4BFMA

The crystal structure of mouse pk38
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
313
Chain Sequence
KDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKCGSLAYAAPELIQGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of the Kinase Domain and Uba Domain of Mpk38 Suggest the Activation Mechanism for Kinase Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
total genus 95
structure length 313
sequence length 330
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bfmA00
2XUUA 4FSWA 5KHWA 4BBEA 3FLQA 4G5PA 1XH5A 4XG3A 3R01A 3CPBA 3NCZA 4U43A 4UMRA 5AAFA 4S34A 1YXUA 4GJ3A 5KZ0A 4EQUA 4USFA 4D5KA 4HVSA 5LWMA 2HENA 5DIAA 3RNIA 4QMPA 4YC3A 4BDJA 4YHTA 4BGQA 4E6AA 1K9AA 4AN3A 3DJ7A 1VZOA 2OF4A 2QO7A 3ORLA 3A8WA 4RSSA 5FGKA 3FYKX 3LCSA 1YXVA 2X7FA 2YJSA 2ZV7A 3GC7A 3KULB 3TV6A 4N70A 1PJKA 3HKOA 3T8OA 3DY7A 4H58A 3ZDUA 4KSPA 3D4QA 5CXZA 1CSNA 2QONA 1OKVA 4X21A 4L67A 3VUGA 2JKQA 2CMWA 5EHLA 3HGKA 2ITUA 2PVRA 3C5UA 3ZC6A 5HD7A 4UMQA 4UY9A 3LFBA 3RHKA 4W9XA 3FJQE 3DBCA 4ACMA 3ZUUA 4MD8E 1ZOHA 3G33A 5AR3A 3MFSA 4FKVA 4ACDA 3GC9A 2J0IA 1OUYA 3PYYA 4XG8A 4QP3A 5F95A 2VX0A 2O65A 4F6WA 2GNHA 5CEQA 3QXPA 4RJ5A 3COIA 3VJOA 1MRUA 3JXWA 4WNOA 3HP5A 3P1AA 1Q8YA 3W10A 1FOTA 4MF0A 5AM7A 4ANQA 3R2BA 3UVQA 3C4FA 3Q04A 4NZWB 3NX8A 4QMTA 5AX3A 2R3QA 1U54B 5BUIA 3ZZWA 4PF4A 2ETKA 4CT2A 3CTQA 2C69A 3PIXA 3IW7A 1BLXA 1OB3A 2UVYA 2UZNA 3PY0A 4G17A 4G9CA 5AA9A 1ZWSA 2C6EA 4HGEA 4X3FA 3ZU7A 1OITA 2RIOA 4EH2A 2CJMA 2ITPA 4DH1A 4QD6A 4AGWA 4F9WA 1R1WA 4B99A 4DC2A 1F0QA 3ZM4A 5C01A 5J9YA 2I6LA 4R5YA 4AOIA 4DFLA 3RZBA 2C6KA 2YCSA 2E9UA 3LW0A 4EOSA 5D11A 1RDQE 5CYIA 1KV2A 4MVFA 3C4CA 4GH2A 4EK4A 4U97A 3OOMA 2VTQA 4ZP5A 2BPMA 1U54A 4KD1A 3UOLA 3E8CA 3MPMA 4LQMA 4RIYA 1PW2A 5AP0A 3RI1A 2A4LA 3FMLA 4JG7A 3WE8A 3MFUA 4MBLA 1QPJA 2YAAA 5CXHA 4AA5A 4A9RA 4WNPA 4C4JA 3RWPA 4ERWA 5LVMA 1LPUA 5J1WA 4G34A 3W2SA 2ZM1A 4GT5A 2JDVA 2IZRA 4RWKA 4BCFA 3DFAA 2OH0E 2XIZA 4O21A 4BDBA 4NIFA 1U5RA 1GZNA 3OY1A 3ZONA 5GHVA 5CAUA 3MS9A 4YU2A 5GNKA 3TNIA 4BWKA 3MY0A 4FZFB 5KMMA 4M66A 4NW6A 4MD9E 4ZTQA 4YJTA 3R7VA 4C38A 2OWBA 2V62A 3PJCA 4KIQA 4DITA 2WMWA 4R3PA 3LFAA 4MAOA 3MN3A 3DV3A 2RL5A 3C13A 3E64A 4L3JA 4U81A 3RHXA 3Q5ZA 4XX9A 1AQ1A 5CVGA 2UZUE 2VTOA 5DE2A 2G2IA 3VS7A 4G3FA 4P90A 5HU3A 3OWKA 4E8AA 2G2FA 4FKIA 4IVDA 5M56A 4I23A 3QTRA 4PL3A 4IWPA 4B8MA 4ZY4A 4RVMA 3W8LA 5M4FA 1E1VA 5K4IA 3DBQA 1SNXA 4C7TA 4W9WA 2WMUA 4QMSA 5T3QA 4H3BA 3CR0A 3M1SA 3OC1A 2PZIA 4ZS0A 4CFUA 5EI2A 2R9SA 3KA0A 5DOSA 5EDQA 2YDJA 2I0EA 1DAWA 1MRVA 3BLHA 4AA4A 2GS7A 2F7EE 2BRHA 2Y8OA 3A8XA 4L00A 4F6SA 4NJ3A 3AD4A 3QQHA 3TWJA 4BTFA 2GU8A 2Y9QA 4ASDA 2YISA 3R8UA 4C35A 4RG0A 4I0RA 5JGBA 4J7BA 2XKFA 5CEOA 2Z8CA 1Z9XA 4KAOA 2WTVA 4RZVA 3R71A 3S2PA 5E91A 5LMBA 4CYIA 3UBDA 2PE0A 4U0IA 5C8KA 3BYSA 3NUXA 3S00A 4LOQA 2XS0A 4O2ZA 5J9LA 4KS8A 2PMOX 2R3MA 1OM1A 4Q5EA 4YJOA 3BE2A 4I20A 3OHTA 3FI3A 3GOKA 3FMNA 2BIYA 2RGPA 3WZUA 2Z7SA 5EYMA 4KB8A 4U41A 2R3FA 3SXSA 3UP2A 2FSMX 4K1BA 3AT3A 2AC3A 5TF9A 2VNYA 2H8HA 2YN8A 4OBPA 4WRGA 5F94A 3COKA 2VO7A 4PDOA 4FV5A 5K5XA 3BU6A 3TZ9A 5AUVA 4EZ5A 4XH6A 4ZLYA 3KXHA 4OTFA 3W2CA 5CTPA 4U9AA 5E8VA 2CGXA 4F0FA 2C6MA 5CEPA 3ORXA 3HDNA 2H34A 5CQWA 2WMBA 3P4KA 3QC9A 3F61A 3SW4A 5BUEA 4I0SA 4AW1A 1K3AA 3UNZA 4TWNA 3HUCA 4V01A 3W1FA 5HLWA 1UKIA 1Y91A 4W4VA 4YJSA 3KMMA 5AX9A 5HE0A 3QTQA 3POZA 1NVSA 5IH4A 2WELA 4QT1A 4FSMA 3EB0A 4JL9A 2EB2A 2BUJA 4H1JA 5F1ZA 2IVSA 3LHJA 4C4FA 4CYJA 4G31A 4EH6A 5I9ZA 4UXQA 4ASZA 3OBGA 2I0HA 4OTQA 1ZY5A 2J7TA 2VTMA 4M68A 4RLLA 4RPVA 4RZWA 4AUAA 4CLIA 1CTPE 4DN5A 2O3PA 4IZYA 5FEQA 4WBBB 1FPUA 4HNIA 2VAGA 3UMWA 3G9LX 2WMSA 1XKKA 2P4IA 3BHUA 1OPKA 4FGBA 4GEOA 4E6QA 4BWXA 2W1IA 2ITNA 5TO8A 3O51A 4X6QC 3PJ2A 4PMPA 2QR8A 3D14A 3MH3A 5E92A 4Z9LA 3F3TA 5H8BA 2JDOA 2JIVA 2CGVA 5D10A 4EOKA 3WI6A 4YNOA 3VO3A 2JAMA 3GENA 3NEWA 4OR5A 4F70A 2XKEA 2VWBA 2VX1A 2XM9A 5AP7A 5BYZA 3L8PA 4ALVA 3BGZA 3A7JA 1DI8A 3MSSA 1FINA 4O22A 4XV3A 4BKZA 1SM2A 4FTRA 5ANJA 3OBJA 1JBPE 3LFCA 5BPYA 4QMXA 1P4FA 3QF9A 3V5PA 4IM2A 3HA8A 2IZTA 4F7JA 2UW9A 4I0TA 3PFQA 3V8WA 4PWNA 2R3OA 3QRIA 2XF0A 2YLEA 4QMWA 1URCA 4V0GB 3IS5A 4D2PA 5AR8A 3EOCA 2HWPA 3R8LA 3UDBA 4AU8A 3RAHA 3BV3A 3CS9A 5H8GA 4NTTA 1WBVA 4FI1A 4TY1A 3NUYA 1YXTA 4YGAA 3ZBXA 4RQVA 3A60A 4BI2A 1RE8A 2F2CB 3ZOSA 3KB7A 4EK3A 2VTJA 5G1XA 4QMNA 4FV3A 3ELJA 3F3ZA 2XB7A 2BAQA 4K8AA 3QA8A 2VWXA 3KMWA 3QX4A 4BICA 5HBHA 3QC4A 2BRBA 5HE3A 5LVNA 3EIDA 4JQEA 3PXYA 1XBCA 5ETCA 2LAVA 4I41A 4J53A 2F57A 4B4LA 3PP0A 4F1TA 3OWPA 4CKJA 2YM7A 3LCOA 4QTEA 3BCEA 1ATPE 4RX9A 4QMOA 2HCKA 1M7NA 3GCQA 3QLGA 3R63A 4XG6A 4AT3A 5ACBC 2XMYA 3E63A 3P23A 3RK5A 3QZHA 5K4JA 3OWJA 5BQ0A 3TNQB 3MH0A 5HVJA 4UALA 3VAPA 4BCPA 4AZVA 4FR4A 4XOZA 2WD1A 2IWIA 4IZAA 3ZDIA 4ZEGA 3ENHA 5HIEA 5EK7A 1WVWA 3EKNA 1YQJA 3FPQA 5CU4A 4DCEA 2XK8A 3QFVA 5AIRA 3F7WA 4FT5A 2XNPA 3QTZA 4BGHA 3ACKA 2OW3A 3PVWA 4CKRA 3R21A 5AV4A 5HCYA 5L2QA 4E4LA 5LMKA 3NR9A 3EN5A 4LGHA 1S9IA 2BVAA 4C4HA 1A9UA 2QNJA 2WKMA 3CKWA 5CASA 2GNLA 3BQCA 2PVNA 3RK9A 4IAAA 4ZOGA 4YHJA 1HCKA 3CQWA 4LOPA 