBA 5C4LA 5LMBA 3ZFMA 5HG8A 4AFJA 2BDJA 5JFSA 3A8XA 3OEZA 1R39A 2W4KA 4NW6A 4XOZA 4DEEA 5JFXA 2EXCX 4R7BA 3NUPA 3DKCA 3FLNC 4LRMA 3NLBA 4FF8A 3VUTA 4LI5A 3PVUA 3W2PA 2J7TA 2FSOX 3WBLA 4QP3A 2R3HA 2GNFA 3Q96A 5J1VA 2EVAA 4MVFA 2RIOA 4DTAA 3HAVA 3ERKA 4FGRA 3B2TA 1L3RE 2WMUA 3II5A 4X3JA 2YCSA 3EYHA 5HTCA 2UUEA 4IMYA 5E8TA 4F6UA 2WQEA 3RWPA 3PG3A 1BUHA 2G2HA 5K4JA 3QRUA 3AD4A 1ZWSA 2QHMA 4FZ7A 5BVOA 4L7FA 2BRGA 3QCXA 4KA3A 4Y95A 1FVTA 2R64A 2ZM1A 3NYVA 3G9NA 2ITOA 2ONLC 4QMOA 4FT0A 4USEA 2XF0A 1W84A 4FV0A 4JR7A 2F49A 4O1PA 3OP5A 5CLPA 4FV3A 3PXKA 4UWCA 3UBDA 4FSUA 3V51A 1WAKA 1YDRE 4N6ZA 5AR7A 3LQ3A 2ZAZA 2VNWA 5D7AA 3VIDA 4AGDA 2WMQA 5CALA 4WOVA 3U51A 5CEMA 4O86A 2UZUE 2NPQA 2QR7A 2YM8A 5EDPA 3PJ8A 2IVUA 4JX7A 1SNUA 4BCMA 1W98A 2YDKA 1Q99A 5CZHA 4U80A 3VULA 4H36A 5C8MA 5CEKA 4HYSA 2OJJA 4IC8A 4QP2A 4QYFA 2E9OA 2J0MB 3EYGA 5A6OA 2BMCA 4WSQA 3P0MA 3QTWA 1Y6AA 2JFLA 2YABA 2BFXA 5BQ0A 4ENYA 3G5DA 4OT5A 3OUKA 2PE1A 4YC6A 4HVHA 4YJNA 3DBEA 3HKOA 3NIEA 3I6UA 2JKMA 5EW9A 2B54A 1W8CA 4M97A 5IISA 2C5YA 4RG0A 4AGWA 1WMKA 2RG5A 3BX5A 4YBJA 4U41A 4W9WA 2X4FA 5AUZA 3ROCA 3TNHA 4I6FA 1MP8A 5ETIA 3TM0A 1Z57A 2BZIB 4GL9A 2XJ0A 1NVSA 3K5VA 2C6TA 2WOTA 3MVLA 4OBPA 4LMNA 4NJ3A 4FA2A 5J9YA 1B38A 4RBLA 1H8FA 2GNIA 4HZRA 4IFCA 4PDSA 4V04A 3KF4A 3R8ZA 2OJFE 4DBNA 2W9FB 5M4IA 5EDQA 5DE2A 2YZLA 5BPYA 4MX9A 2VO0A 2XNPA 2HZ0A 1KE5A 3LCSA 4QPMA 2YWPA 4FT5A 4ALUA 5JSMA 3ETAA 4FEVA 2PUPA 4MBJA 5EQPA 4MXAA 4RIWB 4IAZA 3U4UA 1PXMA 5CVHA 1G8SA 4CCUA 2I0HA 4FTJA 2ZV2A 3W18A 3OOGA 3BKBA 5BNJA 2JKOA 3PZHA 1APME 4FTQA 1CKPA 3CP9A 4C58A 5IQGA 3JVRA 4EOLA 4FSYA 3HDMA 1OPKA 4L01A 3UOKA 5AA9A 4QTDA 5KMKA 1SVHA 3OY1A 2G1TA 5IEXA 3R1SA 3TZ7A 2RFDA 4X6QC 4II5A 5F20A 4AW1A 3R7GA 3QF9A 4ID7A 2CN5A 2Q83A 1PYXA 3CEKA 3GC9A 4UXLA 4ERKA 3EQIA 3MVHA 3PFQA 4WIHA 3SQQA 5CF8A 4U97A 2CCHA 3D15A 4IDVA 2V55A 3D94A 3H9FA 3MVMA 4N0SA 5J7BA 1UV5A 1OB3A 5DPVA 5AP7A 4ASEA 3M42A 4O82A 4YHFA 3UOJA 1FINA 4YZBA 4PP9A 4NL0A 2BDWA 3ORIA 1GZKA 1RDQE 3H10A 4J7BA 3QD2B 5EH0A 2I6LA 2J6MA 2XP2A 2ESMA 3F9NA 5K5NA 4DGNA 3F69A 5C1QB 3TCPA 1BI8A 1PMUA 4I6HA 1BL6A 4FMQA 5FP6A 5L6OA 1U46A 3RAHA 5IU2A 4ZMFA 2Y4IC 2KTYA 4NKSA 3RM7A 3VS1A 1LEZA 3G6HA 3IDCA 4ACCA 