3DY7A

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a complex with ligand and mgatp
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
303
structure length
260
Chain Sequence
ELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Beyond the MEK-pocket: can current MEK kinase inhibitors be utilized to synthesize novel type III NCKIs? Does the MEK-pocket exist in kinases other than MEK?
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 260
sequence length 303
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dy7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dy7A01
2F2UA 2XMYA 3H9FA 4KKGA 2NRUA 5KMOA 3F6XA 3NNVA 3SDJA 3KKVA 3ZO4A 3F9NA 3SW4A 3W2QA 4QMYA 3HEGA 3QRKA 3NNUA 4EORA 2YEXA 3UIUA 5CS6A 3HRCA 4YC8A 4Z7HA 4FOCA 4RLLA 3MFUA 4DEAA 3D15A 1YRPA 5ITAA 2CCIA 1TQIA 4DTAA 5TO8A 3A7FA 3FMDA 1JSVA 3IQ7A 4FT5A 3H0ZA 4YHTA 4ZXTA 3R7YA 3W2OA 3ORIA 4MNEB 3W55A 3ETAA 1NY3A 3LQ8A 5CU0A 5K0XA 3IW7A 3FMHA 3UYTA 3CXWA 1Q24A 2XYNA 5DH3A 4FKVA 3CBLA 3QLGA 3W32A 1LEWA 4GVJA 2R5TA 4CZYB 3KEXA 2QURA 2YDJA 5L6OA 4S33A 4XH6A 5FXQA 2IW8A 1U5QA 4DTBA 1GJOA 4PPCA 4B6LA 3NRMA 4CMOA 4L52A 3WI6A 4DN5A 4GKIA 2HYYA 3AC3A 4DG3E 3ULIA 2UZEA 1FMOE 1QPDA 2WAJA 4BCNA 3QUPA 4U9AA 3DCVA 2QOOA 4HCUA 4W4WA 2YDKA 3E64A 3S3IA 3QD4A 4Q2AA 1OM1A 3FMNA 3QWJA 4FEVA 4JAJA 3W33A 1PW2A 4EJNA 3RK5A 1ZLTA 4IWQA 5M51A 2VO3A 1R39A 3CP9A 3F5UA 4EK5A 2YJSA 3KREA 2C6TA 5JRSA 2GFSA 1M7QA 5H8BA 5L8KA 5I0BA 2XNOA 1Q8WA 4EH8A 3KXZA 3GC0A 4RJ4A 4DH1A 2YM4A 2IZUA 4U8ZA 4UWCA 3A8WA 5LARA 5C4LA 3EQFA 2W0JA 5G6VA 1W7HA 3FLSA 3NUAA 2XK9A 3VUIA 2ZV9A 1XH6A 3CE3A 2A19B 4ZTRA 5TE0A 2VTJA 5E92A 4RIOA 1U46A 3S0OA 3CQWA 3BHHA 3IOPA 4PUZA 5J9LA 4GKHA 3U54A 3FI4A 1Y8YA 2NRYA 1QL6A 3FL5A 2Z7QA 1ZYSA 2IWIA 3HUCA 3QTWA 2OIQA 4G6LA 4GYIA 4RX8A 4M0YA 2GQRA 3F3UA 1PMVA 3HYHA 5HG5A 3R8ZA 3DAJA 3HV3A 4ZSGA 3R9OA 3ZU7A 2PU8A 4FTIA 3N4TA 3DDQA 1YHWA 3PLAE 3OY1A 4P90A 4TWNA 3EFKA 1O9UA 3HV4A 5CEQA 4MK0A 2B9JA 2P0CA 4F9BA 4CNHA 1VJYA 4ZLYA 4M0ZA 3TKIA 3HV5A 4YNOA 3TZ7A 3ZLYA 3MIAA 4YC3A 5IQGA 4IZ5A 4PP7A 3PSBA 3FMKA 4RIWB 4ERWA 5DNRA 4IX4A 3QQKA 5HG8A 4MQ1A 3UG1A 4ENXA 3PA4A 5H3QA 2QKRA 3G0EA 2CNVA 2NP8A 5E1EA 3S1HA 5L8JA 4MF0A 4NCTC 3F69A 3SAYA 4TWOA 4ZK5A 1JKSA 4YJUA 4YTIA 4E4NA 2JAVA 3LQ3A 3EYHA 3QA0A 3EMGA 3W2CA 3OCTA 4ZTNA 4EHGA 3ORNA 3PXKA 2VTOA 3EHAA 2JDVA 4CG8A 3CS9A 5CT0A 3E88A 4A9RA 2EB3A 4I5HA 5AP7A 4G5JA 5CEIA 1BMKA 3GFWA 3R9NA 3KXHA 3G6HA 4KIPA 4QMZA 5E1SA 4D2RA 4UYAA 3ZO2A 3E3BX 5L8LA 2AC5A 2BZJA 5CU4A 3HV7A 4AE6A 2PE1A 3NEWA 3OT3A 4DINA 4Y5QA 4LQMA 5E7RA 2OXYA 4UMQA 1U54B 4ALUA 4F0FA 3QHRA 3PP0A 4UEUA 2DS1A 2XNPA 