4JX7A 3QUDA 5JZJA 3FUPA 4IFGA 4W4XA 3VC4A 3L9NA 4EH7A 4GG7A 3OWLA 4FK3A 4G6NA 4HZRA 4X7QA 2XK6A 3T3UA 3ROCA 3OS3A 4YP8A 4K6ZA 3RP9A 3FBVA 5TE0A 1JSUA 1YW2A 2OFVA 4EWQA 3R7EA 2OZAA 1UKHA 2W4KA 3OCSA 4A9UA 3G6HA 4FL1A 3UQGA 5J5TA 1PXLA 1H1SA 1PMEA 4ZTLA 3FPMA 4F63A 4RIOA 4R3CA 4DG0E 3G51A 4QP2A 2VWVA 5CSWA 3P78A 4YLLA 4APPA 3E3PA 5F20A 4AWIA 4CCBA 1VEBA 1YHSA 3MIAA 2OH4A 4V05A 4C34A 2LGCA 1GIIA 4BYJA 3DA6A 4P2KA 3UVRA 5CAVA 4LRJA 4BDKA 5IA0A 4I5CA 2BZKB 1KSWA 2WTKC 3GGFA 4RA4A 4X0MA 3R7OA 4BYIA 4E4XA 4AXAA 2YAKA 4OTGA 5KHXA 2FO0A 2Y6OA 4A4XA 4FT3A 4FL2A 4KBKA 3AD5A 3D5XA 4PQNA 4TYGA 3IGGA 3F5XA 4B9DA 3AGLA 5FD2A 3LXNA 3QHWA 5AR2A 4HPTE 4P7EA 5A46A 2X2MA 4BCHA 4QP7A 3KF4A 2R3RA 3GU4A 3MB6A 2PE1A 2FYSA 4IADA 4MQ2A 3VHKA 2E9PA 1KOBA 3PRFA 2VTNA 4E5AX 2ACXA 1YWNA 4ZTRA 4J97A 3DKFA 3FZ1A 2F49A 2PVJA 4I4FA 4LUDA 4O0UA 3CKXA 1URWA 4LRKA 4M84A 3W32A 5AAEA 3RM6A 3UO4A 2CKEA 4P5QA 4X2FA 3UNKA 4FV0A 3GNIB 4IC7A 5DR9A 5HTCA 1GY3A 2WAJA 2BIKB 1ZY4A 1JPAA 3BYUA 4NWMA 2CPKE 5KZIA 1IG1A 3MPAA 1J3HA 2C1AA 2UV2A 3BYVA 3PG1A 4Z16A 5ITAA 3EH9A 4CV8A 3QHRA 3PJ3A 2HYYA 1Z57A 1KE6A 4S31A 4ZY6A 3ZLWA 3R8ZA 2RFNA 5KX8A 3DKOA 3CEKA 1PXMA 1H28A 1GOLA 2WHBA 1WVYA 3UP7A 4NCTC 1FVVA 4E93A 4AF3A 5A9UA 4X3FB 3UC4A 5HLNA 2BZJA 4ZSEA 1RJBA 4XV9A 3WBLA 4IVAA 4F1MA 2B55A 3EHAA 3BIZA 3SKCA 4R1YA 3QQGA 3KXGA 2J9MA 4UV0A 4ZZMA 3O8TA 3ZO1A 3GEQA 4LL0A 3SOCA 5CEKA 4FG8A 1Q8UA 2B9IA 2V22A 3BE9A 5DA3A 5ANGA 4KBCA 2PHKA 5C1QB 4IANA 4HOKA 1ZOEA 4EHZA 3VS5A 4FTCA 5IUGA 4M67A 2I0YA 2WO6A 4RQKA 2GPHA 2WMVA 4BB4A 4X2KA 4L7FA 3TNHA 3L1SA 2C6LA 2JKOA 3O7LD 1P2AA 3JY9A 4L7SA 4JAJA 2FUMA 4QNYA 3LFNA 2PZ5A 3OZ6A 4EHEA 3ZRLA 1R78A 3LJ2A 4MXCA 5HORA 2JBPA 4R3RA 4EI4A 1KOAA 1H1QA 3QXOA 3HP2A 3BZ3A 3VBYA 4BCGA 2W1HA 2XK4A 5CS6A 3ZXTA 4AZSA 3NYNA 3QWKA 4FYOA 4XS2A 3AGMA 4MBIA 2W9ZB 2PMNX 3KULA 5H9BA 3HUBA 3M42A 2G9XA 5E90A 4OTPA 1P4OA 4BDCA 4L43A 5KMLA 3UO5A 4LOOA 1YKRA 2E9OA 1H27A 4KNBA 3VW8A 5IG1A 2C6OA 3NNWA 2XNGA 4FSNA 3FZRA 3VUDA 5HG5A 3MH1A 5FTOA 5L6WL 3NDMA 2XK7A 3LFEA 1XH4A 2UZVA 3PXFA 3EFJA 4AFJA 4DEIA 2C0IA 2BMCA 4YPDA 5HO6A 4I92A 2ZB0A 3TUCA 5CALA 5GJFA 4G16A 2J0KA 3TXOA 4J98A 4O0RA 4ERKA 2GNFA 3MVJA 4OTWA 2UZLA 2JC6A 4ACHA 4BN1A 3HDMA 3FXXA 5D41A 3AG9A 4FKQA 1PY5A 4BBMA 4NK9A 4M0ZA 4IAKA 3UIMA 3F5UA 2VTLA 3R1QA 3OW4A 5ETFA 3F7ZA 1IASA 3SXFA 5C8MA 4PTGA 3DLSA 4ZJJA 4FSQA 4JDKA 4E1ZA 3PP1A 2XBJA 3VNTA 4F65A 3T3VA 1H25A 1R0PA 4CLJA 3UE4A 3FZSA 2UZDA 5CLPA 5M44A 4C4EA 5KMJA 4XRJA 3PXKA 3V6SA 4EKLA 4S30A 3QKMA 3ORPA 3KKVA 4G2FA 3ZLYA 5AIKA 4CTBA 5IUHA 2PMLX 4CZYB 4LV5A 1Q99A 1ZRZA 2QHMA 3F66A 4O6EA 3U4WA 4YJRA 3VF9A 3R8PA 2P55A 3G2FA 2OG8A 2QD9A 2WIPA 4WKQA 3W2OA 3AC2A 4FA2A 5TKDA 5AUZA 2QOIA 2BILB 5A6OA 3ACJA 2VZ6A 3RWQA 4L68A 2BHHA 4CNHA 3FHRA 4RC3A 2EWAA 3VRYA 3Q4TA 4C36A 4WSQA 1VJYA 1Y6BA 3K5VA 5KBQA 2PUUA 5IUIA 3FMHA 3MWUA 2X0GA 3MTFA 1OIQA 4MTAA 4OAUC 2UW7A 5GZ8A 3ZRMA 4CVAA 4L9IA 3BHHA 4XOYA 1Y6AA 1SVEA 3G0EA 3KK8A 3VHEA 5BYYA 2E9NA 3C1XA 3KQ7A 2IW6A 2KTYA 4JAIA 3UZPA 5CSPA 3FSKA 3LFQA 3PG3A 4QYHA 4F7SA 2WXVA 1NA7A 1I44A 4L53A 2VTSA 1PMNA 4ITHA 3IW5A 3GI3A 4BHNA 4W8DA 4IAZA 1OKYA 4Y85A 2X8IA 4GCJA 5I9YA 4JI9A 3IW8A 4FKSA 3QCSA 2X39A 2GNJA 4A4LA 1H1RA 4W8EA 2C0TA 2FGIA 3CQUA 5LMAA 3DAEA 4L8MA 5CNOA 3DDPA 5HESA 3VS3A 3AOXA 3QU0A 5EM7A 4I6BA 3NYVA 2QOQA 2RKUA 4GW8A 2FSLX 3U9CA 5JFWA 4OT5A 3O8UA 3BBWA 4CMUA 3HV3A 4DEHA 3N51A 2DYLA 3T9TA 3O2MA 5AUYA 3C9WA 5M53A 1GJOA 2J5FA 4XRLA 5DR6A 1BX6A 5IMEA 1Q8ZA 3LM5A 4FTOA 2XZSA 2NO3A 3UIBA 3U87A 5HGIA 5LWNA 2BAJA 2R3PA 4QMZA 5FP6A 4IAFA 5LCJA 4APCA 3D9VA 2WTWA 5JN2A 2UW0A 5HQ0A 4PTEA 2VGPA 3MI9A 4EH4A 5J87A 4JOAA 2OJJA 4MQ1A 2P33A 4JIKA 2R3LA 3LQ8A 4RJ4A 2B52A 3MJ2A 3HRCA 2H9VA 5CQUA 1BL7A 4DH3A 1YXXA 3CTHA 1V0BA 4AZTA 3BHTA 2GNGA 2J2IB 3EQPA 3UIUA 2CHLA 4ZY5A 1J91A 2YIWA 4GYGA 4A9SA 4FKOA 5EI6A 3COHA 3NW7A 4X2NA 4IZ5A 1LEWA 5HVYA 5E8SA 2PZPA 3SV0A 4C3FA 3TZMA 4G5JA 4MH7A 3PA3A 3EQDA 4YTFA 2J0JA 4MNEA 3FSFA 3GOPA 4H39A 3QCQA 3R9HA 2W05A 3TG1A 3MY1A 2OSCA 1ZXEA 3QD4A 2IVUA 3BLQA 4FTNA 2C3LA 2GHLA 3L8XA 1UWHA 3UTOA 4RMZA 4DG3E 2QU5A 5IEYA 3BEAA 3BELA 3FYJX 4L46A 3HMIA 3EKKA 4XP3A 1ZZLA 4C4GA 4EEVA 4K33A 3A7HA 3Q2MA 2VTRA 2XIXA 3ZH8A 3S1HA 2OJIA 1QMZA 5EDRA 1WZYA 2XK3A 3OY3A 4B0GA 2PY3A 4LRMA 1KE7A 3F9NA 5CANA 2WQBA 2WTDA 5C9CA 4ZJVA 2G15A 2HZIA 1CM8A 3C0HA 3K3IA 3KRWA 5DGZA 1ZYSA 3K2LA 2JKKA 2PZRA 3CD3A 1JVPP 4TXCA 5AV1A 4BBFA 4JX3A 4TWCA 2WEVA 3D83A 3V5LA 4AN2A 3DKCA 4ID7A 4LMUA 4DBNA 4D1ZA 4X6RA 2QKRA 3BGPA 3QUPA 5L2SA 1H1PA 3FAAA 5HICA 3KC3A 3MBLA 4RRVA 3QUEA 3R7YA 4AOJA 3TT0A 5D7VA 3DLZA 4C37A 4AT4A 5LQFA 3S95A 1M2QA 4PMMA 5B2KA 2AC5A 4FSTA 4J52A 3MGYA 3IDCA 3HRFA 4DTKA 5AADA 4FL3A 4MKCA 3O96A 4IJPA 3DZOA 4FZ7A 3Q60A 4CXAA 2EXEA 2CN5A 3UJGA 2NP8A 1KE9A 3EFKA 4ASXA 4U7ZA 5AUWA 3KXNA 3UYTA 5CF5A 2QCSA 5CVFA 1APME 2GTMA 3GU7A 2AUHA 1BL6A 4D0WA 3ZEWA 2OO8X 2KULA 3VVHA 4DLIA 4BDEA 2WOUA 2GFSA 2VTIA 3E8DA 4O6LA 4U44A 1VYWA 2JKMA 4YZBA 4AX8A 4D1XA 3DK6A 2WTIA 3I6UA 3QALE 4HYUA 4IWQA 4AZEA 3P9JA 2ZVAA 5DEYA 4BL1A 2IJMA 2VWYA 4MD7E 2XKDA 