4BFMA

The crystal structure of mouse pk38
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
313
Chain Sequence
KDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKCGSLAYAAPELIQGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title The Structures of the Kinase Domain and Uba Domain of Mpk38 Suggest the Activation Mechanism for Kinase Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 95
structure length 313
sequence length 330
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bfmA00
4O22A 4BDAA 5LMBA 4DFZE 1NVSA 1YXUA 3GI3A 5LWMA 3ERKA 3FZ1A 3QCQA 4FNXA 1Q4LA 4HPUE 3GT8A 5GZ9A 4QYHA 4FUXA 5AP3A 4BGHA 5JKGA 4G5PA 2B1PA 4BYJA 1F5QA 2OJGA 3BYSA 1IEPA 3L8XA 2ITZA 1YWRA 4RX5A 2V22A 5F1ZA 3FMHA 4TKSA 4ANSA 3CTJA 4LYNA 4EC8A 1WBWA 4L00A 5E91A 1M7QA 3HLLA 3FLNC 4YTCA 5L8KA 2UW4A 4WNOA 3VIDA 2C4GA 2VAGA 3Q4ZA 3VS5A 5C26A 5AA9A 4W4XA 2JLDA 3E3PA 2WQMA 4DTKA 3ORLA 3OCSA 2F4JA 4KS7A 4QTBA 1GY3A 2JKKA 3WILA 4OGRA 2YIYA 4UXQA 4QTCA 3WIKA 1OZ1A 3HUCA 3TKIA 3HMIA 4QTAA 4YP8A 3WYYA 3BHYA 3TJCA 4TN6A 5C27A 3TTIA 5IUGA 1Q8WA 2YLEA 4IMYA 3R9HA 5EI8A 4FZ6A 5KMNA 1OL6A 2R3LA 3FJQE 3AOXA 2XP2A 4DLIA 1SNXA 4FICA 4FUYA 3GOPA 3HV6A 2QOLA 4RIXB 3R01A 4BGQA 2YM4A 5LOHA 2BHHA 3GC7A 1OIQA 2OJJA 3CCNA 4QP6A 3GQLA 1H0WA 4AAAA 3LQ5A 4AXAA 3NW5A 4CXAA 4DEHA 5AM7A 2PZRA 3KEXA 2R0UA 2OW3A 2PVHA 2W1GA 4BCNA 4QTEA 4FT0A 3DXNA 3QWJA 5DFPA 2VNWA 5EDRA 5FDXA 2KTYA 4LOQA 2UZLA 4FEQA 2F2CB 2UZEA 4EUUA 1MRUA 3F66A 3AMBA 2WTKC 1RE8A 3GEQA 4GFMA 4NTTA 4X0MA 5C9CA 3PPJA 3W2OA 5DEYA 5AP2A 4OBPA 4F9CA 3IW4A 3ZXTA 5IPJA 2V62A 3UOHA 3E7VA 3FC1X 5CF8A 4YO4A 4YLKA 2BTSA 4KNBA 4AQCA 5HLNA 4FOBA 2PMOX 3R2BA 3FI4A 4GJ3A 4EONA 3C1XA 3VBXA 3HYHA 4MBJA 5CVFA 4XP2A 5KKRC 3F5UA 4QO9A 1T46A 3FZTA 4UN0C 3FMEA 3QTSA 3W16A 3OF0A 4IW0A 5I3RA 3QTWA 2G2HA 2BDFA 3EN9A 3A7IA 3Q96A 4IVCA 4F4PA 4Y73A 4BDGA 3IECA 3R7OA 3MSSA 2RFDA 4LMNA 3EL7A 4TYJA 2XJ2A 3FMLA 4FV1A 3WF8A 3KA0A 5E8UA 3FXZA 1Z57A 3ZUVA 1NVQA 3AXWA 4FKRA 2GMXA 4GK3A 2PZPA 5CS6A 4Q2AA 2ITPA 5A9UA 3EJ1A 3QLFA 2W9FB 3BV2A 3QTIA 5ANOA 4M12A 5HESA 4HCTA 3FLSA 4ERWA 4M0ZA 5AAFA 5HEZA 3MA6A 3ROYA 4RJ8A 3MA3A 3QGWA 3JY0A 4HVIA 4BCOA 2OO8X 4NZWB 4USDA 4ANMA 4AA0A 3Q2MA 5D7AA 4V05A 3I5ZA 2WB8A 4YJRA 5D41A 2C68A 1OL1A 3PVWA 5HO8A 3EWHA 3QTUA 3RAWA 3ZSGA 5D12A 2UZWE 3SDJA 2PVYA 1KWPA 4FR4A 2V5QA 3SQQA 4ITIA 4AN3A 1B6CB 3UZPA 4P4CA 4IX4A 1IA8A 1FMKA 4LRJA 2X2MA 1SVHA 3VHEA 5CXZA 5HO7A 2VTRA 4TT7A 4J96A 4Z7HA 3C4FA 1P4OA 4IWQA 5LQFA 3LMGA 2YA9A 4RRVA 4F7SA 2OZOA 1PXPA 4FTLA 4XG6A 3UTOA 1ZARA 3TKHA 3EKKA 4F64A 4FV2A 1WBTA 2YLFA 4X2NA 4JDIA 5I9WA 4H39A 5DOSA 3TI1A 1Z5MA 4FTRA 3FUPA 5HLWA 1GZNA 1JOWB 1PJKA 2WTKB 4KRCA 4MVFA 3RP9A 3VF9A 5CEPA 4CFNA 2Z2WA 2OIBA 3E7OA 3JUHA 3CJFA 2XYNA 4MNFA 3ZDIA 4A4OA 4F1TA 2QOQA 5A6NA 4UZHA 5EDPA 5KMOA 2VV9A 2PVMA 3KU2A 2C6IA 4XG3A 4M66A 4YJNA 4O21A 3H0YA 4EK8A 5AX3A 1AQ1A 5EOBA 5TOZA 1WMKA 4HVSA 4XHKB 1WFCA 3BYUA 5KKRB 4XG4A 4MXZA 5DRBA 4S30A 5ANJA 5HG8A 5IH6A 3HMNA 1AGWA 1W83A 4J1RA 1JQHA 2X8IA 5AADA 4F7NA 1HCLA 3DFAA 2PE1A 3CLYA 3ZUUA 5AEPA 4GFOA 3KXGA 3KN5A 3M11A 4I0RA 4NW5A 3HMPA 2QR7A 2W1CA 2YCRA 4LUDA 3FWQA 2W4JA 3R8MA 4LRKA 4O2ZA 2NRUA 2XIRA 3QTZA 4I94A 2IN6A 4PF4A 3PE1A 3KCKA 2XNNA 2E9VA 5JSMA 3E8CA 1UNHA 5HTBA 4M68A 3OWLA 2YWPA 3BEGA 5CVHA 3BU5A 4V01A 2JFLA 3CTQA 4BIBA 4E73A 2B9JA 4JI9A 4YR8A 2X0GA 1V0PA 3POOA 2C1AA 5HU3A 4WUNA 5KO1A 3QD4A 5L6WL 1UVRA 2QOFA 4BZDA 4BDKA 2WTWA 4D2SA 4G31A 3VS1A 2F49A 2VU3A 1PMUA 4LRMA 4I23A 2XBAA 4A4LA 3VVHA 2XM9A 4AOJA 3DJ6A 2J5EA 5KCVA 1MUOA 5ICPA 3Q6WA 4TYHA 2GNLA 3GCSA 1K9AA 5GHVA 3PVUA 4V04A 5EHYA 2KULA 3ANQA 4C35A 2C0OA 3AT2A 5GZ8A 5L8JA 3RK9A 5AV4A 5LMKA 1Q97A 4G6NA 4KKEA 4DEEA 5IEXA 3BLQA 5L8LA 1ZXEA 4WNKA 3RAKA 4A07A 5T68A 2YERA 5EK7A 2WTDA 1W84A 4PV0A 2JDRA 4BDJA 4DC2A 3V51A 5J9LA 3KXHA 4W4YA 1QCFA 3V6RA 4IAFA 5IU2A 1P5EA 4MXCA 4TNBA 2V7OA 2EU9A 2J4ZA 2WGJA 5KUPA 4W9WA 4G3GA 4N4SA 3CGOA 5E92A 2B9IA 2RSVA 4PY1A 4LL5A 3VBYA 5FEEA 1PW2A 3OCGA 4EHZA 4KB8A 3MB7A 3MY1A 5ETAA 4PPCA 1V0BA 4TWPA 4O1PA 4IVDA 2X6DA 4FX3A 2YZAA 4EWQA 2UVZA 1UKHA 3MH3A 2J50A 4F7LA 3FKOA 5CEIA 3UOJA 4TWNA 4I6BA 3SOAA 4GV1A 2Q0NA 3HV3A 1SYKA 2A4LA 3LVPA 4L52A 4E6QA 3FQSA 3LLTA 3NUYA 2Y4IC 4G5JA 4FKOA 4BTJA 3P9JA 2BFYA 5FXSA 2QONA 3UP7A 4AUAA 3BYMA 3HP2A 4KA3A 3IK3A 2Y7JA 2QU6A 4IZ5A 4II5A 4KAOA 2E9PA 3M42A 2X8DA 3TV6A 4LL0A 1U4DA 1YOJA 3CKXA 1XKKA 1ATPE 4LQMA 4CCUA 3LM5A 2X1NA 4EBWA 1ZMVA 4B99A 2CGVA 4QMOA 2UW6A 4FTKA 2QCSA 4TTHB 3LXLA 4XOZA 3REPA 2WO6A 4YUQA 2ZMCA 2A0CX 1Q3WA 3U9CA 4DGNA 5IA0A 4C37A 1J91A 3LCKA 5L2IA 2CHLA 4EOKA 3R71A 4J97A 3FSKA 4FV7A 4IAYA 4LGHA 1W98A 2XS0A 3CTHA 1M2RA 4EZ3A 4IAAA 4U79A 4XS2A 5KZ0A 3AGMA 1ZYSA 3FKNA 4RMZA 2OICA 5HBHA 4EK6A 5CF5A 5HU9A 4YJUA 3OXZA 1YHVA 2WMSA 1G5SA 2P2HA 4F6UA 1A06A 2XF0A 3LXKA 5E8WA 3Q4UA 2JC6A 1B38A 3K54A 1DAYA 1MQ4A 2DYLA 5J9YA 2GQGA 4GK2A 2WU7A 4IANA 4J52A 4CFVA 2IWIA 4BI0A 1S9JA 5HD7A 4GH2A 4AS0A 1P14A 3QTQA 5T6KA 2WELA 5AP1A 2XK6A 3EYHA 4BTFA 4KKHA 3BE2A 3OXIA 3QAME 3VBTA 3MVMA 2G2FA 4G1WA 3W2PA 4NJ3A 2IZUA 4CFFA 2E9OA 