4L6QA 5HE2A 5HU3A 5TT7A 3EN9A 4QO9A 2H34A 1WBSA 4H3BA 3UOLA 2YACA 3GCPA 2W06A 3UP2A 3I5NA 3GQIA 3CPCA 2XIRA 1U54B 3OC1A 4O0SA 4RT7A 2Y8OA 2C6DA 3M1SA 2A2AA 3D4QA 4C7TA 1OECA 3OF0A 4CNHA 3ODYX 4FIEA 3MBLA 2PSQA 3WE8A 5HE3A 3VBXA 2PVJA 3HUBA 3W10A 3TJCA 2XNMA 3SW4A 5E9EA 2G15A 2FSLX 5IH6A 1AQ1A 2YM3A 2PZ5A 4XYFA 4DEHA 5DOSA 4DYMA 4V0GA 3GFWA 4EK8A 3ZO3A 5JQ8A 3KRXA 3VVHA 2O0UA 5D41A 1ZY5A 4YHJA 4ZMEA 4KWPA 3NUSA 4A4OA 4F1OA 2UW9A 4EH2A 3FV8A 2ACXA 2IVSA 5H2UA 1KOAA 4YTFA 4UZDA 3U9NA 4JRNA 3PYYA 2C47A 4ANLA 4IX3A 5LARA 4U6RA 4FI1A 2IZRA 1Q3WA 2CKPA 4WUAA 3FY0A 3I0QA 5B2LA 4AE6A 3TV7A 4G34A 3TZ8A 4FEWA 4BZNA 4IANA 4C4FA 3LPBA 3HRFA 3P9JA 4FIFA 1NVQA 3PZEA 2OICA 3GCVA 4C62A 3NAXA 4IAIA 4IVAA 3SRVA 4L53A 4EZ3A 2ZDTA 3C4FA 4CFMA 2PU8A 3POZA 1R0PA 3DLSA 3CTHA 4OBOA 4QMUA 2JKKA 3GCQA 4APPA 2IVTA 5CAVA 5K4IA 3NX8A 2R7BA 1O9UA 4DBXA 3C4ZA 3FKLA 4FIJA 3Q9YA 3FE3A 5JH6A 3F3TA 3F5UA 3EN4A 1ZRZA 3PJ1A 4FKSA 2VTQA 4FT9A 3BHYA 4UWBA 2FGIA 4OTRA 5L8LA 3ZM9A 3EQDA 5EYMA 4USDA 4RJ6A 3ZFYA 3ZEPA 5FWKK 3U54A 2VO3A 4FIHA 3RZBA 3KXHA 3KVXA 2J5EA 2JAVA 4F9CA 1L8TA 1AD5A 4A9TA 4JRVA 4FT7A 4YZMA 4AZSA 3GU6A 3NW5A 4RIXB 3DU8A 4K6ZA 5A4QA 2ZV7A 5AP3A 4GFGA 4PUZA 3CR0A 1XH8A 5CENA 1PXPA 3MWUA 4FNWA 5EK7A 2XVDA 3QD4A 4O27B 4DG3E 1ZMVA 4J96A 4XLIA 4FL1A 3RAIA 3R1YA 4O21A 2I0VA 2YM7A 4NUSA 5CZIA 2H9VA 3RNYA 4B6LA 1T46A 4C57A 4C36A 5BUIA 5HEZA 2PMLX 2X2MA 3VW6A 5LVLA 1HCLA 4R5SA 4D2WA 4EJ7A 4EH5A 1OPJA 3FMDA 3WE4A 4Z3VA 2PUNA 3FLZA 3LMHA 1YOLA 3HP5A 4YZ9A 4QYHA 3QTIA 3BPRA 2BRNA 5J8IA 2XJ2A 1T45A 3BV3A 3CJGA 4C37A 5ANIA 5HO7A 2IG7A 5EM5A 4CFVA 4D2VA 5AMNA 4MNEB 4WBOA 2FA2A 4FEUA 5F94A 3PXRA 2FSTX 3A60A 4GCJA 5J7HA 4M68A 1Q8ZA 4OTHA 5F9EA 2IVVA 4MK0A 4PWNA 1UNLA 2UV2A 4MD9E 4B0GA 1RE8A 4F0IA 4GVAA 1FGKA 2JIIA 4ZLYA 2QHNA 5IF1A 5L4QA 2PZYA 4LGDA 4AW0A 4WSYA 1OIRA 3OW3A 4E26A 4AXAA 4KB8A 2UVZA 2J90A 5AP0A 2QKRA 4FG8A
chains in the Genus database with same CATH superfamily