2IVUA 3BIZA 1UNHA 4FTRA 5HD7A 3FEGA 2B4SB 5EOBA 3H9RA 2XK8A 4CQGA 4M3QA 1IAJA 3NUYA 3T3UA 3RPVA 4D0WA 4F6SA 2YCQA 5KHWA 3R0TA 4BCQA 5IDPA 5F20A 2OBJA 4FV1A 3UPZA 1V0BA 2ZMDA 3E87A 4IE9A 4FI1A 1SNUA 3RPRA 4C58A 1UNLA 4IX6A 1XJDA 2J0KA 4PNIA 4CXAA 4IVAA 2BILB 4ONAA 4RC4A 5FTQA 4DFNA 4O27B 2W96B 2R0IA 2QLUA 4B0GA 2RG5A 5D12A 4J98A 5TR6A 2CGUA 3ORXA 1RQQA 4APPA 5E4HA 3RWPA 2W1IA 4O0SA 2G2IA 2B55A 2F9GA 2PUNA 5EHYA 1JLUE 5IKWA 5CEMA 1LUFA 5AX3A 4F6WA 3MPAA 5HI2A 4AAAA 4FEWA 5HNGA 5HQ0A 3H10A 1JKTA 2R3GA 3BYUA 4GFGA 2HW6A 4UZHA 1TQMA 3TXOA 5IU2A 3L9NA 3WE4A 4ZSLA 5I9ZA 3S00A 2JDTA 3LFFA 3LFCA 3OCBA 3BV3A 3O2MA 4OT5A 4FK3A 2B0QA 5F4NA 4TN6A 4L01A 3TV4A 1NVQA 2VGOA 5K3YA 3KRXA 5CY3A 3FY2A 3OEFX 4RIYA 1AQ1A 2F7ZE 3KU2A 4Z7GA 1ZOHA 4BBFA 4ZAUA 2R7IA 3VBXA 2O64A 2XUUA 3R22A 5AV4A 3NW7A 3MESA 1LEZA 5C8KA 5AP1A 1YW2A 4RA4A 1J3HA 2VWUA 5EW8A 4F0IA 4C4IA 2BHEA 3NVKI 1GAGA 4BBMA 3KN6A 4BYIA 4FKUA 1KUTA 2BFXA 2PZ5A 2VWVA 4JL9A 4K9YA 2ZMCA 4FV6A 3RAKA 4NM7A 4DH5A 3EFJA 4MHAA 4PX6A 4DGGA 1W0XC 3QTIA 4YJVA 4L67A 4YC6A 2XJ0A 2WTJA 4FZFB 2XK6A 4AU8A 4DEDA 1XBBA 4MQ2A 4BGHA 2CNUA 3KXGA 3HA8A 4XV1A 3TJDA 1ZOGA 2YITA 1ZZLA 5AM6A 3LQ5A 3VVHA 3D83A 4LGHA 5KMIA 2YJRA 3I7CA 5D7AA 4F6UA 3R00A 3GC9A 3QZIA 3VQHA 1GZKA 2GTNA 3F3TA 4XG6A 5EOLA 4Q9SA 3SOCA 2GFCA 2OI4X 4X3FA 4GFMA 2O5KA 3DOGA 4N0SA 1CKJA 3R8UA 4B8LA 2QOLA 2Z02A 4QP6A 3NYOA 5BPYA 1U59A 3EIDA 2A2AA 4I21A 3LCSA 2WTVA 4FTUA 5LXMA 1XH5A 4PNKA 2X0GA 5HICA 1SZMA 2F57A 4RJ3A 5LCKA 3OWJA 4PL5A 3FPQA 1SNXA 4MWIA 3VUDA 3GP0A 4B8MA 4NCTA 3ORZA 4PDYA 4FEQA 4J71A 5EHOA 2QNJA 4C62A 4OTPA 2WPAA 2HELA 5CLPA 3R9HA 4V04A 4AZTA 5FEDA 4YSJA 2IVSA 4K8AA 4TY1A 3NAYA 5HESA 3T8OA 3TNQB 3N9XA 3WIGA 4QPAA 3QQJA 4TTHB 3UO5A 2RGPA 3LJ1A 5HTIA 3PP1A 4FMQA 4RFYA 5GHVA 2PYWA 4AZFA 3EQHA 5JK3A 2JDOA 4AOIA 3WF8A 5IF1A 2FH9A 4MTAA 3SX9A 1G8AA 3KC3A 5E8TA 3KULA 4LFIA 4YNEA 3ZXZA 4JX7A 4YP8A 3QCQA 5E9EA 1UU3A 3KMWA 4JDHA 3HDMA 4XG2A 4CG9A 4EBWA 3DKOA 3BYSA 3GNIB 5HBEA 2CJMA 4O7WA 4D2VA 5E8VA 3VJNA 4BVUA 3EQDA 4JQEA 3ATTA 3PDTA 3BHYA 3LIJA 4NFMA 1OZ1A 4I93A 3ELJA 1XKKA 1YDRE 3NIEA 3W10A 4DF3A 4RGJA 1H28A 1XWSA 3ZYAA 1F5QA 1OIUA 2QKWB 2YERA 3HMMA 1IRKA 5FXSA 5IZFA 3DAEA 3II5A 3FSFA 3SHEA 1GIHA 4S32A 5DPVA 3JPVA 5AP5A 5IH6A 1O6KA 2WMTA 3G0FA 2Z8CA 4X7QA 5ANOA 2X7OA 3G5DA 4BDCA 2KULA 1OI9A 2BMCA 4BKYA 4EHVA 4QP3A 3RCDA 5EYMA 4DEHA 4U6RA 2P3GX 4K6ZA 5HE0A 3RNIA 3FBVA 2NO3A 4ASZA 1Q99A 2GNLA 4FL3A 3SRVB 2C5YA 4E3CA 3OC1A 4FZAB 4D0XA 2GQSA 4FEUA 4XG8A 3NYXA 1YQJA 3R7IA 4D4YA 4ALVA 3LCDA 3GOKA 2R3NA 5AV1A 4GRBA 1YDTE 4M12A 4E1ZA 4C4JA 2PVNA 4F08A 3F2AA 4L68A 3L9LA 4BCIA 1JNKA 3PY0A 