5HX6A 5D7AA 3QAME 3DXNA 3EFWA 4M8TA 2Y4IC 4E5WA 4PMSA 3HVCA 4AW2A 1W84A 1LUFA 1XJDA 4JVGA 2X81A 3EWHA 3RVGA 2YLFA 2C5NA 5JFVA 4TYHA 4IMYA 4IFCA 3R8VA 2GMXA 3OROA 4NH1A 4D1SA 2UW5A 2UUEA 2BTRA 2JDSA 4ASEA 3HV5A 1H08A 3C0GA 2XNOA 3M2WA 3OW3A 4KKHA 5HBJA 2XIKA 4CFXA 5CI6A 1H07A 2ITZA 2WQMA 2ZDUA 4D2VA 2BALA 4IB0A 4QQJA 3EYGA 2QOBA 2QURA 3QQFA 5AWMA 4FKJA 2XP2A 2ITVA 3E3BX 4MX9A 3R2YA 2WTKB 3KRLA 4I3ZA 4YZDA 3ZSIA 5KKRC 3QQUA 4GJ2A 5H2UA 3WF8A 3FLNC 3PLSA 3NW5A 2QLUA 4YR8A 3Q53A 3VJNA 3ZSHA 1XR1A 3DBFA 3R7UA 3GC0A 1V1KA 1XH8A 1STCE 3DPKA 3L8VA 1H24A 4M7IA 4FIEA 4YTIA 4AAAA 3H9OA 5EDPA 4CQEA 3QRKA 5DFPA 5CSXA 3COMA 2WEIA 3HV6A 2UVXA 4LUEA 4MWIA 3LXKA 4EHVA 4GK3A 4ANSA 4WG5A 4EH3A 3R73A 4ITIA 2FH9A 2PVLA 3H0ZA 3P86A 4E5BA 1SYKA 4DFNA 4ANMA 2XJ0A 3FV8A 4QQCA 5EM6A 2EB3A 2OU7A 4J95A 1ZMUA 4WG4A 2HZ4A 3WF5A 5E8XA 5AR7A 2GSFA 3WIKA 4NEUA 3NYOA 4GL9A 5EOBA 3HYHA 4O0SA 4B8LA 3EN7A 4YZCA 1YHWA 1JQHA 3WYXA 4CFFA 5CF8A 2J50A 4TYHB 4LYNA 4CEGA 5AP5A 5BVKA 2W96B 5EI8A 3PVUA 4FIGA 4NSTA 3RGFA 3AC3A 3IW6A 3PXZA 4FOCA 5E1EA 3QQJA 2EVAA 3V01A 1GNGA 2R3IA 4KRDA 4OUCA 3GP0A 2H96A 4RC4A 4OW8A 3QD3A 3A4OX 4JBPA 3WF7A 5HG9A 2BRMA 3MVLA 4H36A 4QQTA 5CAPA 3II5A 3A61A 2ITTA 1KV1A 3MPTA 4FYNA 4IVBA 5JZNA 5E8UA 3R1SA 2PZYA 4I24A 5HLPA 4BKYA 3UIXA 4UZHA 4ZLOA 4FKTA 4EOOA 4MXOA 4EJNA 2VX3A 4FK6A 4IX6A 4A06A 4CMTA 3UPZA 4FEQA 2XRWA 1OKZA 3H9FA 3KGAA 3IPHA 3PSBA 5IISA 3LCTA 1YRPA 2YHVA 1ZYLA 2QHNA 2XYNA 5D9HA 3P5KA 2HXLA 2VWWA 4XG9A 2WNTA 5HO7A 2J5EA 1YWVA 3DAKA 4KINA 2C5YA 3GFWA 5EW8A 3D7TB 4ALWA 3OXZA 1UNLA 4IM0A 4KIKB 3MIYA 5LCKA 3BRBA 5M57A 3EL7A 3LFDA 4LI5A 3ROYA 3IOKA 2O8YA 3AC1A 3BWJA 3QLFA 5BVEA 4E4MA 3NAYA 5CU2A 2ZJWA 3BU5A 3KCFA 1UV5A 3ZYAA 3PWDA 5JRQA 3QZFA 4Z7GA 4IX3A 4RIYB 4A4OA 3A7IA 4NFNA 4FV6A 5I4NA 2P2IA 2XEYA 1W0XC 4XCUA 5EW3A 4AN9A 1XHAA 4XJ0A 4AGDA 5HKMA 3BHVA 5F4NA 2VRXA 1OZ1A 3AC4A 4Y5QA 5L8JA 3AT4A 4GRBA 4WO5A 3OEFX 1HOWA 5L2TA 3GT8A 2JITA 2UZOA 4RFYA 4FV9A 1WBPA 2VTPA 4TW9A 3ORTA 4WNKA 4RWIA 4UMUA 1CMKE 3KXXA 3IECA 4UWYA 1H26A 3CC6A 4BCKA 4EK8A 4OTIA 1M14A 4C59A 3W2QA 4ZLZA 3DK7A 1OGUA 3FLYA 2YABA 3VUMA 4C58A 5A14A 3FY2A 3QYWA 3TTJA 3VS6A 3CQEA 4PDSA 4ANOA 5J9ZA 3BLRA 4BVUA 1UU9A 5CX9A 4HGSA 4K11A 2WGJA 1IEPA 4U79A 3Q4CA 4YBJA 4RVKA 5FWKK 4C3RA 2XRUA 1Q41A 3WF9A 3NLBA 2FSTX 4NTSA 4PPCA 4XLVA 4D55A 4QPAA 3B2WA 4C61A 4Z3VA 1G5SA 4A9TA 1WMKA 3PXRA 4EZ7A 3Q9ZA 3A4PA 3E8NA 3VIDA 4XLIA 5HD4A 3UO6A 4EOLA 2X8DA 4R6VA 2WPAA 3LE6A 4BDFA 1DS5A 1V0OA 1XBAA 5I9VA 3MFRA 1Z5MA 4IDVA 2BHEA 4QPMA 4HGTA 4YSJA 3WIGA 3Q9WA 3F5GA 4L45A 5DN3A 1TKIA 5ETIA 2YCQA 4YC8A 3RZFA 5CSHA 3W55A 4DH7A 4EOMA 4FF8A 3VUIA 3MW1A 3CGFA 5FDPA 3R83A 4YO4A 3ZXZA 4L44A 4RX5A 3LPBA 2VTHA 3K3JA 4W4YA 5JFXA 4Y73A 2QODA 3ULIA 2ITXA 4YBKA 4GVJA 2YERA 1Q62A 5BVNA 3A7FA 4OTRA 3THBA 5KMKA 2CN8A 2XJ1A 5FM2A 5BMSA 1ZZ2A 3C51A 5KNJA 1U46A 3Q6UA 4O0TA 4ZTSA 4EORA 4B6LA 4NW5A 3BHYA 4V04A 4XHKB 1OL2A 5HX8A 3DQWA 3LAUA 4YTHA 4MCVA 2V5QA 5KO1A 3G5DA 1TVOA 4OTDA 5DRBA 5AP2A 3TKIA 4MK0A 2DS1A 3UPXA 4FV8A 4KIKA 5KBRA 2F9GA 3QL8A 3R7IA 3C4XA 2XEZA 3OP5A 4FOBA 4MXAA 3E93A 2QOOA 4G3EA 3EQBA 3HMNA 2QC6A 3T9IA 5C27A 5A6NA 1M7QA 3FY0A 4PPAA 2PSQA 4O96A 2PVKA 4XYFA 4F0IA 1TQIA 4K0YA 3DS6A 4PNKA 4BF2A 4G3DA 2CCIA 3ORKA 2HIWA 1OUKA 3SC1A 4JT3A 5JK3A 2FSOX 1MQBA 2R3NA 4GYIA 3TZ8A 4D4VA 2EXCX 2ZM3A 3R8MA 2X6EA 5AA8A 4C0TA 3TCPA 1PMUA 4ITJA 2RF9A 3TIZA 3KXMA 4I6FA 3RMFA 4FT7A 5FXQA 3BBTB 4EUUA 5DHJA 1H1WA 3OT3A 2QO2A 3LFFA 4CQGA 4X2JA 3P79A 5EYKA 1OIUA 1M17A 3LCKA 4IBMA 4QMUA 4UBAA 4KIOA 4XMOA 4ZXTA 3IK3A 3TZ7A 3V5WA 3MVHA 3HMOA 4GFOA 4KKEA 2C3IB 3G9NA 3LJ1A 5LVPA 4PL4A 4OTHA 3ZCLA 3CD8A 4RC2A 2I0VA 3RAWA 2ITOA 4IH8A 3UVPA 4BIDA 4ONAA 2W1FA 1SVGA 5ANIA 4BIBA 4B7TA 4DH8A 4G6OA 3QCXA 3SDJA 4EBWA 2HY0A 2W5BA 4I6HA 4XG7A 4GMYA 5HNGA 4JR7A 4ZIMA 4USDA 3D5VA 4TYJA 5BUJA 2V7AA 3IOPA 4ACGA 4DEBA 5GJDA 2GNIA 3TEIA 2WMXA 5I0BA 4QPSA 5CAOA 2RFSA 4G3GA 2PL0A 2RFEA 4QP9A 5EYCA 4DG2E 4EYMA 4G3CA 4MXXA 2WOTA 4J1RA 4QRCA 3V5TA 5JFSA 5BVFA 3OUKA 2XNEA 1A06A 2X9EA 3TKUA 1IR3A 2CLQA 3BI6A 4GVAA 4LMNA 5M4IA 1SNUA 3DB6A 1P14A 4H3QA 4IWDA 4FG7A 4TWOA 4U5JA 5I3RA 4EOIA 3I5ZA 1ZOGA 2R3HA 3JS2A 1Q3DA 4FKUA 3ANRA 4BC6A 3OG7A 3KMUA 4F08A 4X3JA 1JLUE 4EOQA 4L52A 4ZAUA 5JMSA 3GFEA 2I40A 3CGOA 3W8QA 3PVGA 4W4WA 4I6QA 4WUAA 2W4JA 1OIRA 3I60A 3QKLA 4XBUA 2PWLA 4QYYA 3SX9A 3MTLA 4EHGA 5FBNC 1OVEA 3RM7A 1P5EA 5EM5A 3VBXA 4F9BA 4QMVA 3HV7A 4OBOA 2XCKA 3AMBA 2NPQA 3DBDA 3B2TA 1W8CA 4XV2A 5HG7A 2O0UA 3FI4A 5L2WA 2B53A 1B38A 4GFMA 2VU3A 4BCOA 4PX6A 3VW6A 1FVRA 5EFQA 3R22A 2B54A 4J8MA 4EL9A 4JNWA 4FTUA 5L3AA 4EKKA 1GZOA 2JFLA 2QO9A 4YJPA 4O27B 2DQ7X 3PIYA 4FIJA 2W4OA 4F09A 5L8LA 3VWAA 5ETAA 4NM0A 1NVRA 4RT7A 2ITQA 3EQRA 5J95A 3CBLA 3FQSA 3QCYA 4Z55A 5KUPA 3MV5A 3FXZA 2YM4A 4TYEA 3F2NA 5CU6A 2OBJA 2CSNA 2YFXA 1PXOA 4NFMA 5CVHA 4TKSA 4WSYA 5EHOA 3R9OA 4CTCA 5B7VA 5E7RA 2Y4IB 3DCVA 3QKKA 2W5HA 3TN8A 4FKRA 3ZSGA 3B8RA 3LJ0A 3PPJA 5LMKC 1L3RE 4WNMA 4R1VA 2G01A 3F5PA 2WMRA 3JPVA 4TL0A 5JT2A 4G6LA 4EK6A 2RFDA 2Y6MA 5K9IA 4DAWA 3W2PA 4G9RA 1JSVA 1UU8A 