4BFMA

The crystal structure of mouse pk38
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
313
Chain Sequence
KDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKCGSLAYAAPELIQGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title The Structures of the Kinase Domain and Uba Domain of Mpk38 Suggest the Activation Mechanism for Kinase Activity.
pubmed doi rcsb
source organism Mus musculus
total genus 95
structure length 313
sequence length 330
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bfmA00
3D7ZA 2DWBA 2B1PA 1V0OA 4H3BA 4WG3A 1Z57A 3UOKA 4FSUA 4EC8A 5ETAA 4LGHA 3SKCA 4DG2E 3A61A 2C5NA 1TQPA 4LG4A 3IONA 4M68A 4F6SA 1R3CA 3GCPA 3SW4A 2ITXA 2P3GX 3LFQA 4OGRA 3TNHA 4JRVA 4NJDA 4WRGA 4G9RA 2OBJA 4PNIA 4YBKA 3BV2A 5KMLA 5L2TA 3QQJA 3DLZA 2QNJA 1H1RA 4FTTA 2C4GA 2X4ZA 3ZONA 3R0TA 3P9JA 4NIFB 3UMXA 3LOKA 3QQHA 1GJOA 3BHVA 3EYGA 4NCTC 3EFWA 3QLFA 4BIEA 5IA2A 3IK3A 3OWJA 4IZ5A 1FQ1B 1Q8YA 3BGZA 3NYOA 4I5HA 5ANOA 5F94A 2VZ6A 3VS5A 4AGCA 3FMMA 1CKIA 4IM0A 4JDJA 4E6QA 4L46A 5CF5A 2H96A 4X3JA 1OITA 3OCGA 3UVRA 4QD6A 1FMKA 3EQRA 3A7IA 1H1WA 5CSPA 2YIXA 2YJRA 5GNKA 4F1OA 3NIZA 3R02A 3HV3A 2VWIA 3UZTA 3W2OA 4DEDA 4AAAA 2W7XA 2PSQA 3F5PA 4RJ4A 2VTAA 4A07A 2F9GA 3TG1A 3MB7A 3UQFA 2Z60A 5GJDA 5I3RA 2W17A 3R73A 4DFNA 4LRKA 5JT2A 3TUBA 5HICA 2JIVA 5IH5A 2XEZA 4UY9A 2B9IA 3PG1A 3L8SA 4XG9A 3GCUA 5AR7A 3Q96A 4M8TA 2PMLX 5LJJA 3TKHA 2ZOQA 5ACBC 3AOXA 3POZA 3R8MA 1PXKA 4YPDA 4QTAA 4OTRA 5AX3A 4QMTA 3M42A 1OL6A 5EDRA 5HNIX 3ODYX 5CAQA 4NKAA 3AC1A 4P5ZA 3SOCA 4YSMA 1PKDA 3DK6A 4B0GA 4ALWA 2QQ7A 3HLLA 4TXCA 2R7BA 4JBVA 3VQHA 4QYEA 1Y6AA 4MXAA 4OBPA 3C13A 5IEVA 4CMOA 1FPUA 2IZUA 3I60A 3PE1A 3QQKA 4DG0E 2C6MA 4F1MA 4C4FA 4CYJA 4O91A 3H9RA 4IX6A 2XM9A 4EKKA 3QCQA 4U45A 4FKSA 5GZAA 2BHEA 2W1IA 4QMVA 3MVLA 4FZDB 2W0JA 2ITZA 4AT4A 2Q0BA 4JI9A 4WG4A 1YWVA 2A2AA 3GOKA 2EXCX 4UMTA 3Q04A 3IG7A 2CDZA 5D41A 3F66A 1M2RA 3MIYA 4HNFA 3T9IA 5IISA 2ITPA 5D12A 5AP1A 3W33A 3KN5A 4EZ5A 4LRJA 5KKRB 4NT4A 5CSHA 4OLIA 5M55A 5AP6A 5DT4A 2OGVA 3D83A 2GNFA 4BCIA 3HV4A 2HW7A 2HCKA 3FI3A 3K2LA 3WZEA 3IO7A 3ODZX 4TN6A 5CAOA 3KXHA 3JUHA 4IANA 4CSVA 5M56A 1UNLA 3HRBA 3O8TA 1JSTA 2RFDA 1JOWB 4PPAA 3WILA 4MQ2A 5GZ8A 4LL5A 4NFMA 5HZNA 4S30A 4QTEA 4YSJA 3EL8A 5DG5A 3AGLA 3W55A 4E4NA 2VX0A 2BZIB 4PMPA 4JG6A 3L8PA 4JDHA 2WQOA 4MXCA 2QO2A 4DEGA 3LCSA 4R7HA 2O65A 2OICA 1W98A 2W5AA 2WQNA 4B6LA 4WHZA 4YJRA 5HQ0A 3FC2A 2ZVAA 3KRWA 3P78A 4ZY5A 4GEOA 1A9UA 3RKBA 3PVGA 3Q6WA 2G01A 2VN9A 2BHHA 1VJYA 2UZTA 3DKCA 3OUNB 4L68A 4WO5A 1ZZLA 1H24A 3H0YA 4C4JA 4FTQA 5EYDA 1OL2A 3RGFA 4XHKB 1WMKA 1RE8A 5BPYA 1URCA 1AQ1A 2VTLA 4HGTA 4H3PA 2C5YA 3R9HA 4N6ZA 3U51A 4FTNA 5AP4A 3TKUA 4YJPA 1A06A 4BTKA 4I6QA 1XH6A 1XJDA 3LZBA 3IDBA 1REKA 5HLNA 3FZSA 4AXAA 4XV9A 2H8HA 2X6EA 1H01A 4L7FA 2HAKA 2JKOA 3LFSA 2XNNA 4IBMA 4IVCA 5DPVA 5FM3A 3JPVA 4JBQA 5D10A 3UQCA 2YJSA 4ENXA 2IVVA 3D2KA 4QPMA 4IB5A 2CHLA 4AN3A 3O23A 2F49A 2W05A 4XV3A 2YIYA 3A2CA 5DT3A 3HMOA 5EM6A 3E8EA 5CVHA 3UC3A 1OPKA 2Z7RA 3V5PA 3F3WA 4F6UA 5CI6A 3KRJA 4W9XA 2YM3A 5H2UA 3R7UA 4E8AA 4KABA 3O8PA 2I0VA 3AT2A 4EH9A 5EDPA 4YC3A 4IWPA 3FMLA 3REPA 3TV7A 4IC7A 3KXMA 3GENA 4PL3A 4ID7A 4C36A 5JFSA 1PXNA 5LCJA 2YDIA 5LARA 4FKVA 3GBZA 4DFYA 3Q2MA 3OZ6A 5E7RA 5HO8A 1PJKA 2VWVA 1JKTA 5CEKA 3DK3A 1KE6A 1SNXA 2FSLX 3GI3A 4W4WA 4QYFA 5E8VA 4YTIA 1OKVA 1UU9A 4AGDA 5H8EA 3VW8A 2YHVA 2W4KA 5F20A 2B54A 4FV7A 4G3GA 4M84A 4TWCA 3VO3A 3PVWA 5EOBA 4D5HA 1HCLA 1ZMUA 4QRCA 4BKJA 4Q9ZA 5M51A 4ALVA 3B8RA 4MWHA 1PF8A 1Y8GA 4FNZA 4FT7A 4W8EA 5J95A 5TKDA 1PMNA 2XJ2A 4KD1A 3DY7A 3NAXA 4MNFA 4GIIA 3QD2B 4D9UA 3LHJA 4F7NA 3FYKX 4RA5A 4UMQA 2GNJA 5JFXA 5JRSA 2C30A 4FC0A 3LJ2A 4RRVA 3G6HA 2V0DA 4PP7A 4RLLA 4I4FA 4YTCA 5ITAA 4AZSA 5JZNA 2R9SA 5L8KA 3BWFA 3FSFA 5HG7A 4J53A 5BX0A 5M53A 1DS5A 4OBQA 3RWQA 5DVRA 4X3FB 4BI0A 1SMHA 4MBJA 2XIXA 3QLGA 3U4WA 3MJ1A 1YHWA 3G90X 4FKTA 5I4NA 4FTOA 4ZY4A 3RWPA 3TZMA 2R3QA 3GQIA 4RQKA 2C6DA 3GQLA 4BGHA 4DFLA 3Q4ZA 4HVSA 1UKHA 4C3RA 5CU3A 2FA2A 5M4UA 1KE9A 4FNYA 2CSNA 2PVRA 3F5XA 4JAIA 4NH1A 2QO9A 4JIAA 4PY1A 3R7VA 1KE7A 1CTPE 2C69A 3FMHA 1FOTA 2VO6A 4G6LA 4MVFA 4I5MA 3SXFA 3R9NA 2RIOA 3EOCA 4RC2A 3RCJA 3FAAA 4O22A 1DM2A 2GNGA 5BVEA 3RNYA 4D2SA 2VTIA 4GG7A 4MXYA 4OBOA 5L8JA 3UE4A 4O1PA 1LR4A 3TV6A 4GVJA 1O6LA 2X1NA 4JQEA 3M1SA 4L52A 4Q5EA 4A4LA 2CGWA 4BIBA 5A9UA 2PE1A 3ANQA 2EXMA 5LMAA 2OJFE 5LQFA 3PPZA 3Q4UA 3KRXA 3CC6A 3BCEA 4S32A 5EYMA 4CKIA 2XK6A 3LM0A 4TW9A 4BDIA 3EQPA 4NSTA 3QTIA 4I0SA 2OIBA 3UIXA 2V7OA 4PX6A 3WOWA 5HKMA 3PFQA 5E1SA 4ZZNA 3I5NA 4JR3A 2ITUA 2OJIA 2VNYA 4HVIA 2ZM4A 3R1YA 3ORNA 4P7EA 3EQBA 3OT8A 2W5HA 1P4FA 4KAOA 5BVFA 2R0UA 3A7HA 3VBTA 4FOCA 4EK4A 2VU3A 3BYUA 2BRBA 2RG5A 4I24A 4D55A 3U6HA 4AE9A 4JAJA 3VUDA 4DGNA 5JN2A 1TKIA 4Z9LA 5L4QA 1FINA 1OKYA 1NXKA 2FGIA 3CY3A 4L9IA 4KWPA 3EN6A 1SNUA 1DAYA 1JKSA 4UB7A 4MNEA 4PTEA 3D5VA 2FVDA 3K5VA 4KIOA 5DLSA 4G6OA 2UW5A 4AZTA 4AE6A 5HOAA 2QR7A 3ZHPC 3CTJA 4R5SA 3ZO4A 1R1WA 4RIWA 3NYNA 2W1HA 4AWIA 2BRMA 3F6XA 2JFLA 5J9ZA 4O0WA 2F7EE 3QRKA 5EW9A 2QG5A 3MA6A 3WE4A 2KTYA 4PQNA 