2ZM4A 1H4LA 2R3OA 2JIVA 4RVKA 4CFUA 4FKIA 3ALOA 4NKSA 4HVHA 3G5DA 3OWJA 4F9YA 3EYGA 5HE3A 3O2MA 4EK4A 3UZTA 3OT3A 3O96A 1SZMA 4JQEA 3NIZA 3GU8A 4CT2A 4F9BA 3DKGA 2AC5A 5CY3A 3FBVA 2UW9A 3LXNA 1DI9A 2C3JA 4QMLA 2W1EA 3I6UA 5AP0A 3DNDA 2QOOA 5IA5A 2WTJA 3O8UA 4MF0A 3UNJA 4D4VA 3H30A 3VUIA 2CCIA 3DA6A 2O2UA 2YM5A 2PTKA 4WUAA 3RNYA 3E93A 4E20A 2QO2A 3U4UA 3EQDA 2HZIA 4L46A 4O0XA 4R3PA 2XEZA 5FLFA 3EZVA 3VNTA 5C1QB 4X2GA 5DT3A 3ZRKA 5DE2A 1ZYLA 3ACJA 1YI6A 1E1XA 4Y5HA 4O91A 4BIDA 1H8FA 2WIPA 2YHVA 3QHWA 4HCUA 3UDBA 3WZKA 3ZRLA 3VUKA 2WMAA 3ULIA 3LE6A 4MBIA 3DAJA 4FSYA 2QLUA 2JKMA 4AT4A 5IA1A 4PMTA 2OG8A 5FBNC 5JGBA 3W33A 3C4CA 4WBBB 4XUFA 4H1MA 2EB3A 2OJIA 2UZVA 2C5YA 3N51A 5E8YA 2IJMA 2Q0BA 4GS6A 5EM5A 4XJ0A 4USEA 2ITVA 2YACA 5TR6A 2VX3A 3PUPA 3QUPA 5M51A 1Q8TA 3S3IA 3LJ1A 1LUFA 2BMCA 3ZS5A 1H1PA 4AN2A 2XVDA 3OTVA 3PA5A 3NW6A 2OF2A 2GPHA 3BQCA 3ZHPC 2GNIA 1UKIA 3EQHA 4NM0A 4EH7A 1PXKA 4EJNA 2NO3A 4O0SA 5HTIA 2GHMA 2H8HA 4DEBA 4GU6A 4QT1A 5GJGA 4C38A 2PY3A 4GFGA 4HZRA 3RZFA 3QZGA 4BKYA 4G16A 5HBEA 3SW4A 1Y57A 5FP6A 4DCEA 5EI2A 3PIYA 2V55A 1KE8A 3WZUA 2PZIA 2BRNA 4ZTQA 2YFXA 3KRWA 4K18A 5CYIA 4CD0A 4FKJA 1R0EA 3SXRA 4KIKA 4YC6A 3RWPA 4DG2E 5HZNA 3BYOA 4D4YA 4FTOA 4Q5HA 4RLKA 4ZXTA 3MDYA 1BYGA 2QOHA 4PRJA 2ZMDA 3IW8A 1ZYJA 2C0IA 3C0GA 3KB7A 3PIXA 3CPBA 4OTRA 4YBJA 5KMKA 4G3DA 3DY7A 5HG5A 5FDPA 2DUVA 3IW5A 3HNGA 5C8MA 1OITA 3IPHA 3DK7A 2NP8A 1Y91A 3QRTA 2C3KA 3GNIB 2R3QA 3ZSHA 3IW7A 4TYHB 2OH4A 4UYAA 4JIKA 1XWSA 5AR7A 3L8SA 1ZYDA 3Q53A 4JLCA 3TZ7A 1XJDA 2R0IA 3QRKA 3UYTA 5K5NA 2WOUA 4U81A 4BICA 3EN5A 4FKLA 3R30A 3RHXA 4ARKA 3EMGA 5J7HA 5L2WA 1TQPA 4YO6A 4P90A 2WHBA 3DJ7A 4YC8A 1OPLA 3BKBA 4TL0A 4AZWA 3F5GA 3G9NA 2OXXA 4QQTA 3R8PA 1LR4A 4WKQA 3V8SA 2BROA 4ZTRA 4CFXA 4ZOGA 4QP2A 2R3GA 3R02A 4EOSA 4JDKA 2VWXA 5AJQA 4LOOA 5EYDA 4TW9A 3O7LB 2VTPA 2XKEA 5K3YA 3S00A 1JSVA 4HYSA 3UIMA 4MH7A 3OUKA 4PUZA 4YNOA 2XZSA 2NRYA 1CM8A 1WBOA 2GHLA 4ZY5A 1BLXA 2QQ7A 2VTSA 3K5VA 3CR0A 3NZ0A 3PJ1A 3OROA 2RFNA 4JS8A 4MD7E 3PSCA 4MXAA 5IZFA 2A1AB 4NKAA 2QC6A 5IH4A 3PVBA 4PMMA 5CZIA 2HK5A 4PTCA 4IM3A 3TWJA 4FSRA 5JFSA 4HYHA 4BWPA 5DMZA 1GZKA 3WZEA 1GIIA 4HCVA 2UUEA 5IG1A 5AUUA 5A4LA 3FI3A 2BILB 1EH4A 3EFLA 3AMYA 1QPJA 3I60A 1JNKA 3OY3A 1W0XC 2VO3A 3VW6A 2VWVA 2CPKE 4X3JA 3DDPA 2VX1A 1XBCA 2R9SA 4R3CA 2YABA 2HENA 3SAYA 1YDTE 2X4FA 4D1XA 1PXOA 1Q61A 4D1ZA 1T45A 2XNGA 4FL3A 4G34A 3WIGA 5CF6A 5ANKA 5LXMA 3TV4A 4UMQA 3DK3A 2PZYA 4MXYA 3ZMMA 4QMUA 3G0EA 5HCYA 2FGIA 2VTHA 5BMMA 4FMQA 4KIQA 2O65A 3R6XA 5AR8A 2BZJA 2JBOA 3EFJA 3MFRA 4OTWA 4APPA 4CVAA 2ZDTA 5IDNA 5LWNA 2R64A 2YCQA 4NFNA 3ORKA 3WBLA 5F9EA 4DH3A 3KMWA 2P2IA 3EH9A 4ZEGA 4W4VA 2F7XE 2EXCX 3BHHA 2X2LA 5EM7A 5CT7A 2EB2A 5FRIA 5HHWA 3EHAA 2Y8OA 5DH3A 4CFWA 4EYMA 3LCOA 2ERKA 4KKGA 5AUYA 2BTRA 4GSBA 4BCHA 2ITXA 2C5NA 3Q9XA 2YDJA 4QMPA 1OECA 1PMEA 3QCXA 4L9IA 4BCJA 2I0YA 2I0HA 4FODA 5TF9A 2JBPA 1URWA 4WG5A 4IM0A 4MXOA 1JKKA 1JKTA 1P4FA 4F70A 4O0TA 4ZIMA 3P78A 4O6EA 4QMQA 1WCCA 3K3JA 4RJ6A 5HVKA 1JVPP 1Q5KA 2F57A 4JR7A 4KABA 4MTAA 3A4OX 4I5PA 3AD5A 1FVRA 2WD1A 3IOKA 3PRFA 4DYMA 3PIZA 2ETMA 4R5YA 3BWFA 3V04A 3DU8A 2IW8A 3V5WA 4DITA 4J99A 1XH9A 2XBJA 4RIOA 4I21A 2BFXA 4IBMA 4MWHA 4WIHA 2VTTA 2PE2A 3Q32A 1H00A 2R3FA 3GC9A 4WT6A 2IZRA 4XG7A 5D1JA 5L6OA 4I41A 4NU1A 2O8YA 3QU0A 3HMOA 4IFCA 5CT0A 5AV1A 2JDTA 3H9RA 2R2PA 4L7FA 5E1EA 3MPTA 5LVMA 3A99A 5BX0A 4L68A 2HYYA 4NSTA 2XK4A 5K4JA 5H3QA 5TE0A 4YJPA 4FKVA 4FT5A 3PXQA 4F65A 2JITA 1PMVA 3QCSA 4J98A 4NJDA 1PXMA 4FVQA 3G90X 3ORTA 4QMVA 2W1HA 5TO8A 3VAPA 4MYGA 5LJJA 1YQJA 2GS6A 4QP1A 2QKRA 3QL8A 4IM2A 3SXSA 4CYIA 2GS2A 3HX4A 4E6DA 5K0KA 2EVAA 4DFYA 3FMMA 5LCKA 2UW7A 2ITWA 3FQEA 4J53A 4OTDA 4U0IA 3V5JA 2GNFA 3DQWA 4BVUA 4IACA 3R04A 4K9YA 4PMPA 2JD5A 3CD8A 3GP0A 1GIHA 4EWHA 4RX7A 3I0QA 4ONAA 3TXOA 4NM3A 4AOTA 2H6DA 4AACA 3GCVA 5J9ZA 3OEFX 3UVQA 1URCA 3V5QA 4ALUA 3UVRA 3W18A 4MEDA 3A7JA 1Q41A 4CKRA 1IRKA 5GJFA 3FL4A 2GNHA 3GQIA 4MXXA 3F2AA 4HVGA 1XQZA 3HMMA 4PDPA 4UXLA 4XH6A 2X6EA 2ACXA 3QQKA 5HE2A 4IHPA 5HBJA 3DTCA 3V8WA 3ITZA 4O38A 5TKDA 2JDVA 1ZRZA 1YXVA 5JGDA 3UC3A 3TEIA 4AZVA 3OVVA 5EHOA 3BCEA 3DAEA 2WQEA 5CVGA 5DLSA 4FSZA 3VHKA 3ZO3A 1WBVA 3KF4A 3QCYA 2VUWA 3EQGA 5LMAA 5EYKA 4NCTA 3UO5A 2YIRA 5J79A 3WF7A 3F3WA 2GCDA 2WEIA 3NLBA 4IWPA 5EW9A 3TNIA 3ALNA 5C8KA 5HE0A 2W1IA 1WVYA 2EWAA 1CDKA 5EM6A 3H10A 3UOKA 3DOGA 5DA3A 4BCIA 2YM6A 2WIHA 4I5MA 4RFMA 4YNEA 2WTVA 3FLZA 3U51A 1OIUA 4Y5QA 2VTJA 2ZV8A 3QZIA 3E8DA 3NYVA 2WMUA 5FTQA 2QG5A 4DGMA 3H3CA 3EFKA 3I4BA 4CZYB 4DG0E 3C4WA 4RA5A 1E9HA 3TT0A 3FXXA 4FV8A 3HVCA 4FKSA 5J1WA 5H8BA 3DJ5A 4U8ZA 4RVTA 1KOAA 2UW0A 5BVFA 4H1JA 4RZWA 3OW3A 4L3JA 4TWOA 3VS4A 2X7FA 4TYIA 4ANLA 4U40A 5EW8A 1STCE 4ZTLA 3QALE 5K5XA 2W05A 5AV0A 3KL8A 4IC8A 4O96A 4M97A 4QYYA 5E8XA 5HICA 3EQIA 3EN4A 4CRLA 4XV1A 2WQBA 3PJCA 5BUEA 4ZZMA 5IEVA 3TNPC 4IVBA 4ID7A 3BRBA 3V6SA 1HOWA 4L43A 3MIAA 4GIHA 4AW2A 5J5TA 3R9DA 2QHMA 1VZOA 4RVMA 2VO6A 4FYNA 5GZAA 2J5FA 5J1VA 3T9TA 4IC7A 5B0XA 2WMXA 3PSBA 4XG2A 2C6DA 3QD2B 4NM7A 4RG0A 3D4QA 3E63A 3GC0A 3UPXA 4BDEA 3NUNA 