4FZ6A 5DPVA 3HX4A 3E5AA 4DFZE 1XH7A 4KIPA 3A7GA 1PXJA 5BVWA 1MRYA 2BFXA 3BX5A 4P4CA 3EN9A 3BYOA 2BROA 3FHIA 3QGYA 2WMQA 2Z2WA 4RJ8A 4TZRA 5D12A 3H9RA 3SHEA 4C3PA 4RJ3A 5KE0A 3NYXA 4CRSA 2X7GA 4NCTA 4RX8A 4I4EA 3DKGA 2OIBA 3E92A 5LVOA 5K0KA 3P7CA 3ALNA 3FDNA 4C57A 5AEPA 1PXKA 4HVHA 2C4GA 4EOJA 1B6CB 1S9JA 2GDOA 4S33A 5C26A 4HYHA 2X8EA 4JG6A 3EQIA 4LV8A 3OT8A 3GBZA 2BRGA 3SAYA 1PHKA 3TTIA 4AFEA 2BDFA 3D5WA 2P0CA 3F3WA 1QPDA 4I94A 5A3XA 2FA2A 3QRUA 2Y4PA 5CZHA 4EH8A 3AQVA 3EQFA 3GCUA 2H6DA 4FTQA 4P5ZA 5ANOA 2GTNA 4HCVA 4L3LA 4NM5A 4RX7A 4XBRA 4RIXA 1JKKA 3AC5A 4Y83A 3DNEA 3ORIA 3MB7A 3ZTXA 1M2RA 1FGIA 1DI9A 1X8BA 3PJ1A 3I7BA 5FM3A 4XP0A 4AQCA 1YXSA 4IAIA 2Z7QA 2PVMA 3H10A 2YZAA 1ZLTA 3UQFA 2YDKA 2DWBA 4FV4A 1O6KA 4QYEA 4ZZOA 2C68A 3PXQA 4YZ9A 1ZYCA 3H3CA 3HV4A 3O0GA 3Q52A 3V5JA 2OXYA 3KRJA 4BZOA 4FV1A 5J1VA 4F6UA 1OIYA 5I9UA 5CU3A 2RSVA 4YJQA 4FX3A 5JQ8A 2CLXA 3RBWA 3I1AA 2JD5A 4OLIA 4CV9A 2A19B 4F64A 2ITYA 3MJ1A 5DNRA 5ACKA 2V7OA 4E3CA 4FTKA 4I93A 3MY5A 2HXQA 3F69A 2YIXA 4EC8A 2GQGA 4EH9A 4BIEA 4IVCA 4DLJA 3AT2A 1H0WA 5BNJA 4ZSJA 1U5QA 5HNIX 3ENMA 4EWHA 2YM3A 4TTHB 4FIHA 4X3FC 3VS4A 3VS1A 3GU8A 3PWYA 3NUPA 2W1CA 5CT7A 3S0OA 2VWZA 4NKAA 3WARA 4RFMA 4D0XA 3R02A 5DT0A 4JQ8A 4PTCA 3R04A 4QMLA 4FSYA 3UGCA 4D28A 3KL8A 3VBVA 2B9HA 3FKOA 3K5UA 4EH5A 2PE2A 4GV1A 4MBJA 2F7XE 4JQ7A 5FLFA 5F9EA 2V0DA 4GT4A 4R7IA 5TOZA 2BCJA 1Q24A 3KN5A 4G1WA 2Q0NA 2XVDA 5GZAA 4PP9A 4BDIA 2X1NA 4UZDA 5CU0A 1Q61A 3FWQA 4K18A 2XBAA 3W2RA 2UZWE 3Q3BA 2YCRA 4D5HA 3KVWA 2A27A 2ZYBA 3O23A 3ETAA 4FUYA 3QWJA 5AP6A 2W7XA 4YJNA 3R28A 1REJA 2REIA 3W33A 2Y0AA 4QNAA 3GVUA 4FKGA 2RG5A 3ZFMA 4GK4A 5HCZA 1BUHA 3C4ZA 4WHZA 3UYSA 3AMAA 3GQIA 3UOJA 3MH2A 3NS9A 2IZUA 4C33A 4HJOA 4Z7HA 3QQKA 5DEWA 4YMJA 3ODZX 3ALOA 3AMYA 3JVRA 1T46A 1AGWA 1JKLA 3ET7A 2C5OA 2UW4A 2QU6A 3GU5A 3O8PA 4GSBA 5EH0A 4ANBA 5HIDA 3PE1A 1Q8TA 2HY81 4GUBA 2UZBA 2ONLA 2ERZE 5ANDA 2HOGA 4IXPA 3SOAA 4DFYA 1PXIA 2WQEA 5EG3A 3C4EA 4UWCA 4LL5A 4AS0A 4V0GA 1NXKA 4F0GA 3LCDA 3QX2A 3L9MA 4CT1A 4E20A 2BDWA 2R5TA 3AC8A 3PZHA 2IW9A 3DJ6A 1H01A 5FRIA 3RTPA 5A4QA 4E26A 5KCVA 2C5VA 1GZKA 3SLSA 3QZIA 4ANLA 4JG8A 1JKTA 5DMZA 5G6VA 4D9TA 2VO0A 1PYEA 4IB3A 3ZS5A 2OFUA 2C3KA 4TNBA 3V8SA 2WB8A 4YLKA 1J1BA 3HL7A 3FLZA 4FG9A 2BDJA 5HE1A 4FSZA 5J8IA 4AACA 5J7HA 3VQHA 4N0SA 4BDGA 4ENYA 2W1ZA 2XJ2A 1F5QA 1W7HA 3P08A 4I5HA 4K9YA 4M3QA 4Q2AA 3HMMA 4FT0A 2QOFA 4HCTA 5I9XA 2WQNA 3A2CA 2C5XA 3EMGA 3RINA 3PIZA 4ANNA 1YHVA 3CY3A 5FEDA 1QL6A 4NUSA 1O6LA 2IVTA 2UZTA 2ZM4A 2XK9A 3CLYA 2OIQA 5HVKA 3QD2B 4RIWB 4J99A 2X6DA 4O0WA 1OECA 1WBSA 4F9YA 2R7BA 4XEYA 4FSUA 5DI1A 4AE6A 5HZNA 1CDKA 3C0IA 2VGOA 2J0MB 4YO6A 5HE2A 3ZHPC 3EZVA 3V04A 4MXYA 3RPYA 1SVHA 4II5A 4PL5A 4LGGA 2VUWA 2W17A 1YVJA 2C6TA 1NY3A 3LOKA 2J4ZA 3RPVA 4IW0A 4N6ZA 4PP7A 2YEXA 5T68A 4XP2A 1WBTA 1XH6A 5EW9A 1W83A 2A1AB 3MFTA 3F88A 3E7OA 3G0FA 4UB7A 3NUNA 3DOGA 5FBOA 1DM2A 1XH9A 4YC6A 3E87A 1AD5A 2WZJA 1MP8A 3U6JA 4J8NA 4U8ZA 3H30A 5K0XA 2HWOA 5C8NA 1R39A 3B8QA 2XNBA 4IIRA 5E1SA 3KCKA 3VUKA 1OKWA 2BAKA 2XNMA 3BYMA 4JDHA 3IONA 1T45A 4QP8A 3POOA 2UVZA 3SW7A 4JJRA 2JDRA 4BDAA 4E73A 2OZOA 3A62A 3ZO4A 4PV0A 2QOLA 4L42A 3U4UA 3OD6X 2YIRA 3F3VA 3NIEA 1UU7A 3DTWA 4UYNA 4HVIA 4NU1A 4BZNA 4M12A 1ZAOA 4O1OA 5AR5A 3UZTA 3K54A 4BZDA 2ZB1A 3C50A 3TIYA 5AP4A 5HG8A 4FBXA 2W1GA 2OJGA 3HMPA 3OOGA 2QKWB 2GHMA 2B1PA 4DGMA 1ZARA 1OL5A 3PSDA 4FMQA 3E8EA 5HO8A 3ZUTA 2CDZA 3D2KA 3FZPA 5AAGA 2HAKA 3TV4A 4IHPA 4FZAB 3AD6A 4PUZA 3RAKA 3RCDA 4GUEA 4M69B 4FKLA 4FTAA 3KRXA 5J7BA 2ZV9A 4FKWA 1RW8A 3DT1A 2OIDA 1B39A 4JR3A 1YOMA 5CZIA 5EYDA 1WBWA 5ANKA 1W98A 4KA3A 3E7VA 4KKGA 2PTKA 4F99A 3R00A 4M15A 4D2TA 5A4LA 4BTKA 3I5NA 4GIHA 5AV0A 2B9JA 3PVBA 4FVPA 3KEXA 4H3PA 2X4ZA 1BMKA 1UA2A 4L6QA 3I81A 5AJQA 2RG6A 3I7CA 3UC3A 3PZEA 2C1BA 3IDPA 4HYIA 2B4SB 5CT0A 3FQEA 4FTIA 5JEBA 3O71A 1ZYJA 3ZFXA 1JNKA 3G6GA 5A4TA 4BKJA 2JFMA 4E7WA 4AGCA 3C4WA 1YDTE 3BEGA 3EJ1A 3V8TA 5FXRA 3R7GA 3NCGA 3HECA 3JYAA 4M97A 1OL1A 3LM0A 3OMVA 3TNWA 3OFMA 2W99B 3OTVA 3FXWA 1VYZA 3TNPC 2WTJA 1TQMA 2YWPA 3O7LB 3MYGA 4YUQA 4GFGA 3TACA 3I0OA 4IDTA 3S4QA 3DBEA 5FTQA 4ENXA 4KRCA 3SXRA 2W1EA 4AE9A 2YIQA 1JSTA 2GS2A 2NRYA 5L2IA 2UZEA 3DDQA 5IKWA 4R7HA 3FZTA 1OPJA 3QTSA 1GZ8A 3KRRA 4F7NA 1MUOA 1U59A 4QP1A 4BFMA 1Q8WA 1YI3A 1O6YA 3FC1X 2A2AA 5DH3A 2FVDA 3FI2A 4QMQA 5CENA 3ZRKA 4IE9A 3VULA 2BR1A 3IW4A 4C4IA 1QPEA 3FQHA 4LG4A 4D4RA 4A7CA 3NUSA 2JBOA 2O64A 4WUNA 2X9FA 4H1MA 3QRTA 1YOJA 2YM5A 2CGUA 3NUUA 3FKLA 1Y8YA 4O1PA 4FTTA 4Y46A 4AG8A 5EKNA 1WAKA 2UW8A 4AA0A 3BQRA 2JIUA 4WT6A 4BDHA 3TJCA 2IO6A 2YJRA 4FVQA 5I5ZA 3O17A 3VUTA 4U3ZA 2OZAB 1IRKA 3PPKA 5I9WA 4A9YA 5HCXA 3FKNA 4YSMA 3E88A 3MDYA 4EONA 4F1OA 4JS8A 2VO6A 1PF8A 4MXZA 5GJGA 4DINA 4PY1A 3VS0A 2J51A 4R5SA 1U4DA 3FC2A 3IDBA 3SQQA 3V6RA 1NVQA 4BWPA 1JKSA 4BCJA 1FMKA 3WZKA 4AT5A 2C6IA 2R2PA 3CPCA 1FGKA 2I1MA 3REPA 4WRSA 5E8YA 1E9HA 5IA1A 2YITA 2E9VA 3PY1A 4CFNA 2F7ZE 4Y95A 1WBNA 2Q0BA 1OMWA 3FL5A 3KU2A 4M69A 4YLJA 4I5PA 4WG3A 5B2MA 5DG5A 3IGOA 4YPSA 4OBQA 1H00A 3QYZA 2IW8A 3TKHA 3L9PA 2R3GA 3NNVA 4YTCA 