3GCSA 2JBPA 5IA0A 4NKAA 3EL7A 1URWA 3LFBA 5DE2A 3ZRKA 1M17A 2X6EA 1W83A 1BLXA 3DLZA 3VBTA 3MFTA 2WEIA 5EYDA 5E8UA 5ANIA 3UIXA 4LI5A 3V3VA 2X2MA 3SGCA 4ZS0A 3TZ9A 3HAVA 2CGWA 2IZRA 3BLQA 1IR3A 4F9YA 4NEUA 4MEDA 5EYCA 3JVSA 2QVSE 3GCPA 3RCJA 4D5HA 3LFAA 5CF6A 2G01A 3UODA 4IWOA 3ZSIA 3TDVA 5J7HA 1HCLA 4TWPA 4O7VA 5B0XA 4F63A 3W8LA 4H05A 2FVDA 4QYYA 4E8AA 3E3PA 2HWPA 4MNEA 4IVDA 4QNYA 3I6UA 3BQRA 4R7HA 3GQIA 3W2RA 1PXLA 1ZOEA 3TUCA 4JS8A 2JLDA 4YTCA 2BR1A 3QQGA 4W4YA 4BB4A 1ERKA 2C68A 2OH4A 4FIIA 4GYGA 4IM3A 4ANOA 3O8UA 2Y4IB 3FAAA 4Q5HA 3FI8A 5GJGA 4ZP5A 4O7RA 1STCE 5FP5A 5KO1A 3DAKA 3JUHA 4YJRA 1NXKA 3MIYA 2PZRA 4RWKA 3RPYA 2XBJA 3DJ6A 4JQ7A 4CQEA 3D5UA 4WO5A 4CCBA 3WZUA 4YGAA 1Q4LA 1IG1A 5KNJA 3C4EA 4O21A 3QQUA 1QCFA 2B54A 2XKFA 3MY5A 3PJ1A 3QHWA 5A4LA 3ERKA 4BCFA 3UQFA 2GHLA 3OS3A 4DG2E 4F99A 2YN8A 3M2WA 3KF4A 3DT1A 4NTTA 3VS0A 5F1ZA 4MXZA 3SV0A 3TCPA 5ACKA 3PJ8A 4IZAA 5HLPA 2X8EA 2YWPA 3QX4A 5IUIA 4JNWA 4FTTA 4C59A 4GJ2A 1FMKA 1V0PA 3BYVA 3EL8A 1R78A 3CTHA 3JXWA 3ZUUA 5AUXA 2YFXA 5AUZA 2I0EA 3ACKA 3MY1A 4NM3A 4HVSA 4RLKA 3DBDA 3O17A 4JDKA 4K0YA 5AIKA 3CSVA 3OOGA 4FNXA 5CSHA 4LV5A 3KMUA 4BCOA 2C0OA 2GHMA 4AG8A 5CANA 4U42A 3BPRA 5I5ZA 1J7UA 4Y95A 2I0VA 4O0XA 1Q41A 2UW8A 2ITQA 2B7AA 3FJQE 3R1NA 4G9CA 5DLSA 4EOMA 4DH3A 4O81A 2WQNA 2W1FA 4YJQA 2Z7LA 3ORPA 4BL1A 3CD3A 2XYUA 3K54A 3QALE 4YZMA 5EQEA 4O0TA 2XS0A 4C0TA 3TT0A 2QG5A 5IH5A 3WIKA 3IOKA 3WF9A 4AA0A 3ZM4A 3U4WA 1XO2B 4FV9A 3FLQA 2ZDTA 3PPJA 4EBVA 1WBOA 3FLZA 1KE9A 3LXKA 5FBNC 4CFUA 4RIWA 4Y85A 4DT9A 4ITHA 1Y6BA 5DOSA 4O84A 1UKIA 4FIJA 3R7EA 5C26A 4CZTA 1OBGA 1VYWA 3N4VA 4YZDA 3FMJA 4UY9A 3UDBA 2BIKB 2UZNA 5H2UA 2RFDA 1YXVA 2CLXA 2Z7RA 3FYJX 2PZIA 3MH0A 3RNYA 2CKPA 2CNQA 2OSCA 1MP8A 2WTIA 1UA2A 3KL8A 3OP5A 2QD9A 4PWNA 1YHVA 2PZPA 3C50A 4OTGA 4R77A 4HYUA 1GOLA 3MN3A 1H07A 3ORLA 1WVYA 2J5FA 4FR4A 1T45A 3DZQA 2YLEA 3RVGA 4NTSA 4XV2A 2R2PA 2HW7A 5KZIA 5J1VA 4RX5A 4G5PA 4OT6A 3FL4A 5D10A 3HVCA 4YBKA 3PZHA 2XM8A 2GSFA 4G3EA 4U3YA 4A4LA 2FA2A 2YM3A 4EK8A 1PJKA 3EQCA 5ANKA 4EOJA 4FT7A 2WXVA 3RHKA 2FB8A 5GIOE 2GU8A 3NIZA 1U54A 4LGGA 4GUEA 4EH9A 2ETMA 1G3NA 2YIRA 3R8PA 4WSQA 2IW9A 3ZCLA 4R78A 3QXPA 5TT7A 5L2IA 2BAKA 5EI6A 3BE9A 2QR8A 3QBNA 4ZZNA 1OPJA 5HLWA 1J91A 4PP9A 1YI4A 2GS2A 5FEEA 1M2PA 3E93A 3G33A 4I4EA 4FKSA 4QTDA 3RK7A 3THBA 3U87A 3MV5A 3E5AA 3KK9A 4CFNA 3EQGA 2V22A 3LCOA 4PMPA 4KIQA 4X3FB 5FLFA 5CVGA 4ANBA 2WQOA 3G15A 4DE4A 3T3VA 3LXLA 3NUNA 3VHEA 3SVVA 2GHGA 4IVBA 1KV1A 3ENHA 1BX6A 4MCVA 4FX3A 1OL2A 5ETCA 4E20A 2XNMA 3LMGA 3OG7A 4E5AX 1DM2A 2CN8A 2XNNA 4FTOA 5EW9A 4J96A 4QTCA 4D28A 5FP6A 4GK3A 3UP2A 1J1BA 4L44A 4BDBA 