4I4EA 3LCDA 1HCKA 4AZSA 4IVAA 4IIRA 4I22A 4D28A 5CAPA 4TWCA 2W9ZB 2R3NA 3ZSIA 4L67A 1BI8A 3OBGA 4JBQA 1JSTA 1UWHA 4UB7A 4DG3E 5L2SA 4FIFA 5CI6A 3M2WA 3F5XA 1UNLA 3QHRA 3BGZA 3A8WA 4B4LA 3SKCA 3R9NA 3H4JA 1F0QA 4ZK5A 3MFUA 5IH5A 2A19B 4U44A 1H28A 3MH1A 4KSPA 5M56A 3QRJA 2XNMA 1MRYA 3G9LX 4QPSA 5LVOA 3Q9WA 3UO4A 5K4IA 4BF2A 2ETRA 4KINA 5EYMA 1J1BA 3I0OA 3NUSA 4MAOA 3KCFA 4DH8A 3R9OA 1AD5A 4ASZA 4IFGA 5DT0A 3BLHA 3BEAA 4AG8A 4YGAA 2NPQA 2ZV7A 3QUDA 3ZLWA 4JXFA 1BL6A 4KBCA 4AFJA 3ENHA 4ASXA 4UWBA 4ZLYA 1JKLA 3KFAA 4PMSA 3D2KA 3PLSA 3WE4A 1U54A 2PVNA 3SW7A 3ZBFA 4B8LA 5DR6A 5H8EA 3RPOA 3KXNA 3RMFA 3KGAA 1DM2A 1YXSA 3PY1A 3Q6UA 4HGTA 4RWLA 3SVVA 1JBPE 3VBWA 4YTFA 3TCPA 4G9RA 5I9VA 3C5UA 4K1BA 2OXDA 4UEUA 5LARA 2JFMA 3NGAA 3O7LD 2E9UA 4I0SA 3NIEA 3VS7A 3R7UA 2RG6A 2UW5A 1R78A 3POZA 1KE5A 4ZTNA 5KMIA 2ZJWA 4KIPA 5ACBC 4GU9A 4M84A 4RWJA 1PXNA 3H9FA 3RWQA 1B39A 1RJBA 4FSWA 4IX5A 1PYXA 2I0EA 3UMXA 4X6QC 2H9VA 5BVWA 4G17A 3RHKA 5JEBA 3QBNA 2QVSE 3P7CA 2VX0A 1KSWA 1UU7A 2BUJA 2SRCA 3NWWA 2VTNA 5M4CA 3BHVA 5F95A 4BCGA 3HDMA 5F4NA 4CCBA 3D83A 3R8ZA 3P7BA 3HECA 4J8NA 1UU3A 3MI9A 3IDCA 1BX6A 3OWKA 3MFSA 1ERKA 3KRLA 2CJMA 3ZXZA 4BZNA 5CU0A 3LHJA 2HY0A 2ZAZA 5LVNA 5CU6A 4XBUA 3C13A 4IDTA 2WNTA 4RJ3A 3Q60A 5I5ZA 3R7EA 1DAWA 2X81A 2WMTA 4M7IA 5HG9A 3RAIA 4BGGA 4IZAA 3SX9A 3MGYA 4CSVA 4Z55A 5KNJA 3G6GA 4RJ5A 3R0TA 1M14A 2UVYA 3E8NA 3G6HA 4UMTA 4W8DA 3P86A 3OEZA 3UMWA 3W2SA 3FY2A 4RC4A 4BDIA 3AGLA 3GGFA 3DFCB 4KBKA 4O0WA 4WOVA 4F0FA 2VRXA 5FGKA 4I24A 3ACKA 4F9WA 3G33A 2O5KA 5IA2A 3D7TA 4YZNA 3R8UA 4K77A 4X2KA 3R8VA 4MBLA 3WZJA 3PPZA 4LI5A 2G2IA 4OT5A 3E87A 5GJDA 5EDQA 1Y6AA 4UWYA 4Z16A 2ONLA 3UE4A 2BIKB 3C4ZA 3MWUA 3NYNA 1FPUA 5CEMA 3SV0A 4R5SA 2O64A 3R1YA 3UNZA 2VO0A 5E1SA 4C3PA 1I09A 2B9HA 4FTJA 4XV9A 4A4XA 3WARA 5DWRA 2HXQA 4K8AA 3FPMA 4QYEA 3UOLA 4H58A 1Y6BA 2FSMX 4OTHA 3WYXA 4YJVA 3OWPA 2XIYA 3DGKA 2C69A 3F3TA 3KVWA 3KXXA 4IQ6A 2R3RA 3QD0A 4ALWA 3KQ7A 2XKDA 4FV6A 5KBQA 4QP8A 3MVLA 3NUPA 5CF4A 5JT2A 3FL5A 2BRMA 3ROCA 4PP7A 2W5AA 3MYGA 5H8GA 2WOTA 1M7NA 2OSCA 4XG8A 4DH5A 4FKGA 5FP5A 5M4IA 5FTOA 3FLQA 3KULA 3WF6A 2X8EA 5HKMA 4UY9A 4C4FA 4HYUA 5DBXA 4FSNA 2PL0A 2C1BA 3RCJA 4JL9A 3F2NA 3A8XA 5DVRA 3VRZA 4GT4A 2QD9A 2OF4A 3W2CA 4LV8A 5L2TA 4RWKA 2IZSA 4PNIA 5DI1A 4FTTA 5HE1A 1OIYA 2PMLX 2Z8CA 1YHSA 5AR2A 3Q4TA 2XK3A 2UZUE 2XA4A 1YWVA 4M67A 4O6LA 3SRVA 5CXHA 2O3PA 3ORZA 4BTMA 5L3AA 1U5RA 4M0YA 4ITHA 2QU5A 3AC3A 4FNZA 4C4EA 2CGUA 1REJA 3TNHA 4X6RA 4UALA 5CENA 2WTIA 2QO7A 3VW8A 1YHWA 3F88A 5AR5A 1FINA 5HVYA 5JK3A 2BZIB 3OOMA 2WFYA 3Q4CA 3HV7A 2UZNA 2W1FA 2UZOA 3C0HA 5B2KA 1JKSA 4AGUA 3RPYA 4MX9A 3DKOA 3F3UA 5I0BA 3QZHA 4G3CA 2BIYA 2IVVA 4FL2A 1YI4A 3DLZA 4ANOA 3OTUA 3P08A 3G51A 4FTAA 3CXWA 3C4EA 4R3RA 3ODZX 5HOAA 3RALA 3OG7A 5KHXA 4GT5A 5E7RA 2QI8A 4L3LA 5FXQA 2ERZE 2F9GA 3OW4A 3ZM4A 3QKKA 3R1NA 4ERKA 3FMJA 4NWMA 2EXMA 3V5TA 3I5NA 2OIQA 1BUHA 2GFSA 4JBVA 3HEGA 3DDQA 2JDSA 1GNGA 1ZOHA 4F99A 3BZ3A 4OBOA 4U3ZA 4FSUA 3ZLXA 2ETKA 4D0XA 3EIDA 4O0UA 3QUEA 4TPTA 5CSHA 2YCFA 1F3MC 1YOMA 3U6HA 3IG7A 4CKJA 3KVXA 2G1TA 2XKFA 3I79A 4FKPA 4EORA 4CQGA 4QMYA 4DINA 2ITOA 4E8AA 3ORNA 1GZ8A 1BKXA 3F6XA 4KRDA 2YDKA 4O1OA 2VNYA 2UW8A 4I20A 4B7TA 3EKNA 4JRVA 4E4XA 3QGYA 4IJPA 5LVLA 2X9FA 4U45A 4E6AA 4NK9A 4XLIA 3ORPA 4JAIA 1QPCA 3FMDA 1Z9XA 3ETAA 4BCQA 3T3VA 4KSQA 5HCXA 4C62A 3WF5A 4CV9A 4EZ7A 2Y4IB 4F0GA 3E64A 3ZTXA 2XRUA 2B9FA 3AC4A 4FTUA 4BDBA 4GUBA 2G9XA 4EBVA 4PTGA 2WKMA 3KXZA 4JAJA 3PWYA 1NA7A 1VEBA 4HZSA 1K3AA 3F5PA 2YITA 4JT3A 4Q9ZA 4QMXA 3ZLSA 3RAHA 4ZTSA 2FB8A 3B2TA 5FWKK 1QL6A 4RGJA 2UZTA 4EKKA 2C0TA 2ONLC 2PVRA 2WQOA 5CAVA 4IAIA 3EOCA 3DLSA 2X7GA 3F3VA 5DHJA 4BDCA 3UIBA 4EQCA 1E1VA 3MN3A 4F7JA 3R63A 5LMKC 4NTSA 3PJ2A 4FA2A 2XCKA 3OHTA 3D15A 4JR3A 5AUTA 3AC8A 5IA3A 2B54A 4OAUC 3OFMA 4ZZOA 4OTIA 4U7ZA 1FGKA 1RW8A 2C6LA 3BBWA 4O0YA 4ENXA 3TUCA 1V0OA 4MNEA 2W1ZA 4EOOA 4O0RA 1U46A 5K0XA 2C3LA 4K6ZA 3EQFA 4E6CA 4RA4A 4JNWA 5A54A 4RFYA 4E93A 5D11A 4BCMA 4BN1A 4KIOA 4QP9A 3EN6A 5KE0A 4ZJJA 3TZ9A 3RPRA 4AT5A 4EQMA 3HA6A 4FF8A 4J8MA 2ITTA 2X39A 2BRBA 3OCTA 3E8EA 4BB4A 4TZRA 1M52A 3W8LA 4Z9LA 4BCFA 4NM5A 5AUXA 3MTLA 4TY1A 1OPJA 4OW8A 5LVPA 4FTIA 1PMNA 4ASDA 4F6WA 2IVSA 2YEXA 2OJFE 5HD4A 5JN2A 3ZUTA 4Z7GA 2ZV2A 4MWIA 5AX9A 4AZEA 4EOJA 4DN5A 3CP9A 4ZP5A 3FXWA 3TG1A 2V7AA 3LFBA 2BKZA 3VQUA 2J0JA 2BAJA 4MD8E 3RZBA 2YAKA 3D0EA 3MJ2A 3ZZEA 1KE6A 1CKPA 1UNGA 3DAKA 3GU7A 3KRXA 2CKEA 1XO2B 4BDDA 2QOKA 1R0PA 5FEQA 4YHTA 1PYEA 2IO6A 4RX8A 3SD0A 3K2LA 2ZM3A 4FV0A 4CEGA 1FGIA 5BUIA 1ZLTA 3VBQA 2HAKA 3Q9ZA 1O9UA 1PXJA 4E26A 3CE3A 3D5UA 4YLJA 3NX8A 3L9MA 3RCDA 4FT7A 4L6QA 3MJ1A 4N0SA 3W55A 3G0FA 3E5AA 2P0CA 3OD6X 4G6OA 5CANA 2ZV9A 4PPBA 3ORMA 5D9HA 4KD1A 5C01A 4S33A 4U5JA 4XBRA 3L9NA 4R7HA 2BCJA 1LEZA 1V1KA 4FV3A 2WAJA 2XNBA 3JY9A 3PA4A 3FLYA 3TNWA 2W1DA 3GOKA 5EOLA 3AT3A 3IS5A 4JX7A 2WEVA 3HKOA 4GUEA 1Q99A 2QLQA 1WBNA 4M3QA 4RSSA 2BAKA 4ZSJA 5ETFA 1J1CA 3RBWA 4ANBA 2QOIA 4NH1A 1K2PA 4E5AX 4FIHA 3S95A 4QTDA 5F20A 3ZC6A 5CQUA 2FSLX 2X7OA 5L2QA 4GL9A 4FC0A 4H3QA 1CKIA 3GFWA 5AUVA 3KRJA 