2CCIA 4KIKB 4U3ZA 4ZSAA 3HX4A 4FL3A 1O9UA 3D4QA 4X21A 3EZVA 3DJ6A 4ACGA 3C4ZA 4W8DA 3QZGA 2NPQA 3ZFXA 4RG0A 4YJVA 2AYPA 2RFNA 3E7OA 4QMLA 4D5KA 4OT5A 2WAJA 4JOAA 4BGGA 5IMXA 2EUFB 4ANQA 1U5QA 2HZNA 1CDKA 3NUYA 2OW3A 3PIXA 5EYKA 2W9FB 1LP4A 4LGDA 5CASA 1YOMA 2CN8A 3IDCA 4G16A 5AJQA 4F7SA 3ZDUA 4X2FA 3Q32A 2BDWA 1ZWSA 2C5OA 2E9PA 4ACDA 3LE6A 3C7QA 4B9DA 5C26A 2WOUA 3MTFA 5CNNA 4F70A 3WZJA 2PVHA 1K9AA 3LMGA 3LXNA 4IADA 4RX8A 4UV0A 4F4PA 4IM2A 4F9YA 2BVAA 2ZM3A 3DLSA 3G2FA 4KBAA 5CSWA 2OXXA 2E9NA 4ERWA 3ORMA 3TNQB 2PVLA 4HYHA 4YGAA 3QQUA 3HV6A 3JS2A 1U59A 3RAWA 3HV7A 3PE2A 2FUMA 4FTLA 5HTBA 5EK7A 3C9WA 4EK6A 3MY1A 1WVYA 4YBJA 5AV0A 4XH6A 3EWHA 5AP7A 2CGVA 3CTQA 4ANOA 1CMKE 2BZHB 2QOOA 1JVPP 4BCPA 5L2QA 3ZUUA 5HVKA 2OXYA 2R5TA 3DCVA 3FMEA 2XF0A 4PV0A 4UBAA 3BZ3A 4ANMA 3QCYA 1QMZA 3GU6A 4FNWA 3MY0A 5D11A 3IW7A 4NM5A 4BYJA 3MWUA 1IRKA 1ZOGA 1F3MC 5AR2A 1HOWA 2OIQA 4JDIA 5FBOA 5DT0A 4C4EA 3UPZA 1WVWA 4PF4A 4DINA 5K4JA 4YNEA 4D4RA 3CTHA 4MX9A 3KU2A 1GZOA 4WIHA 5ANEA 4GFMA 1T45A 4CYIA 3COMA 4HOKA 3A7FA 3EQGA 4RIXA 4NTTA 1UKIA 3GNIB 4FUXA 3VC4A 2HYYA 2ONLA 4N0SA 4PDPA 4BB4A 5IA3A 3DBFA 4RFYA 4LL0A 5JEBA 3BLRA 3KFAA 4YHJA 3W16A 2VGPA 4RIYA 4XLVA 3GT8A 2VNWA 3O7LB 1NVQA 4GW8A 3KL8A 4LYNA 2WZJA 3GOPA 4MK0A 2ETMA 4BDBA 3MPAA 1U4DA 3A8WA 2LAVA 2BPMA 5KE0A 4IJPA 4DN5A 3OG7A 2BZKB 2GHMA 2IVUA 4K18A 4FV4A 4ZTRA 4EH3A 4M0ZA 3ZU7A 1WVXA 4AOTA 5HBJA 3H10A 3MSSA 3O50A 3ZRLA 4M12A 3COKA 5DOSA 1SVHA 3FLZA 4MD9E 4YC6A 1R0EA 3M2WA 4I92A 3ZXTA 2C3LA 3DU8A 3Q5ZA 2GSFA 3DDQA 4O0TA 4O27B 4DEBA 3NCGA 2JDRA 4FIHA 4EUUA 2P4IA 5T68A 4AW5A 2BIYA 2VTRA 4L45A 5HG5A 3WF8A 2PHKA 2Y8OA 3QZFA 3V8TA 3HVCA 1X8BA 3B2WA 2X2LA 4LFIA 5I9XA 3DTWA 4ZS0A 1SZMA 5DRBA 3WYXA 3PY1A 2XM8A 3ORLA 2QOHA 3RK7A 4D4SA 1W83A 4D2PA 4II5A 3ZBFA 4PL4A 2WOTA 3GGFA 5L6PA 3OY1A 4Z55A 4U79A 4B8MA 3UC4A 1BUHA 5C03A 4C7TA 1XH9A 2QOKA 4EQMA 4IEBA 5FBNC 4AW2A 3VUTA 3UP2A 3FMDA 3C4FA 3MA3A 4K8AA 2IZTA 2O63A 5JQ8A 4FG7A 4FEQA 4IX3A 4C58A 1YRPA 4HCVA 2XVDA 3KRLA 3OCBA 4JNWA 2HW6A 3CE3A 4CEGA 4EZ7A 4LGGA 2WTKB 3CD3A 3DTCA 3UJGA 3F61A 3LQ8A 5M57A 4TWPA 3TTIA 3W10A 3ACJA 4JXFA 5EI6A 5KBQA 4KIPA 1W84A 3HDMA 2ZMCA 3RZBA 1UU3A 2B9FA 2HELA 4FV0A 3FBVA 3GC9A 4DH3A 2J0LA 4KS8A 3MN3A 4WT6A 3VJOA 3AG9A 4MHAA 3PZHA 4M67A 3D7TA 4I3ZA 3EQCA 5TE0A 3Q9YA 3VNTA 5JMSA 5CU0A 5J9YA 3UPXA 2RSVA 2QVSE 3FHIA 4EHGA 1XBBA 2B9JA 4USFA 4DH7A 3PTGA 2W96B 4LMNA 3R01A 3KY2A 4XYFA 3BE9A 5AP3A 2C1AA 2RFEA 5FXQA 5E8WA 1BKXA 3LAUA 3QWKA 3PSDA 4TYIA 4WKQA 1WBOA 1RDQE 4FK3A 4L67A 3CJGA 4RPVA 3UOLA 4A9UA 3ORZA 1OM1A 3F3VA 4CZUA 4APPA 4EQCA 2VX1A 1Y91A 4WBOA 4IVBA 4FYOA 1UU8A 2A27A 3RBWA 4YP8A 4ASEA 1MP8A 3O8UA 5CT7A 1GZKA 2REIA 4V01A 3QFVA 3R9DA 4QTDA 3SA0A 4RJ6A 5L6OA 3HKOA 3BELA 5HO6A 3Q4TA 1GZNA 5DFPA 4A4XA 3PJ8A 4C37A 4UWCA 2BFXA 2NP8A 5JRQA 1H08A 5KX8A 4I4EA 5ANDA 3CQWA 2ITQA 3MFUA 3P7CA 4YZDA 3PRIA 5IUIA 1Y6BA 4G3EA 5HE2A 3BU6A 4FSMA 4MTAA 4ITJA 4Z3VA 3R7GA 4PPCA 5E8XA 4FL2A 3DV3A 4CFWA 3U6JA 3SAYA 2OJGA 3TNIA 3VBQA 4BDAA 5A14A 2X9EA 3LJ0A 4OTQA 5I9ZA 3QX2A 3MS9A 2OU7A 4TYGA 4ANBA 3PWDA 4U80A 4C59A 3ENMA 3EKKA 4TWOA 3F88A 4WSYA 4JG7A 3QGYA 5J5TA 5AUXA 5BUEA 4NZWB 3PJ1A 2RG6A 4UYAA 4V05A 2GNLA 4C3FA 5AR5A 2BFYA 4AU8A 4BCMA 3VBYA 2QODA 2A1AB 3CS9A 5JGDA 2B53A 5L2WA 4I5CA 4M69B 5AP0A 3N9XA 3I6WA 3Q3BA 1YW2A 3AMBA 1M52A 3OBGA 1RJBA 4AUAA 2J6MA 4F08A 4MCVA 2XNMA 3BIZA 2YM8A 3F2AA 3HV5A 1ZYJA 3MH0A 1GIJA 4FT0A 4FKWA 3KA0A 4TYHB 3R04A 3ZSGA 5LVOA 3F2NA 5EH0A 2ZAZA 3ZO3A 2J2IB 2UVXA 3FL4A 4C4GA 5KBRA 4IAIA 3I4BA 3L8XA 1S9JA 4X2GA 2ACXA 4FICA 2YCQA 4F9AA 1NY3A 3BHYA 2BDFA 2ITOA 3PA4A 4FUYA 3Q4CA 4O1OA 4YO4A 4YU2A 4ALUA 4UMRA 4FX3A 4XOYA 4AFJA 5DE2A 3S4QA 3D0EA 2R3LA 5C27A 4ENYA 4S34A 2G15A 4U41A 5DIAA 5HVYA 4C4HA 5GJGA 1U5RA 4AFEA 2PZPA 4AS0A 4F6WA 2QURA 1Q4LA 3DQWA 2UW0A 2ZDUA 2W1EA 2XUUA 2XA4A 4L3LA 2ZJWA 5CY3A 4C0TA 3LCOA 3W2QA 1KV2A 4ZTMA 5C01A 4BL1A 5TT7A 2ITWA 3ZLWA 4XS2A 5E8ZA 3SQQA 2UW6A 3DQXA 1B39A 3EYHA 1W7HA 1XBAA 2XRWA 3MGYA 1J91A 2GFCA 1OUYA 4EH8A 4QMZA 3KXZA 2W1ZA 4O0VA 4JIKA 1YDRE 5HGIA 1WBPA 2JIUA 4KKHA 3U9CA 4B8LA 5HX8A 1WZYA 2BAJA 4RLKA 4ZLZA 3HUBA 3SRVB 2OKRA 1BL6A 3V6SA 4EZ3A 4BBMA 2VTMA 3S95A 4CXAA 3NUUA 4YZBA 3VAPA 4A4OA 4FR4A 2CLXA 4K2RA 2VTPA 1STCE 2UW7A 1PYEA 2R3NA 2XNBA 3KF7A 5CSXA 2J0IA 3DBQA 4BZNA 1WAKA 2Q0NA 4HYIA 3PY3A 4FIFA 2UZOA 2F7XE 4YJOA 1TQIA 5DMZA 2X8IA 2YM4A 3C0HA 3GU7A 1V1KA 3RK9A 4D1ZA 5DEWA 4BVUA 4ZTNA 2YAAA 3ZOSA 4FV8A 5EM7A 4G17A 3LFFA 3P0MA 3H4JA 3ORPA 4KRDA 3EB0A 4ZTLA 4QTBA 4QQ5A 4FKGA 3LQ5A 4QMOA 4EHEA 4BHNA 4CV8A 4FVQA 4QMMA 3U9NA 4HCUA 3VF8A 4CT1A 2W4OA 4D2TA 4DCEA 3CBLA 3CR0A 2ITVA 4GYGA 2Y4IC 4WUAA 5DWRA 3RCDA 4L3PA 2XMYA 3QC9A 4F0GA 3SXRA 4BDCA 3UO4A 4RWLA 2PL0A 4ZK5A 4YMJA 4H39A 1ZOHA 4U9AA 5IF1A 3FY0A 5CQUA 2WMRA 3E7VA 2YCFA 4IXPA 4U5JA 5A4CA 3PPJA 2OJ9A 3Q5IA 2YAKA 4EOQA 5CXZA 2J4ZA 2PVFA 3WZDA 3QKKA 3B2TA 2QCSA 2I0YA 3I0QA 3DJ5A 4KSQA 4YO6A 4DHFA 3ORTA 5JQ5A 4LOOA 2R7IA 3VN9A 4QP4A 1H4LA 4MD8E 4MBLA 3QD4A 3Q53A 2RL5A 4GIHA 3B8QA 1ZXEA 4ZSEA 4DYMA 3IW6A 4N4SA 5E8TA 5IG1A 2C5VA 2WTCA 