3VQHA 4ZTMA 3NS9A 1O6LA 1OGYA 1LEWA 2HYYA 2OJGA 1M14A 3C50A 5CEIA 4EOJA 2R0IA 4G5PA 5AP4A 1E1XA 1R3CA 4O7ZA 4FTRA 2WAJA 4W8EA 4R5YA 4FVPA 3Q4TA 4IH8A 5CS6A 5I9VA 3TJDA 3DBCA 2RF9A 3BYSA 2J4ZA 5I9ZA 4MHAA 3PFYA 3QKKA 5EYCA 3KGAA 4J99A 3JVSA 4K18A 1JLUE 4EZ5A 4ZJJA 4FEXA 3G0EA 2O5KA 3N4VA 3PVGA 4TPTA 3QKLA 1PXKA 2ETMA 3FL4A 4GS6A 4AU8A 1NVRA 1XBCA 4XUFA 1YDTE 3GNIB 3WF6A 1BYGA 2XM8A 3PXYA 4S31A 4EUTA 3UDZA 4RSSA 2PUIA 3DDQA 3LFQA 2OFUA 1CKJA 3SKCA 3O7LB 4LV8A 3QLGA 3Q9ZA 4IZYA 3FWQA 4BBFA 4EORA 1KE8A 3NPCA 4TW9A 1M7QA 3EFLA 4BB4A 3VAPA 2W99B 5E1EA 4AN9A 2EXMA 2XRWA 4HVDA 2W17A 3HZTA 5KZ0A 3EQPA 1OUKA 4AXCA 3LQ5A 3EN5A 3E7OA 3LXLA 3AT4A 1ZZLA 3A7HA 4O0RA 3DOGA 1JSVA 4U3ZA 4O4CA 2WU6A 3R6XA 2R0UA 3FYJX 4Y85A 3PE1A 3KEXA 2QC6A 5LMKC 4FG7A 4DEBA 2WQBA 5AWMA 3TV4A 4CD0A 3FJQE 3K3IA 1X8BA 4BDFA 3GB2A 3QRTA 4AX8A 3DFAA 1LR4A 1W83A 4R3PA 1YRPA 1GY3A 3BHTA 3HECA 2BTRA 3KA0A 4H1MA 4QNAA 3KXMA 5FBNC 4CMUA 4O0XA 3ORXA 3O96A 4I21A 4GU9A 4ZLOA 3L9MA 4YBKA 3DTWA 4XG4A 4GH2A 4QTEA 3OCBA 4E4MA 2CCIA 2C6LA 3KULA 4FV2A 3PLSA 2CNUA 5H9BA 1SNXA 1P5EA 3SC1A 4CFFA 5FDPA 4MBLA 4X3FB 4XV2A 3PSBA 4YJQA 3D2IA 4UMRA 3I1AA 3MA6A 4FTOA 3PJCA 4TL0A 4CFNA 3VRZA 5DR9A 2P0CA 5DG5A 4D4YA 4HW7A 2QOHA 2CNVA 3BRBA 4TKSA 5J9LA 1NXKA 3E3PA 2UW5A 5HD4A 3IOKA 3F2NA 3TL8A 1OKVA 1PXJA 2W7XA 4K77A 3ZLYA 4K0YA 4LYNA 1H0WA 5D11A 4CT2A 4CKJA 3FHRA 4NM3A 4PMSA 5ANEA 5B2KA 3FUPA 4JBPA 4LRJA 4YC8A 4PDPA 3R1QA 4ZJIA 2WHBA 4G17A 5CSWA 2I7QA 4RC2A 2C5OA 2VX0A 1CMKE 4CZYB 4AAYA 2EXEA 3IS5A 2XIZA 3O8TA 2BAKA 2R3NA 5FEQA 3O23A 3GVUA 4Y72A 2QOOA 1H01A 4G16A 4IAFA 5T68A 4DT9A 1OKYA 3DBFA 2XNEA 3F3ZA 4EH6A 2GNJA 3AT2A 4FSZA 3MJ1A 5C8KA 3UZRA 3E64A 2WB8A 3CBLA 3VS0A 4I94A 2NNWB 1BI7A 4RQKA 4B99A 5ANKA 4BIBA 5KNJA 4O0WA 5BVEA 3LXNA 4NEUA 2UZEA 4IC7A 2XIXA 3K2LA 1UKIA 3WIGA 5KMIA 3Q60A 5BVDA 3BYVA 3ZZWA 4C34A 2J0LA 5HORA 3FZOA 4Q9SA 3WZKA 2XNNA 3UNZA 4O7TA 4WG4A 4DHIB 2UW3A 4L42A 1PHKA 3DAEA 4UALA 2GQRA 4D4RA 3S0OA 4QRCA 1OKZA 4AW2A 4CSVA 1PJKA 1GIHA 1KUTA 4JAIA 2VTLA 2PZPA 5AM7A 3BIZA 4FSNA 2HY0A 4TYEA 3G33A 4BF2A 4YJVA 5HIEA 3SXRA 2XEYA 3LFDA 4FV8A 1MRVA 4QQCA 4NTTA 3WARA 4EQMA 3KY2A 2VWZA 2CKQA 4P7EA 3MH1A 3UG1A 4PTCA 4QDVA 4HNFA 2XNOA 5BMSA 3BZ3A 4WA9A 3V5PA 1XQZA 1U4DA 4YUQA 5KMMA 4HPUE 3TDVA 2CDZA 3ZO4A 2Z7LA 4EL9A 1P4FA 2J2IB 3FMEA 3LIJA 4GK2A 3B2WA 2KULA 1OIUA 3KK8A 2PYWA 4FOCA 5E8WA 3ET7A 5F1ZA 4DFXE 4DH7A 3SGCA 5ETFA 1KE9A 1UU3A 2CMWA 3DB6A 3DY7A 2CGVA 4EHGA 3EFWA 4BR3A 4AXFA 