4CT1A 3QC9A 3A7JA 2VWYA 1HCKA 1RE8A 2YHVA 3SD0A 4F7SA 2I40A 5KMMA 2PMOX 3GVUA 4QNAA 4BI0A 1J7IA 4QOXA 2Q0BA 4KSPA 4NFNA 4X2KA 4EH6A 1XH8A 2C6OA 3EN7A 3NCZA 5LVLA 2OGVA 3U6IA 1S9JA 3DPKA 3R8VA 4O83A 3NNWA 4BDIA 2X8DA 1IA9A 3PXYA 3QL8A 5D7VA 3E8DA 4I5MA 4BICA 4G9RA 4MKCA 3RTPA 4FT9A 3NLBA 3LFSA 4WNOA 5C8MA 5JFVA 1OECA 4I1ZA 3VBVA 5K5XA 5AUTA 4D4RA 4O7SA 1H00A 4W8EA 1M2RA 2VO7A 4LUDA 4IBMA 2C0IA 4ZZMA 2DQ7X 3D2IA 1PYXA 2IPXA 2QLQA 2F2CB 2PVMA 2QC6A 1OL5A 3BRBA 1SVEA 2HY0A 4DBXA 4M67A 4L9IA 4M7IA 4PTGA 5LVOA 4AXAA 1CSNA 5CAVA 1Y8GA 4KNBA 4QMTA 4N57A 3KFAA 4BBEA 2CKOA 3VIDA 4W9WA 4HPTE 4C3PA 2PL0A 1B39A 1YWNA 2I7QA 3UVQA 2G2FA 4AGUA 2ONLA 3RAHA 3V01A 4ZJJA 2QO9A 3QC4A 4PMSA 2YABA 3RPOA 4ASXA 2C3JA 2C0TA 5CU2A 5IQBA 3E7OA 2ZM4A 1YKRA 4RJ8A 5F9EA 3ACJA 3ZRLA 3QYZA 2R3QA 2WMUA 3AXWA 3K5UA 4IAFA 5FDXA 2R3IA 3FY0A 4HNIA 2YCFA 4JR3A 3UZPA 3BYOA 2VTQA 3UG2A 2DUVA 3AC8A 4QP4A 4FEXA 1Q8UA 3RZBA 3RHXA 4MAOA 3R1YA 3LVPA 5DWRA 4FV7A 5IA2A 3F88A 4OAUC 1UNGA 3DFAA 3FLYA 3IGGA 2H6DA 5HKMA 3ZEWA 2YZAA 4FZ6A 5EI2A 2WQBA 4AS0A 3AMYA 3AC5A 4FNYA 4CT2A 3DXPA 2CMWA 5HVYA 3PIXA 4EYJA 3Q6WA 5HGIA 1CM8A 4XHKB 4CCUA 2XIKA 4O82A 3GU8A 1ZZ2A 2PE0A 2ITTA 3A8XA 3QD2B 5T6KA 4FV8A 5HCXA 2HK5A 3OMVA 2QQ7A 1Y57A 3P23A 5DT3A 2VNYA 2VD5A 4U7ZA 3I5ZA 3BYMA 1U4DA 4ANQA 2JKKA 3ZC6A 4X3JA 4QMPA 4U41A 2C4GA 4FNZA 4U43A 4XG7A 4DA5A 3IDPA 1QMZA 1H1QA 3LFNA 1O6YA 4USDA 5GNKA 4F1TA 3PTGA 4MF1A 2OIBA 3QTSA 4KA3A 4QPMA 3SQQA 3CTJA 5B2KA 2EWAA 4FTMA 2CLQA 3TZ8A 4EYMA 2C6DA 2QOIA 4QQ5A 4QT1A 4QQTA 4OW8A 2ZOQA 4EWQA 3CIKA 2JEDA 1IA8A 3BGPA 4PF4A 4RFMA 4BZOA 5AUUA 2QOCA 3COIA 3UOHA 4F9AA 2ITZA 3G9LX 4D2SA 4MXCA 1FVVA 2RIOA 3TEIA 5HTBA 5IA1A 3BKBA 4NUSA 5HO8A 3UOLA 4EOKA 3VF8A 1OVEA 3NUXA 4F09A 1E1VA 4RPVA 5K5NA 3VULA 5LVMA 4GMYA 4K33A 4XS2A 2QOKA 4JJRA 4G6OA 3R6XA 3TIZA 1H1SA 3VS2A 4O1PA 3RMFA 3U6HA 3MDYA 4F7JA 5CU3A 4FG9A 1B6CB 2XZSA 4U81A 4ZIMA 4FSUA 3FDNA 3G6GA 3R7GA 4HGEA 4ALWA 5FRIA 2FSOX 2OJGA 3OXIA 3OD6X 4M68A 4TYIA 4C8BA 4NYEA 2PWLA 4L43A 5IISA 4FBXA 2VWBA 3ALNA 3IK3A 3M11A 4I24A 4WA9A 4NM5A 3WF5A 3SRVA 4DFLA 3TI1A 3P5KA 4YPDA 5IA5A 2NNWB 4F7LA 2VTTA 3BZ3A 4IWPA 2A0CX 2WOUA 3MWUA 3HRFA 4QD6A 5I9WA 5M53A 5EDRA 3Q2JA 5A54A 2GNHA 4Y72A 4DLJA 3TACA 2X1NA 3L1SA 4DC2A 5ICPA 3CJFA 2OZOA 3P7AA 2YISA 5HE3A 3R9RA 4GJ3A 4YMJA 2QOFA 1BUHA 5LVNA 4RQVA 3ZDUA 4FTQA 1JKLA 2B9IA 3KA0A 4N6ZA 5K0KA 3RM6A 3CGFA 5TF9A 2CKEA 4G2FA 3O23A 5EDQA 3GEQA 2Y4PA 3IKAA 3NUUA 4ZLZA 2Y7JA 4FG8A 5EFQA 2B53A 5AV3A 5KE0A 3DJ5A 3Q6UA 4X3FC 5BUEA 5JQ5A 3C4FA 2R3RA 3QFVA 4N4SA 3TNPC 5C01A 4ITIA 4FK6A 3CCNA 4JAIA 5CQWA 4E6CA 1APME 5M4IA 3RBWA 3QUDA 3U8WA 