3RM6A 4F08A 5ACKA 2GFCA 4K2RA 2XEYA 4YZDA 3PG3A 2VN9A 3OY1A 4I6HA 2PWLA 4PL3A 4WRGA 1YWNA 3TV7A 2Z7LA 4AN9A 2EXEA 4WSYA 3OZ6A 1VJYA 2C3IB 4E1ZA 5JQ8A 4FTCA 4HGEA 4RJ7A 5CI7A 1PHKA 1W82A 2VO7A 4FTMA 3R1SA 4MHAA 5FM2A 2HIWA 5AV2A 5KZIA 4DEAA 1OL7A 3ODYX 1ZMUA 2QNJA 4ZTMA 1U59A 4EL9A 4CRSA 4FK6A 1MP8A 2Y6OA 3CQEA 2X9EA 2Z7QA 5HX6A 4D9TA 2A27A 2ESMA 2XK9A 3U8WA 3V8TA 2QR8A 4Y85A 2Z7RA 2XH5A 3QD3A 2HZ4A 3LFSA 3PVGA 3VUHA 3SRVB 2VWWA 5IMEA 3KY2A 4JJRA 5EW3A 3A61A 3NNUA 2Z60A 2HXLA 3ORIA 1DI8A 2JDOA 3EN7A 3CJGA 5CSVA 4EK3A 4YU2A 3Q9YA 4QQJA 3Q52A 1WVXA 4S34A 3A4PA 1G3NA 1M2PA 1PF8A 2BDJA 2HWPA 2R4BA 3LFAA 5HG7A 5FQDC 4F1OA 3AC1A 3D14A 4CTCA 3BGQA 3MBLA 4M14A 3EQBA 4QMMA 3F61A 3CGFA 4R1YA 3ZYAA 4D9UA 4D2VA 3GVUA 4QOXA 1RQQA 2W96B 4DHFA 4C57A 3DZQA 4X2JA 3CD3A 3QQHA 4FZFB 4YBKA 3EQCA 3QRUA 3T9IA 5BQ0A 3OBJA 5DR2A 4A7CA 3KMMA 2XNPA 4GW8A 4G2FA 4IWDA 3F69A 4Y72A 5ANIA 5IEYA 4IB5A 1X8BA 3O8PA 5CU3A 3QQFA 5JRSA 1ZY4A 3HUBA 3FHIA 2P3GX 4IEBA 2XIXA 1VYZA 2FO0A 4IB1A 5A3XA 3BLRA 3VBVA 4BCKA 3NYXA 4OTGA 4E4MA 4YSJA 3AQVA 4RQVA 5FM3A 4QYGA 3ZONA 4P5ZA 4AWIA 2R7BA 3QA8A 3T3UA 5L6PA 2H34A 2JAVA 3LFCA 3R7YA 2E9NA 4PDOA 4XRLA 4A06A 3EL8A 4DGGA 4ZSAA 1QPEA 4B8MA 3IONA 5BVOA 3MS9A 3BWJA 1OL2A 2VWZA 2OXYA 4D2RA 4I1ZA 4FT3A 1M2QA 2RFEA 2W06A 2WMBA 1BI7A 2BR1A 3KN6A 1H07A 4S32A 4YSMA 3QWKA 2VGPA 4IE9A 2QKWB 2ITQA 5HNIX 2G15A 1XH7A 5BMSA 4MKCA 3UYSA 3UQCA 1ZMWA 2YAAA 2PE0A 4LUEA 2UW3A 2PMIA 3FSFA 5CSWA 4ZS0A 4CV8A 4DBNA 5CAOA 4Y8DA 4F1MA 3FI2A 4ZZNA 1REKA 4AGCA 3F82A 3NRMA 4JQ7A 3CBLA 4K11A 2VGOA 4P2KA 5HLPA 3U6IA 4ZSLA 2XK7A 1YI3A 2PK9A 2OWBA 1YKRA 2VWUA 2WQNA 1WBPA 1UA2A 4J71A 3VJNA 3R7GA 1FOTA 4FIEA 3WZDA 1WBSA 4I5CA 4CMTA 3PWDA 5AIRA 2R3HA 3MVJA 3RPVA 5B7VA 5I9XA 5A4CA 2C5XA 2HOGA 3GXLA 3JXWA 3OXTA 4LM5A 3OUNB 3FMNA 4CZUA 4BI1A 5D7VA 2ITUA 3E92A 3AD4A 3GU6A 4RJ4A 4ASEA 1ZYCA 4QMSA 4GG7A 4FTNA 3I1AA 1JWHA 2CCHA 5BYZA 4DGOA 3K3IA 3ANRA 3AT4A 5IKWA 2PZ5A 4GYGA 4ZAUA 4QMTA 3MW1A 4ZSGA 5FBOA 5J87A 1UU8A 1OPKA 1UU9A 5CASA 3ELJA 4EOLA 4LMUA 4JOAA 3DZOA 4U97A 4XRJA 2RG5A 4MNEB 5ETIA 2XB7A 4BBEA 3PY0A 4D4RA 2WZJA 3FZRA 4FTQA 1OL5A 4AZTA 1IG1A 5H9BA 2RGPA 3R1QA 4U41A 3P4KA 4EH4A 3I7BA 5CLPA 3QRIA 1KV1A 3R22A 4FIIA 3ZO1A 1O6LA 2GTMA 4FKUA 3D5XA 4WA9A 2J0LA 4IADA 2XK8A 4RPVA 1OUYA 4HOKA 3TIYA 4FG7A 4WG4A 3V01A 1XH5A 4CYJA 5C8NA 4D58A 4NUSA 3SA0A 3KK9A 2UZBA 2WMRA 5ANEA 5IUIA 2CMWA 3ZO2A 4D0WA 2OFUA 2J51A 4X3FA 5CSPA 3NCZA 4AFEA 1VYWA 4C59A 3A7FA 3LFEA 4GEOA 2E2BA 3QTXA 2XNOA 3RK5A 5CAUA 3CC6A 1Y8GA 4PX6A 3R8LA 3PYYA 3COIA 4JVGA 1XH4A 4KIKB 1M17A 3GUBA 3GB2A 4JBOA 4M13A 4F09A 1PXIA 3VN9A 3D2IA 3QQLA 5JFXA 2QOBA 4NT4A 4M15A 1ZAOA 2YM8A 1XBBA 2GU8A 4AOIA 4L01A 2BDWA 3PA3A 3W2QA 5E8ZA 5HCZA 2IZTA 4MD9E 2BAQA 5HIDA 5HO6A 2IVUA 3R00A 3VUTA 2J0IA 2I0VA 4MQ1A 3S4QA 4BFMA 4GIIA 5I9UA 4FSMA 3LQ8A 1J3HA 3F3ZA 4FV5A 2IVTA 3II5A 4J95A 3QQJA 4YHFA 4BZOA 1H08A 3RM7A 1OM1A 5BVNA 2WU6A 3LFFA 4YJSA 4C7TA 2R3PA 4AU8A 3DS6A 5EG3A 1XBAA 3EB0A 3LPBA 3OP5A 1APME 1H27A 2X2KA 3UIUA 2RF9A 2FSOX 5KBRA 3HRCA 2CGXA 1YDSE 4YURA 1Q3DA 2ZOQA 2V0DA 4AW0A 4XNEA 4ENYA 2CDZA 4I92A 4YMJA 2XYUA 4EQUA 2RKUA 4PL4A 3PTGA 4CMUA 4RT7A 5KHWA 1FMOE 1CTPE 4YZ9A 2VTOA 3RI1A 3COKA 2VTAA 3FYKX 3FAAA 4OTQA 3TZMA 4C34A 3OC1A 2QODA 4EC9A 2W7XA 2LGCA 4H3BA 3ZH8A 3PSDA 3UBDA 5AA8A 4X2FA 1JLUE 1ZOEA 3IW6A 3ZFMA 4BRXA 4UYNA 2BVAA 4ITJA 4AW5A 3EQPA 5M4FA 3HGKA 5JGAA 1TQIA 4EUTA 2YM3A 4I5HA 3W2RA 1JPAA 2FUMA 3FYJX 2IW9A 3W8QA 4ZJVA 4APCA 3ZEWA 4AA5A 4XG9A 4MF1A 3KMUA 4ALVA 3TZ8A 3R2YA 2JIUA 3M1SA 2P33A 5LCJA 4FK3A 4YZMA 3ZOSA 2P4IA 2XUUA 5HTCA 3CQWA 4RLLA 4E4NA 3E62A 2XM8A 3ZBXA 4KS8A 4C33A 1XHAA 3NDMA 5J7BA 4F0IA 3AG9A 3KF7A 3MH0A 3NNWA 4E7WA 3CY2A 4F63A 3BHUA 3MPMA 4OTFA 2YM7A 5JZJA 1YXXA 3QQUA 4ACGA 2ZB0A 4CZTA 1SVEA 3V3VA 5HIBA 3JYAA 4XP0A 3UGCA 3NEWA 3ZC5A 4PWNA 3AD6A 3RTPA 3I81A 4AT3A 3BQRA 3A60A 3A7GA 2O63A 4FI1A 5DR9A 3VO3A 5BVEA 4C2WA 5CNOA 1W7HA 4IB3A 5CAQA 5HORA 1KV2A 4I6FA 3QC4A 3QZFA 1IASA 4LG4A 4ACHA 3NW7A 5L4QA 2R3KA 1FVVA 3PZEA 4AE9A 4JIAA 4AX8A 2QOCA 1H1WA 3DB8A 4ACDA 3QXOA 4MCVA 2FH9A 1Y8YA 3LFDA 4GT3A 3BBTB 4FVRA 4BWXA 4LV5A 3B8RA 4GG5A 3PXYA 3PRIA 4FZDB 4ZJIA 1H25A 3C50A 3TL8A 3O17A 3ZO4A 4HJOA 3DB6A 5EH0A 2GTNA 1H26A 5ETCA 2B4SB 2C6EA 4H3PA 2HW7A 2I6LA 4OTPA 5J8IA 4D5HA 4OBQA 3LCTA 4TYEA 3FKLA 3DKFA 5IF1A 3ENMA 3RGFA 3QLGA 4EK5A 5CWZA 2J0KA 5JFVA 4NCTC 3P23A 4C4HA 3CY3A 4C3RA 4X3FC 4B0GA 4G3FA 4RIYA 3DTWA 5E90A 5JFWA 2CN8A 3VUGA 3QKMA 4EI4A 1OKYA 2AUHA 3PP0A 4U43A 2PVLA 4NIFA 2W4OA 2XNEA 3BV3A 3MH2A 3NPCA 4OT6A 4DFXE 1GAGA 3IGOA 3ZU7A 5IMXA 4FOCA 4QNYA 2Y6MA 4BKJA 3O0GA 1KE7A 1H1SA 3DBFA 4E5WA 4FVPA 5H2UA 2XJ1A 3K5UA 5A14A 3UQFA 1LP4A 3FY0A 4WNMA 4YLLA 2ITYA 3LJ2A 4XCUA 2RL5A 5CNNA 3R7VA 2WXVA 3NS9A 3QXPA 4U3YA 1YOLA 4R6VA 4CQEA 4DGLC 3HV5A 4I4FA 4EHGA 3C4XA 4DH7A 3VF8A 4HNIA 5I4NA 4L53A 4C4IA 4CFMA 4FGBA 4I93A 4DLJA 4N6YA 2QURA 3NR9A 5AP6A 5TT7A 5K9IA 4N70A 3GCPA 3EQRA 3UC4A 5AIKA 3DBCA 3UODA 3BE9A 1L3RE 3TIZA 4BI2A 5BVDA 5KMLA 4UX9A 4YTIA 4IX3A 4YJOA 4IWOA 2C30A 1O6YA 1OI9A 3D9VA 3I7CA 4FBXA 