2YM6A 4GG5A 4LUDA 2JLDA 4ZLOA 4MNEB 4D2WA 1NVSA 4GUBA 4FTAA 2YCSA 5D1JA 1H8FA 4I93A 1Q3DA 4QP9A 2XIRA 3VS4A 3CY2A 5TF9A 2IZSA 3A7JA 2P0CA 1PW2A 3PWYA 2BUJA 4RIWB 1UWHA 4JQ7A 4O2PA 1WFCA 3AC5A 4GFOA 4C61A 3RPYA 3WIKA 5HG8A 4CZTA 1UWJA 2BRHA 1H28A 1QPEA 3DNEA 1JWHA 3EN4A 1QPJA 4O21A 5AR3A 2J9MA 3EQFA 1M2PA 1J3HA 3CLYA 3MW1A 3F5GA 3R7EA 2JBOA 3OFMA 1G5SA 2E9OA 4XG7A 2ZMDA 3F3TA 4I21A 1OB3A 4BHZA 3UOJA 3ORKA 3M11A 2JDTA 4EQUA 3QALE 3P86A 1KV1A 4GVAA 4YJQA 4EHVA 1I09A 3BI6A 4IVDA 4XEYA 2BDJA 2BIKB 1S9IA 5LMBA 2XB7A 3I81A 5HCYA 3IOKA 3PYYA 4YLJA 1YI6A 4A06A 4D1XA 2WQEA 4Y72A 3OOMA 1UU7A 4P5QA 2Y6MA 1NVRA 3A7GA 1E9HA 5IDNA 2C3IB 1LPUA 3BYMA 3P5KA 3UBDA 3OXTA 4HPUE 3ANRA 3TNWA 5D9HA 2PMNX 3A8XA 2XNPA 2ONLC 4BCJA 3ORXA 2EB3A 2XK8A 5BUJA 3QU0A 3RM7A 3MB6A 3CJFA 4BCOA 2WTJA 5H9BA 2JC6A 5HORA 5LMKA 3QQFA 1QPCA 2JFMA 4J8MA 2KULA 4RFZA 3UDBA 3FLYA 2WPAA 5HO7A 4AP7A 4J7BA 3KMMA 2PMIA 3BGQA 3FMJA 4ZTQA 4BDFA 3HRCA 4HVDA 2LGCA 3PZEA 4M14A 3GC7A 5CEOA 4QP6A 3MTLA 4LV8A 4UXQA 4S31A 3G0EA 2FH9A 3EJ1A 1GIHA 4QOXA 4GT5A 4TRLA 5ETFA 5T3QA 5FDXA 3ZXZA 1PMVA 1OL7A 1GOLA 2GTMA 4JBOA 1APME 4IB1A 4KS7A 4KINA 3LFNA 2YABA 2YISA 4GJ3A 4NTSA 4A9TA 4F0IA 1ZARA 3E5AA 4YZCA 4FI1A 3ORIA 4GCJA 4ANSA 1KE8A 4RVMA 2Y6OA 3TWJA 2VTNA 5B2KA 3WZKA 3S1HA 1KOAA 3VULA 4ITIA 3C51A 4KBKA 4YHFA 3VJNA 2SRCA 4KA3A 4RIXB 3VBVA 3ZEWA 5A54A 5DHJA 1E1VA 4DEIA 4UZDA 3ZSHA 1OPLA 2G2IA 3LXPA 3P7AA 5IKWA 4BCQA 4DEHA 2IVSA 5E8SA 4RVLA 2CN5A 4AA5A 2HXQA 5FDPA 5ANJA 2UZUE 4RIYB 4XV1A 3FZTA 4S33A 2VD5A 2J0KA 2QOCA 3HA6A 3OD6X 3RK5A 5HD4A 4IZ7A 2QKWB 1YOLA 3ITZA 4PTCA 5A46A 3VQUA 3TZ8A 4Z16A 3HP5A 1REJA 3RPVA 3HMMA 3OTVA 4IX4A 3FPMA 4CLIA 4NEUA 4EBWA 2UUEA 1I44A 3UGCA 1IG1A 2UZDA 3EFJA 3NAYA 4O38A 2B7AA 3BLHA 2X4FA 5JGAA 2OO8X 3S00A 2AC5A 5FLFA 1YHVA 1IA8A 3F3ZA 3QD0A 4OTFA 4QP1A 4XG8A 4C33A 5FEQA 1QPDA 4BKZA 4RZVA 2IW8A 4L00A 3SW7A 1BL7A 4OTPA 4BWKA 4CFUA 1XO2B 4QP7A 1ZMVA 2RFSA 1BI7A 1YWNA 4IFCA 3ZBXA 3GFEA 4LM5A 1JKKA 1SYKA 2ITYA 3QRJA 4HZRA 4OT6A 2IO6A 3RHXA 3T9TA 4E26A 5A4LA 2PWLA 2HY0A 4NIFA 5CEMA 3EL7A 1Y57A 3LJ1A 5ACKA 2PZIA 4EI4A 4EYMA 4TY1A 4D28A 3F7ZA 4C2VA 4YJTA 4IAKA 1E1XA 5DNRA 3NUPA 3MFRA 4OTWA 5H3QA 4XG3A 3TZ9A 3DAEA 4RVKA 3FXXA 4H1MA 1FVRA 3E8CA 3NIEA 3FZPA 4O0UA 3E64A 4RMZA 2C6EA 3PA3A 3H9OA 3RALA 3U6IA 4PDOA 3HUCA 5AUUA 1JNKA 4U97A 3FKLA 3EHAA 4FSWA 4FV2A 3U87A 3ZO2A 5IDPA 4F0FA 3L9LA 4FYNA 2BCJA 4IM3A 4AT3A 5IA1A 3PIYA 3POOA 2BMCA 2YCRA 3RI1A 2VWWA 3HP2A 5AM6A 5CAUA 4FKJA 3SD0A 1QL6A 4YLLA 4E93A 3OVVA 5CZHA 1XH5A 1YXTA 5K4IA 3BHUA 2X2KA 1O6KA 3L9MA 3OW4A 4O0SA 4CVAA 2HOGA 4K6ZA 5CNOA 4KB8A 2C3JA 2Z7LA 1FGIA 2ETKA 2OH4A 4AG8A 4NM0A 4NU1A 4DGGA 4EH6A 4KNBA 4D0XA 2GTNA 2XNEA 3EN7A 2H9VA 2YM5A 3GB2A 3NUSA 3BGPA 4K11A 4DTKA 2AC3A 1RQQA 2DYLA 1H00A 2WNTA 4QNYA 3TACA 2JKMA 4E6CA 2ZM1A 2Y9QA 5H8BA 3DOGA 3BEGA 1Q24A 3DS6A 2XBJA 1B38A 3KK9A 5EKNA 4UZHA 2X2MA 5CEIA 2VAGA 2G2HA 5I9YA 5J1WA 4PDSA 4EORA 2WIPA 1M7QA 4G3CA 3P08A 4N6YA 5DBXA 4IQ6A 3RPRA 4BBFA 4GSBA 5ICPA 5DR2A 2Y7JA 5EKOA 4BCNA 3KULB 2OZOA 2NRUA 4QMQA 4B99A 3VHEA 2PVKA 1Q5KA 3CGFA 3NWWA 4IFGA 3UP7A 5BYZA 3DBCA 1O6YA 3EN9A 5HBHA 2I0HA 3NEWA 2JAMA 5B7VA 2GCDA 4JJRA 3UYSA 1OL1A 2OF2A 2WMXA 1J1CA 3ERKA 4L53A 4TPTA 1BX6A 2W1GA 2Z2WA 5FM2A 2WMAA 3PJ2A 3EQHA 2C5XA 2C6KA 4HPTE 4E7WA 4AT5A 1YXUA 1U54B 2XRUA 4W4XA 3SDJA 4Q5HA 2EVAA 4XV2A 3VIDA 4JS8A 1LEZA 1MQBA 5E8YA 3DPKA 3R1QA 4A9RA 3QUPA 3DKFA 3D94A 5J79A 3UNKA 3T3UA 2C6LA 3W18A 3W2PA 5L3AA 4ZSJA 1ZAOA 3MJ2A 4S2ZA 2PE0A 5DEYA 3UQGA 5K5XA 4U40A 2PY3A 4W9WA 4RVTA 2ITTA 1SVGA 2QI8A 4EKLA 3Q6UA 3JVRA 5I9UA 4FKPA 4GT4A 5BVOA 4AQCA 5HBEA 3OS3A 1WCCA 3Q9ZA 1MRVA 5HNBA 3W1FA 3DJ7A 5JZJA 5M4FA 4NK9A 5EI8A 3G9NA 2WQMA 3NYVA 4X0MA 5HCZA 1ZYCA 3N51A 4FBXA 2OI4X 5EM8A 3UOHA 5AA8A 2ETRA 3PSBA 2CMWA 4J97A 4BCKA 5EHLA 3FJQE 5HIBA 4IVAA 2QKRA 4G34A 4HGLA 4NKSA 3TCPA 5CEPA 2GS7A 1JQHA 5KZ0A 3SC1A 5IEXA 2O2UA 4OTIA 4FSQA 1UNHA 4P2KA 1VEBA 1W0XC 4ZXTA 3WF9A 4IH8A 2A0CX 5IA5A 3W8QA 5CF6A 4YC8A 5AIKA 3TUCA 3UMWA 5IMEA 2R64A 4WNKA 3COHA 4EWQA 3IECA 5I5ZA 4PRJA 4EWHA 3LCDA 1YVJA 3NLBA 4E6DA 4BDJA 3QQGA 1H26A 5AV2A 1H07A 4CFXA 3DAKA 2XKCA 3FQSA 4YNOA 3KN6A 3T8OA 3LIJA 1Q99A 4D2VA 3VHKA 3PXKA 4LOPA 4UN0C 4BWPA 1Q97A 4FNXA 5KMJA 5HD7A 1XH4A 2R3RA 3VBXA 1VR2A 5L2SA 3ZEPA 1LEWA 3FKNA 4NW6A 2J50A 3RINA 5J5SA 1Z5MA 1SM2A 2IJMA 3ALOA 2VO0A 4IZYA 4IAZA 4YUQA 1JLUE 3FQHA 5E1EA 5AADA 4EYJA 2DS1A 1T46A 5CENA 2UZLA 3MVHA 1B6CB 3AXWA 4GU6A 4XMOA 4J71A 3C4EA 5G6VA 4J95A 4DH5A 2QLQA 5J7BA 1YOJA 2J5FA 5ANGA 3NGAA 5HIEA 3CGOA 4GJ2A 4BWXA 5AWMA 4M97A 2V7AA 3BYSA 4RZWA 4JLCA 3MDYA 3FDNA 5DI1A 4ZLYA 1RW8A 2XK9A 3L1SA 4E6AA 3IGGA 2HZ0A 1XR1A 2ZB0A 3BQCA 1H27A 4O96A 4L3JA 3ZFYA 4CQEA 3V01A 2C3KA 4AOJA 1KWPA 1W82A 3MI9A 3EQDA 4H58A 4IWDA 4CQGA 3ZZEA 5AX9A 2F7ZE 4BCFA 3GCQA 3DDPA 3PJCA 2WMBA 4QMPA 2W99B 1JBPE 2WTWA 3AMYA 4O2ZA 4UMUA 4RSSA 5DR6A 3QHRA 2OF4A 3OCTA 4Q2AA 5J7HA 4OAUC 4DGLC 2UZVA 4MWIA 5F4NA 4L7SA 4FV5A 4FOBA 1PXOA 5GHVA 4E5WA 1FGKA 4V0GA 1IASA 2HXLA 4X3FA 1TVOA 4QQCA 3V5QA 2GPHA 4U42A 4TTHB 4C2WA 3R6XA 3FL5A 3V5JA 