4I6FA 1RDQE 2BAJA 2BTSA 3PIYA 3D4QA 5BVFA 4AGWA 3BV2A 2SRCA 4H3QA 3HL7A 3U4UA 1MUOA 2G1TA 4FIGA 4AZSA 5HNIX 4KKEA 4XP3A 3GT8A 4YO6A 2UVYA 2B9FA 2XRUA 3R02A 3PRFA 4OBOA 2WIPA 4S31A 3CY3A 4PPAA 3NSZA 4B99A 4FV5A 3ZC5A 1ZMUA 2OG8A 4B4LA 3BHVA 3HECA 2H8HA 1H8FA 5IQEA 1PXJA 3KXNA 5A6NA 2O0UA 4EQUA 1ZY4A 4BI1A 4DFYA 3CD8A 3LZBA 4ZOGA 3TKHA 2XM9A 3QQFA 4H1JA 4U40A 1ZYDA 3AT2A 1YOJA 4FIEA 1PKGA 4EHEA 3BEGA 2EB2A 5CF4A 4EKKA 4RSSA 5AV2A 4E6AA 5IQAA 4Q5EA 4D1ZA 1NT2A 5BVOA 4IQ6A 4YJOA 4FC0A 1DS5A 4NKSA 5GJFA 4XNEA 2ITYA 3FI2A 2QO2A 3ORMA 4AP7A 2OU7A 4BDDA 5LMBA 4EQCA 4LMUA 4IAZA 4A9YA 3HMOA 4WG4A 1H0VA 1OIQA 2I6LA 2VTAA 2VWXA 3O7LB 3QGYA 4J52A 2PULA 3UMXA 4R6VA 2PPQA 1NVRA 3WARA 3PPKA 2QU5A 3MGYA 3UO6A 4WSYA 3PJ3A 1ZYLA 3FE3A 2ITPA 3ZO3A 4E6QA 4IADA 5IEXA 1JSTA 4AX8A 3PJ2A 4FKWA 3B8QA 3NYNA 3Q2MA 2OFVA 4PY1A 4LMNA 4TRLA 3PFQA 2C5VA 4TL0A 2WNTA 3CC6A 2VUWA 1YXXA 2ZAZA 1S9IA 1VR2A 1YOLA 4AGDA 3EN5A 3PSDA 2GPHA 1PXNA 2LGCA 3BI6A 1CDKA 4JG6A 4DAWA 5BYZA 1P14A 4AACA 2UZDA 3MS9A 3FXZA 3L8VA 3VBQA 1SMHA 2IVVA 4J8NA 2WMRA 3TTJA 3EOCA 2X39A 5IUGA 5HIEA 3FQSA 3VN9A 1BI8A 4D9TA 3FZTA 5JN2A 3AD4A 3RINA 2ITUA 5AUVA 2C69A 2E2BA 3MA3A 4UZDA 5KMJA 4XUFA 4C34A 3H0YA 3DY7A 2OWBA 4FKIA 3WF6A 1ZYCA 3E63A 4IZ7A 3OFMA 3ZO1A 4GSBA 5DYJA 2FO0A 2UVXA 3MI9A 3LMIA 1YOMA 3VS3A 2I0YA 1BYGA 4RA5A 3WE8A 5JKGA 1FVTA 5JZNA 2X8IA 3M1SA 5CALA 1A9UA 5CWZA 3I60A 2GNGA 3IG7A 3MW1A 4WBOA 4TYHB 3HDNA 5AUYA 3ID6C 4FZ7A 1JKKA 3LLAA 5CEOA 4XOZA 2HIWA 3OW4A 4CVAA 5EH0A 4WNPA 3BHTA 4MXYA 2RG6A 3TN8A 3MH1A 5JGDA 3OZ6A 3UVRA 2VTLA 2XVDA 4DT8A 2QHNA 4KKHA 1E9HA 4NWMA 4RIXB 3HX4A 3ZM9A 1OPLA 1YDSE 2QHMA 3FHRA 2VNWA 3Q9WA 5E8WA 4K18A 4EC9A 1KSWA 1F3MC 2UW5A 3JYAA 5AAGA 4P2KA 4AWIA 4G3GA 3ZRMA 3POOA 3AMBA 4FICA 4OTQA 3EKNA 5E8ZA 3TUBA 2VX0A 2ITWA 4AT3A 4BTFA 5BVEA 4H58A 1W84A 2G9XA 5EKNA 5HO7A 4YZCA 4ZS4A 3NGAA 5DI1A 4RZVA 5AP2A 3FKNA 2R64A 2QOQA 2CGVA 5AX9A 3PA5A 5C4KA 2C3LA 5AR7A 1U5RA 5KMLA 2YM5A 4ZMEA 4GG5A 5FEQA 5DT4A 3V5LA 4AZWA 2XJ1A 1BKXA 2XKDA 4CKJA 3GQLA 4GK2A 3R8MA 4GEOA 1XH4A 1O6LA 3OT8A 4IB1A 4JDIA 4KRCA 2PE2A 2QO7A 3MTFA 4FODA 1MQ4A 1GIJA 5HHWA 4QYGA 3F66A 3F3ZA 4YURA 5CSXA 4IFCA 3OWPA 2QG7A 5J79A 4EK6A 1M7NA 2C6KA 3H30A 3MB6A 4C36A 5DEYA 2W99B 3LLTA 5CSPA 5GZ8A 3PVWA 1URCA 4AW5A 3WYXA 4FUXA 5AIRA 2X4FA 2YLFA 3ZLXA 1Z57A 2V62A 4EK4A 4F4PA 5CAUA 4GT3A 4EH4A 2VAGA 2EUFB 4FTCA 4BY9E 3NCGA 2V0DA 4FZDB 2ZDUA 3FZ1A 4D9UA 1V1KA 2BKZA 4AN2A 5CASA 4GG7A 1F0QA 3PVBA 1GZ8A 2JBOA 3D94A 4IAIA 5LCJA 3CEKA 2PVKA 4X2NA 3PWDA 3VNTA 3FSKA 4E4LA 5AWMA 3POZA 3GBZA 2BZHB 2IG7A 4BCMA 3K3IA 4EUTA 4IEBA 4NSTA 2XP2A 5M4CA 4ZJVA 3JR1A 4O2PA 