3VJOA 2OKRA 3QX4A 3F9NA 4RX9A 4PL5A 3VRYA 4C0TA 4D2TA 3L9PA 4W8EA 4FV4A 5IA4A 4C36A 3BU3A 4KWPA 3WF9A 4QMZA 4BCPA 4U6RA 3COHA 5JH6A 3EZRA 3LJ0A 3N9XA 1CSNA 4DEGA 2BHEA 4USFA 2XIKA 5AP5A 3LXPA 2A2AA 2F2UA 3DT1A 2GNGA 3A2CA 4UWCA 1XH6A 4QD6A 1Q8ZA 5F94A 1O6KA 3C9WA 4IZ7A 5CX9A 5HGIA 5EM8A 3KRRA 5EYCA 2B53A 2G01A 4L42A 4B6LA 1NVRA 1QPDA 5AAGA 3IDBA 4UV0A 5ITAA 3TJDA 3WI6A 3NYOA 3P7AA 4CNHA 2XMYA 3GFEA 4CLIA 3VS0A 2OZAA 3SOCA 3COMA 3ZFXA 5A6OA 3MV5A 3IKAA 4J7BA 4YZBA 3QKLA 3THBA 1OKVA 3SLSA 2C5OA 5DNRA 5M44A 3DBEA 2HZNA 1H1RA 3BI6A 4ZLOA 3W1FA 4X3FB 4MQ2A 3QC9A 2YJSA 3O51A 3AC2A 2PHKA 1OIRA 3FQHA 3JS2A 3GU4A 4AP7A 2FYSA 2HY81 5CQWA 2JIIA 5BUJA 3BYVA 4C58A 3FZPA 4M8TA 3QYZA 3O23A 4BYIA 3R73A 3RPSA 4LGDA 4U9AA 4RVLA 3O50A 4YHJA 4Q5EA 5DGZA 4IXPA 3CEKA 2WMWA 4ZY4A 3BHTA 5BYYA 2QHNA 2QO9A 3KXMA 3DV3A 3ZRMA 4CTBA 4XOYA 3D5WA 5EKOA 3PXKA 4BWKA 4EH6A 5IDPA 2XJ0A 2HCKA 1YXTA 3LZBA 3QA0A 4GRBA 4F6SA 3NAYA 2CGWA 2PVFA 1OKWA 4QPAA 5IISA 2YJRA 1RDQE 3DBQA 3HL7A 1YVJA 3PXRA 3MTFA 2W4KA 5AP4A 4QMNA 3NSZA 3PZHA 3DPKA 4JG6A 1OVEA 1ZWSA 2VWIA 1R3CA 5JZNA 4L7SA 1H01A 1ZY5A 4WRSA 1IR3A 1WZYA 3TUBA 5A4EA 4RFZA 4A9TA 4QP4A 4O2PA 2Z7SA 3CIKA 5BNJA 3V5PA 2JGZA 4S2ZA 2WTCA 5B2MA 4CKIA 4C02A 3CKWA 3NUUA 4IX6A 4D1SA 5DRDA 4M69A 2PVKA 4ANNA 4OUCA 3MFTA 3LAUA 4FIGA 2BZHB 4L45A 4O27B 4RIWA 5EI6A 4HGLA 3P79A 3T8OA 4O0VA 2WMVA 3DKCA 4XV3A 2OGVA 3BU6A 4W9XA 2GDOA 4ACCA 4R7IA 4FG8A 3NCGA 3WOWA 2UVXA 5BVKA 3DQXA 2O0UA 3TTJA 3UG1A 1JAMA 2J2IB 4S31A 3RNIA 4FIJA 3UIXA 2I40A 3FE3A 2OBJA 4PNKA 4EYJA 5M53A 1A9UA 4QQCA 1BMKA 5GNKA 4QQ5A 3LFQA 4EEVA 4JDJA 4TYGA 5EFQA 2YISA 4RQKA 1LEWA 4TNDA 2Y0AA 2C6KA 1GOLA 3U4WA 4B9DA 4C61A 4EOIA 5JRQA 2ZVAA 4QMWA 2GS7A 3TNQB 2RFSA 2FA2A 3E3BX 4E4LA 2DQ7X 3VULA 2WPAA 2GSFA 4N6ZA 1U54B 1DS5A 2R5TA 2F7ZE 2ZYBA 2C47A 3JVRA 2YCSA 2R3JA 3MY0A 2P55A 3FMKA 4HNFA 4ACMA 4AGWA 4UMUA 1GIJA 4CT1A 4DFLA 4EH2A 3UNKA 2ZB1A 2YIXA 1GJOA 3V5LA 1QMZA 2J7TA 4BIEA 4HGSA 4UMPA 1PKGA 4G3EA 5FEDA 2XRWA 3QQGA 4TXCA 3GCQA 4LFIA 4YJTA 3IDPA 5AAEA 4PQNA 3L8PA 5M57A 1U5QA 3BX5A 5AUWA 3MIYA 5I3OA 4RWIA 4I0TA 2GNJA 1LPUA 4JQ8A 5CTPA 3RVGA 4PDSA 5CU4A 5DPVA 2OU7A 3IQ7A 4H36A 3VUMA 2ZM1A 4F9AA 2H96A 4FZ7A 1WAKA 2JEDA 3HZTA 3RJCA 2AYPA 4UZDA 1GZOA 4E3CA 3UVPA 4K33A 2PSQA 3P5KA 1TKIA 2Y9QA 4V0GA 3JPVA 1OMWA 4P5QA 4DEIA 5E8VA 4D2PA 3GC8A 4OLIA 4A9SA 4JRNA 4CMOA 5AR4A 1OKZA 5EHLA 4XEYA 5DG5A 1R1WA 4ZSEA 1P2AA 2BRGA 2JKQA 3E88A 3PY3A 4C4JA 4HW7A 5CSXA 3Q04A 3SXFA 3R28A 5A46A 1MRVA 4JX3A 4YPDA 4JDHA 3RK7A 3W32A 3TUDA 1UWJA 4RBLA 4D55A 4MK0A 4BHZA 4Z3VA 3OS3A 4AE6A 3GCUA 3OOGA 3VS2A 4OAVB 5E8SA 5AWMA 1KOBA 2W17A 4RIYB 4YZCA 4AF3A 3NUXA 4U42A 4FKTA 4OR5A 1SMHA 4FT9A 4LOPA 2BALA 2B52A 2VZ6A 4ZTHA 4EOQA 2HWOA 2UZDA 4ZY6A 1KE9A 2DS1A 4NIFB 5CALA 4FNYA 4EHVA 3CPCA 3RKBA 4YJQA 4BL1A 1H0VA 2XCHA 4WD5A 2OK1A 1YDRE 5AMNA 3D7TB 4QNAA 1Q24A 4D4SA 4WNPA 3BIZA 3ZZWA 2OJ9A 5KX8A 1OGUA 2PVJA 1CKJA 4DEDA 2EUFB 4TRLA 4DAWA 2BZKB 4RIXA 4BDHA 4BDFA 2YIQA 3KC3A 4R1VA 3NAXA 4D2WA 4IB0A 3QYWA 2JAMA 4XV2A 3F7ZA 4IAKA 1ZZLA 4G9CA 5DIAA 5ANGA 3R7IA 3U9NA 3QFVA 2J90A 3L8VA 5HVJA 4BTKA 3UO6A 3FLWA 5IUHA 1OB3A 5I9YA 3B2WA 1WVWA 2UV2A 3MPAA 3S0OA 1FQ1B 5FD2A 1YW2A 3TKUA 3S2PA 4FV9A 5KMMA 2IW6A 3OT8A 3MY5A 1TQMA 3H0ZA 3GBZA 3PJ3A 3UQGA 4AGDA 4C8BA 1S9IA 1YRPA 4IJ9A 3SHEA 2I1MA 4YC3A 3A7HA 2ITNA 1JSUA 1XR1A 3OMVA 1MQBA 1R39A 3KULB 3PG1A 4UBAA 2VD5A 3DNEA 4JG8A 4BHNA 4FNWA 1ZOGA 3GU5A 4YTHA 3TN8A 3HRBA 3LCSA 4X21A 1UV5A 4AW1A 2B55A 3JVSA 3LW0A 3RINA 3BPRA 3NNVA 2HZ0A 4I3ZA 5AUZA 2XIZA 5FG8A 2VWBA 2PUUA 5HI2A 4GMYA 4IH8A 2OZAB 3VWAA 5B2LA 4FKQA 1SVGA 4C3FA 3S1HA 3PP1A 3P0MA 4EH5A 4BBFA 1NXKA 3FPQA 2OH0E 5D10A 5AR3A 3Q3BA 2B7AA 3UJGA 3VC4A 2J0MB 3C51A 3U87A 4XYFA 4WSQA 3HDNA 2CLQA 1PXLA 2JKOA 3VQHA 3CQUA 5G6VA 2BPMA 4GK4A 2X4ZA 4WO5A 3R83A 2BRHA 2HW6A 4WBOA 4WG3A 2CSNA 3UG2A 3OCBA 2LAVA 2YDIA 3O71A 4G6LA 5C03A 5A4QA 3A62A 2F7EE 3FV8A 4D5KA 4YPSA 2ZDUA 3VS3A 3FZSA 4IZYA 4QRCA 2XKCA 3QF9A 4EOPA 4EOMA 5CEOA 2OI4X 3F7WA 3ZDUA 5JMSA 4U80A 2REIA 1TVOA 3P1AA 3U6JA 5CEQA 1VR2A 3UP2A 4L44A 4C2VA 2DWBA 2PMNX 3BGPA 3FZOA 4FSQA 3PXZA 4FL1A 2VTQA 4EKLA 5J5SA 4Q9SA 2WMQA 1W8CA 1XH8A 2Y4PA 3ZCLA 4ANQA 5A4TA 5AM6A 4WHZA 3QX2A 3PPKA 3HA8A 4XP3A 4IAZA 3D94A 2C6MA 3I6WA 4GJ2A 4FG9A 4A9YA 4HPTE 4M69B 4BBMA 5HX8A 3H9OA 2FVDA 5DN3A 1OUKA 4RIWB 2J9MA 2W5HA 4LGGA 5FXRA 3D7ZA 4AA4A 3PJ8A 3Q5IA 4HYIA 5M4UA 2VTIA 3UPZA 4IDVA 3LFNA 4EHEA 3LM0A 4PPAA 4BC6A 2FSTX 3ET7A 2VTMA 2YN8A 4JBPA 3L9LA 3HRFA 4JG7A 5M55A 1BL7A 4A9RA 2W5BA 3C0IA 5I9ZA 5DEWA 3ULZA 4A9UA 2RIOA 3O8TA 5EKNA 4R8QA 5KMJA 2R3MA 4UMRA 2R3IA 3L1SA 1SM2A 2W0JA 2C6OA 3AC5A 4EH3A 1H1QA 3W10A 5CEKA 3FHRA 3ZLYA 1CMKE 3FDNA 3LIJA 4FZAB 1I44A 2AC3A 4Y83A 2VTLA 3Q5ZA 4RC3A 3DK6A 4X7QA 4P7EA 3G2FA 4I6QA 3WE8A 3IO7A 4CLJA 3IGGA 3DBDA 4GCJA 4GVAA 3DCVA 3KKVA 3PFQA 4K0YA 3IOPA 3KK8A 3R21A 4FKWA 3TACA 3PXFA 3VS6A 4RZVA 4DFNA 5J95A 3PE2A 5HIEA 2J6MA 4W4WA 3MB6A 4XMOA 4DH1A 4FSTA 4Y95A 4QPMA 5T3QA 3ZEPA 1FVTA 4L8MA 5HNBA 4AZFA 4L3PA 3ZFYA 1NY3A 4C4GA 2C5VA 1H24A 4EH8A 1PKDA 3B8QA 4RC2A 4Y46A 4HVDA 5DT4A 2HELA 4NW6A 4E5BA 1Q8YA 1ZZ2A 2OIDA 3HP5A 4QP7A 3SC1A 4BKZA 4ZLZA 2OFVA 4GVJA 2CN5A 3FC2A 1Q62A 3C7QA 3AMAA 4KBAA 3NNXA 4NEUA 4NFMA 3BELA 3MVHA 3D5VA 4QP3A 3HV4A 5BPYA 4FYOA 5CZHA 5AP7A 1Q8UA 3QTRA 4GYIA 3EFWA 1SNUA 2GHGA 1PY5A 4QYFA 5HQ0A 5ANDA 4EH9A 5CU2A 3ORXA 2C6TA 5E8TA 3CS9A 4PP9A 3GENA 5AV3A 5HNGA 5JQ5A 2VWYA 4XX9A 4V0GB 2R7IA 4XLVA 2YIWA 2CLXA 3VUDA 4EZ5A 4PTEA 2W99B 5G1XA 3LOKA