2W06A 4AACA 4DLJA 2CCHA 3BQRA 2J90A 4FV6A 4I41A 4HYUA 3V5TA 5T6KA 4Y85A 3PXZA 1OMWA 3UNZA 4CMTA 4CFNA 4K0YA 4J96A 3RM6A 3U8WA 3WZUA 3ZFMA 4YURA 3AC4A 4HW7A 5BYYA 2BROA 4C4IA 5I9VA 3R7IA 4U7ZA 3VS1A 5IPJA 4IAYA 3ZC5A 4WNPA 2JGZA 5HI2A 2OXDA 1R78A 2X7FA 2FO0A 2OFUA 3HL7A 3BLQA 4FTUA 4FSRA 3KC3A 2CLQA 3OF0A 4QP8A 3FPQA 4HCTA 3VS7A 3E62A 3TN8A 2RF9A 3DFCB 4M66A 4UWBA 2ESMA 1ERKA 1PMUA 4ZOGA 1OIUA 3BHHA 4JBPA 3JYAA 3LXLA 3QWJA 5FWKK 3GC0A 4AZEA 5HU3A 3ULZA 2JITA 1OPJA 4RBLA 4YTFA 5K5NA 3MBLA 4W4YA 4CNHA 3FI4A 3S3IA 5C8NA 5JSMA 2IWIA 4G5JA 4R7IA 4FV1A 5EOLA 5EW8A 2F4JA 4R8QA 2VO3A 2HIWA 3RMFA 4MAOA 1M14A 3I6UA 1P2AA 1Q8UA 4CD0A 2CPKE 4FG8A 5E8UA 4MXXA 3ZSIA 5IUGA 3G6GA 4CFVA 4D4YA 2VGOA 3E88A 3MFSA 5CEQA 3TTJA 4UMPA 2VWZA 3MH3A 3TIYA 3R8ZA 4WRSA 4BDHA 1GNGA 2C0IA 3I79A 5LMKC 3HMNA 3TZ7A 3R2BA 4BZDA 3E3BX 3EN5A 2OIDA 2HK5A 4O0XA 4ZTHA 1VYWA 4WD5A 4XOZA 3TT0A 3NYXA 3NUXA 3TKIA 3KVWA 3II5A 5IU2A 4PWNA 5KCVA 1R39A 3KCKA 2X8DA 2YFXA 2YWPA 3NPCA 3EMGA 3PY0A 3K54A 4FKOA 4YHTA 3PXRA 3QF9A 1YXVA 2JAVA 4QTCA 3ZUVA 4USEA 1P5EA 4XBRA 5KNJA 2X8EA 4DAWA 4F9BA 5ETCA 4EOJA 2EWAA 4PMMA 3SOAA 3I0OA 3C4CA 3KQ7A 4RWIA 4D0WA 3LLTA 4E5BA 3UVPA 5AP5A 5AEPA 1XBCA 3ETAA 4IWQA 4QT1A 4MF1A 3UTOA 5IA0A 2GS6A 3ET7A 3QA8A 3QYWA 2VWYA 3DGKA 3RHKA 3DKOA 4BFMA 3V6RA 3ULIA 3ZZWA 4OTDA 3R71A 5A4TA 3MH1A 1OKWA 3FI2A 4I0TA 5CVGA 4QP2A 4G5PA 2XKEA 5AUVA 2DQ7X 4QPAA 2UZEA 2DUVA 3BWJA 4YPSA 4QQJA 3FZ1A 4IC8A 3BBTB 4IHPA 5TO8A 5FP5A 2PTKA 4F99A 4MF0A 3QX4A 1XHAA 2WHBA 3V04A 4XCUA 3R8LA 1XWSA 3A99A 2IVTA 1CM8A 2WXVA 3AD5A 4E3CA 3F69A 4DH8A 5FEDA 2JDOA 2VTHA 2YN8A 4FMQA 2GHGA 3K5UA 3KF4A 4O0RA 2YIWA 5FP6A 3TL8A 4CKJA 3FWQA 3W32A 2W1FA 3GUBA 3QTUA 1PY5A 2VUWA 4EJNA 4MKCA 2XIYA 2XZSA 3ZCLA 4LV5A 3BRBA 4ZTSA 4BTMA 3BKBA 3IPHA 3I5ZA 3T3VA 5HIDA 2W5BA 5EDQA 2WFYA 3V8WA 4JDKA 4WUNA 4GYIA 5F9EA 5JFVA 5BVNA 5CU6A 4QMYA 3AD6A 4FZ6A 4D1SA 1WBSA 2B55A 3QQLA 2E2BA 3MVMA 4ZEGA 4ZJIA 3VW6A 4FVRA 4DC2A 1JAMA 4RX5A 4EONA 3C0IA 2VRXA 4IAFA 3KB7A 4Y73A 4ZY6A 3E63A 1PYXA 5HESA 2J0JA 2VTJA 3WF6A 4EK5A 5AAEA 3BYVA 4I20A 1OKZA 5IEYA 4ACCA 2OZAA 4IAAA 4B4LA 5KHWA 2C6IA 5I3OA 3H0ZA 2GFSA 3WIGA 2XCKA 3D5UA 5CTPA 3QTXA 1F5QA 3OT3A 4BDDA 3L9NA 2XIKA 3KXNA 3NNUA 4EK8A 3OWKA 2H34A 1Q61A 4WBBB 3DZOA 4BDKA 3RVGA 2YDKA 5CF8A 1P4OA 4GFGA 1XQZA 4BTJA 3FSKA 4DFXE 3F5UA 1WBTA 2VTQA 3AT4A 3PG3A 4FSNA 4EBVA 4EL9A 5AA9A 5JKGA 5IH4A 4RX9A 4EH2A 2GDOA 5ETIA 3CCNA 2YLEA 3FLWA 4C57A 5AIRA 1ZY5A 4BBEA 3EIDA 5KUPA 3MFTA 4XNEA 4I23A 3O71A 4ZSGA 5DH3A 2YM7A 4IZAA 3V8SA 3DBDA 3OEFX 4ONAA 4FG9A 3RP9A 5CAPA 3F7WA 4KIQA 2XYNA 4BC6A 1PXLA 3P1AA 3R63A 3R2YA 4AZVA 2GQGA 2IN6A 4KKGA 4L44A 3G51A 1Z9XA 3UODA 5IH6A 1FMOE 3BYOA 3PP0A 5C1QB 1G3NA 4F09A 2C47A 2WU7A 3CKXA 4IB0A 4UWYA 4PNKA 4XRLA 4U6RA 1H1SA 3DBEA 3EQIA 2CGUA 2FYSA 3PXFA 4R1YA 4ARKA 4E73A 5JK3A 4MEDA 4FT3A 2QLUA 2C68A 3FHRA 3O0GA 4BCHA 1W8CA 2R3JA 4IJ9A 1ZOEA 1CKPA 3NCZA 1BLXA 3QXOA 4J8NA 3BU5A 4DGOA 5KKRC 3O7LD 3R28A 4RGJA 1PXPA 1BMKA 2I1MA 2O8YA 3IDPA 2W1DA 4ZZOA 2UZWE 2UW9A 4L42A 1H1QA 4H3QA 3HEGA 2XP2A 5D7AA 3FQEA 3GU8A 4UX9A 4R3PA 3C4XA 4LUEA 5AUZA 3VS2A 4E4XA 4DGMA 2OWBA 4AGWA 4EHZA 4TNDA 5I9WA 2R3IA 3G9LX 4UYNA 4LRMA 5M44A 2XEYA 3GU5A 4FL1A 2F57A 4ZSLA 2X7GA 3FLQA 3HZTA 5C8MA 3RPSA 3MVJA 3FXWA 3QZHA 2JBPA 3HECA 4PP9A 5A4QA 4YJUA 3NW6A 2EB2A 4YR8A 3R8VA 1ZYSA 3LFDA 5HLPA 1UVRA 2C1BA 2WU6A 2XNOA 4RJ5A 3R30A 5BMMA 2AUHA 3KRRA 5AAFA 3NR9A 5HEZA 3ZO1A 5KMNA 2Y4IB 4M15A 3V5WA 4XP3A 2QOIA 4HGEA 3NS9A 4FTJA 4YJNA 3TIZA 5KHXA 3UIBA 5KO1A 3E92A 5CQWA 3QGWA 2E9VA 2W1CA 1F0QA 2WMUA 4KRCA 4F65A 5KMIA 5LXMA 3C50A 4XG2A 2B52A 5C9CA 2XK3A 3DAJA 1OIYA 3LM5A 4GL9A 4CMUA 1UA2A 4FZFB 3ZC6A 5HCXA 3L8VA 3HDNA 4WG5A 4XP2A 5J1VA 1OGUA 4JT3A 4DH1A 2J5EA 4FZAB 2YA9A 4ZIMA 3R1NA 4MQ1A 4EH7A 3Q9XA 3I7BA 1PXMA 4LOQA 2W9ZB 3GU4A 4FTCA 3OWPA 3R22A 2C0TA 4FTIA 3ROYA 4BZOA 3CXWA 1ZRZA 2X7OA 2WEIA 1IR3A 3E93A 4G31A 1FVVA 4C38A 3LVPA 4FKIA 4IW0A 4U3YA 5HG9A 1OUKA 4IWOA 4L6QA 3TUDA 4HVHA 1YQJA 3R83A 4IIRA 4WOVA 4QMNA 4ACMA 2R3KA 2HWPA 1H1PA 3ACKA 3KGAA 4WA9A 3SHEA 5CX9A 3D14A 3FKOA 3A4PA 3NW7A 4EOPA 4HNIA 4G2FA 1YXSA 2CKEA 4G9CA 4J98A 5AUWA 4CZYB 3LW0A 4BN1A 2WKMA 2C6OA 4IDVA 3FY2A 2IW9A 5JH6A 1PXIA 5J9LA 5B2LA 5CVFA 3SV0A 4LI5A 4L01A 2UW4A 4EC9A 5EFQA 5AMNA 4M69A 3QZIA 4WSQA 4AA4A 2FSMX 2XK7A 2R3HA 4HJOA 4J52A 5FXSA 4TKSA 3W2RA 4MD7E 4PUZA 5AUYA 5BVKA 4GU9A 4RIOA 4FIIA 4EOMA 2X81A 5FD2A 3OWLA 3AGMA 5M4CA 3GEQA 4Y95A 3ZLSA 3DA6A 4E4MA 2WIHA 1YXXA 3C1XA 4TYHA 3K3JA 3UIMA 5BVWA 2QD9A 2OJJA 3SLSA 2YIQA 4FSTA 4FK6A 4FVPA 2W4JA 2YITA 5IA4A 4AOIA 4FTRA 5E91A 4ITHA 4PL5A 4QPSA 5FGKA 4DFZE 3TJDA 2WQBA 5CU4A 5J8IA 3QCSA 4I94A 4USDA 4XLIA 4AF3A 2P2HA 2PUUA 2OG8A 1ATPE 4UEUA 4A9YA 2BALA 1YDSE 4RX7A 3MY5A 2XK4A 5ANKA 5AV3A 2FB8A 2ZYBA 4I0RA 3R7OA 3TEIA 3FLNC 3WBLA 4BRXA 3UIUA 1Q41A 3I1AA 2WEVA 4GK2A 1PXJA 4ANLA 1HCKA 3TJCA 2OH0E 1JKLA 3I7CA 4KBCA 3P79A 2VWXA 4QP3A 4RWKA 5A3XA 2HWOA 4B7TA 4X3FC 3ZRKA 3VWAA 4JL9A 2R4BA 2P55A 2VWBA 5HU9A 2BR1A 5A4EA 3E3PA 3KXGA 1URWA 1ZZ2A 2R0IA 5FTQA 4CRLA 1TQMA 3OOGA 5HLWA 