5AADA 3Q52A 5CQUA 4EZ3A 2GQGA 3UC4A 3LOKA 3GCVA 4CYJA 1DAYA 4HZSA 2BROA 4YTHA 2BRNA 2WHBA 3I81A 3TDWA 3E8EA 2PVFA 3E7VA 3MSSA 5JT2A 2X9EA 4FE2A 3ANQA 4NJ3A 4CFFA 4KS7A 2A4LA 3C51A 4JR7A 1M14A 1K2PA 3VS5A 3F82A 4MD7E 4TXCA 2YIWA 4EJ7A 2UW7A 4XP2A 3DB6A 4GK4A 4FKLA 5DFPA 4D1XA 3UZTA 5I9XA 4FKQA 4FKPA 4H36A 5HORA 3LAUA 2RF9A 3UO4A 4C3RA 1G5SA 4P4CA 2H9VA 5JGBA 3DFCB 2BRGA 3PJCA 1OKVA 4H1MA 3DZOA 3P86A 3TTIA 3ROYA 4DHFA 3QGWA 2XH5A 4ZY4A 5GIPE 3JY0A 4DEEA 1A48A 3LPBA 5EYKA 2J0LA 3V04A 3NX8A 3FYKX 4PV0A 3OWLA 5HCZA 3OTVA 2YDIA 2JGZA 2JITA 3L9MA 2WMSA 3B2TA 3KMMA 2PTKA 1LR4A 3TM0A 1CKPA 4KABA 1GZNA 1JSUA 2JIVA 3R73A 4HZRA 3AT3A 4USFA 4Y5HA 2CSNA 3L8SA 4FVQA 2IVTA 4X6RA 4QP7A 5JRQA 3CJGA 2E9VA 4DFUA 4JBVA 3TZMA 3AQVA 3FV8A 4KSQA 3A99A 3MVHA 3NR9A 4LOPA 4YZNA 3R2BA 4PMMA 4QQCA 2REIA 3V5PA 5CAPA 4OUCA 5B2MA 4UWBA 5C1QB 4FYOA 3O8PA 3H4JA 4BHZA 3VO3A 3NNXA 3KVWA 4F9CA 2OIDA 4I23A 4OBPA 3VF9A 4NIFB 5ANEA 2EVAA 3D9VA 1Q97A 2UZVA 3NS9A 2O3PA 1RJBA 4P5ZA 4RT7A 3W1FA 2VZ6A 4FIHA 4KBAA 2PSQA 4C02A 5E8SA 4FV4A 2F7XE 2XIYA 3PY3A 4P7EA 1KE6A 5DR2A 3NVMB 2P2HA 4X0MA 5M4FA 1VZOA 2VTSA 3AG9A 4IIRA 5DMZA 1UVRA 3O51A 4R5SA 1KV2A 5J5SA 5J7BA 4UMUA 1XH7A 4YR8A 3QQHA 2GMXA 3E92A 4HGTA 5E90A 2VTPA 4BDKA 3KB7A 5KBRA 4A07A 5CENA 3TIYA 2JDRA 4QMVA 3FXXA 4HYIA 1ZARA 2F7EE 3A61A 4NT4A 3RZFA 4JIKA 5IQIA 2ZVAA 3A7HA 5EQYA 1Q62A 4WNKA 5AAFA 5FQDC 4DCAA 4I0TA 2PMNX 4RWIA 3VRZA 4PDOA 2YACA 3AC2A 4BTKA 2UZOA 2A27A 2J2IB 5CAOA 1H01A 4KD1A 2VN9A 5HG9A 5LWMA 3KRLA 2GS7A 1OL1A 3Q4ZA 2X6DA 3KN5A 2YM6A 4U97A 5ANGA 3WOWA 3MTLA 4FUYA 2Z7SA 4U0IA 3IGOA 1M52A 3EYGA 2XKCA 3GGFA 3CQEA 1PMEA 5BVDA 3O7LD 5A4EA 4BR3A 4J8MA 5A4CA 1J1CA 4DLIA 1VEBA 2W1CA 3D0EA 3D7ZA 5J9YA 2ONLC 3D5XA 3VW8A 3IONA 5BVWA 4CZUA 4AOTA 3L9PA 2R0UA 2XEZA 4W4XA 1SYKA 4XBRA 2PMIA 3DS6A 3P7CA 3KVXA 3PVUA 5L2WA 2O65A 4M13A 4DEBA 4QTBA 5L3AA 3VUGA 4XG4A 3QKKA 4D1SA 1KWPA 3EQPA 3ULZA 5HCYA 3LMHA 3KXXA 5K9IA 1GZOA 5J9ZA 3PUPA 4ENYA 1SM2A 4TNBA 1WBNA 3TNHA 4RVTA 3A7IA 5EM5A 3I0QA 2HXQA 3PY1A 4FGBA 4GS6A 4NJDA 4U3ZA 2IJMA 4HCVA 4UMTA 4UWYA 1QPEA 2R3KA 4R1VA 3Q96A 5HO6A 4I22A 5BNJA 2BTRA 4J95A 3R7OA 1SVGA 3R7UA 4DGOA 4U79A 3VS1A 5AA8A 2OZAA 3TG1A 3NUSA 2PK9A 2OJJA 3WILA 3AD6A 4EUUA 3ZOSA 3DNEA 5BYLA 4E93A 3DV3A 2OH0E 4FSRA 4E73A 4D2TA 2C5OA 4GUBA 3RI1A 5FWKK 3E62A 3SKCA 4AFJA 2RFSA 3MH3A 5IUHA 3Q53A 3NDMA 4EOOA 3I1AA 5K4IA 3AT4A 4L00A 4YSMA 4ID7A 3V8TA 4UX9A 3CKXA 4EH7A 3V5JA 3OF0A 3OUKA 1Q3DA 2VTMA 2VX3A 3FXWA 3U9CA 2YAAA 2B9HA 3Q9ZA 1OB3A 1TKIA 3ZTXA 4MBLA 2VRXA 2X2KA 5A6OA 5FBOA 2LAVA 1YHSA 3DTCA 4EQMA 1PXMA 2ERKA 2OJIA 2W9ZB 3HMNA 4F0GA 2W4KA 4ACGA 4GT4A 2BIYA 