2CKOA 4FVRA 4QMVA 3RZFA 3KXGA 2XIYA 4L67A 4MUQA 1KV2A 4M8TA 1XH7A 3GCSA 3I79A 3MY5A 4EQCA 4FNZA 1Q24A 3DFCB 4CVAA 3W32A 2XKEA 3QWKA 3SG9A 2O64A 4FSMA 4TYJA 2CN8A 2Q0NA 4BN1A 2XARA 4AXEA 4DHZA 5HVKA 1ZOHA 4D4VA 5J9ZA 1OUYA 5M51A 2WPAA 3KRJA 4QOXA 5DGZA 4UMUA 2PVNA 2PY3A 5AEPA 3TTJA 2W1DA 2E2BA 3VBWA 3SAYA 3ZTXA 2IW9A 5L2IA 3SXSA 2BR1A 5IA5A 4C3FA 4CFWA 5I9WA 4LDTA 4YPDA 2XBJA 5HOAA 4CLIA 4MCVA 1JKSA 3VONA 3MPTA 4X2JA 3BU6A 5J5TA 2YM5A 4H58A 3O5AA 3E87A 5C4KA 5HLWA 5G6VA 3NW7A 2ETKA 4D2PA 2CGXA 3AC1A 4FT3A 5AP5A 4NKAA 4DE4A 4FJVA 3NNXA 3H9RA 3DNEA 5TF9A 4D1XA 5AV3A 4BWPA 3KIOC 4YHTA 3CE3A 4O6EA 3PIXA 4JT3A 5BVKA 3I0OA 4R78A 3V04A 3SOAA 3ZC6A 4IADA 3HV6A 4RIWA 5DRBA 1V0PA 3JY9A 4PL5A 3W2OA 4HGTA 4TYIA 4DG2E 5KX8A 4FKQA 4QPSA 4LUEA 3VBYA 3ZLWA 4PMTA 2BZJA 4NCTC 3GC0A 3KN6A 4JIAA 4GJ3A 4EK5A 3F82A 5CF4A 5CASA 4FSRA 4FSTA 3W2SA 3D14A 4ANMA 2YIWA 2P33A 2WQNA 2AC3A 3K5UA 4O2ZA 4CGAA 3O0GA 3EQCA 5CVFA 4YSJA 5AX9A 4UX9A 4A9YA 4BCJA 2QQ7A 1JKTA 4MXZA 4YLKA 4ASXA 3HA8A 2C0OA 2E9PA 4E6DA 2OH4A 2OJ9A 3UMXA 3ZO2A 4KRCA 3JYAA 4N70A 3REPA 4DH8A 3LMIA 4DFUA 2XJ1A 2ONLA 3HLLA 3R9OA 1IR3A 4BL1A 2WMTA 3IK3A 4KNBA 4P90A 4JQEA 4X6RA 3ZMMA 4ANOA 1ZARA 3MYGA 5HVJA 4WNMA 3V6SA 5IUGA 5E4HA 5KMJA 3S1HA 5KMLA 3NMUF 1JOWB 4C4JA 1OPLA 4OTQA 4ANNA 4IAKA 3OBGA 2CSNA 3NFGB 1XR1A 4D1ZA 4Q5HA 1P2AA 3F66A 3LFSA 2GQGA 4FGBA 5FGKA 3CPBA 3MPMA 4I0RA 2Z7RA 4NFNA 1FQ1B 3MI9A 3R7YA 5IDNA 1Y91A 4D2SA 3E8EA 2IJMA 3EOCA 4LM5A 3GCUA 4C2VA 2Z7SA 3AGMA 2QO7A 2WO6A 5EW8A 3D9VA 3O2MA 2NRYA 2GHLA 3F2AA 2VTTA 3F3VA 1U54A 3SLSA 3NDMA 3QYZA 4EOPA 3Q53A 4HGLA 3R8VA 3WYYA 1PKGA 4RJ4A 4I4FA 4O84A 2RFEA 4JX3A 4E73A 3S4QA 5EI6A 4BRXA 2RSVA 4DF3A 1J3HA 4I22A 2XK8A 5TR6A 3RGFA 4FTMA 4QMNA 3P5KA 3DCVA 3VS7A 4IIRA 2XK6A 3RAWA 3JUHA 1BKXA 4EC9A 4W4YA 4RX7A 4GK4A 3ROYA 2WQOA 3PRIA 3LCDA 4FNYA 5A46A 3PP0A 3D5VA 3MV5A 2O63A 4FTLA 4R7IA 5DEYA 4JXFA 4E5AX 3S00A 2HK5A 3AMBA 3EN6A 3P23A 4KSPA 2HXLA 2GDOA 5A54A 3W0PA 4DCAA 2NYAA 4FK6A 3TN8A 5HTBA 4PMMA 3LOKA 3UTOA 5CQWA 4O7YA 2C3IB 2PMIA 4OLIA 5DT4A 2X0PA 3KRLA 4EUUA 5CF6A 3NUXA 3V5JA 2XKDA 2QOLA 1H1WA 3MVJA 5ANOA 3G9LX 4TNBA 3HV3A 2HWOA 3Q04A 4JG6A 2F7EE 4J8MA 4YLJA 3BWFA 5CI7A 1Y57A 5FQDC 2VTHA 