3IKAA 4TL0A 2O5KA 3TI1A 3QHWA 4BCGA 3EFLA 4TNBA 5EHOA 3OHTA 4G3FA 2HY81 3CD8A 4YZNA 5E90A 4GRBA 4P90A 3NW5A 4AA0A 4JG8A 5K0XA 4D4VA 5AM7A 2X39A 3PJ3A 3QBNA 2XH5A 4FGBA 4EUTA 4BI2A 2V55A 3R9OA 2WGJA 4EK3A 4WNOA 2OFVA 3GXLA 2BRNA 3BEAA 3HRFA 5LVMA 1NA7A 2UV2A 4Y46A 5LOHA 4QO9A 4U8ZA 4G6NA 5K3YA 2YLFA 2J51A 3PXYA 5DGZA 2PVNA 3SRVA 3P7BA 2PZ5A 3QAME 3E8NA 1YI3A 2QONA 2YZAA 3EKNA 5FG8A 4EOLA 3O96A 2WO6A 3NZ0A 2V22A 2VTTA 4RJ7A 1J1BA 4H36A 4R5YA 3PA5A 4V0GB 4GH2A 4F64A 4EOOA 4ZZMA 1YWRA 4ACHA 4NUSA 2FSTX 3OW3A 3VRZA 3VUKA 1Q62A 4FSZA 4O6EA 2HZ4A 3AMAA 3U4UA 4ZJJA 4ASXA 4CTCA 2ZDTA 3MYGA 2V62A 4XX9A 1ZMWA 4JQ8A 2R3FA 2NO3A 3W2CA 3MPTA 2JKKA 3HMIA 4KSPA 5EW3A 4I6BA 4JVGA 4FZ7A 3FZOA 3E8DA 3MIAA 4TYJA 4YZ9A 4N70A 4X2JA 4BDEA 3DKGA 3UG1A 1DAWA 1YKRA 2R2PA 3QRTA 4Y8DA 5DR9A 4LQMA 4Z7GA 5CANA 1Q8ZA 3D7TB 1M7NA 3HGKA 3HYHA 3C0GA 2I0EA 4L43A 2ZV9A 3R21A 3H3CA 3FYJX 2GU8A 1PHKA 4IX5A 2RKUA 3WF7A 4NCTA 2XBAA 3PVBA 4QYGA 3D2IA 2F2UA 4KKEA 4Y83A 3S0OA 3OBJA 3QKLA 2WELA 3KCFA 4ZJVA 2BKZA 3A60A 2O0UA 2R3OA 4C62A 4Y5HA 2E9UA 4YZMA 1Q8WA 4A7CA 5J87A 3NNVA 5CYIA 2XS0A 3QL8A 5KMKA 5HE3A 4XG4A 3CP9A 3SXSA 3G0FA 3BX5A 3QD3A 3RZFA 3QKMA 5BMSA 5BUIA 3F9NA 3BV3A 2O3PA 4E1ZA 3WF5A 1OECA 4GK3A 3V5LA 3EZRA 4RJ8A 3FZRA 3GVUA 2XYUA 4YLKA 4APCA 1M2QA 1ZLTA 2WTIA 3BPRA 2BRGA 3D15A 3G5DA 4Q9SA 4BGQA 1M17A 4F7JA 2G1TA 4HGSA 1R0PA 3ZS5A 4EEVA 3QCXA 4JR7A 5BQ0A 1WBWA 4CFFA 3BE2A 4CFMA 4C34A 4BKYA 2PZYA 2WMSA 4AW0A 3ZUTA 2UW8A 4D58A 5CF4A 3OMVA 4GMYA 3QUEA 5D7VA 2X0GA 4DITA 4J1RA 1V0PA 4HZSA 4E5AX 4BDGA 5LWMA 3IW4A 1QCFA 2Z8CA 2EXEA 2QOFA 1YI4A 3AD4A 1K3AA 2Y4PA 3LFBA 4F9WA 3CPBA 1CSNA 3QUDA 3OC1A 4G1WA 2VTSA 5F1ZA 3RNIA 4JRNA 5CWZA 3DNDA 2B9HA 4AN9A 2QU6A 2QOLA 2UZNA 3GCVA 2QU5A 4CRSA 4X6RA 3A62A 2UVYA 2XKDA 4FKUA 5K0KA 2X6DA 4NM3A 4M13A 3GCSA 3LCTA 2IW6A 3CQEA 3A4OX 4OTHA 2PMOX 3VS0A 5HTCA 3ZDIA 3ZYAA 1GY3A 3K3IA 4LMUA 2OK1A 3CPCA 4CKRA 1PMEA 5ANIA 3HMPA 4C3PA 5LWNA 2VWUA 3VUIA 3PIZA 3OXZA 3CEKA 4EOSA 5JGBA 3MV5A 3UG2A 1YHSA 2YEXA 3ELJA 3UNJA 4ASDA 4MXOA 4M0YA 2XJ0A 2BZJA 3ZLXA 4X6QC 3ZLYA 5L2IA 3G33A 3PPKA 5CZIA 3KK8A 5M4IA 3R7YA 3R8PA 2Z7QA 4RT7A 4Y5QA 1MRYA 4QYYA 3WYYA 4CT2A 3AC3A 5DRDA 4DEEA 4FTKA 2A19B 2QHNA 3C5UA 1CKJA 1V0BA 1KOBA 1XKKA 2PK9A 5FRIA 3QA0A 4C8BA 2GNIA 2HENA 4EOIA 5LVPA 2JDVA 3UO6A 1OIQA 3Q60A 1K2PA 4QMWA 1JSVA 4FIEA 5AP2A 1P14A 5AAGA 3CQUA 3HNGA 4CCBA 1KSWA 2IZRA 4BYIA 4FF8A 3OP5A 4F7LA 1VYZA 4QMXA 5FXRA 3H9FA 1VZOA 4RC4A 4OTGA 4P4CA 5B0XA 2ZB1A 3VUHA 4AW1A 3CKWA 2V5QA 5G1XA 4W4VA 4WNMA 3NNXA 1OL5A 2PVJA 4UALA 2J7TA 3F82A 2H6DA 3VRYA 5CS6A 4AX8A 4XRJA 2YDJA 4D2RA 4H1JA 3DB8A 2EU9A 2OZAB 4NW5A 3VBWA 5DA3A 3RJCA 3JY0A 4I6HA 4F63A 2C6TA 4IDTA 5CT0A 3ZMMA 3BBWA 4U81A 1MUOA 3VS3A 5K9IA 4GUEA 4R6VA 1GIIA 4BI1A 4IE9A 3RAIA 2BAKA 2VTOA 3HA8A 2ZV8A 3NX8A 3QTSA 3UO5A 3THBA 4JX3A 4XUFA 5HNGA 1JSUA 3OUKA 3RPOA 1ZY4A 3JY9A 2VO7A 3ZM4A 4FIJA 4ZAUA 5EHYA 4I22A 3AT3A 2XKFA 3WE8A 4NM7A 3PRFA 4ERKA 2Y0AA 2R3MA 5LVLA 3IQ7A 3FMKA 2CJMA 1Y8YA 3GC8A 2WTKC 4PTGA 4AZFA 2QOQA 4FKRA 4QMSA 4F9CA 4PPBA 4C02A 4TWNA 3KMUA 5CALA 5CLPA 3MPMA 4QNAA 2QOBA 4FT5A 4HVGA 1XH8A 5AR4A 3WI6A 1ZYLA 3QYZA 4U43A 2CGXA 2I40A 2PVMA 3Q52A 3QXPA 4RQVA 4X7QA 5B2MA 3UYTA 2WTVA 2XIZA 3GFWA 3DXNA 2UVZA 3OROA 3R8UA 4RA4A 3PXQA 3O2MA 3QC4A 4XJ0A 5CXHA 3RTPA 3LPBA 4AZWA 3QTQA 2ITNA 3NUNA 3SVVA 5EM5A 2ERZE 3PP1A 3R1SA 3KEXA 4O6LA 1WBVA 3L9PA 2BTRA 2HZIA 3FMNA 3GP0A 1KE5A 2JD5A 2UW3A 3D5XA 3KMWA 4MYGA 5FEEA 3DT1A 3LFAA 4QMUA 3W2SA 5IZFA 4FIGA 1PKGA 3KVXA 3ZRMA 3P4KA 1LUFA 2YIRA 2GHLA 3PLSA 5GZ9A 5FTOA 5FQDC 3CIKA 5LVNA 4F1TA 4OAVB 2XCHA 3PSCA 2BAQA 3IGOA 5HVJA 3W8LA 4M3QA 3LCKA 1AD5A 2B4SB 3NDMA 4R1VA 4RFMA 4FODA 5A6OA 4FSYA 3FE3A 4FT9A 4XP0A 2ZV2A 4AN2A 4IMYA 1OZ1A 4U44A 1OVEA 4E20A 1U46A 1ZYDA 4X2KA 5F95A 3IOPA 4MBIA 2O64A 3O17A 2YERA 2P33A 3NSZA 4RJ3A 4YTHA 4ZP5A 3AC8A 4MXZA 4IACA 4BIDA 2PVYA 4ANNA 4EOKA 5AR8A 1MQ4A 3RAKA 5HHWA 4CLJA 2JEDA 3OCSA 3OXIA 3AC2A 4XG6A 2WD1A 2XJ1A 4BTFA 3FC1X 3VUGA 4GS6A 2ZV7A 4R3RA 3E87A 4PMSA 3LXKA 2YACA 3DZQA 2X9FA 5KZIA 1L3RE 2ERKA 1XH7A 3ENHA 3LFCA 3COIA 3Q9WA 1GZ8A 5CI7A 2WMQA 1SVEA 4D9TA 2UZBA 1FVTA 3FUPA 4DBNA 1EH4A 3PVUA 1IEPA 3H30A 2A4LA 4TYEA 1Q3WA 3AQVA 4M7IA 5EYCA 2QC6A 2F2CB 3OY3A 1OI9A 3FXZA 1BI8A 4JX7A 2PE2A 2XNGA 3P23A 4BICA 4AGUA 2G9XA 3EH9A 3MH2A 1DI9A 2PZRA 4C35A 4RWJA 2WMWA 1WBNA 5HE0A 1H0WA 1OIRA 5CSVA 4KIKA 3KULA 4HYSA 2RGPA 4UXLA 1AGWA 1H25A 4V04A 5A6NA 3O51A 5AUTA 3WARA 4CV9A 4BF2A 4FA2A 3NNWA 5DN3A 5HE1A 5EI2A 5AV4A 3FV8A 2GS2A 3QRUA 5CU2A 5BNJA 1JPAA 2JKQA 2P2IA 3FLSA 4GK4A 4NWMA 3BHTA 5GJFA 3TNPC 4DG3E 5HTIA 3DK7A 2J0MB 2JIIA 4OW8A 3QTWA 4ASZA 4E4LA 4U0IA 5CAVA 3DFAA 4NJ3A 4QYHA 3IW8A 2VX3A 4RC3A 2FSOX 3IS5A 2JDSA 3QTZA 5LCKA 2R3GA 3VUMA 3NRMA 1U54A 4TT7A 4IB3A 5AV1A 5EG3A 5E92A 5C8KA 3KXXA 2QHMA 5HX6A 3TXOA 4EH4A 5H8GA 1MRUA 4R3CA 5L6WL 2C0OA 4DEAA 3VF9A 3JXWA 1BYGA 4K1BA 3LFEA 3D5WA 2WB8A 3KKVA 1Q8TA 3JVSA 2WTDA 3QTRA 3SX9A 5L8LA 1GAGA 4FKQA 3C4WA 5TOZA 4QQTA 4I5PA 4X2NA 2OSCA 4PMTA 5TR6A 4OR5A 1UNGA 4OUCA 4K33A 1UV5A 2QR8A 2I6LA 5I0BA 4J99A 4YJSA 4MH7A 4CCUA 4Z7HA 2WMVA 5BVDA 2VV9A 2BTSA 2Z7SA 3EFKA 3ROCA 3PUPA 3D9VA 4GV1A 4FTMA 4CTBA 4O0YA 4A9SA 3R00A 1H0VA 4I6FA 4XBUA 3RAHA 3ALNA 2BILB 4K77A 3DB6A 2GMXA 4I1ZA 3S2PA 3ZTXA 4EH5A 2QO7A 3VS6A 3IW5A 4K9YA 4FKLA 2NRYA 2G2FA 4FV3A 4TZRA 3UVQA 3ZH8A 4NFNA 4L8MA 3BU3A 3V3VA 3TV4A 3UZPA 3V51A 3OEZA 2R3PA 5JFWA 1DI8A 2WMTA 1YDTE 3OTUA 4DLIA 5KMOA 2GNHA 3F3UA 4GT3A 5IUHA 4FV9A 3VVHA 4G3DA 3QRIA 5KMMA