chains in the Genus database with same CATH superfamily
4O22A 4BDAA 5LMBA 4DFZE 1NVSA 1YXUA 3GI3A 5LWMA 3ERKA 3FZ1A 3QCQA 4FNXA 1Q4LA 4HPUE 3GT8A 5GZ9A 4QYHA 4FUXA 5AP3A 4BGHA 5JKGA 4G5PA 2B1PA 4BYJA 1F5QA 2OJGA 3BYSA 1IEPA 3L8XA 2ITZA 1YWRA 4RX5A 2V22A 5F1ZA 3FMHA 4TKSA 4ANSA 3CTJA 4LYNA 4EC8A 1WBWA 4L00A 5E91A 1M7QA 3HLLA 3FLNC 4YTCA 5L8KA 2UW4A 4WNOA 3VIDA 2C4GA 2VAGA 3Q4ZA 3VS5A 5C26A 5AA9A 4W4XA 2JLDA 1W2FA 3E3PA 2WQMA 4DTKA 3ORLA 3OCSA 2F4JA 4KS7A 4QTBA 1GY3A 2JKKA 3WILA 4OGRA 2YIYA 4UXQA 4QTCA 3WIKA 1OZ1A 3HUCA 3TKIA 3HMIA 4QTAA 4YP8A 3WYYA 3BHYA 3TJCA 4TN6A 5C27A 3TTIA 5IUGA 1Q8WA 2YLEA 4IMYA 3R9HA 5EI8A 4FZ6A 5KMNA 1OL6A 2R3LA 3FJQE 3AOXA 2XP2A 4DLIA 1SNXA 4FICA 4FUYA 3GOPA 3HV6A 2QOLA 4RIXB 3R01A 4BGQA 2YM4A 5LOHA 2BHHA 3GC7A 1OIQA 2OJJA 3CCNA 4QP6A 3GQLA 1H0WA 4AAAA 3LQ5A 4AXAA 3NW5A 4CXAA 4DEHA 5AM7A 2PZRA 3KEXA 2R0UA 2OW3A 2PVHA 2W1GA 4BCNA 4QTEA 4FT0A 3DXNA 3QWJA 5DFPA 2VNWA 5EDRA 5FDXA 2KTYA 4LOQA 2UZLA 4FEQA 2F2CB 2UZEA 4EUUA 1MRUA 3F66A 3AMBA 2WTKC 1RE8A 3GEQA 4GFMA 4NTTA 4X0MA 5C9CA 3PPJA 3W2OA 5DEYA 5AP2A 4OBPA 4F9CA 3IW4A 3ZXTA 5IPJA 2V62A 3UOHA 3E7VA 3FC1X 5CF8A 4YO4A 4YLKA 2BTSA 4KNBA 4AQCA 5HLNA 4FOBA 2PMOX 3R2BA 3FI4A 4GJ3A 4EONA 3C1XA 3VBXA 3HYHA 4MBJA 5CVFA 4XP2A 5KKRC 3F5UA 4QO9A 1T46A 3FZTA 4UN0C 3FMEA 3QTSA 3W16A 3OF0A 4IW0A 5I3RA 3QTWA 2AQXA 2G2HA 2BDFA 3EN9A 3A7IA 3Q96A 4IVCA 4F4PA 4Y73A 4BDGA 3IECA 3R7OA 3MSSA 2RFDA 4LMNA 3EL7A 4TYJA 2XJ2A 3FMLA 4FV1A 3WF8A 3KA0A 5E8UA 3FXZA 1Z57A 3ZUVA 1NVQA 3AXWA 4FKRA 2GMXA 4GK3A 2PZPA 5CS6A 4Q2AA 2ITPA 5A9UA 3EJ1A 3QLFA 2W9FB 3BV2A 3QTIA 5ANOA 4M12A 5HESA 4HCTA 3FLSA 4ERWA 4M0ZA 5AAFA 5HEZA 3MA6A 3ROYA 4RJ8A 3MA3A 3QGWA 3JY0A 4HVIA 4BCOA 2OO8X 4NZWB 4USDA 4ANMA 4AA0A 3Q2MA 5D7AA 4V05A 3I5ZA 2WB8A 4YJRA 5D41A 2C68A 1OL1A 3PVWA 5HO8A 3EWHA 3QTUA 3RAWA 3ZSGA 5D12A 2UZWE 3SDJA 2PVYA 1KWPA 4FR4A 2V5QA 3SQQA 4ITIA 4AN3A 1B6CB 3UZPA 4P4CA 4IX4A 1IA8A 1FMKA 4LRJA 2X2MA 1SVHA 3VHEA 5CXZA 5HO7A 2VTRA 4TT7A 4J96A 4Z7HA 3C4FA 1P4OA 4IWQA 5LQFA 3LMGA 2YA9A 4RRVA 4F7SA 2OZOA 1PXPA 4FTLA 4XG6A 3UTOA 1ZARA 3TKHA 3EKKA 4F64A 4FV2A 1WBTA 2YLFA 4X2NA 4JDIA 5I9WA 4H39A 5DOSA 3TI1A 1Z5MA 4FTRA 3FUPA 5HLWA 1GZNA 1JOWB 1PJKA 2WTKB 4KRCA 4MVFA 3RP9A 3VF9A 5CEPA 4CFNA 2Z2WA 2OIBA 3E7OA 3JUHA 3CJFA 2XYNA 4MNFA 3ZDIA 4A4OA 4F1TA 2QOQA 5A6NA 4UZHA 5EDPA 5KMOA 2VV9A 2PVMA 3KU2A 2C6IA 4XG3A 4M66A 4YJNA 4O21A 3H0YA 4EK8A 5AX3A 1AQ1A 5EOBA 5TOZA 1WMKA 4HVSA 4XHKB 1WFCA 3BYUA 5KKRB 4XG4A 4MXZA 5DRBA 4S30A 5ANJA 5HG8A 5IH6A 3HMNA 1AGWA 1W83A 4J1RA 1JQHA 2X8IA 5AADA 4F7NA 1HCLA 3DFAA 2PE1A 3CLYA 3ZUUA 5AEPA 4GFOA 3KXGA 3KN5A 3M11A 4I0RA 4NW5A 3HMPA 2QR7A 2W1CA 2YCRA 4LUDA 3FWQA 2W4JA 3R8MA 4LRKA 4O2ZA 2NRUA 2XIRA 3QTZA 4I94A 2IN6A 4PF4A 3PE1A 3KCKA 2XNNA 2E9VA 5JSMA 3E8CA 1UNHA 5HTBA 4M68A 3OWLA 2YWPA 3BEGA 5CVHA 3BU5A 4V01A 2JFLA 3CTQA 4BIBA 4E73A 2B9JA 4JI9A 4YR8A 2X0GA 1V0PA 3POOA 2C1AA 5HU3A 4WUNA 5KO1A 3QD4A 5L6WL 1UVRA 2QOFA 4BZDA 4BDKA 2WTWA 4D2SA 4G31A 3VS1A 2F49A 2VU3A 1PMUA 4LRMA 4I23A 2XBAA 4A4LA 3VVHA 2XM9A 4AOJA 3DJ6A 2J5EA 5KCVA 1MUOA 5ICPA 3Q6WA 4TYHA 2GNLA 3GCSA 1K9AA 5GHVA 3PVUA 4V04A 5EHYA 2KULA 3ANQA 4C35A 2C0OA 3AT2A 5GZ8A 5L8JA 3RK9A 5AV4A 5LMKA 1Q97A 4G6NA 4KKEA 4DEEA 5IEXA 3BLQA 5L8LA 1ZXEA 4WNKA 3RAKA 4A07A 5T68A 2YERA 5EK7A 2WTDA 1W84A 4PV0A 2JDRA 4BDJA 4DC2A 3V51A 5J9LA 3KXHA 4W4YA 1QCFA 3V6RA 4IAFA 5IU2A 1P5EA 4MXCA 4TNBA 2V7OA 2EU9A 2J4ZA 2WGJA 5KUPA 4W9WA 4G3GA 4N4SA 3CGOA 5E92A 2B9IA 2RSVA 4PY1A 4LL5A 3VBYA 5FEEA 1PW2A 3OCGA 4EHZA 4KB8A 3MB7A 3MY1A 5ETAA 4PPCA 1V0BA 4TWPA 4O1PA 4IVDA 2X6DA 4FX3A 2YZAA 4EWQA 2UVZA 1UKHA 3MH3A 2J50A 4F7LA 3FKOA 5CEIA 3UOJA 4TWNA 4I6BA 3SOAA 4GV1A 2Q0NA 3HV3A 1SYKA 2A4LA 3LVPA 4L52A 4E6QA 3FQSA 3LLTA 3NUYA 2Y4IC 4G5JA 4FKOA 4BTJA 3P9JA 2BFYA 5FXSA 2QONA 3UP7A 4AUAA 3BYMA 3HP2A 4KA3A 3IK3A 2Y7JA 2QU6A 4IZ5A 4II5A 4KAOA 2E9PA 3M42A 2X8DA 3TV6A 4LL0A 1U4DA 1YOJA 3CKXA 1XKKA 1ATPE 4LQMA 4CCUA 3LM5A 2X1NA 4EBWA 1ZMVA 4B99A 2CGVA 4QMOA 2UW6A 4FTKA 2QCSA 4TTHB 3LXLA 4XOZA 3REPA 2WO6A 4YUQA 2ZMCA 2A0CX 1Q3WA 3U9CA 4DGNA 5IA0A 4C37A 1J91A 3LCKA 5L2IA 2CHLA 4EOKA 3R71A 4J97A 3FSKA 4FV7A 4IAYA 4LGHA 1W98A 2XS0A 3CTHA 1M2RA 4EZ3A 4IAAA 4U79A 4XS2A 5KZ0A 3AGMA 1ZYSA 3FKNA 4RMZA 2OICA 5HBHA 4EK6A 5CF5A 5HU9A 4YJUA 3OXZA 1YHVA 2WMSA 1G5SA 2P2HA 4F6UA 1A06A 2XF0A 3LXKA 5E8WA 3Q4UA 2JC6A 1B38A 3K54A 1DAYA 1MQ4A 2DYLA 5J9YA 2GQGA 4GK2A 2WU7A 4IANA 4J52A 4CFVA 2IWIA 4BI0A 1S9JA 5HD7A 4GH2A 4AS0A 1P14A 3QTQA 5T6KA 2WELA 5AP1A 2XK6A 3EYHA 4BTFA 4KKHA 3BE2A 3OXIA 3QAME 3VBTA 3MVMA 2G2FA 4G1WA 3W2PA 4NJ3A 2IZUA 4CFFA 2E9OA 2ZM4A 1H4LA 2R3OA 2JIVA 4RVKA 