3VQUA 4IQ6A 3DLZA 4AG8A 2JDRA 3MS9A 3FPQA 5H8GA 4GVJA 2YJSA 3KU2A 3FSFA 3DXPA 3IW5A 4L45A 3FHIA 3QUDA 4QQJA 4ANBA 3AXWA 4EK6A 5JGAA 4W4VA 4U44A 1NW1A 2OXXA 3ORTA 3OTVA 3HAMA 3LCOA 4U81A 3T9IA 4U7ZA 5GIOE 4I3ZA 4ZTSA 4O38A 1LP4A 4LMUA 5AA8A 3PDTA 5ICPA 4K2RA 2YDIA 5BVWA 3LW0A 3R63A 2RKUA 4BDIA 3BQRA 5EQEA 4S33A 3HL7A 4D9UA 2VWVA 2GNHA 4V01A 5AP1A 2BZKB 4LL0A 4PNKA 3NNUA 4QMMA 3A8WA 3MTFA 4C4EA 1YWVA 2XCKA 3F3UA 4HYHA 5FTOA 4RIXA 4YTCA 4O4FA 4R77A 5LJJA 3F5GA 4BFMA 3P78A 5B2MA 2XIKA 3HMOA 2WMRA 4QYYA 2V5QA 3NSZA 2W5HA 3HMPA 4MF1A 4PQNA 4FC0A 3R7OA 4YSMA 1H1RA 1VZOA 2GSFA 3V5LA 5H8EA 4RFZA 3ZRKA 4GMYA 2A27A 4ZSEA 3CGFA 3QA8A 3PPKA 4G31A 3WZDA 2YERA 3CSVA 2YIXA 5A14A 2YEXA 3FI8A 4CZTA 3TZMA 1WVYA 3QXOA 4FTTA 4QMYA 3FI3A 5H8BA 4S30A 4AP7A 3P79A 5HU9A 2XAMA 2QURA 2I0YA 3ZC5A 3U55A 1ZMWA 2WTKB 5CAPA 3K54A 3MY0A 4HGEA 4JL9A 2UZTA 4FTCA 5JN2A 3H30A 4FKLA 1OIQA 3V5QA 4DGGA 3V6RA 3C7QA 3NAYA 2W1GA 4PL4A 3QD3A 2B7AA 4YJTA 4C0TA 3HYHA 4ZY4A 4JBQA 2BKKA 4P4CA 1PY5A 2X2KA 2BRMA 1MQBA 3FLQA 3FEGA 5JT2A 2BHHA 1ATPE 4DLJA 4QMXA 4UWYA 3BEGA 5DIAA 4HCVA 3MSSA 4IJPA 3VS5A 1VLRA 3A7FA 4FIGA 1YDSE 3ORKA 5FDXA 3RAKA 5CNNA 2YIQA 4F78A 2IW6A 4RQVA 1G8JA 3AD5A 1JQHA 2Y7JA 3V8TA 3FXXA 3S2PA 4WO5A 4ENXA 4B8LA 2C3JA 2HELA 3NCZA 3KREA 4E20A 4RA4A 4K1BA 3UQFA 2PVYA 5AUXA 1MRUA 4F9BA 4N6YA 2JIUA 3RCJA 2OH0E 4GYIA 2OZOA 3QL8A 3QBNA 1J7IA 1TQIA 4AOIA 4IXPA 1S9JA 3DV3A 5FEDA 5CT0A 5EM7A 2O8YA 3DQWA 3ZLSA 5FEEA 2UZLA 5LVNA 1IG1A 3CQEA 4EC8A 1VEBA 1ZYLA 2F57A 1IAJA 1DS5A 2VTNA 3VBTA 2X0QA 1V1KA 2XMYA 4AT3A 4JS8A 5DI1A 3KB7A 3TEIA 4E1ZA 2F7XE 1YI4A 3H0ZA 4U42A 5E7RA 2WEIA 2VX3A 1OBDA 3A4OX 2X7GA 2BAJA 2QVSE 2XYNA 4C8BA 3R21A 2C5VA 4F99A 2LGCA 2OIBA 4EOOA 2ZMCA 4F7NA 3WYXA 4D9TA 2FB8A 4JNWA 4YO6A 1OM1A 3PRFA 2WTWA 2PMOX 4M15A 4HVIA 5DYJA 4EHZA 4DFBA 3UNJA 4NIFB 1MRYA 3HNGA 3U6IA 2E9NA 4U9AA 2B9JA 4CG9A 4O81A 3UO6A 1URWA 4ZEGA 5DLSA 3FC1X 3ZUUA 2XANA 3TG1A 1XBBA 3D0EA 4GKHA 5HBHA 4MXXA 2JEDA 5EQYA 1PF8A 3QX4A 3AOXA 5JRSA 3U4WA 3MB6A 5HHWA 2IO6A 1YHWA 3H4JA 2VGOA 2J9MA 3HV4A 3R00A 2IW8A 2PHKA 4L7SA 2W1FA 2AUHA 4PL3A 3RWQA 3SHEA 2GPHA 4AW5A 3FC2A 4DFYA 2GHMA 3A61A 4BWKA 2UW6A 3FL5A 4NWMA 5D10A 3F2RA 3VHKA 4CV9A 2GFCA 