chains in the Genus database with same CATH superfamily
3D7ZA 2DWBA 2B1PA 1V0OA 4H3BA 4WG3A 1Z57A 3UOKA 4FSUA 4EC8A 5ETAA 4LGHA 3SKCA 4DG2E 3A61A 2C5NA 1TQPA 4LG4A 3IONA 4M68A 4F6SA 1R3CA 3GCPA 3SW4A 2ITXA 2P3GX 3LFQA 4OGRA 3TNHA 4JRVA 4NJDA 4WRGA 4G9RA 2OBJA 4PNIA 4YBKA 3BV2A 5KMLA 5L2TA 3QQJA 3DLZA 2QNJA 1H1RA 4FTTA 2C4GA 2X4ZA 3ZONA 3R0TA 3P9JA 4NIFB 3UMXA 3LOKA 3QQHA 1GJOA 3BHVA 3EYGA 4NCTC 3EFWA 3QLFA 4BIEA 5IA2A 3IK3A 3OWJA 4IZ5A 1FQ1B 1Q8YA 3BGZA 3NYOA 4I5HA 5ANOA 5F94A 2VZ6A 3VS5A 4AGCA 3FMMA 1CKIA 4IM0A 4JDJA 4E6QA 4L46A 5CF5A 2H96A 4X3JA 1OITA 3OCGA 3UVRA 4QD6A 1FMKA 3EQRA 3A7IA 1H1WA 5CSPA 2YIXA 2YJRA 5GNKA 4F1OA 3NIZA 3R02A 3HV3A 2VWIA 3UZTA 3W2OA 4DEDA 4AAAA 2W7XA 2PSQA 3F5PA 4RJ4A 2VTAA 4A07A 2F9GA 3TG1A 3MB7A 3UQFA 2Z60A 5GJDA 5I3RA 2W17A 3R73A 4DFNA 4LRKA 5JT2A 3TUBA 5HICA 2JIVA 5IH5A 2XEZA 4UY9A 2B9IA 3PG1A 3L8SA 4XG9A 3GCUA 5AR7A 3Q96A 4M8TA 2PMLX 5LJJA 3TKHA 2ZOQA 5ACBC 3AOXA 3POZA 3R8MA 1PXKA 4YPDA 4QTAA 4OTRA 5AX3A 4QMTA 3M42A 1OL6A 5EDRA 5HNIX 3ODYX 5CAQA 4NKAA 3AC1A 4P5ZA 3SOCA 4YSMA 1PKDA 3DK6A 4B0GA 4ALWA 2QQ7A 3HLLA 4TXCA 2R7BA 4JBVA 3VQHA 4QYEA 1Y6AA 4MXAA 4OBPA 3C13A 5IEVA 4CMOA 1FPUA 2IZUA 3I60A 3PE1A 3QQKA 4DG0E 2C6MA 4F1MA 4C4FA 4CYJA 4O91A 3H9RA 4IX6A 2XM9A 4EKKA 3QCQA 4U45A 4FKSA 5GZAA 2BHEA 2W1IA 4QMVA 3MVLA 4FZDB 2W0JA 2ITZA 4AT4A 2Q0BA 4JI9A 4WG4A 1YWVA 2A2AA 3GOKA 2EXCX 4UMTA 3Q04A 3IG7A 2CDZA 5D41A 3F66A 1M2RA 3MIYA 4HNFA 3T9IA 5IISA 2ITPA 5D12A 5AP1A 3W33A 3KN5A 4EZ5A 4LRJA 5KKRB 4NT4A 5CSHA 4OLIA 5M55A 5AP6A 5DT4A 2OGVA 3D83A 2GNFA 4BCIA 3HV4A 2HW7A 2HCKA 3FI3A 3K2LA 3WZEA 3IO7A 3ODZX 4TN6A 5CAOA 3KXHA 3JUHA 4IANA 4CSVA 5M56A 1UNLA 3HRBA 3O8TA 1JSTA 2RFDA 1JOWB 4PPAA 3WILA 4MQ2A 5GZ8A 4LL5A 4NFMA 5HZNA 4S30A 4QTEA 4YSJA 3EL8A 5DG5A 3AGLA 3W55A 4E4NA 2VX0A 2BZIB 4PMPA 4JG6A 3L8PA 4JDHA 2WQOA 4MXCA 2QO2A 4DEGA 3LCSA 4R7HA 2O65A 2OICA 1W98A 2W5AA 2WQNA 4B6LA 4WHZA 4YJRA 5HQ0A 3FC2A 2ZVAA 3KRWA 3P78A 4ZY5A 4GEOA 1A9UA 3RKBA 3PVGA 3Q6WA 2G01A 2VN9A 2BHHA 1VJYA 2UZTA 3DKCA 3OUNB 4L68A 4WO5A 1ZZLA 1H24A 3H0YA 4C4JA 4FTQA 5EYDA 1OL2A 3RGFA 4XHKB 1WMKA 1RE8A 5BPYA 1URCA 1AQ1A 2VTLA 4HGTA 4H3PA 2C5YA 3R9HA 4N6ZA 3U51A 4FTNA 5AP4A 3TKUA 4YJPA 1A06A 4BTKA 4I6QA 1XH6A 1XJDA 3LZBA 3IDBA 1REKA 5HLNA 3FZSA 4AXAA 4XV9A 2H8HA 2X6EA 1H01A 4L7FA 2HAKA 2JKOA 3LFSA 2XNNA 4IBMA 4IVCA 5DPVA 5FM3A 3JPVA 4JBQA 5D10A 3UQCA 2YJSA 4ENXA 2IVVA 3D2KA 4QPMA 4IB5A 2CHLA 4AN3A 3O23A 2F49A 2W05A 4XV3A 2YIYA 3A2CA 5DT3A 3HMOA 5EM6A 3E8EA 5CVHA 3UC3A 1OPKA 2Z7RA 3V5PA 3F3WA 4F6UA 5CI6A 3KRJA 4W9XA 2YM3A 5H2UA 3R7UA 4E8AA 4KABA 3O8PA 2I0VA 3AT2A 4EH9A 5EDPA 4YC3A 4IWPA 3FMLA 3REPA 3TV7A 4IC7A 3KXMA 3GENA 4PL3A 4ID7A 4C36A 5JFSA 1PXNA 5LCJA 2YDIA 5LARA 4FKVA 3GBZA 4DFYA 3Q2MA 3OZ6A 5E7RA 5HO8A 1PJKA 2VWVA 1JKTA 5CEKA 3DK3A 1KE6A 1SNXA 2FSLX 3GI3A 4W4WA 4QYFA 5E8VA 4YTIA 1OKVA 1UU9A 4AGDA 5H8EA 3VW8A 2YHVA 2W4KA 2X0PA 5F20A 2B54A 4FV7A 4G3GA 4M84A 4TWCA 3VO3A 3PVWA 5EOBA 4D5HA 1HCLA 1ZMUA 4QRCA 4BKJA 4Q9ZA 5M51A 4ALVA 3B8RA 4MWHA 1PF8A 1Y8GA 4FNZA 4FT7A 4W8EA 5J95A 5TKDA 1PMNA 2XJ2A 4KD1A 3DY7A 3NAXA 4MNFA 4GIIA 3QD2B 4D9UA 3LHJA 4F7NA 3FYKX 4RA5A 4UMQA 2GNJA 5JFXA 5JRSA 2C30A 4FC0A 3LJ2A 4RRVA 3G6HA 2V0DA 4PP7A 4RLLA 4I4FA 4YTCA 5ITAA 4AZSA 5JZNA 2R9SA 5L8KA 3BWFA 3FSFA 5HG7A 4J53A 5BX0A 5M53A 1DS5A 4OBQA 3RWQA 5DVRA 4X3FB 4BI0A 1SMHA 4MBJA 2XIXA 3QLGA 3U4WA 3MJ1A 1YHWA 3G90X 4FKTA 5I4NA 4FTOA 4ZY4A 3RWPA 3TZMA 2R3QA 3GQIA 4RQKA 2C6DA 3GQLA 4BGHA 4DFLA 3Q4ZA 4HVSA 1UKHA 4C3RA 5CU3A 2FA2A 5M4UA 1KE9A 4FNYA 2CSNA 2PVRA 3F5XA 4JAIA 4NH1A 2QO9A 4JIAA 4PY1A 3R7VA 1KE7A 1CTPE 2C69A 3FMHA 1FOTA 2VO6A 4G6LA 4MVFA 4I5MA 3SXFA 3R9NA 2RIOA 3EOCA 4RC2A 3RCJA 3FAAA 4O22A 1DM2A 2GNGA 5BVEA 3RNYA 4D2SA 2VTIA 4GG7A 4MXYA 4OBOA 5L8JA 3UE4A 4O1PA 1LR4A 3TV6A 4GVJA 1O6LA 2X1NA 4JQEA 3M1SA 4L52A 4Q5EA 4A4LA 2CGWA 4BIBA 5A9UA 2PE1A 3ANQA 2EXMA 5LMAA 2OJFE 5LQFA 3PPZA 3Q4UA 3KRXA 3CC6A 3BCEA 4S32A 5EYMA 4CKIA 2XK6A 3LM0A 4TW9A 4BDIA 3EQPA 4NSTA 3QTIA 4I0SA 2OIBA 3UIXA 2V7OA 4PX6A 3WOWA 5HKMA 3PFQA 5E1SA 4ZZNA 3I5NA 4JR3A 2ITUA 2OJIA 2VNYA 4HVIA 2ZM4A 3R1YA 3ORNA 4P7EA 3EQBA 3OT8A 2W5HA 1P4FA 4KAOA 5BVFA 2R0UA 3A7HA 3VBTA 4FOCA 4EK4A 2VU3A 3BYUA 2BRBA 2RG5A 4I24A 4D55A 3U6HA 4AE9A 4JAJA 3VUDA 4DGNA 5JN2A 1TKIA 4Z9LA 5L4QA 1FINA 1OKYA 1NXKA 2FGIA 3CY3A 4L9IA 4KWPA 3EN6A 1SNUA 1DAYA 1JKSA 4UB7A 4MNEA 4PTEA 3D5VA 2FVDA 3K5VA 4KIOA 5DLSA 4G6OA 2UW5A 4AZTA 4AE6A 5HOAA 2QR7A 3ZHPC 3CTJA 4R5SA 3ZO4A 1R1WA 4RIWA 3NYNA 2W1HA 4AWIA 2BRMA 3F6XA 2JFLA 5J9ZA 4O0WA 2F7EE 3QRKA 5EW9A 2QG5A 3MA6A 3WE4A 2KTYA 4PQNA 2CCIA 4KIKB 4U3ZA 4ZSAA 3HX4A 4FL3A 1O9UA 3D4QA 