1AGWA 4W4VA 2RSVA 2XIZA 3HUBA 1MQBA 2J51A 5EI8A 1JOWB 2UZWE 5AJQA 3UMWA 3UNKA 3W2PA 4BDJA 2WU7A 3B2WA 3ZUTA 4FGRA 3JVRA 3C5UA 3EZVA 4KAOA 3BU6A 1LPUA 3PRIA 4M97A 3VJOA 3HKOA 2C6LA 2B1PA 5M08A 4O22A 2ERZE 3Q4UA 4W8DA 3BX5A 5J87A 3S4QA 1ZY5A 2O8YA 3HZTA 4IJPA 3N4UA 5CYIA 4BDAA 1PY5A 3HA6A 3VRYA 1REJA 4EZ5A 4XRJA 4HJOA 4AN9A 3F3WA 3W16A 4R8QA 3MJ1A 2JKQA 4G1WA 4NK9A 5H9BA 3DU8A 3V8SA 4CV9A 3BQCA 2XNBA 5L2SA 4BKZA 3DKFA 3VAPA 4RZWA 4ASDA 2Z2WA 4G3DA 5C03A 4UB7A 5KCVA 2GDOA 4D2WA 1Q8ZA 3R01A 4DGLC 4HVDA 5CSWA 2Y0AA 4LRJA 1YVJA 4E5WA 2R4BA 4II5A 2C6IA 2X4ZA 4O7LA 2GS6A 3CKWA 3C0GA 4ACDA 2JIUA 4TYHA 1ZWSA 2H96A 4FVPA 2J0IA 3FQEA 3AD5A 3NAXA 2AYPA 4BDEA 4AZEA 4BIBA 2O63A 5DGZA 4GIHA 4UN0C 2FUMA 4ZJIA 4EOIA 4ERKA 4Q9ZA 1GY3A 4KRDA 3WZEA 2UW0A 3LJ2A 5IQDA 2FGIA 1PYEA 3S95A 4UALA 3DK7A 4RIXA 1FVRA 3ZFXA 2YA9A 3FMMA 4L3LA 3VS7A 4TYJA 3GI3A 3SW7A 1FOTA 1BL7A 2C5XA 4IAYA 2W1GA 5AP3A 3F5XA 4IACA 4BF2A 4WHZA 2BFYA 4UXLA 3FWQA 4L7SA 4ANMA 4YLJA 3KGAA 2IZTA 3NPCA 3AC1A 1WBVA 1UKHA 3DBEA 1PXIA 5I4NA 5HBJA 4DH8A 4HVIA 2JKOA 3ZSGA 3F2NA 3NWWA 5H8GA 4QQJA 5AP0A 5LOHA 3R28A 1P4FA 2Y4IC 3EN9A 4JBQA 2GCDA 4BRXA 5KBQA 5BVKA 2W1ZA 4JRNA 1YWRA 4U45A 3GU6A 3C4CA 4RWLA 3W8QA 4BCPA 4EH2A 4QMNA 2Y8OA 5CEPA 5HU3A 5G1XA 5FGKA 3QTZA 4C4GA 2O2UA 5DT0A 4M14A 5HIBA 5AP4A 4QO9A 2BZIB 2G2HA 5DIAA 1M2QA 3QD0A 2VO0A 5HE2A 3SC1A 4EKLA 2BRMA 5DHJA 3VS6A 5IMXA 4YJPA 2CPKE 3ET7A 4GU6A 3QF9A 4WD5A 4ZTSA 4NH1A 5AR8A 3FI3A 3FHIA 3U51A 5IEYA 3L8XA 3LXPA 4FTKA 4KBKA 5D11A 5M57A 2R3PA 4ORKA 4ZMFA 5JZJA 4RVKA 2HOGA 4OTWA 3VC4A 4CGAA 1JWHA 2W1HA 4YUQA 3JY9A 3SG8A 1JPAA 1YI6A 2UZBA 3NW6A 4L53A 4CEGA 5IMEA 2F4JA 4KB8A 5EG3A 3ODYX 2W4JA 3SXSA 5L6PA 1AD5A 2OF4A 4XV9A 3UJGA 3B8RA 4OAVB 1L8TA 4FKRA 4K11A 4PL3A 4CLIA 4CKRA 1B38A 2W1DA 3SXRA 2VGPA 3NMUF 1XBCA 1W8CA 2R3MA 2AUHA 3BLHA 1YWVA 3HNGA 3P08A 1W82A 2FSTX 5AR4A 4WKQA 4ANSA 5AEPA 5B7VA 2OKRA 2XA4A 1R0PA 4Z55A 2QODA 4NW5A 3Q4CA 1ZAOA 2XK4A 2J90A 4WUAA 1TQPA 5ETIA 3A62A 4QP1A 5DRDA 3TKUA 3WYYA 1Z9XA 2V7OA 3PE2A 5M07A 3F3VA 4GCJA 3BBTB 1P2AA 3BHUA 5AM7A 2ZM3A 4PPBA 1YI3A 2UZUE 2ZV2A 3FQHA 4S30A 1DI8A 3MFRA 4BIDA 2UUEA 2P33A 3BLRA 5JEBA 5M09A 4L42A 5A9UA 3NUPA 4RVLA 4S2ZA 3IPHA 4AFEA 1QPCA 5AMNA 1L3RE 3Q9XA 2PY3A 4FSZA 5K4JA 4ZTHA 4QMMA 1ZYJA 5FDPA 4CYIA 4YJSA 1VYZA 3ENMA 4I5CA 4FIFA 4KWPA 3OCSA 2B52A 4HYHA 2UW9A 2JD5A 2YCSA 4K1BA 4L6QA 4RX7A 3KF7A 3HAMA 4X6QC 3QTRA 3AC4A 4TZRA 5LVPA 3OUNB 5D9HA 5HVJA 4H3PA 5D41A 4J53A 4M69B 2QOBA 3FMEA 3R8LA 1Y91A 4NM0A 4BZDA 3L8PA 4D58A 5A14A 1Q8YA 4BTMA 1PMNA 4QYEA 4IM0A 2W9FB 3Q32A 2EXEA 4L3PA 4A06A 3QWKA 4G3CA 3KCFA 3RAWA 4G6NA 1OMWA 1ZMWA 