4MQ1A 5JGDA 3WI6A 2UZVA 4X3FA 3P7AA 2OXYA 1SVEA 3TKUA 4DINA 3LKMA 4O0YA 3OXTA 4FX3A 3BEAA 5EI8A 2AQXA 1YXUA 2QLQA 5E8UA 5IQHA 4DH5A 2C3LA 4W8DA 4ERWA 4AFEA 3KMWA 4XEYA 4EEVA 1Q62A 2X7OA 3KQ7A 4YU2A 3RI1A 1ST4A 1W82A 3Q4UA 3QLFA 3EKKA 4QQ5A 3TZ9A 3ZXTA 4D5KA 3BYUA 4Q5EA 2B1PA 4XP0A 3NGAA 5HVYA 3V5WA 4AF3A 5AFVA 3OHTA 3IO7A 5FM3A 5M09A 3KXNA 2X1NA 3I60A 5L2WA 1YXSA 2JLDA 4IB3A 3KKVA 4JMQA 4J95A 2W1HA 5HCXA 2BIKB 3NNWA 2EB2A 3QUEA 5CU0A 3R02A 3COHA 3TNQB 4D58A 2X39A 2OW3A 5IUHA 4JG8A 2O3PA 4GK3A 4TZRA 3WIKA 5AADA 5IQAA 5EKNA 5JFVA 2GU8A 4IDTA 2QOIA 4F70A 5BUJA 1PXNA 3F5XA 4I20A 4KIQA 4YTHA 3U9CA 5CSPA 5TE0A 5DEWA 3BYMA 5CXZA 5JEBA 2VU3A 3O17A 3LFFA 2QOKA 4NU1A 3RK5A 1OL1A 2VO7A 1PMVA 2F7ZE 2HCKA 3KMUA 3NIZA 4QP4A 5CTPA 4TYHB 4C35A 4UZHA 3ZCLA 4B4LA 5CAOA 4RVTA 2XRUA 2IN6A 2VAGA 4LOPA 1J7LA 3RJCA 1K2PA 2YFXA 2WTDA 4ZY5A 2WZJA 3BU5A 2VGPA 2JDVA 1H1PA 5HX8A 3LAUA 2P2IA 3MH0A 5HE0A 1WBOA 4HJOA 1R1WA 4IACA 5AAEA 1TFFA 4BCKA 4YZNA 5LMKA 1DAYA 4MAOA 1CSNA 5K0KA 1GZOA 5HNBA 3FKOA 2WEVA 3LCKA 3AKLA 5E90A 4HPTE 4FTKA 4BDBA 3UNKA 4TXCA 3NRMA 2UVYA 4I5CA 1SM2A 4KD1A 1RQQA 5K5XA 5L2SA 4I92A 4YGAA 1OL2A 1UVRA 3MFUA 5EYKA 3V8SA 2B9IA 4ZZMA 3FMMA 3NNVA 4I6LA 5FP5A 4BDGA 4UBAA 5E92A 4JDIA 4E4XA 4IB5A 3T9TA 4IB1A 2JKQA 3GU4A 5AUVA 5HE1A 2Y4IB 5JKGA 3GGFA 4IJ9A 3O51A 3PG1A 4YNOA 3AD6A 3QA0A 1YXXA 4J8NA 4EH4A 1QPDA 3PA4A 4FYNA 4CTCA 3PIZA 4DFNA 1YOJA 3ENMA 2VTSA 3CY2A 2PULA 4F09A 2IWIA 3IDBA 3R8MA 3W33A 1Y8YA 5HZNA 5EYDA 2OF2A 4FG9A 4W9XA 5JK3A 4BCFA 4NH1A 3VO3A 1ZAOA 3RPYA 3E7VA 3K3JA 1Y8GA 5FUTA 3TNIA 4PPAA 2Q0BA 2OSCA 3NVKI 3UGCA 3U6JA 5LCJA 4IHPA 4L44A 4L3JA 4BYJA 4XV9A 5IEVA 5KMOA 4AZFA 1OIYA 4RC3A 2W1IA 2QI8A 1F3MC 3F7WA 1Q8TA 2BILB 4FZ6A 4B8MA 5C01A 3UVQA 2FO0A 3HUCA 4R3CA 2ITQA 4C38A 1NA7A 1FPUA 2C6OA 2OI4X 4OTIA 4U8ZA 5EM8A 5GHVA 4CV8A 4E4NA 4F4PA 3RHKA 1PW2A 3R7UA 4PRJA 1MUOA 3TKIA 3UIUA 4FKOA 1GZ8A 3UDBA 2B52A 1XKKA 1WBTA 2ITUA 1G5SA 3ZXZA 4C3PA 2BUJA 2PUUA 5J95A 5LOHA 2PPQA 3VWAA 3CQUA 1DI9A 3NZ0A 2XKCA 3MFSA 4QTCA 4Y73A 5CU2A 1XH9A 4IX6A 3ULIA 2ZM3A 1P4OA 3UYTA 4BKZA 4XNEA 3BWJA 1LPUA 3BQCA 2GS6A 3EKNA 3BU3A 4BI2A 5GINE 3AKJA 2J0IA 2JC6A 3OTUA 3UIBA 2FH9A 2BHEA 3P4KA 4RPVA 4RVLA 5JRQA 1REKA 