4X21A 3EZVA 3DJ6A 4ACGA 3C4ZA 4W8DA 3QZGA 2NPQA 3ZFXA 4RG0A 4YJVA 2AYPA 2RFNA 3E7OA 4QMLA 4D5KA 4OT5A 2WAJA 4JOAA 4BGGA 5IMXA 2EUFB 4ANQA 1U5QA 2HZNA 1CDKA 3NUYA 2OW3A 3PIXA 5EYKA 2W9FB 1LP4A 4LGDA 5CASA 1YOMA 2CN8A 3IDCA 4G16A 5AJQA 2AQXA 4F7SA 3ZDUA 4X2FA 3Q32A 2BDWA 1ZWSA 2C5OA 2E9PA 4ACDA 3LE6A 3C7QA 4B9DA 5C26A 2WOUA 3MTFA 5CNNA 4F70A 3WZJA 2PVHA 1K9AA 3LMGA 3LXNA 4IADA 4RX8A 4UV0A 4F4PA 4IM2A 4F9YA 2BVAA 2ZM3A 3DLSA 3G2FA 4KBAA 5CSWA 2OXXA 2E9NA 4ERWA 3ORMA 3TNQB 2PVLA 4HYHA 4YGAA 3QQUA 3HV6A 3JS2A 1U59A 3RAWA 3HV7A 3PE2A 2FUMA 4FTLA 5HTBA 5EK7A 3C9WA 4EK6A 3MY1A 1WVYA 4YBJA 5AV0A 4XH6A 3EWHA 5AP7A 2CGVA 3CTQA 4ANOA 1CMKE 2BZHB 2QOOA 1JVPP 4BCPA 5L2QA 3ZUUA 5HVKA 2OXYA 2R5TA 3DCVA 3FMEA 2XF0A 4PV0A 4UBAA 3BZ3A 4ANMA 3QCYA 1QMZA 3GU6A 4FNWA 3MY0A 5D11A 3IW7A 4NM5A 4BYJA 3MWUA 1IRKA 1ZOGA 1F3MC 5AR2A 1HOWA 2OIQA 4JDIA 5FBOA 5DT0A 4C4EA 3UPZA 1WVWA 4PF4A 4DINA 5K4JA 4YNEA 4D4RA 3CTHA 4MX9A 3KU2A 1GZOA 4WIHA 5ANEA 4GFMA 1T45A 4CYIA 3COMA 4HOKA 3A7FA 3EQGA 4RIXA 4NTTA 1UKIA 3GNIB 4FUXA 3VC4A 2HYYA 2ONLA 4N0SA 4PDPA 4BB4A 5IA3A 3DBFA 4RFYA 4LL0A 5JEBA 3BLRA 3KFAA 4YHJA 3W16A 2VGPA 4RIYA 4XLVA 3GT8A 2VNWA 3O7LB 1NVQA 4GW8A 3KL8A 4LYNA 2WZJA 3GOPA 4MK0A 2ETMA 4BDBA 3MPAA 1U4DA 3A8WA 2LAVA 2BPMA 5KE0A 4IJPA 4DN5A 3OG7A 2BZKB 2GHMA 2IVUA 4K18A 4FV4A 4ZTRA 4EH3A 4M0ZA 3ZU7A 1WVXA 4AOTA 5HBJA 3H10A 3MSSA 3O50A 3ZRLA 4M12A 3COKA 5DOSA 1SVHA 3FLZA 4MD9E 4YC6A 1R0EA 3M2WA 4I92A 3ZXTA 2C3LA 3DU8A 3Q5ZA 2GSFA 3DDQA 4O0TA 4O27B 4DEBA 3NCGA 2JDRA 4FIHA 4EUUA 2P4IA 5T68A 4AW5A 2BIYA 2VTRA 4L45A 5HG5A 3WF8A 2PHKA 2Y8OA 3QZFA 3V8TA 3HVCA 1X8BA 3B2WA 2X2LA 4LFIA 5I9XA 3DTWA 4ZS0A 1SZMA 5DRBA 3WYXA 3PY1A 2XM8A 3ORLA 2QOHA 3RK7A 4D4SA 1W83A 4D2PA 4II5A 3ZBFA 4PL4A 2WOTA 3GGFA 5L6PA 3OY1A 4Z55A 4U79A 4B8MA 3UC4A 1BUHA 5C03A 4C7TA 1XH9A 2QOKA 4EQMA 4IEBA 5FBNC 4AW2A 3VUTA 3UP2A 3FMDA 3C4FA 3MA3A 4K8AA 2IZTA 2O63A 5JQ8A 4FG7A 4FEQA 4IX3A 4C58A 1YRPA 4HCVA 2XVDA 3KRLA 3OCBA 4JNWA 2HW6A 3CE3A 4CEGA 4EZ7A 4LGGA 2WTKB 3CD3A 3DTCA 3UJGA 3F61A 3LQ8A 5M57A 4TWPA 3TTIA 3W10A 3ACJA 4JXFA 5EI6A 5KBQA 4KIPA 1W84A 3HDMA 2ZMCA 3RZBA 1UU3A 2B9FA 2HELA 4FV0A 3FBVA 3GC9A 4DH3A 2J0LA 4KS8A 3MN3A 4WT6A 3VJOA 3AG9A 4MHAA 3PZHA 4M67A 3D7TA 4I3ZA 3EQCA 2X0OA 5TE0A 3Q9YA 3VNTA 5JMSA 5CU0A 5J9YA 3UPXA 2RSVA 2QVSE 3FHIA 4EHGA 1XBBA 2B9JA 4USFA 4DH7A 3PTGA 2W96B 4LMNA 3R01A 3KY2A 4XYFA 3BE9A 5AP3A 2C1AA 2RFEA 5FXQA 5E8WA 1BKXA 3LAUA 3QWKA 3PSDA 4TYIA 4WKQA 1WBOA 1RDQE 4FK3A 4L67A 3CJGA 4RPVA 3UOLA 4A9UA 3ORZA 1OM1A 3F3VA 4CZUA 4APPA 4EQCA 2VX1A 1Y91A 4WBOA 4IVBA 4FYOA 1UU8A 2A27A 3RBWA 4YP8A 4ASEA 1MP8A 3O8UA 5CT7A 1GZKA 2REIA 4V01A 3QFVA 3R9DA 4QTDA 3SA0A 4RJ6A 5L6OA 3HKOA 3BELA 5HO6A 3Q4TA 1GZNA 5DFPA 4A4XA 3PJ8A 4C37A 4UWCA 2BFXA 2NP8A 5JRQA 1H08A 5KX8A 4I4EA 5ANDA 3CQWA 2ITQA 3MFUA 3P7CA 4YZDA 3PRIA 5IUIA 1Y6BA 4G3EA 5HE2A 3BU6A 4FSMA 4MTAA 4ITJA 4Z3VA 3R7GA 4PPCA 5E8XA 4FL2A 3DV3A 4CFWA 3U6JA 3SAYA 2OJGA 3TNIA 3VBQA 4BDAA 5A14A 2X9EA 3LJ0A 4OTQA 5I9ZA 3QX2A 3MS9A 2OU7A 4TYGA 4ANBA 3PWDA 4U80A 4C59A 3ENMA 3EKKA 4TWOA 3F88A 4WSYA 4JG7A 3QGYA 5J5TA 5AUXA 5BUEA 4NZWB 3PJ1A 2RG6A 4UYAA 4V05A 2GNLA 4C3FA 5AR5A 2BFYA 4AU8A 4BCMA 3VBYA 2QODA 2A1AB 3CS9A 5JGDA 2B53A 5L2WA 4I5CA 4M69B 5AP0A 3N9XA 3I6WA 3Q3BA 1YW2A 3AMBA 1M52A 3OBGA 1RJBA 4AUAA 2J6MA 4F08A 4MCVA 2XNMA 3BIZA 2YM8A 3F2AA 3HV5A 1ZYJA 3MH0A 1GIJA 4FT0A 4FKWA 3KA0A 4TYHB 3R04A 3ZSGA 5LVOA 3F2NA 5EH0A 2ZAZA 3ZO3A 2J2IB 2UVXA 3FL4A 4C4GA 5KBRA 4IAIA 3I4BA 3L8XA 1S9JA 4X2GA 2ACXA 4FICA 2YCQA 4F9AA 1NY3A 3BHYA 2BDFA 2ITOA 3PA4A 4FUYA 3Q4CA 4O1OA 4YO4A 4YU2A 4ALUA 4UMRA 4FX3A 4XOYA 4AFJA 5DE2A 3S4QA 3D0EA 2R3LA 5C27A 4ENYA 4S34A 2G15A 4U41A 5DIAA 5HVYA 4C4HA 5GJGA 1U5RA 4AFEA 2PZPA 4AS0A 4F6WA 2IF8A 1Q4LA 2QURA 2UW0A 2ZDUA 2W1EA 2XUUA 2XA4A 3DQWA 4L3LA 2ZJWA 5CY3A 4C0TA 3LCOA 3W2QA 1KV2A 4ZTMA 5C01A 4BL1A 5TT7A 2ITWA 3ZLWA 4XS2A 5E8ZA 3SQQA 2UW6A 3DQXA 1B39A 3EYHA 1W7HA 1XBAA 2XRWA 3MGYA 1J91A 2GFCA 1OUYA 4EH8A 4QMZA 3KXZA 2W1ZA 4O0VA 4JIKA 1YDRE 5HGIA 1WBPA 2JIUA 1W2DA 4KKHA 3U9CA 4B8LA 1WZYA 2BAJA 5HX8A 4RLKA 4ZLZA 3HUBA 3SRVB 2OKRA 1BL6A 3V6SA 4EZ3A 4BBMA 2VTMA 3S95A 4CXAA 3NUUA 4YZBA 3VAPA 4A4OA 4FR4A 2CLXA 4K2RA 2VTPA 1STCE 2UW7A 1PYEA 2R3NA 2XNBA 3KF7A 5CSXA 2J0IA 3DBQA 4BZNA 1WAKA 1W2FA 2Q0NA 4HYIA 3PY3A 4FIFA 2UZOA 2F7XE 4YJOA 1TQIA 5DMZA 2X8IA 2YM4A 3C0HA 3GU7A 1V1KA 3RK9A 4D1ZA 5DEWA 4BVUA 4ZTNA 2YAAA 3ZOSA 4FV8A 5EM7A 4G17A 3LFFA 3P0MA 3H4JA 3ORPA 4KRDA 3EB0A 4ZTLA 4QTBA 4QQ5A 4FKGA 3LQ5A 4QMOA 4EHEA 4BHNA 4CV8A 4FVQA 4QMMA 3U9NA 4HCUA 3VF8A 4CT1A 2W4OA 4D2TA 4DCEA 3CBLA 3CR0A 2ITVA 4GYGA 2Y4IC 4WUAA 5DWRA 3RCDA 4L3PA 2XMYA 3QC9A 4F0GA 3SXRA 4BDCA 3UO4A 4RWLA 2PL0A 4ZK5A 4YMJA 4H39A 1ZOHA 4U9AA 5IF1A 3FY0A 5CQUA 2WMRA 3E7VA 2YCFA 4IXPA 4U5JA 5A4CA 3PPJA 2OJ9A 3Q5IA 2YAKA 4EOQA 5CXZA 2J4ZA 2PVFA 3WZDA 3QKKA 3B2TA 2QCSA 2I0YA 3I0QA 3DJ5A 4KSQA 4YO6A 4DHFA 3ORTA 5JQ5A 4LOOA 2R7IA 3VN9A 4QP4A 1H4LA 4MD8E 4MBLA 3QD4A 3Q53A 2RL5A 4GIHA 3B8QA 1ZXEA 4ZSEA 4DYMA 3IW6A 4N4SA 5E8TA 5IG1A 2C5VA 2WTCA 2YM6A 4GG5A 4LUDA 