4CFUA 4FKIA 3ALOA 4NKSA 4HVHA 3G5DA 3OWJA 4F9YA 3EYGA 5HE3A 3O2MA 4EK4A 3UZTA 3OT3A 3O96A 1SZMA 4JQEA 3NIZA 3GU8A 4CT2A 4F9BA 3DKGA 2AC5A 5CY3A 3FBVA 2UW9A 3LXNA 1DI9A 2C3JA 4QMLA 2W1EA 3I6UA 5AP0A 3DNDA 2QOOA 5IA5A 2WTJA 3O8UA 4MF0A 3UNJA 4D4VA 3H30A 3VUIA 2CCIA 3DA6A 2O2UA 2YM5A 2PTKA 4WUAA 3RNYA 3E93A 4E20A 2QO2A 3U4UA 3EQDA 2HZIA 4L46A 4O0XA 4R3PA 2XEZA 5FLFA 3EZVA 3VNTA 5C1QB 4X2GA 5DT3A 3ZRKA 5DE2A 1ZYLA 3ACJA 1YI6A 1E1XA 4Y5HA 4O91A 4BIDA 1H8FA 2WIPA 2YHVA 3QHWA 4HCUA 3UDBA 3WZKA 3ZRLA 3VUKA 2WMAA 3ULIA 3LE6A 4MBIA 3DAJA 4FSYA 2QLUA 2JKMA 4AT4A 5IA1A 4PMTA 2OG8A 5FBNC 5JGBA 3W33A 3C4CA 4WBBB 4XUFA 4H1MA 2EB3A 2OJIA 2UZVA 2C5YA 3N51A 5E8YA 2IJMA 2Q0BA 4GS6A 5EM5A 4XJ0A 4USEA 2ITVA 2YACA 5TR6A 2VX3A 3PUPA 3QUPA 5M51A 1Q8TA 3S3IA 3LJ1A 1LUFA 2BMCA 3ZS5A 1H1PA 4AN2A 2XVDA 3OTVA 3PA5A 3NW6A 2OF2A 2GPHA 3BQCA 3ZHPC 2GNIA 1UKIA 3EQHA 4NM0A 4EH7A 1PXKA 4EJNA 2NO3A 4O0SA 5HTIA 2GHMA 2H8HA 4DEBA 4GU6A 4QT1A 5GJGA 4C38A 2PY3A 4GFGA 4HZRA 3RZFA 3QZGA 4BKYA 4G16A 5HBEA 3SW4A 1Y57A 5FP6A 4DCEA 5EI2A 3PIYA 2V55A 1KE8A 3WZUA 2PZIA 2BRNA 4ZTQA 2YFXA 3KRWA 4K18A 5CYIA 4CD0A 4FKJA 1R0EA 3SXRA 4KIKA 4YC6A 3RWPA 4DG2E 5HZNA 3BYOA 4D4YA 4FTOA 4Q5HA 4RLKA 4ZXTA 3MDYA 1BYGA 2QOHA 4PRJA 2ZMDA 3IW8A 1ZYJA 2C0IA 3C0GA 3KB7A 3PIXA 3CPBA 4OTRA 4YBJA 5KMKA 4G3DA 3DY7A 5HG5A 5FDPA 2DUVA 3IW5A 3HNGA 5C8MA 1OITA 3IPHA 3DK7A 2NP8A 1Y91A 3QRTA 2C3KA 3GNIB 2R3QA 3ZSHA 3IW7A 4TYHB 2OH4A 4UYAA 4JIKA 1XWSA 5AR7A 3L8SA 1ZYDA 3Q53A 4JLCA 3TZ7A 1XJDA 2R0IA 3QRKA 3UYTA 5K5NA 2WOUA 4U81A 4BICA 3EN5A 4FKLA 3R30A 3RHXA 4ARKA 3EMGA 5J7HA 5L2WA 1TQPA 4YO6A 4P90A 2WHBA 3DJ7A 4YC8A 1OPLA 3BKBA 4TL0A 4AZWA 3F5GA 3G9NA 2OXXA 4QQTA 3R8PA 1LR4A 4WKQA 3V8SA 2BROA 4ZTRA 4CFXA 4ZOGA 4QP2A 2R3GA 3R02A 4EOSA 4JDKA 2VWXA 5AJQA 4LOOA 5EYDA 4TW9A 3O7LB 2VTPA 2XKEA 5K3YA 3S00A 1JSVA 4HYSA 3UIMA 4MH7A 3OUKA 4PUZA 4YNOA 2XZSA 2NRYA 1CM8A 1WBOA 2GHLA 4ZY5A 1BLXA 2QQ7A 2VTSA 3K5VA 3CR0A 3NZ0A 3PJ1A 3OROA 2RFNA 4JS8A 4MD7E 3PSCA 4MXAA 5IZFA 2A1AB 4NKAA 2QC6A 5IH4A 3PVBA 4PMMA 5CZIA 2HK5A 4PTCA 4IM3A 3TWJA 4FSRA 5JFSA 4HYHA 4BWPA 5DMZA 1GZKA 3WZEA 1GIIA 4HCVA 2UUEA 5IG1A 5AUUA 5A4LA 3FI3A 2BILB 1EH4A 3EFLA 3AMYA 1QPJA 3I60A 1JNKA 3OY3A 1W0XC 2VO3A 3VW6A 2VWVA 2CPKE 4X3JA 3DDPA 2VX1A 1XBCA 2R9SA 4R3CA 2YABA 2HENA 3SAYA 1YDTE 2X4FA 4D1XA 1PXOA 1Q61A 4D1ZA 1T45A 2XNGA 4FL3A 4G34A 3WIGA 5CF6A 5ANKA 5LXMA 3TV4A 4UMQA 3DK3A 2PZYA 4MXYA 3ZMMA 4QMUA 3G0EA 5HCYA 2FGIA 2VTHA 5BMMA 4FMQA 4KIQA 2O65A 3R6XA 5AR8A 2BZJA 2JBOA 3EFJA 3MFRA 4OTWA 4APPA 4CVAA 2ZDTA 5IDNA 5LWNA 2R64A 2YCQA 4NFNA 3ORKA 3WBLA 5F9EA 4DH3A 3KMWA 2P2IA 3EH9A 4ZEGA 4W4VA 2F7XE 2EXCX 3BHHA 2X2LA 5EM7A 5CT7A 2EB2A 5FRIA 5HHWA 3EHAA 2Y8OA 5DH3A 4CFWA 4EYMA 3LCOA 2IEWA 2ERKA 4KKGA 5AUYA 2BTRA 4GSBA 4BCHA 2ITXA 2C5NA 3Q9XA 2YDJA 4QMPA 1OECA 1PMEA 3QCXA 4L9IA 4BCJA 2I0YA 2I0HA 4FODA 5TF9A 2JBPA 1URWA 4WG5A 4IM0A 4MXOA 1JKKA 1JKTA 1P4FA 4F70A 4O0TA 4ZIMA 3P78A 4O6EA 4QMQA 1WCCA 3K3JA 4RJ6A 5HVKA 1JVPP 1Q5KA 2F57A 4JR7A 4KABA 4MTAA 3A4OX 4I5PA 3AD5A 1FVRA 2WD1A 3IOKA 3PRFA 4DYMA 3PIZA 2ETMA 4R5YA 3BWFA 3V04A 3DU8A 2IW8A 3V5WA 4DITA 4J99A 1XH9A 2XBJA 4RIOA 2X0QA 4I21A 2BFXA 4IBMA 4MWHA 4WIHA 2VTTA 2PE2A 3Q32A 1H00A 2R3FA 3GC9A 4WT6A 2IZRA 4XG7A 5D1JA 5L6OA 4I41A 4NU1A 2O8YA 3QU0A 3HMOA 4IFCA 5CT0A 5AV1A 2JDTA 3H9RA 2R2PA 4L7FA 5E1EA 3MPTA 5LVMA 3A99A 5BX0A 4L68A 2HYYA 4NSTA 2XK4A 5K4JA 5H3QA 5TE0A 4YJPA 4FKVA 4FT5A 3PXQA 4F65A 2JITA 1PMVA 3QCSA 4J98A 4NJDA 1PXMA 4FVQA 3G90X 3ORTA 4QMVA 2W1HA 5TO8A 3VAPA 4MYGA 5LJJA 1YQJA 2GS6A 4QP1A 2QKRA 3QL8A 4IM2A 3SXSA 4CYIA 2GS2A 3HX4A 4E6DA 5K0KA 2EVAA 4DFYA 3FMMA 5LCKA 2UW7A 2ITWA 3FQEA 4J53A 4OTDA 4U0IA 3V5JA 2GNFA 3DQWA 4BVUA 4IACA 3R04A 2X0OA 4K9YA 2JD5A 3CD8A 3GP0A 1GIHA 4EWHA 4PMPA 4RX7A 3I0QA 4ONAA 3TXOA 4NM3A 4AOTA 2H6DA 4AACA 3GCVA 5J9ZA 3OEFX 3UVQA 1URCA 3V5QA 4ALUA 3UVRA 3W18A 4MEDA 3A7JA 1Q41A 4CKRA 1IRKA 5GJFA 3FL4A 2GNHA 3GQIA 4MXXA 3F2AA 4HVGA 1XQZA 3HMMA 4PDPA 4UXLA 4XH6A 2X6EA 2ACXA 3QQKA 5HE2A 4IHPA 5HBJA 3DTCA 3V8WA 3ITZA 4O38A 5TKDA 2JDVA 1ZRZA 1YXVA 5JGDA 3UC3A 3TEIA 4AZVA 3OVVA 5EHOA 3BCEA 3DAEA 2WQEA 5CVGA 5DLSA 4FSZA 3VHKA 3ZO3A 1WBVA 3KF4A 3QCYA 2VUWA 3EQGA 5LMAA 5EYKA 4NCTA 3UO5A 2YIRA 5J79A 3WF7A 3F3WA 2GCDA 2WEIA 3NLBA 4IWPA 5EW9A 3TNIA 3ALNA 5C8KA 5HE0A 2W1IA 1WVYA 2EWAA 1CDKA 5EM6A 3H10A 3UOKA 3DOGA 5DA3A 4BCIA 2YM6A 2WIHA 4I5MA 4RFMA 4YNEA 2WTVA 3FLZA 3U51A 1OIUA 4Y5QA 2VTJA 2ZV8A 3QZIA 3E8DA 3NYVA 2WMUA 5FTQA 2QG5A 4DGMA 3H3CA 3EFKA 3I4BA 4CZYB 4DG0E 3C4WA 4RA5A 1E9HA 3TT0A 3FXXA 4FV8A 3HVCA 4FKSA 5J1WA 5H8BA 3DJ5A 4U8ZA 4RVTA 1KOAA 2UW0A 5BVFA 4H1JA 4RZWA 3OW3A 4L3JA 4TWOA 3VS4A 2X7FA 4TYIA 4ANLA 4U40A 5EW8A 1STCE 4ZTLA 3QALE 5K5XA 2W05A 5AV0A 3KL8A 4IC8A 4O96A 4M97A 4QYYA 5E8XA 5HICA 3EQIA 3EN4A 4CRLA 4XV1A 2WQBA 3PJCA 5BUEA 4ZZMA 5IEVA 3TNPC 4IVBA 4ID7A 3BRBA 3V6SA 1HOWA 4L43A 3MIAA 4GIHA 4AW2A 5J5TA 3R9DA 2QHMA 1VZOA 4RVMA 2VO6A 4FYNA 5GZAA 2J5FA 5J1VA 3T9TA 4IC7A 5B0XA 2WMXA 3PSBA 4XG2A 2C6DA 3QD2B 4NM7A 4RG0A 3D4QA 3E63A 3GC0A 3UPXA 4BDEA 3NUNA 4I4EA 3LCDA 1HCKA 