2UZNA 5JZNA 3S3IA 4QMQA 4GT5A 4DGOA 2R3MA 2B9FA 2PMNX 4E8AA 4RX5A 4BIEA 4EQUA 4MKCA 2YAKA 3IPHA 2CLXA 5HG5A 2O2UA 5FD2A 4AOTA 3FZRA 3UJGA 3WF7A 3QQLA 5CT7A 4Y5QA 2QD9A 3A7GA 1GIJA 2PK9A 5CU6A 2QCSA 4KAOA 5BVNA 2WIPA 4LL5A 3E3BX 4UMTA 3ZYAA 4MD8E 3MH3A 3LXKA 1BL7A 4EH8A 5LWMA 3QZGA 3DS6A 4BYIA 2XYUA 5M53A 1FBNA 3DGKA 2F4JA 4GRBA 4XG6A 1YQJA 4AN2A 1VJYA 4DG0E 5D1JA 3U6HA 3F5PA 3PY1A 3QQUA 3VW8A 3OOMA 3Q52A 4UYNA 5DMZA 5HIBA 1E1VA 3AGLA 3LVPA 3FLWA 4GW8A 4XG7A 2QODA 5A6NA 5BV3A 3OZ6A 4CEGA 3OWLA 1G8AA 5GIPE 4KIPA 4KBAA 2P2HA 3PWYA 4JDKA 5D12A 4RC4A 3ZBFA 1H00A 3H3CA 4KBKA 4MEDA 1XJDA 4XRLA 2C6KA 4IBMA 4NW5A 5BYZA 4F1MA 3ANRA 2C1BA 5C9CA 4N57A 5HNGA 3FQEA 1Z9XA 2OIQA 3ALOA 1WFCA 3OCGA 4LG4A 1JKKA 4HYUA 4IB0A 4QYGA 3BBWA 4L46A 4MBIA 4EYJA 3DBDA 3MFTA 5CAUA 4QYEA 1STCE 4C59A 3F61A 4M67A 3F7ZA 4A9SA 4H3PA 4H3QA 1UWJA 3MW1A 3PA3A 5GJGA 1JWHA 4BCOA 4CFUA 1FVVA 2VX1A 4TN6A 3R0TA 4XBRA 3D7ZA 4M0YA 1UU9A 4ZIMA 3QQHA 2UVXA 4I1ZA 3G90X 3KXXA 3VS6A 3FQSA 4JQ7A 2F2UA 4ZTNA 4M14A 3KK9A 4RWJA 5F95A 2J0JA 4XG8A 2R3GA 1IA9A 2W96B 4RIYA 4JLCA 5EHLA 3RPVA 3UIXA 3ZSGA 4BGHA 5JQ5A 1ZZ2A 3CXWA 1PXOA 3VBVA 4AZEA 1HCKA 4WRGA 1ZMUA 2IEWA 3EL8A 3Q4CA 4FKUA 5T3QA 2HWPA 5JGBA 2QONA 3QQFA 2ZJWA 2PVHA 4DEAA 1Q41A 4P5QA 4I6BA 5D9HA 2IZTA 4YJRA 4ALVA 5AAFA 2GS7A 4WNPA 4NSTA 2Y6OA 4CYJA 4EZ7A 2Z02A 1XH6A 3G51A 1WVXA 5M4CA 3QC9A 3W0NA 3LJ2A 1CTPE 3ZRMA 3H0YA 4D0XA 4F6WA 2W1ZA 3L8PA 3MDYA 2C68A 5B7VA 1CKIA 5HICA 5HQ0A 3LFCA 2R3OA 5KMNA 4O7RA 3IW6A 4XX9A 3EFJA 4RMZA 4XP3A 5DA3A 5E91A 4W4XA 2SRCA 3QTQA 4BGQA 3DNDA 4QMZA 1U5QA 2GCDA 1ZY4A 2ZM4A 3H9OA 3KL8A 3QWJA 4FV5A 5AJQA 3V3VA 4RZWA 2RL5A 5LMAA 4I5MA 4D55A 5BUEA 2ZVAA 3OXIA 2BFYA 4Z7HA 4IE9A 4ZSJA 5IKWA 1J7UA 2V0DA 3FZTA 3CY3A 2X4ZA 3C0HA 4JQ8A 2HOGA 5CNOA 1M2RA 3ACJA 1M52A 3S95A 3KC3A 1WBPA 2W4OA 2OZAB 3GC7A 1OZ1A 1K3AA 4ITJA 4MWHA 4XLVA 3GFEA 4YLLA 4ASDA 5M08A 1M2PA 2Z60A 1B39A 3QQKA 4MH7A 4NK9A 4L3PA 5EW3A 4CKRA 2BROA 2PE0A 4AA5A 1YW2A 3L9NA 4UN0C 4IWDA 1IEPA 1NY3A 3PVWA 3TACA 4M84A 4IX4A 1Q8WA 2HZNA 4APCA 3FLYA 1LUFA 3NUNA 4LGHA 1XBAA 1GNGA 3MJ2A 3ANQA 4XHKB 4XP2A 3TWJA 5CEOA 3LCTA 3O8UA 1URCA 2VTOA 4FBXA 4U40A 3OWPA 3FAAA 4EOIA 1GIIA 4QD6A 4O2PA 2JDTA 5J79A 