1CKPA 5DT4A 4DEDA 4QMMA 3VS2A 1OL7A 4BCQA 3RPSA 4A07A 4LFIA 3GU6A 3FL4A 2AYPA 5HEZA 1O9UA 4RVLA 5AP3A 4JLCA 5L6OA 2WMAA 3D0EA 5B2LA 1RQQA 4BHZA 4XG2A 3LLTA 3Q96A 5IA5A 1TQPA 5EHYA 5L8KA 3FLSA 5CEMA 4HVDA 3QTXA 5AMNA 3OCBA 3V5QA 5FG8A 1ZMWA 2VTAA 4ZSLA 3UG1A 3ZZEA 5CF6A 4RFZA 4TWPA 2ZV8A 2W9FB 3OF0A 3UOKA 4JIAA 1LP4A 2UW6A 5BX0A 3R30A 4GK2A 2JLDA 3PPZA 3EN4A 3JVSA 1JWHA 4HNFA 1Y57A 4QMYA 4F9CA 4RJ6A 4FT9A 4DFXE 3JUHA 3CTJA 4NM3A 5E8WA 2X2KA 3DTCA 4ZTMA 4I5MA 4HPUE 1PMVA 5B0XA 1BI8A 2WU6A 3KY2A 4ZJIA 3FMDA 1K2PA 5KKRB 4YZMA 4DGGA 1YDSE 1H0VA 4D2WA 2BKZA 3NRMA 2SRCA 3CIKA 3HLLA 2X7OA 4FNXA 4IB1A 4RGJA 5CAQA 3EFLA 4EUTA 2HK5A 5M51A 2YACA 4F7LA 2C3JA 2FB8A 3C7QA 3EYHA 3CJFA 4ZSGA 4RIWA 3QD0A 5GZ9A 4TN6A 5KMIA 2X4FA 4J96A 2YM8A 5IDNA 4D4SA 3P0MA 1WCCA 4GU9A 5EM8A 3QA0A 3LFSA 2V55A 4BTMA 4IACA 3NNUA 4ZK5A 1OL6A 4O2PA 5AV2A 3TUBA 5KMOA 3BGQA 3CY2A 1PYXA 4DYMA 3R0TA 2ESMA 4IM3A 1BI7A 2QI8A 3BV2A 2QLQA 4WOVA 4FIFA 3QTIA 4YNEA 1YI6A 5FDXA 2ZAZA 3D15A 2QVSE 4YJVA 3GUBA 2OICA 2ONLC 2PMIA 1GIHA 2HW6A 4RJ7A 3R9DA 4NM7A 2ERKA 5JH6A 2EUFB 4NKSA 4IJ9A 4RA5A 3FE3A 2B9FA 3R1NA 3VQUA 2QOHA 3RPOA 5DLSA 3TUDA 3KXZA 4BCIA 3OXTA 4UXLA 2R0UA 5JGAA 3VBQA 3ZLSA 4XUFA 5A54A 4UMTA 3F2AA 5IEVA 1YOLA 5DR2A 2GS6A 4RVTA 3DAJA 2XIYA 4MYGA 2ZMDA 3ZO2A 4FIIA 5T6KA 4GG5A 4I21A 5JSMA 2ZDTA 4YJUA 4U42A 1E1XA 2QOKA 4KWPA 4TYIA 4CCUA 5HHWA 5CY3A 3WILA 5KMNA 2JDTA 4PPBA 2EXMA 3U6IA 4UX9A 3EQGA 3KF7A 3I6WA 3KVXA 4OT6A 4DGLC 5DBXA 2OXXA 3DB8A 4GT3A 3EZRA 2OK1A 5A4EA 4D2SA 4FTJA 1BKXA 4KSQA 4NJDA 3PA4A 3VUHA 4EZ3A 3ZUVA 3CCNA 1H8FA 4U3YA 5DRDA 3BU3A 4UEUA 3R9NA 2E2BA 1W82A 4J71A 2WFYA 3WE4A 1XQZA 2JGZA 1R3CA 1I09A 3CP9A 3CE3A 3VN9A 3F3UA 5IA2A 1PXNA 3NW6A 2YIYA 2VWIA 4BTJA 4XG4A 4ALUA 3W16A 1UWJA 3UODA 5K5NA 2DUVA 4IZ7A 4PDPA 5M4UA 4DEGA 4EK5A 4Y8DA 3FMEA 4QTAA 4FV7A 1YI4A 5DT3A 4QOXA 4WIHA 4C2WA 3PSCA 4C8BA 5HOAA 5LOHA 3Q6WA 4Q5HA 3Q4UA 3SRVA 4TNDA 3EQHA 2ZV2A 5ICPA 4MWHA 3ZO3A 4CD0A 3PUPA 2XYUA 2W1DA 3WYYA 4C62A 3DGKA 4MHAA 3I4BA 3HZTA 3EQCA 5I3OA 4IX4A 4XV1A 4C2VA 3OCGA 2W5AA 3FZOA 4CSVA 3UOHA 1XO2B 3F6XA 5IZFA 2Z60A 4JXFA 1ERKA 2BZHB 4FODA 3RKBA 4RBLA 2HW7A 3ORMA 5TT7A 1JOWB 5M55A 5CEIA 2Z7LA 3AXWA 4FTLA 1UNGA 3KFAA 3NPCA 4ACCA 1CKJA 2O2UA 4EOPA 3VRZA 1H4LA 2X2LA 3EL8A 4FNYA 4S32A 5L4QA 4YURA 2VD5A 3UMXA 1VR2A 5FEEA 4CFVA 4D58A 4EBVA 5CWZA 3VF8A 5HNBA 2YA9A 3KN6A 3SVVA 3QGWA 4HW7A 3LMGA 3O50A 2J90A 5AR4A 3DU8A 2C0OA 4JBVA 1Q3WA 5H3QA 3M11A 4E6CA 3GC8A 2HZNA 5D1JA 3LZBA 4D2RA 4F4PA 3OEZA 4CMOA 5FXSA 3ORZA 2PVYA 1M52A 2VV9A 5J5SA 4TRLA 3OTUA 3ORNA 3ZEPA 3ZFYA 4HGLA 3U51A 2QQ7A 2WMTA 3QBNA 2CCHA 3Q5IA 4MEDA 4PNIA 4O0XA 4U45A 3ZC5A 4DEEA 4JBQA 3IO7A 3KK9A 3WZEA 2QG5A 2IZSA 4UYAA 2JEDA 4ZTNA 2PK9A 2VWUA 2QOCA 2PVHA 4RLKA 5AUUA 4QYGA 3QRJA 4RWJA 4FSRA 1MQ4A 2PVFA 3EN6A 3GCPA 5AUTA 3Q9YA 4O0VA 3NNXA 2IVVA 5K3YA 5AP1A 4QO9A 2VNWA 4GU6A 4M0YA 5ANEA 4FKPA 3DK3A 3D5UA 4IQ6A 1PKDA 2C30A 4NIFB 4D9UA 4UMPA 3ANQA 3LXLA 3W18A 4KABA 4UWBA 4CFMA 3QTUA 1M2PA 5HIBA 2XM8A 3A99A 3BKBA 4M13A 4QP4A 2O5KA 2BZIB 2OKRA 2XKCA 4ARKA 1OI9A 5JRSA 5H8EA 5HTBA 4O38A 3Q4ZA 5IMXA 3FLWA 3PJ8A 3QQLA 4K77A 1F3MC 2Z7RA 4IC8A 4QQ5A 4IEBA 4BI1A 2XH5A 4O91A 2G2HA 4YZNA 5BMMA 4M14A 3DZQA 3V3VA 3ULZA 4BI0A 4HYSA 4AW5A 3RALA 4OAVB 3FMJA 4Q9ZA 3RK7A 3HRBA 5AV3A 3TJDA 2W0JA 4FNZA 3DJ5A 2R0IA 1WFCA 2W06A 1XBBA 2BRNA 2BTSA 3PY3A 3HA6A 5IDPA 4OGRA 3OUNB 4C02A 3IG7A 4AZWA 1UU3A 2NRUA 3FMMA 3HEGA 4FUXA 3NGAA 4WA9A 4QTBA 1R0EA 5IEXA 3FMKA 3U6HA 3D2IA 1SZMA 2GHGA 2GFCA 4GS6A 3IKAA 4U80A 4Q9SA 3DFCB 4MNEB 4RIXB 5LARA 5IU2A 2ETMA 4FICA 4K2RA 1PKGA 3ITZA 4L3PA 4E6DA 1IA8A 2JIIA 4PMTA 4EQCA 5BVDA 1OPLA 3PTGA 5AM6A 5CI7A 3HNGA 5M4CA 4TPTA 3ZBFA 1FQ1B 3RNYA 3RAIA 4LM5A 3MA6A 2F4JA 4Y5HA 3LIJA 2YDIA 1REKA 3UQCA 2QR7A 3NAXA 2B7AA 3OXIA 1V0PA 4IX5A 4AW0A 5LJJA 2R3JA 3PE2A 4QP6A 4ZZNA 1BYGA 1KE5A 4D4YA 5FP5A 2J0LA 3VBWA 3ZLXA 3OCTA 1LR4A 4L01A 2C6DA 4FNWA 1Q4LA 4I1ZA 1WVXA 3WZDA 1DAYA 3H4JA 4DEAA 4AOTA 1GAGA 4BCMA 4KS7A 3D94A 5JGDA 3D7TA 1Q5KA 3NSZA 1HCLA 5IF1A 3TV7A 1LEZA 2XA4A 3QTWA 3GCSA 1WBOA 4DH5A 4MF1A 2BFYA 4CZTA 4DHFA 5AUXA 4U40A 3QZGA 3BWFA 4BRXA 4HCUA 3DQXA 5E8TA 4EQMA 5BVOA 4E4NA 3BPRA 1YWRA 2ETRA 1UVRA 3LVPA 4I22A 4KBAA 3TL8A 4QTDA 2P3GX 3GXLA 3PRIA 2XIRA 1EH4A 2Y7JA 3IQ7A 3RJCA 2OXDA 4QYFA 5A4CA 1ZYDA 3U8WA 4USEA 3GB2A 4DGNA 5JQ5A 1FMOE 3L9LA 5EKOA 4CKIA 5CF4A 5TR6A 1JAMA 3Q9XA 3TI1A 5CSVA 4EC9A 5HBEA 4ZSAA 3Q32A 4PRJA 2IN6A 4IAYA 3UG2A 4FV2A 3H0YA 3U9NA 2YCFA 2WU7A 4JBOA 5L6PA 4LGDA 3JY0A 4FVRA 4GIIA 3MA3A 4AZFA 2VO3A 4UN0C 3G90X 3I79A 4JRVA 2EU9A 4AP7A 1KWPA 4MNFA 3VBTA 3MVMA 5IA3A 4QTCA 4FC0A 4YHFA 5LVLA 3WOWA 3RPRA 5LXMA 1GIJA 2JAVA 5IPJA 2P2HA 1XWSA 4N4SA 2J6MA 5IH5A 3DNDA 4O0YA 1FVTA 2OJ9A 3I0QA 4TT7A 4FZDB 3WF6A 5DWRA 5JKGA 3P7BA 4IWOA 2OGVA 1KE8A 2R64A 3NZ0A 3S3IA 2CGWA 5FQDC 5HI2A 4HVGA 2ZOQA 4JDIA 4Y72A 5IA4A 1UNHA 3RCJA 4FTMA 4CFWA 3SA0A 2GCDA 3SD0A 3UNJA 5DVRA 2R4BA 3SRVB 1SMHA 4IB5A 3WZJA 4R8QA 2VN9A 5C03A 1PXPA 1ZMVA 4JDJA 3CXWA 5IH6A 2HZ0A 1Y8GA 1QCFA 2ITWA 2WIHA 3NIZA 2F2UA 1Q97A 4F9AA 3OVVA 4JRNA 4CZUA 2A0CX 4BGGA 1YDRE 2G1TA 4WBOA 2XNNA 2ZMCA 4BDDA 2OF2A 3GQLA 3N9XA 3GCVA 3L8SA 2WQOA 3E62A 3PA5A 3V51A 3ZMMA 2O63A 2XCHA 2HELA 4X2GA 4U6RA 3CJGA 4AGUA 4CRLA 3LXPA 5CNNA 3LQ5A 4NT4A 5HTIA 4N6YA 2R3KA 4HZSA 2VTTA 5HU9A 3P7AA 4ZTHA 2YM6A 2OJFE 4BCNA 1J1CA 3R1YA 4S2ZA 5J79A 3F82A 2C47A 2UW3A 5E8ZA 3D7ZA 3NWWA 3ODYX 4DGOA 1CKIA 1QPCA 3R6XA 5EOLA 2R7IA 1G3NA 2WTCA 3ERKA 4RWLA 4XNEA 4WD5A 4EYJA 2OI4X