2JLDA 4ZLOA 4MNEB 4D2WA 1NVSA 4GUBA 4FTAA 2YCSA 5D1JA 1H8FA 4I93A 1Q3DA 4QP9A 2XIRA 3VS4A 3CY2A 5TF9A 2IZSA 3A7JA 2P0CA 1PW2A 3PWYA 2BUJA 4RIWB 1UWHA 4JQ7A 4O2PA 1WFCA 3AC5A 4GFOA 4C61A 3RPYA 3WIKA 5HG8A 4CZTA 1UWJA 2BRHA 1H28A 1QPEA 3DNEA 1JWHA 3EN4A 1QPJA 4O21A 5AR3A 2J9MA 3EQFA 1M2PA 1J3HA 3CLYA 3MW1A 3F5GA 3R7EA 2JBOA 3OFMA 1G5SA 2E9OA 4XG7A 2ZMDA 3F3TA 4I21A 1OB3A 4BHZA 4O4DA 3ORKA 3M11A 2JDTA 4EQUA 3QALE 3UOJA 3P86A 1KV1A 4GVAA 4YJQA 4EHVA 1I09A 3BI6A 4IVDA 4XEYA 2BDJA 2BIKB 1S9IA 5LMBA 2XB7A 3I81A 5HCYA 3IOKA 3PYYA 4YLJA 1YI6A 4A06A 4D1XA 2WQEA 4Y72A 3OOMA 1UU7A 4P5QA 2Y6MA 1NVRA 3A7GA 1E9HA 5IDNA 2C3IB 1LPUA 3BYMA 3P5KA 3UBDA 3OXTA 4HPUE 3ANRA 3TNWA 5D9HA 2PMNX 3A8XA 2XNPA 2ONLC 4BCJA 3ORXA 2EB3A 2XK8A 5BUJA 3QU0A 3RM7A 3MB6A 3CJFA 4BCOA 2WTJA 5H9BA 2JC6A 5HORA 5LMKA 3QQFA 1QPCA 2JFMA 4J8MA 2KULA 4RFZA 3UDBA 3FLYA 2WPAA 5HO7A 4AP7A 4J7BA 3KMMA 2PMIA 3BGQA 3FMJA 4ZTQA 4BDFA 3HRCA 4HVDA 2LGCA 3PZEA 4M14A 3GC7A 5CEOA 4QP6A 3MTLA 4LV8A 4UXQA 4S31A 3G0EA 2FH9A 3EJ1A 1GIHA 4QOXA 4GT5A 4TRLA 5ETFA 5T3QA 5FDXA 3ZXZA 1PMVA 1OL7A 1GOLA 2GTMA 4JBOA 1APME 4IB1A 4KS7A 4KINA 3LFNA 2YABA 2YISA 4GJ3A 4NTSA 4A9TA 4F0IA 1ZARA 4O4BB 3E5AA 4YZCA 4FI1A 3ORIA 4GCJA 4ANSA 1KE8A 4RVMA 2Y6OA 3TWJA 2VTNA 5B2KA 3WZKA 3S1HA 1KOAA 3VULA 4ITIA 3C51A 4KBKA 4YHFA 3VJNA 2SRCA 4KA3A 4RIXB 3VBVA 3ZEWA 5A54A 5DHJA 1E1VA 4DEIA 4UZDA 3ZSHA 1OPLA 2G2IA 3LXPA 3P7AA 5IKWA 4BCQA 4DEHA 2IVSA 5E8SA 4RVLA 2CN5A 4AA5A 2A98A 2HXQA 5FDPA 5ANJA 2UZUE 4RIYB 4XV1A 3FZTA 4S33A 2VD5A 2J0KA 2QOCA 3HA6A 3OD6X 3RK5A 5HD4A 4IZ7A 2QKWB 1YOLA 3ITZA 4PTCA 5A46A 3VQUA 3TZ8A 4Z16A 3HP5A 1REJA 3RPVA 3HMMA 3OTVA 4IX4A 3FPMA 4CLIA 4NEUA 4EBWA 2UUEA 1I44A 3UGCA 1IG1A 2UZDA 3EFJA 3NAYA 4O38A 2B7AA 3BLHA 2X4FA 5JGAA 2OO8X 3S00A 2AC5A 5FLFA 1YHVA 1IA8A 3F3ZA 3QD0A 4OTFA 4QP1A 4XG8A 4C33A 5FEQA 1QPDA 4BKZA 4RZVA 2IW8A 4L00A 3SW7A 1BL7A 4OTPA 4BWKA 4CFUA 1XO2B 4QP7A 1ZMVA 2RFSA 1BI7A 1YWNA 4IFCA 3ZBXA 3GFEA 4LM5A 1JKKA 1SYKA 2ITYA 3QRJA 4HZRA 4OT6A 2IO6A 3RHXA 3T9TA 4E26A 5A4LA 2PWLA 2HY0A 4NIFA 5CEMA 3EL7A 1Y57A 3LJ1A 5ACKA 2PZIA 4EI4A 4EYMA 4TY1A 4D28A 3F7ZA 4C2VA 4YJTA 4IAKA 1E1XA 5DNRA 3NUPA 3MFRA 4OTWA 5H3QA 4XG3A 3TZ9A 3DAEA 4RVKA 3FXXA 4H1MA 1FVRA 3E8CA 3NIEA 3FZPA 4O0UA 3E64A 4RMZA 2C6EA 3PA3A 3H9OA 3RALA 3U6IA 4PDOA 3HUCA 5AUUA 1JNKA 4U97A 3FKLA 3EHAA 4FSWA 4FV2A 3U87A 3ZO2A 5IDPA 4F0FA 3L9LA 4FYNA 2BCJA 4IM3A 4AT3A 5IA1A 3PIYA 3POOA 2BMCA 2YCRA 3RI1A 2VWWA 3HP2A 5AM6A 5CAUA 4FKJA 3SD0A 1QL6A 4YLLA 4E93A 3OVVA 5CZHA 1XH5A 1YXTA 5K4IA 3BHUA 2X2KA 1O6KA 3L9MA 3OW4A 4O0SA 4CVAA 2HOGA 4K6ZA 5CNOA 4KB8A 2C3JA 2Z7LA 1FGIA 2ETKA 2OH4A 4AG8A 4NM0A 4NU1A 4DGGA 4EH6A 4KNBA 4D0XA 2GTNA 2XNEA 3EN7A 2H9VA 2YM5A 3GB2A 3NUSA 3BGPA 4K11A 4DTKA 2AC3A 1RQQA 2DYLA 1H00A 2WNTA 4QNYA 3TACA 2JKMA 4E6CA 2ZM1A 2Y9QA 5H8BA 3DOGA 3BEGA 1Q24A 3DS6A 2XBJA 1B38A 3KK9A 5EKNA 4UZHA 2X2MA 5CEIA 2VAGA 2G2HA 5I9YA 5J1WA 4PDSA 4EORA 2WIPA 1M7QA 4G3CA 3P08A 4N6YA 5DBXA 4IQ6A 3RPRA 4BBFA 4GSBA 5ICPA 5DR2A 2Y7JA 5EKOA 4BCNA 3KULB 2OZOA 2NRUA 4QMQA 4B99A 3VHEA 2PVKA 1Q5KA 3CGFA 3NWWA 4IFGA 3UP7A 5BYZA 3DBCA 1O6YA 3EN9A 5HBHA 2I0HA 3NEWA 2JAMA 5B7VA 2GCDA 4JJRA 3UYSA 1OL1A 2OF2A 2WMXA 1J1CA 3ERKA 4L53A 4TPTA 1BX6A 2W1GA 2Z2WA 5FM2A 2WMAA 3PJ2A 3EQHA 2C5XA 2C6KA 4HPTE 4E7WA 4AT5A 1YXUA 1U54B 2XRUA 4W4XA 3SDJA 4Q5HA 2EVAA 4XV2A 3VIDA 4JS8A 1LEZA 1MQBA 5E8YA 3DPKA 3R1QA 4A9RA 3QUPA 3DKFA 3D94A 5J79A 3UNKA 3T3UA 2C6LA 3W18A 3W2PA 5L3AA 4ZSJA 1ZAOA 3MJ2A 4S2ZA 2PE0A 5DEYA 3UQGA 5K5XA 4U40A 2PY3A 4W9WA 4RVTA 2ITTA 1SVGA 2QI8A 4EKLA 3Q6UA 3JVRA 5I9UA 4FKPA 4GT4A 5BVOA 4AQCA 5HBEA 3OS3A 1WCCA 3Q9ZA 1MRVA 5HNBA 3W1FA 3DJ7A 5JZJA 5M4FA 4NK9A 5EI8A 3G9NA 2WQMA 3NYVA 4X0MA 5HCZA 1ZYCA 3N51A 4FBXA 2OI4X 5EM8A 3UOHA 5AA8A 2ETRA 3PSBA 2CMWA 4J97A 4BCKA 5EHLA 3FJQE 5HIBA 4IVAA 2QKRA 4G34A 4HGLA 4NKSA 3TCPA 5CEPA 2GS7A 1JQHA 5KZ0A 3SC1A 5IEXA 2O2UA 4OTIA 4FSQA 1UNHA 4P2KA 1VEBA 1W0XC 4ZXTA 3WF9A 4IH8A 2A0CX 5IA5A 3W8QA 5CF6A 4YC8A 5AIKA 3TUCA 3UMWA 5IMEA 2R64A 4WNKA 3COHA 4EWQA 3IECA 5I5ZA 4PRJA 4EWHA 3LCDA 1YVJA 3NLBA 4E6DA 4BDJA 3QQGA 1H26A 5AV2A 1H07A 4CFXA 3DAKA 2XKCA 3FQSA 4YNOA 3KN6A 3T8OA 3LIJA 1Q99A 4D2VA 3VHKA 3PXKA 4LOPA 4UN0C 4BWPA 1Q97A 4FNXA 5KMJA 5HD7A 1XH4A 2R3RA 3VBXA 1VR2A 5L2SA 2X0QA 3ZEPA 1LEWA 3FKNA 4NW6A 2J50A 3RINA 5J5SA 1Z5MA 1SM2A 2IJMA 3ALOA 2VO0A 4IZYA 4IAZA 4YUQA 1JLUE 3FQHA 5E1EA 5AADA 4EYJA 2DS1A 1T46A 5CENA 2UZLA 3MVHA 1B6CB 3AXWA 4GU6A 4XMOA 4J71A 3C4EA 5G6VA 4J95A 4DH5A 2QLQA 5J7BA 1YOJA 2J5FA 5ANGA 3NGAA 5HIEA 3CGOA 4GJ2A 4BWXA 5AWMA 4M97A 2V7AA 3BYSA 4RZWA 4JLCA 3MDYA 3FDNA 5DI1A 4ZLYA 1RW8A 2XK9A 3L1SA 4E6AA 3IGGA 2HZ0A 1XR1A 2ZB0A 3BQCA 1H27A 4O96A 4L3JA 3ZFYA 4CQEA 3V01A 2C3KA 4AOJA 1KWPA 1W82A 3MI9A 3EQDA 4H58A 4IWDA 4CQGA 3ZZEA 5AX9A 2F7ZE 4BCFA 3GCQA 3DDPA 3PJCA 2WMBA 4QMPA 2W99B 1JBPE 2WTWA 3AMYA 4O2ZA 4UMUA 4RSSA 5DR6A 3QHRA 2OF4A 3OCTA 4Q2AA 5J7HA 4OAUC 4DGLC 2UZVA 4MWIA 5F4NA 4L7SA 4FV5A 4FOBA 1PXOA 5GHVA 4E5WA 1FGKA 4V0GA 1IASA 2HXLA 4X3FA 1TVOA 4QQCA 3V5QA 2GPHA 4U42A 4TTHB 4C2WA 3R6XA 3FL5A