4EH3A 5EOLA 5M57A 3DK3A 3LE6A 3QTXA 5A4CA 4CYIA 4DFLA 5HCZA 3EQRA 4DGLC 5IH4A 1JAMA 4FV6A 4RZVA 2J0KA 3OWJA 1Q8YA 3QCQA 3QD0A 2IPXA 2X6EA 3TUDA 2B9HA 2HENA 2A19B 2QOCA 2UW8A 3EJ1A 3QTZA 3AC8A 4IM3A 4PPBA 3W2CA 2X7FA 3KCKA 4DLIA 1PRYA 2JDSA 3E63A 4M3QA 2BAQA 2X0GA 4TWCA 4ZXTA 4BDJA 4RFMA 5CU4A 3ZH8A 3PXFA 4R1YA 3UVRA 3KN5A 2UW4A 2UW0A 2QO2A 3A99A 3TUBA 5CVGA 2XBAA 4A4XA 3TDWA 2R3QA 3BE9A 1H4LA 1YXTA 2YDJA 4L00A 4AACA 2XNGA 2ZB0A 4CQGA 4U3YA 4FK3A 4Q2AA 5CSHA 2CGWA 2F9GA 3SXFA 1YOMA 5A3XA 4B9DA 2WTVA 4G6OA 3CS9A 3CJFA 4FKIA 4BCQA 4JI9A 4C61A 4L43A 4G3DA 1TVOA 4Y5HA 4I23A 3NEWA 3RTPA 1I44A 5JFWA 5ETAA 4OAVB 5CX9A 4GU6A 4KRDA 4M69B 2NP8A 2JBOA 4ZTHA 2WTCA 2CLQA 4C33A 5DBXA 5EFQA 5CXHA 4NJDA 4O7LA 2J51A 1H28A 3LLAA 1A48A 4FKTA 4XV1A 3SW7A 2JAMA 3WF8A 1M17A 1FMKA 3TT0A 5AIRA 3ZDUA 1YHVA 3UODA 4OTGA 3PPZA 3LFEA 4RJ8A 5KHWA 3QZIA 4EHEA 4JBVA 4E93A 3OXZA 3P1AA 4FUYA 3E8NA 4NIFA 2YA9A 3DKGA 4UMQA 3I5ZA 1QPCA 3C4XA 5FXQA 3R9HA 3VC4A 4BI1A 2XK4A 5A4TA 2IZUA 4ACGA 1UNHA 4CRLA 4O96A 1Q97A 2QO9A 4QP1A 5KBRA 4DEDA 3BELA 4F65A 4Z55A 4BIDA 1ND4A 4FKVA 3TV6A 4TTHB 3KFAA 4FKJA 4YJSA 4BZDA 3BLRA 2ZOQA 1A9UA 5AUTA 4A4LA 2HZ4A 3W0MA 5E8SA 3RM6A 4G9CA 3UOHA 5CEPA 2XAOA 5ANDA 2NRUA 3VS3A 5AV2A 5DVRA 1P14A 4PNIA 4RA5A 2ITVA 4YC3A 5EI2A 5KCVA 4D5HA 2JDOA 1WVWA 4L68A 4FL2A 4PPCA 2X8EA 3DKOA 3TMOA 4M12A 2VO6A 3BHUA 4JDJA 4P2KA 4V05A 3UQGA 1K9AA 5HNIX 3OVVA 2YM6A 5TKDA 1OL7A 2OF4A 4FKRA 5BYLA 3UQCA 3FZSA 3BHVA 3NUAA 1WBVA 2C0TA 2W0JA 3W0SA 3IW8A 4AWIA 3AMYA 3BYOA 5IMEA 1OGUA 1UU7A 3AC4A 5L2QA 3I81A 1FVRA 5CWZA 1IASA 4F7JA 2Y9QA 1H1SA 3FYKX 3LXPA 3C9WA 2QOFA 2XEZA 4WT6A 4OR5A 4LOQA 3ACKA 3DXNA 5I3OA 4QPAA 3PJ2A 5DRDA 5EHOA 4E6QA 3E92A 2RFSA 2UZWE 2WTIA 2PZIA 3C0IA 3EQBA 2CKEA 3PIYA 1YI6A 1FMOE 2A0CX 4BVUA 5H3QA 2FYSA 3OD6X 2WGJA 4YZCA 4XG9A 3QXPA 4WG3A 3QZFA 2PVRA 3T8OA 1XMMA 3EIDA 1VYZA 3PWDA 4GG5A 2WD1A 2UZDA 4KKHA 5KE0A 3W16A 5C26A 2BCJA 2F2CB 3QGYA 1OL6A 4BDEA 5A4LA 4QEBA 3C1XA 3QHRA 4G3EA 3BGZA 3OCTA 4M13A 3VN9A 3ATSA 4YJPA 4K8AA 4PTGA 4TYHA 4PX6A 2Y4PA 3EQFA 2BKZA 5HI2A 3ZM4A 4IZAA 2EU9A 3ZLXA 3FBVA 5CSXA 3COKA 1JVPP 2YLEA 1YXVA 5E8XA 1ZOGA 4FV9A 4QTBA 1KOBA 3DZQA 4ACDA 2J50A 1UA2A 3WZEA 4EH9A 3EWHA 4HCTA