chains in the Genus database with same CATH superfamily
2XUUA 4FSWA 5KHWA 4BBEA 3FLQA 4G5PA 1XH5A 4XG3A 3R01A 3CPBA 3NCZA 4U43A 4UMRA 5AAFA 4S34A 1YXUA 4GJ3A 5KZ0A 4EQUA 4USFA 4D5KA 4HVSA 5LWMA 2HENA 5DIAA 3RNIA 4QMPA 4YC3A 1W2CA 4YHTA 4BDJA 4BGQA 4E6AA 1K9AA 4AN3A 3DJ7A 1VZOA 2OF4A 2QO7A 3ORLA 3A8WA 4RSSA 5FGKA 3FYKX 3LCSA 1YXVA 2X7FA 2YJSA 2ZV7A 3GC7A 3KULB 3TV6A 4N70A 1PJKA 3HKOA 3T8OA 3DY7A 4H58A 3ZDUA 4KSPA 3D4QA 5CXZA 1CSNA 2QONA 1OKVA 4X21A 4L67A 3VUGA 2JKQA 2CMWA 5EHLA 3HGKA 2ITUA 2PVRA 3C5UA 3ZC6A 5HD7A 4UMQA 4UY9A 3LFBA 3RHKA 4W9XA 3FJQE 3DBCA 4ACMA 3ZUUA 4MD8E 1ZOHA 3G33A 5AR3A 2IF8A 3MFSA 4FKVA 4ACDA 3GC9A 2J0IA 1OUYA 3PYYA 4XG8A 4QP3A 5F95A 2VX0A 2O65A 4F6WA 2GNHA 5CEQA 3QXPA 4RJ5A 3COIA 3VJOA 1MRUA 3JXWA 4WNOA 3HP5A 3P1AA 1Q8YA 3W10A 1FOTA 4MF0A 5AM7A 4ANQA 3R2BA 3UVQA 3C4FA 3Q04A 4NZWB 3NX8A 4QMTA 5AX3A 2R3QA 1U54B 5BUIA 3ZZWA 4PF4A 2ETKA 4CT2A 3CTQA 2C69A 3PIXA 3IW7A 1BLXA 1OB3A 2UVYA 2UZNA 3PY0A 4G17A 4G9CA 5AA9A 1ZWSA 2C6EA 4HGEA 4X3FA 3ZU7A 1OITA 2RIOA 4EH2A 2CJMA 2ITPA 4DH1A 4QD6A 4AGWA 4F9WA 1R1WA 4B99A 4DC2A 1F0QA 3ZM4A 5C01A 5J9YA 2I6LA 4R5YA 4AOIA 4DFLA 3RZBA 2C6KA 2YCSA 2E9UA 3LW0A 4EOSA 5D11A 1RDQE 5CYIA 1KV2A 4MVFA 3C4CA 4GH2A 4EK4A 4U97A 3OOMA 2VTQA 4ZP5A 2BPMA 1U54A 4KD1A 3UOLA 3E8CA 3MPMA 4LQMA 4RIYA 1PW2A 5AP0A 3RI1A 2A4LA 3FMLA 4JG7A 3WE8A 3MFUA 4MBLA 1QPJA 2YAAA 5CXHA 4AA5A 4A9RA 4WNPA 4C4JA 3RWPA 4ERWA 5LVMA 1LPUA 5J1WA 4G34A 3W2SA 2ZM1A 4GT5A 2JDVA 2IZRA 4RWKA 4BCFA 3DFAA 2OH0E 2XIZA 4O21A 4BDBA 4NIFA 1U5RA 1GZNA 3OY1A 3ZONA 5GHVA 5CAUA 3MS9A 4YU2A 5GNKA 3TNIA 4BWKA 3MY0A 4FZFB 5KMMA 4M66A 4NW6A 4MD9E 4ZTQA 4YJTA 3R7VA 4C38A 2OWBA 2V62A 3PJCA 4KIQA 4DITA 2WMWA 4R3PA 3LFAA 4MAOA 3MN3A 3DV3A 2RL5A 3C13A 3E64A 4L3JA 4U81A 3RHXA 3Q5ZA 4XX9A 1AQ1A 5CVGA 2UZUE 2VTOA 5DE2A 4O4CA 2G2IA 3VS7A 4G3FA 4P90A 5HU3A 3OWKA 4E8AA 2G2FA 4FKIA 4IVDA 5M56A 4I23A 3QTRA 4PL3A 4IWPA 4B8MA 4ZY4A 4RVMA 3W8LA 5M4FA 1E1VA 5K4IA 3DBQA 1SNXA 4C7TA 4W9WA 2WMUA 4QMSA 5T3QA 4H3BA 3CR0A 3M1SA 3OC1A 2PZIA 4ZS0A 4CFUA 5EI2A 2R9SA 3KA0A 5DOSA 5EDQA 2YDJA 2I0EA 1DAWA 1MRVA 3BLHA 4AA4A 2GS7A 2F7EE 2BRHA 2Y8OA 3A8XA 4L00A 4F6SA 4NJ3A 3AD4A 3QQHA 3TWJA 4BTFA 2GU8A 2Y9QA 4ASDA 2YISA 3R8UA 4C35A 4RG0A 4I0RA 5JGBA 4J7BA 2XKFA 5CEOA 2Z8CA 1Z9XA 4KAOA 2WTVA 4RZVA 3R71A 3S2PA 5E91A 5LMBA 4CYIA 3UBDA 2PE0A 4U0IA 5C8KA 3BYSA 3NUXA 3S00A 4LOQA 2XS0A 4O2ZA 5J9LA 4KS8A 2PMOX 2R3MA 1OM1A 4Q5EA 4YJOA 3BE2A 4I20A 3OHTA 3FI3A 3GOKA 3FMNA 2BIYA 2RGPA 3WZUA 2Z7SA 5EYMA 4KB8A 4U41A 2R3FA 3SXSA 3UP2A 2FSMX 4K1BA 3AT3A 2AC3A 5TF9A 2VNYA 2H8HA 1W2FA 2YN8A 4OBPA 4WRGA 5F94A 3COKA 2VO7A 4PDOA 4FV5A 5K5XA 3BU6A 3TZ9A 5AUVA 4EZ5A 4XH6A 4ZLYA 3KXHA 4OTFA 3W2CA 5CTPA 4U9AA 5E8VA 2CGXA 4F0FA 2C6MA 5CEPA 3ORXA 3HDNA 2H34A 5CQWA 2WMBA 3P4KA 3QC9A 3F61A 3SW4A 5BUEA 4I0SA 4AW1A 1K3AA 3UNZA 4TWNA 3HUCA 4V01A 3W1FA 5HLWA 1UKIA 1Y91A 4W4VA 4YJSA 3KMMA 5AX9A 5HE0A 3QTQA 3POZA 1NVSA 5IH4A 2WELA 2X0OA 4QT1A 4FSMA 3EB0A 4JL9A 2EB2A 2BUJA 4H1JA 5F1ZA 2IVSA 3LHJA 4C4FA 4CYJA 4G31A 4EH6A 5I9ZA 4UXQA 4ASZA 3OBGA 2I0HA 4OTQA 1ZY5A 2J7TA 2VTMA 4M68A 4RLLA 4RPVA 4RZWA 4AUAA 4CLIA 1CTPE 4DN5A 2O3PA 4IZYA 5FEQA 4WBBB 1FPUA 4HNIA 2VAGA 3UMWA 3G9LX 2WMSA 1XKKA 2P4IA 3BHUA 1OPKA 4FGBA 4GEOA 4E6QA 4BWXA 2W1IA 2ITNA 5TO8A 3O51A 4X6QC 3PJ2A 4PMPA 2QR8A 3D14A 3MH3A 5E92A 4Z9LA 3F3TA 5H8BA 2JDOA 2JIVA 2CGVA 5D10A 4EOKA 3WI6A 4YNOA 3VO3A 2JAMA 3GENA 3NEWA 4OR5A 4F70A 2XKEA 2VWBA 2VX1A 2XM9A 5AP7A 5BYZA 3L8PA 4ALVA 3BGZA 3A7JA 1DI8A 3MSSA 1FINA 4O22A 4XV3A 4BKZA 1SM2A 4FTRA 5ANJA 3OBJA 1JBPE 3LFCA 5BPYA 4QMXA 1P4FA 3QF9A 3V5PA 4IM2A 3HA8A 2IZTA 4F7JA 2UW9A 4I0TA 3PFQA 3V8WA 4PWNA 2R3OA 3QRIA 2XF0A 2YLEA 4QMWA 1URCA 4V0GB 3IS5A 4D2PA 5AR8A 3EOCA 2HWPA 3R8LA 3UDBA 4AU8A 3RAHA 3BV3A 3CS9A 5H8GA 4NTTA 1WBVA 4FI1A 4TY1A 3NUYA 1YXTA 4YGAA 3ZBXA 4RQVA 3A60A 4BI2A 1RE8A 2F2CB 3ZOSA 3KB7A 4EK3A 2VTJA 5G1XA 4QMNA 4FV3A 3ELJA 4O4EA 3F3ZA 2XB7A 2BAQA 4K8AA 3QA8A 2VWXA 3KMWA 3QX4A 4BICA 5HBHA 3QC4A 2BRBA 5HE3A 5LVNA 3EIDA 4JQEA 3PXYA 1XBCA 5ETCA 2LAVA 4I41A 4J53A 2F57A 4B4LA 3PP0A 4F1TA 3OWPA 4CKJA 2YM7A 3LCOA 4QTEA 3BCEA 1ATPE 4RX9A 4QMOA 2HCKA 1M7NA 3GCQA 3QLGA 3R63A 4XG6A 4AT3A 5ACBC 2XMYA 3E63A 3P23A 3RK5A 3QZHA 5K4JA 3OWJA 5BQ0A 3TNQB 3MH0A 5HVJA 4UALA 3VAPA 4BCPA 4AZVA 4FR4A 4XOZA 2WD1A 2IWIA 4IZAA 3ZDIA 4ZEGA 3ENHA 5HIEA 5EK7A 1WVWA 3EKNA 1YQJA 3FPQA 5CU4A 4DCEA 2XK8A 3QFVA 5AIRA 3F7WA 4FT5A 2XNPA 3QTZA 4BGHA 3ACKA 2OW3A 3PVWA 4CKRA 3R21A 5AV4A 5HCYA 5L2QA 4E4LA 5LMKA 3NR9A 3EN5A 4LGHA 1S9IA 2BVAA 4C4HA 1A9UA 2QNJA 2WKMA 3CKWA 5CASA 2GNLA 3BQCA 2PVNA 3RK9A 4IAAA 4ZOGA 4YHJA 1HCKA 3CQWA 4LOPA 4JX7A 