4AZSA 4IVAA 4IIRA 2X0PA 4I22A 4D28A 5CAPA 4TWCA 2W9ZB 2R3NA 3ZSIA 4L67A 1BI8A 3OBGA 4JBQA 1JSTA 1UWHA 4UB7A 4DG3E 5L2SA 4FIFA 5CI6A 3M2WA 3F5XA 1UNLA 3QHRA 3BGZA 3A8WA 4B4LA 3SKCA 3R9NA 3H4JA 1F0QA 4ZK5A 3MFUA 5IH5A 2A19B 4U44A 1H28A 3MH1A 4KSPA 5M56A 3QRJA 2XNMA 1MRYA 3G9LX 4QPSA 5LVOA 3Q9WA 3UO4A 5K4IA 4BF2A 2ETRA 4KINA 5EYMA 1J1BA 3I0OA 3NUSA 4MAOA 3KCFA 4DH8A 3R9OA 1AD5A 4ASZA 4IFGA 5DT0A 3BLHA 3BEAA 4AG8A 4YGAA 2NPQA 2ZV7A 3QUDA 3ZLWA 4JXFA 1BL6A 4KBCA 4AFJA 3ENHA 4ASXA 4UWBA 4ZLYA 1JKLA 3KFAA 4PMSA 3D2KA 3PLSA 3WE4A 1U54A 2PVNA 3SW7A 3ZBFA 4B8LA 5DR6A 5H8EA 3RPOA 3KXNA 3RMFA 3KGAA 1DM2A 1YXSA 3PY1A 3Q6UA 4HGTA 4RWLA 3SVVA 1JBPE 3VBWA 4YTFA 3TCPA 4G9RA 5I9VA 3C5UA 4K1BA 2OXDA 4UEUA 5LARA 2JFMA 3NGAA 3O7LD 2E9UA 4I0SA 3NIEA 3VS7A 3R7UA 2RG6A 2UW5A 1R78A 3POZA 1KE5A 4ZTNA 5KMIA 2ZJWA 4KIPA 5ACBC 4GU9A 4M84A 4RWJA 1PXNA 3H9FA 3RWQA 1B39A 1RJBA 4FSWA 4IX5A 1PYXA 2I0EA 3UMXA 4X6QC 2H9VA 5BVWA 4G17A 3RHKA 5JEBA 3QBNA 2QVSE 3P7CA 2VX0A 1KSWA 1UU7A 2BUJA 2SRCA 3NWWA 2VTNA 5M4CA 3BHVA 5F95A 4BCGA 3HDMA 5F4NA 4CCBA 3D83A 3R8ZA 3P7BA 3HECA 4J8NA 1UU3A 3MI9A 3IDCA 1BX6A 3OWKA 3MFSA 1ERKA 3KRLA 2CJMA 3ZXZA 4BZNA 5CU0A 3LHJA 2HY0A 2ZAZA 5LVNA 5CU6A 4XBUA 3C13A 4IDTA 2WNTA 4RJ3A 3Q60A 5I5ZA 3R7EA 1DAWA 2X81A 2WMTA 4M7IA 5HG9A 3RAIA 4BGGA 4IZAA 3SX9A 3MGYA 4CSVA 4Z55A 5KNJA 3G6GA 4RJ5A 3R0TA 1M14A 2UVYA 3E8NA 3G6HA 4UMTA 4W8DA 3P86A 3OEZA 3UMWA 3W2SA 3FY2A 4RC4A 4BDIA 3AGLA 3GGFA 3DFCB 4KBKA 4O0WA 4WOVA 4F0FA 2VRXA 5FGKA 4I24A 3ACKA 4F9WA 3G33A 2O5KA 5IA2A 3D7TA 4YZNA 3R8UA 4K77A 4X2KA 3R8VA 4MBLA 3WZJA 3PPZA 4LI5A 2G2IA 4OT5A 3E87A 5GJDA 5EDQA 1Y6AA 4UWYA 4Z16A 2ONLA 3UE4A 2BIKB 3C4ZA 3MWUA 3NYNA 1FPUA 5CEMA 3SV0A 4R5SA 2O64A 3R1YA 3UNZA 2VO0A 5E1SA 4C3PA 1I09A 2B9HA 4FTJA 4XV9A 4A4XA 3WARA 5DWRA 2HXQA 4K8AA 3FPMA 4QYEA 3UOLA 4H58A 1Y6BA 2FSMX 4OTHA 3WYXA 4YJVA 3OWPA 2XIYA 3DGKA 2C69A 3F3TA 3KVWA 3KXXA 4IQ6A 2R3RA 3QD0A 4ALWA 3KQ7A 2XKDA 4FV6A 5KBQA 4QP8A 3MVLA 3NUPA 5CF4A 5JT2A 3FL5A 2BRMA 3ROCA 4PP7A 2W5AA 3MYGA 5H8GA 2WOTA 1M7NA 2OSCA 4XG8A 4DH5A 4FKGA 5FP5A 5M4IA 5FTOA 3FLQA 3KULA 3WF6A 2X8EA 5HKMA 4UY9A 4C4FA 4HYUA 5DBXA 4FSNA 2PL0A 2C1BA 3RCJA 4JL9A 3F2NA 3A8XA 5DVRA 3VRZA 4GT4A 2QD9A 2OF4A 3W2CA 4LV8A 5L2TA 4RWKA 2IZSA 4PNIA 5DI1A 4FTTA 5HE1A 1OIYA 2PMLX 2Z8CA 1YHSA 5AR2A 3Q4TA 2XK3A 2UZUE 2XA4A 1YWVA 4M67A 4O6LA 3SRVA 5CXHA 2O3PA 3ORZA 4BTMA 5L3AA 1U5RA 4M0YA 4ITHA 2QU5A 3AC3A 4FNZA 4C4EA 2CGUA 1REJA 3TNHA 4X6RA 4UALA 5CENA 2WTIA 2QO7A 3VW8A 1YHWA 3F88A 5AR5A 1FINA 5HVYA 5JK3A 2BZIB 3OOMA 2WFYA 3Q4CA 3HV7A 2UZNA 2W1FA 2UZOA 3C0HA 5B2KA 1JKSA 4AGUA 3RPYA 4MX9A 3DKOA 3F3UA 5I0BA 3QZHA 4G3CA 2BIYA 2IVVA 4FL2A 1YI4A 3DLZA 4ANOA 3OTUA 3P08A 3G51A 4FTAA 3CXWA 3C4EA 4R3RA 3ODZX 5HOAA 3RALA 3OG7A 5KHXA 4GT5A 5E7RA 2QI8A 4L3LA 5FXQA 2ERZE 2F9GA 3OW4A 3ZM4A 3QKKA 3R1NA 4ERKA 3FMJA 4NWMA 2EXMA 3V5TA 3I5NA 2OIQA 1BUHA 2GFSA 4JBVA 3HEGA 3DDQA 2JDSA 1GNGA 1ZOHA 4F99A 3BZ3A 4OBOA 4U3ZA 4FSUA 3ZLXA 2ETKA 4D0XA 3EIDA 4O0UA 3QUEA 4TPTA 5CSHA 2YCFA 1F3MC 1YOMA 3U6HA 3IG7A 4CKJA 3KVXA 2G1TA 2XKFA 3I79A 4FKPA 4EORA 4CQGA 4QMYA 4DINA 2ITOA 4E8AA 3ORNA 1GZ8A 1BKXA 3F6XA 4KRDA 2YDKA 4O1OA 2VNYA 2UW8A 4I20A 4B7TA 3EKNA 4JRVA 4E4XA 3QGYA 4IJPA 5LVLA 2X9FA 4U45A 4E6AA 4NK9A 4XLIA 3ORPA 4JAIA 1QPCA 3FMDA 1Z9XA 3ETAA 4BCQA 3T3VA 4KSQA 5HCXA 4C62A 3WF5A 4CV9A 4EZ7A 2Y4IB 4F0GA 3E64A 3ZTXA 2XRUA 2B9FA 3AC4A 4FTUA 4BDBA 4GUBA 2G9XA 4EBVA 4PTGA 2WKMA 3KXZA 4JAJA 3PWYA 1NA7A 1VEBA 4HZSA 1K3AA 3F5PA 2YITA 4JT3A 4Q9ZA 4QMXA 3ZLSA 3RAHA 4ZTSA 2FB8A 3B2TA 5FWKK 1QL6A 4RGJA 2UZTA 4EKKA 2C0TA 2ONLC 2PVRA 2WQOA 5CAVA 4IAIA 3EOCA 3DLSA 2X7GA 3F3VA 5DHJA 4BDCA 3UIBA 4EQCA 1E1VA 3MN3A 4F7JA 3R63A 5LMKC 4NTSA 3PJ2A 4FA2A 2XCKA 3OHTA 3D15A 4JR3A 5AUTA 3AC8A 5IA3A 2B54A 4OAUC 3OFMA 4ZZOA 4OTIA 4U7ZA 1FGKA 1RW8A 2C6LA 3BBWA 4O0YA 4ENXA 3TUCA 1V0OA 4MNEA 2W1ZA 4EOOA 4O0RA 1U46A 5K0XA 2C3LA 4K6ZA 3EQFA 4E6CA 4RA4A 4JNWA 5A54A 4RFYA 4E93A 5D11A 4BCMA 4BN1A 4KIOA 4QP9A 3EN6A 5KE0A 4ZJJA 3TZ9A 3RPRA 4AT5A 4EQMA 3HA6A 4FF8A 4J8MA 2ITTA 2X39A 2BRBA 3OCTA 3E8EA 4BB4A 4TZRA 1M52A 3W8LA 4Z9LA 4BCFA 4NM5A 5AUXA 3MTLA 4TY1A 1OPJA 4OW8A 5LVPA 4FTIA 1PMNA 4ASDA 4F6WA 2IVSA 2YEXA 2OJFE 5HD4A 5JN2A 3ZUTA 4Z7GA 2ZV2A 4MWIA 5AX9A 4AZEA 4EOJA 4DN5A 3CP9A 4ZP5A 3FXWA 3TG1A 2V7AA 3LFBA 2BKZA 3VQUA 2J0JA 2BAJA 4MD8E 3RZBA 2YAKA 3D0EA 3MJ2A 3ZZEA 1KE6A 1CKPA 1UNGA 3DAKA 3GU7A 3KRXA 2CKEA 1XO2B 4BDDA 2QOKA 1R0PA 4O4EA 5FEQA 4YHTA 1PYEA 2IO6A 4RX8A 3SD0A 3K2LA 2ZM3A 4FV0A 4CEGA 1FGIA 5BUIA 1ZLTA 3VBQA 2HAKA 3Q9ZA 1O9UA 1PXJA 4E26A 3CE3A 3D5UA 4YLJA 3NX8A 3L9MA 3RCDA 4FT7A 4L6QA 3MJ1A 4N0SA 3W55A 3G0FA 3E5AA 1TZDA 2P0CA 3OD6X 4G6OA 5CANA 2ZV9A 4PPBA 3ORMA 5D9HA 4KD1A 5C01A 4S33A 4U5JA 4XBRA 3L9NA 4R7HA 2BCJA 1LEZA 1V1KA 4FV3A 2WAJA 2XNBA 3JY9A 3PA4A 3FLYA 3TNWA 2W1DA 3GOKA 5EOLA 3AT3A 3IS5A 4JX7A 2WEVA 3HKOA 4GUEA 1Q99A 2QLQA 1WBNA 4M3QA 4RSSA 2BAKA 4ZSJA 5ETFA 1J1CA 3RBWA 4ANBA 2QOIA 4NH1A 1K2PA 4E5AX 4FIHA 3S95A 4QTDA 5F20A 3ZC6A 5CQUA 2FSLX 2X7OA 5L2QA 4GL9A 4FC0A 4H3QA 1CKIA 3GFWA 5AUVA 3KRJA