3QUDA 5JZJA 3FUPA 4IFGA 4W4XA 3VC4A 3L9NA 4EH7A 4GG7A 3OWLA 4FK3A 4G6NA 4HZRA 4X7QA 2XK6A 3T3UA 3ROCA 3OS3A 4YP8A 4K6ZA 3RP9A 3FBVA 5TE0A 1JSUA 1YW2A 2OFVA 4EWQA 3R7EA 2OZAA 1UKHA 2W4KA 3OCSA 4A9UA 3G6HA 4FL1A 3UQGA 5J5TA 1PXLA 1H1SA 1PMEA 2A98A 4ZTLA 3FPMA 4F63A 4RIOA 4R3CA 4DG0E 3G51A 4QP2A 2VWVA 5CSWA 3P78A 4YLLA 4APPA 3E3PA 5F20A 4AWIA 4CCBA 1VEBA 1YHSA 3MIAA 2OH4A 4V05A 4C34A 2LGCA 1GIIA 4BYJA 3DA6A 4P2KA 3UVRA 5CAVA 4LRJA 4BDKA 5IA0A 4I5CA 2BZKB 1KSWA 2WTKC 3GGFA 4RA4A 4X0MA 3R7OA 4BYIA 4E4XA 4AXAA 2YAKA 4OTGA 5KHXA 2FO0A 2Y6OA 4A4XA 4FT3A 4FL2A 4KBKA 3AD5A 3D5XA 4PQNA 4TYGA 3IGGA 3F5XA 4B9DA 3AGLA 5FD2A 3LXNA 1TZDA 3QHWA 5AR2A 4HPTE 4P7EA 5A46A 2X2MA 4BCHA 4QP7A 3KF4A 2R3RA 3GU4A 3MB6A 2PE1A 2FYSA 4IADA 4MQ2A 3VHKA 2E9PA 1KOBA 3PRFA 2VTNA 4E5AX 2ACXA 1YWNA 4ZTRA 4J97A 3DKFA 3FZ1A 2F49A 2PVJA 4I4FA 4LUDA 4O0UA 3CKXA 1URWA 4LRKA 4M84A 3W32A 5AAEA 3RM6A 3UO4A 2CKEA 4P5QA 4X2FA 3UNKA 4FV0A 3GNIB 4IC7A 5DR9A 5HTCA 1GY3A 2WAJA 2BIKB 1ZY4A 1JPAA 3BYUA 4NWMA 2CPKE 5KZIA 1IG1A 3MPAA 1J3HA 2C1AA 2UV2A 3BYVA 3PG1A 4Z16A 5ITAA 3EH9A 4CV8A 3QHRA 3PJ3A 2HYYA 1Z57A 1KE6A 4S31A 4ZY6A 3ZLWA 3R8ZA 2RFNA 5KX8A 3DKOA 3CEKA 1PXMA 1H28A 1GOLA 2WHBA 1WVYA 3UP7A 4NCTC 1FVVA 4E93A 4AF3A 5A9UA 4X3FB 3UC4A 5HLNA 2BZJA 4ZSEA 1RJBA 4XV9A 3WBLA 4IVAA 4F1MA 2B55A 3EHAA 3BIZA 3SKCA 4R1YA 3QQGA 3KXGA 2J9MA 4UV0A 4ZZMA 3O8TA 3ZO1A 3GEQA 4LL0A 3SOCA 5CEKA 4FG8A 1Q8UA 2B9IA 2V22A 3BE9A 5DA3A 5ANGA 4KBCA 2PHKA 5C1QB 4IANA 4HOKA 1ZOEA 4EHZA 3VS5A 4FTCA 5IUGA 4M67A 2I0YA 2WO6A 4RQKA 2GPHA 2WMVA 4BB4A 4X2KA 4L7FA 3TNHA 3L1SA 2C6LA 2JKOA 3O7LD 1P2AA 3JY9A 4L7SA 4JAJA 2FUMA 4QNYA 3LFNA 2PZ5A 3OZ6A 4EHEA 3ZRLA 1R78A 3LJ2A 2X0PA 4MXCA 5HORA 2JBPA 4R3RA 4EI4A 1KOAA 1H1QA 3QXOA 3HP2A 3BZ3A 3VBYA 4BCGA 2W1HA 2XK4A 5CS6A 3ZXTA 4AZSA 3NYNA 3QWKA 4FYOA 4XS2A 3AGMA 4MBIA 2W9ZB 2PMNX 3KULA 5H9BA 3HUBA 3M42A 2G9XA 5E90A 4OTPA 1P4OA 4BDCA 4L43A 5KMLA 3UO5A 4LOOA 1YKRA 2E9OA 1H27A 4KNBA 3VW8A 5IG1A 2C6OA 3NNWA 2XNGA 4FSNA 3FZRA 3VUDA 5HG5A 3MH1A 5FTOA 5L6WL 3NDMA 2XK7A 3LFEA 1XH4A 2UZVA 3PXFA 3EFJA 4AFJA 4DEIA 2C0IA 2BMCA 4YPDA 5HO6A 4I92A 2ZB0A 3TUCA 5CALA 5GJFA 4G16A 2J0KA 3TXOA 4J98A 4O0RA 4ERKA 2GNFA 3MVJA 4OTWA 2UZLA 2JC6A 4ACHA 4BN1A 3HDMA 3FXXA 5D41A 3AG9A 4FKQA 1PY5A 4BBMA 4NK9A 4M0ZA 4IAKA 3UIMA 3F5UA 2VTLA 3R1QA 3OW4A 5ETFA 3F7ZA 1IASA 3SXFA 5C8MA 4PTGA 3DLSA 4ZJJA 4FSQA 4JDKA 4E1ZA 3PP1A 2XBJA 3VNTA 4F65A 3T3VA 1H25A 1R0PA 4CLJA 3UE4A 3FZSA 2UZDA 5CLPA 5M44A 4C4EA 5KMJA 4XRJA 3PXKA 3V6SA 4EKLA 4S30A 3QKMA 3ORPA 3KKVA 4G2FA 3ZLYA 5AIKA 4CTBA 5IUHA 2PMLX 4CZYB 4LV5A 1Q99A 1ZRZA 2QHMA 3F66A 4O6EA 3U4WA 4YJRA 3VF9A 3R8PA 2P55A 3G2FA 2OG8A 2QD9A 2WIPA 4WKQA 3W2OA 3AC2A 4FA2A 5TKDA 5AUZA 2QOIA 2BILB 5A6OA 3ACJA 2VZ6A 3RWQA 4L68A 2BHHA 4CNHA 3FHRA 4RC3A 2EWAA 3VRYA 3Q4TA 4C36A 4WSQA 1VJYA 1Y6BA 3K5VA 5KBQA 2PUUA 5IUIA 3FMHA 3MWUA 2X0GA 3MTFA 1OIQA 4MTAA 4OAUC 2UW7A 5GZ8A 3ZRMA 4CVAA 4L9IA 3BHHA 4XOYA 1Y6AA 1SVEA 3G0EA 3KK8A 4O4BB 3VHEA 5BYYA 2E9NA 3C1XA 3KQ7A 2IW6A 2KTYA 4JAIA 3UZPA 5CSPA 3FSKA 3LFQA 3PG3A 4QYHA 4F7SA 2WXVA 1NA7A 1I44A 4L53A 2VTSA 1PMNA 4ITHA 3IW5A 3GI3A 4BHNA 4W8DA 4IAZA 1OKYA 4Y85A 2X8IA 4GCJA 5I9YA 4JI9A 3IW8A 4FKSA 3QCSA 2X39A 2GNJA 4A4LA 1H1RA 4W8EA 2C0TA 2FGIA 3CQUA 5LMAA 3DAEA 4L8MA 5CNOA 3DDPA 5HESA 3VS3A 3AOXA 3QU0A 5EM7A 4I6BA 3NYVA 2QOQA 2RKUA 4GW8A 2FSLX 3U9CA 5JFWA 4OT5A 3O8UA 3BBWA 4CMUA 3HV3A 4DEHA 3N51A 2DYLA 3T9TA 3O2MA 5AUYA 3C9WA 5M53A 1GJOA 2J5FA 4XRLA 5DR6A 1BX6A 5IMEA 1Q8ZA 3LM5A 4FTOA 2XZSA 2NO3A 3UIBA 3U87A 5HGIA 5LWNA 2BAJA 2R3PA 4QMZA 5FP6A 4IAFA 5LCJA 4APCA 3D9VA 2WTWA 5JN2A 2UW0A 5HQ0A 4PTEA 2VGPA 3MI9A 4EH4A 5J87A 4JOAA 2OJJA 4MQ1A 2P33A 4JIKA 2R3LA 3LQ8A 4RJ4A 2B52A 3MJ2A 3HRCA 2H9VA 5CQUA 1BL7A 4DH3A 1YXXA 3CTHA 1V0BA 4AZTA 3BHTA 2GNGA 2J2IB 3EQPA 3UIUA 2CHLA 4ZY5A 1J91A 2YIWA 4GYGA 4A9SA 4FKOA 5EI6A 3COHA 3NW7A 4X2NA 4IZ5A 1LEWA 5HVYA 5E8SA 2PZPA 3SV0A 4C3FA 3TZMA 4G5JA 4MH7A 3PA3A 3EQDA 4YTFA 2J0JA 4MNEA 3FSFA 3GOPA 4H39A 3QCQA 3R9HA 2W05A 3TG1A 3MY1A 2OSCA 1ZXEA 3QD4A 2IVUA 3BLQA 4FTNA 2C3LA 2GHLA 3L8XA 1UWHA 3UTOA 4RMZA 4DG3E 2QU5A 5IEYA 3BEAA 3BELA 3FYJX 4L46A 3HMIA 3EKKA 4XP3A 1ZZLA 4C4GA 4EEVA 4K33A 3A7HA 3Q2MA 2VTRA 2XIXA 3ZH8A 3S1HA 2OJIA 1QMZA 5EDRA 1WZYA 2XK3A 3OY3A 4B0GA 2PY3A 4LRMA 1KE7A 3F9NA 5CANA 2WQBA 2WTDA 5C9CA 4ZJVA 2G15A 2HZIA 1CM8A 3C0HA 3K3IA 3KRWA 5DGZA 1ZYSA 3K2LA 2JKKA 2PZRA 3CD3A 1JVPP 4TXCA 4O4FA 5AV1A 4BBFA 4JX3A 4TWCA 2WEVA 3D83A 3V5LA 4AN2A 3DKCA 4ID7A 4LMUA 4DBNA 4D1ZA 4X6RA 2QKRA 3BGPA 3QUPA 5L2SA 1H1PA 3FAAA 5HICA 3KC3A 3MBLA 4RRVA 3QUEA 3R7YA 4AOJA 3TT0A 5D7VA 3DLZA 4C37A 4AT4A 5LQFA 3S95A 1M2QA 4PMMA 5B2KA 2AC5A 4FSTA 4J52A 3MGYA 3IDCA 3HRFA 4DTKA 5AADA 4FL3A 4MKCA 3O96A 4IJPA 3DZOA 4FZ7A 3Q60A 4CXAA 2EXEA 2CN5A 3UJGA 2NP8A 1KE9A 3EFKA 4ASXA 4U7ZA 5AUWA 3KXNA 3UYTA 5CF5A 2QCSA 5CVFA 1APME 2GTMA 3GU7A 2AUHA 1BL6A 4D0WA 3ZEWA 2OO8X 2KULA 3VVHA 4DLIA 4BDEA 2WOUA 2GFSA 2VTIA 3E8DA 4O6LA 4U44A 1VYWA 2JKMA 4YZBA 4AX8A 4D1XA 3DK6A 2WTIA 3I6UA 3QALE 4HYUA 4IWQA 4AZEA 3P9JA 2ZVAA 5DEYA 4BL1A 2IJMA 2VWYA 4MD7E 2XKDA 5HX6A 5D7AA 3QAME 3DXNA 3EFWA 4M8TA 2Y4IC 4E5WA 4PMSA 3HVCA 4AW2A 1W84A 1LUFA 1XJDA 4JVGA 2X81A 3EWHA 3RVGA 2YLFA 2C5NA 5JFVA 4TYHA 4IMYA 4IFCA 3R8VA 2GMXA 3OROA 4NH1A 4D1SA 2UW5A 2UUEA 2BTRA 2JDSA 4ASEA 3HV5A 1H08A 3C0GA 2XNOA 3M2WA 3OW3A 4KKHA 5HBJA 2XIKA 4CFXA 5CI6A 1H07A 2ITZA 2WQMA 2ZDUA 4D2VA 2BALA 4IB0A 4QQJA 3EYGA 2QOBA 2QURA 3QQFA 5AWMA 4FKJA 2XP2A 2ITVA 3E3BX 4MX9A 3R2YA 2WTKB 3KRLA 4I3ZA 4YZDA 3ZSIA 5KKRC 3QQUA 4GJ2A 5H2UA 3WF8A 3FLNC 3PLSA 3NW5A 2QLUA 4YR8A 3Q53A 3VJNA 3ZSHA 1XR1A 3DBFA 3R7UA 3GC0A 1V1KA 1XH8A 1STCE 3DPKA 3L8VA 1H24A 4M7IA 4FIEA 4YTIA 4AAAA 3H9OA 5EDPA 4CQEA 3QRKA 5DFPA 5CSXA 3COMA 2WEIA 3HV6A 2UVXA 4LUEA 4MWIA 3LXKA 4EHVA 4GK3A 4ANSA 4WG5A 4EH3A 3R73A 4ITIA 2FH9A 2PVLA 3H0ZA 3P86A 4E5BA 1SYKA 4DFNA 4ANMA 2XJ0A 3FV8A 4QQCA 5EM6A 2EB3A 2OU7A 4J95A 1ZMUA 4WG4A 2HZ4A 3WF5A 5E8XA 5AR7A 2GSFA 3WIKA 4NEUA 3NYOA 4GL9A 5EOBA 3HYHA 4O0SA 4B8LA 3EN7A 4YZCA 1YHWA 1JQHA 3WYXA 4CFFA 5CF8A 2J50A 4TYHB 4LYNA 4CEGA 5AP5A 5BVKA 2W96B 5EI8A 3PVUA 4FIGA 4NSTA 3RGFA 3AC3A 3IW6A 3PXZA 4FOCA 5E1EA 3QQJA 2EVAA 3V01A 1GNGA 2R3IA 4KRDA 4OUCA 3GP0A 2H96A 4RC4A 4OW8A 3QD3A 3A4OX 4JBPA 3WF7A 5HG9A 2BRMA 3MVLA 4H36A 4QQTA 5CAPA 3II5A 3A61A 2ITTA 1KV1A 3MPTA 4FYNA 4IVBA 5JZNA 5E8UA 3R1SA 2PZYA 4I24A 5HLPA 4BKYA 3UIXA 4UZHA 4ZLOA 4FKTA 4EOOA 4MXOA 4EJNA 2VX3A 4FK6A 4IX6A 4A06A 4CMTA 3UPZA 4FEQA 2XRWA 1OKZA 3H9FA 3KGAA 3IPHA 3PSBA 5IISA 3LCTA 1YRPA 2YHVA 1ZYLA 2QHNA 2XYNA 5D9HA 3P5KA 2HXLA 2VWWA 4XG9A 2WNTA 5HO7A 2J5EA 1YWVA 3DAKA 4KINA 2C5YA 3GFWA 5EW8A 3D7TB 4ALWA 3OXZA 1UNLA 4IM0A 4KIKB 3MIYA 5LCKA 3BRBA 5M57A 3EL7A 3LFDA 4LI5A 3ROYA 3IOKA 2O8YA 3AC1A 3BWJA 3QLFA 5BVEA 4E4MA 3NAYA 5CU2A 2ZJWA 3BU5A 3KCFA 1UV5A 3ZYAA 3PWDA 5JRQA 3QZFA 4Z7GA 4IX3A 4RIYB 4A4OA 3A7IA 4NFNA 4FV6A 5I4NA 2P2IA 2XEYA 1W0XC 4XCUA 5EW3A 4AN9A 1XHAA 4XJ0A 4AGDA 5HKMA 3BHVA 5F4NA 2VRXA 1OZ1A 3AC4A 4Y5QA 5L8JA 3AT4A 4GRBA 4WO5A 3OEFX 1HOWA 5L2TA 3GT8A 2JITA 2UZOA 4RFYA 4FV9A 1WBPA 2VTPA 4TW9A 3ORTA 4WNKA 4RWIA 4UMUA 1CMKE 3KXXA 3IECA 4UWYA 1H26A 3CC6A 4BCKA 4EK8A 4OTIA 1M14A 4C59A 3W2QA 4ZLZA 3DK7A 1OGUA 3FLYA 2YABA 3VUMA 4C58A 5A14A 3FY2A 3QYWA 3TTJA 3VS6A 3CQEA 4PDSA 4ANOA 5J9ZA 3BLRA 4BVUA 1UU9A 5CX9A 4HGSA 4K11A 2WGJA 1IEPA 4U79A 3Q4CA 4YBJA 4RVKA 5FWKK 4C3RA 2XRUA 1Q41A 3WF9A 3NLBA 2FSTX 4NTSA 4PPCA 4XLVA 4D55A 4QPAA 3B2WA 4C61A 4Z3VA 1G5SA 4A9TA 1WMKA 3PXRA 4EZ7A 3Q9ZA 3A4PA 3E8NA 3VIDA 4XLIA 5HD4A 3UO6A 4EOLA 2X8DA 4R6VA 2WPAA 3LE6A 4BDFA 1DS5A 1V0OA 1XBAA 5I9VA 3MFRA 1Z5MA 4IDVA 2BHEA 4QPMA 4HGTA 4YSJA 3WIGA 3Q9WA 3F5GA 4L45A 5DN3A 1TKIA 5ETIA 2YCQA 4YC8A 3RZFA 5CSHA 3W55A 4DH7A 4EOMA 4FF8A 3VUIA 3MW1A 3CGFA 5FDPA 3R83A 4YO4A 3ZXZA 4L44A 4RX5A 3LPBA 2VTHA 3K3JA 4W4YA 5JFXA 4Y73A 2QODA 3ULIA 2ITXA 4YBKA 4GVJA 2YERA 1Q62A 2X0QA 5BVNA 3A7FA 4OTRA 3THBA 5KMKA 2CN8A 2XJ1A 5FM2A 5BMSA 1ZZ2A 3C51A 5KNJA 1U46A 3Q6UA 4O0TA 4ZTSA 4EORA 4B6LA 4NW5A 3BHYA 4V04A 4XHKB 1OL2A 5HX8A 3DQWA 3LAUA 4YTHA 4MCVA 2V5QA 5KO1A 3G5DA 1TVOA 4OTDA 5DRBA 5AP2A 3TKIA 4MK0A 2DS1A 3UPXA 4FV8A 4KIKA 5KBRA 2F9GA 3QL8A 3R7IA 3C4XA 2XEZA 3OP5A 4FOBA 4MXAA 3E93A 2QOOA 4G3EA 3EQBA 3HMNA 2QC6A 3T9IA 5C27A 5A6NA 1M7QA 3FY0A 4PPAA 2PSQA 4O96A 2PVKA 4XYFA 4F0IA 1TQIA 4K0YA 3DS6A 4PNKA 4BF2A 4G3DA 2CCIA 3ORKA 2HIWA 1OUKA 3SC1A 4JT3A 5JK3A 2FSOX 1MQBA 2R3NA 4GYIA 3TZ8A 4D4VA 2EXCX 2ZM3A 3R8MA 2X6EA 5AA8A 4C0TA 3TCPA 1PMUA 4ITJA 2RF9A 3TIZA 3KXMA 4I6FA 3RMFA 4FT7A 5FXQA 3BBTB 4EUUA 5DHJA 1H1WA 3OT3A 2QO2A 3LFFA 4CQGA 4X2JA 3P79A 5EYKA 1OIUA 1M17A 3LCKA 4IBMA 4QMUA 4UBAA 4KIOA 4XMOA 4ZXTA 3IK3A 3TZ7A 3V5WA 3MVHA 3HMOA 4GFOA 4KKEA 2C3IB 3G9NA 3LJ1A 5LVPA 4PL4A 4OTHA 3ZCLA 3CD8A 4RC2A 2I0VA 3RAWA 2ITOA 4IH8A 3UVPA 4BIDA 4ONAA 2W1FA 1SVGA 5ANIA 4BIBA 4B7TA 4DH8A 4G6OA 3QCXA 3SDJA 4EBWA 2HY0A 2W5BA 4I6HA 4XG7A 4GMYA 5HNGA 4JR7A 4ZIMA 4USDA 3D5VA 4TYJA 5BUJA 2V7AA 3IOPA 4ACGA 4DEBA 5GJDA 2GNIA 3TEIA 2WMXA 5I0BA 4QPSA 1W2DA 5CAOA 2RFSA 4G3GA 2PL0A 2RFEA 4QP9A 5EYCA 4DG2E 4EYMA 4G3CA 4MXXA 2WOTA 4J1RA 4QRCA 3V5TA 5JFSA 5BVFA 4FRFA 3OUKA 2XNEA 1A06A 2X9EA 3TKUA 1IR3A 2CLQA 3BI6A 4GVAA 4LMNA 5M4IA 1SNUA 3DB6A 1P14A 4H3QA 4IWDA 4FG7A 4TWOA 4U5JA 5I3RA 4EOIA 3I5ZA 1ZOGA 2R3HA 3JS2A 1Q3DA 4FKUA 3ANRA 4BC6A 3OG7A 3KMUA 4F08A 4X3JA 1JLUE 4EOQA 4L52A 4ZAUA 5JMSA 3GFEA 2I40A 3CGOA 3W8QA 3PVGA 4W4WA 4I6QA 4WUAA 2W4JA 1OIRA 3I60A 3QKLA 4XBUA 2PWLA 4QYYA 3SX9A 3MTLA 4EHGA 5FBNC 1OVEA 3RM7A 1P5EA 5EM5A 3VBXA 4F9BA 4QMVA 3HV7A 4OBOA 2XCKA 3AMBA 2NPQA 3DBDA 3B2TA 1W8CA 4XV2A 5HG7A 2O0UA 3FI4A 5L2WA 2B53A 1B38A 4GFMA 2VU3A 4BCOA 4PX6A 3VW6A 1FVRA 5EFQA 3R22A 2B54A 4J8MA 4EL9A 4JNWA 4FTUA 5L3AA 4EKKA 1GZOA 2JFLA 2QO9A 4YJPA 4O27B 2DQ7X 3PIYA 4FIJA 2W4OA 4F09A 5L8LA 3VWAA 5ETAA 4NM0A 1NVRA 4RT7A 2ITQA 3EQRA 5J95A 3CBLA 3FQSA 3QCYA 4Z55A 5KUPA 3MV5A 3FXZA 2YM4A 4TYEA 3F2NA 5CU6A 2OBJA 2CSNA 2YFXA 1PXOA 4NFMA 5CVHA 4TKSA 4WSYA 5EHOA 3R9OA 4CTCA 5B7VA 5E7RA 2Y4IB 3DCVA 3QKKA 2W5HA 3TN8A 4FKRA 3ZSGA 3B8RA 3LJ0A 3PPJA 5LMKC 1L3RE 4WNMA 4R1VA 2G01A 3F5PA 2WMRA 3JPVA 4TL0A 5JT2A 4G6LA 4EK6A 2RFDA <