3CQUA 4QMOA 3E8NA 5D1JA 1I44A 3LJ0A 3IW5A 5C8NA 1IEPA 5HU9A 4CTCA 2Q83A 3GU7A 2HENA 3RWQA 4JLCA 3OW3A 4FSMA 2ZV7A 3QU0A 2J0JA 3LCTA 2IO6A 3UZRA 4YHFA 4P5QA 4PTCA 4A9UA 1OUKA 4L3JA 4F1OA 4FV3A 3CR0A 4CD0A 4F65A 1X8BA 3UP7A 4FOBA 2C6EA 3HMPA 5HEZA 5BQ0A 3ZXTA 4JBPA 3QCYA 3PPZA 4FNWA 4M8TA 3V5WA 2OJ9A 2X9FA 4BIEA 4FKJA 3UYSA 2PUPA 2JIIA 5T3QA 4O86A 4CSVA 4XLVA 4BCJA 4IDTA 3D7TB 1PKDA 3RAIA 3U9NA 2ITXA 2YWVA 4G3FA 5I3OA 4WT6A 4FA2A 3P1AA 4R1YA 4I0SA 3MPTA 4EL9A 3TWJA 4FSNA 4NIFA 4YJTA 4DEGA 2HZ4A 3AOXA 4V05A 4AUAA 1WMKA 2W05A 4HVHA 2ITVA 4V01A 3ZH8A 2XK3A 4HCTA 4AW1A 1H24A 2R3JA 4W9XA 4BN1A 3MVJA 1NA7A 3PLSA 5CI7A 3OBGA 5AV0A 4QMSA 4I92A 4AT5A 3D14A 3C7QA 4O0RA 4D4VA 3BE2A 5FXRA 4LRKA 1MRYA 2NPQA 1NVSA 5GINE 3MYGA 3ITZA 3P9JA 2UW4A 2VO6A 4GVAA 4C61A 2OZAB 3REPA 1KOBA 5EQPA 5IPJA 3C0HA 3RM7A 3UNZA 5J1WA 3MVMA 5F95A 4MNFA 4LL0A 4RBLA 1W98A 4RJ7A 4CFXA 3COKA 2C3IB 2HY81 3O8TA 4EONA 5I9VA 3KRRA 3F5GA 5EM7A 4V0GB 4PTEA 3R71A 4I6BA 3QRIA 2I0HA 3A7GA 4BCKA 4NL0A 4C7TA 4KIKB 3OCGA 4U5JA 1XHAA 1OITA 3A60A 3LE6A 3ODZX 4FVRA 2R3LA 1A06A 3IDCA 3Q04A 4K2RA 2WMAA 4NU1A 4OTRA 4X2FA 3TL8A 4H3BA 4F70A 3F2RA 1R3CA 3R9DA 4E5BA 4YU2A 4ZSEA 2Y6OA 4J97A 5C27A 1ATPE 1XR1A 4WRSA 5CF5A 3P4KA 4LOQA 4BTJA 4PDSA 2XF0A 2VWWA 5JSMA 5M56A 4XEYA 1H25A 5AR5A 4ZLOA 3M42A 3OEZA 5IQFA 5J8IA 4AW2A 4O7ZA 3GB2A 3DBCA 3C1XA 4RWJA 2BALA 2BRBA 5CAQA 1UU7A 3EWHA 3WZKA 4EOLA 4CLJA 2J0MB 3EN4A 5HX6A 2IW6A 2WKMA 3BU3A 4QP2A 4ZY5A 4C2WA 3C4WA 5JGAA 3GCQA 1OL7A 4QMLA 4OTHA 1ZRZA 4EC8A 5JFSA 2C1BA 3QRUA 5M55A 2OLCA 5HD4A 3KXMA 2CKQA 5DN3A 5ACBC 4CTBA 2Q0NA 4PMTA 4AE9A 5BVNA 1UU9A 3KRWA 3DBQA 4G34A 5DVRA 5FG8A 4O7NA 3DJ7A 3ZBXA 3ZSHA 5CU6A 4FYNA 4USEA 4BGQA 4FL2A 5CZIA 2WO6A 4E6DA 5KHXA 2KTYA 2UV2A 1MRUA 3HGKA 3HMIA 4PL4A 3P0MA 4MWHA 4IX3A 3SG9A 4WUNA 2E9UA 5J95A 1WBSA 4X2GA 4M84A 1XQZA 4IJ9A 4IB5A 5T68A 5IA3A 2V55A 3RJCA 3GOPA 5DA3A 4BI2A 3EN6A 4WRGA 4YLKA 1OUYA 3AMAA 3P78A 3RGFA 5AFVA 2CCHA 2HCKA 4L45A 2BKKA 4MH7A 3BU5A 5I9UA 4TT7A 3LHJA 4TWCA 3TV7A 2XIRA 3GCUA 5ANJA 2DYLA 4O6LA 3R21A 2FSLX 3QTXA 4FSQA 5AR3A 1Q3WA 4B7TA 3JS2A 5AP6A 4Z3VA 3CPCA 1YXTA 3FMLA 3EQIA 5IDNA 3ZS5A 1OKZA 2CDZA 4EH3A 3V5TA 4MBJA 1DAWA 3MH2A 5CEKA 1Q5KA 3EQRA 4WIHA 3EH9A 5CI6A 4KS8A 4XMOA 3DDPA 5CX9A 4B9DA 2W17A 4LRMA 4XLIA 4EH5A 2WTKB 4DBNA 1OIRA 3DGKA 1XBAA 3UNJA 2W4OA 3IW4A 2WMWA 4A4XA 2VTRA 4C35A 4DFXE 1G8SA 2JDSA 1P5EA 2HWOA 4LG4A 3I7BA 2ZB1A 4GV1A 3UOKA 5M44A 4MBIA 3DXQA 4E4MA 4PQNA 4KIOA 1IASA 5M4UA 1WBWA 3P79A 4R3PA 5CF8A 4YTFA 2R3HA 4F1MA 3ZZWA 5I3RA 3PE1A 4A9SA 1R0EA 5C9CA 1ZMVA 2C1AA 1OKWA 4JIAA 4QYHA 1WBTA 4RMZA 3R83A 2OF2A 3BGQA 1V0OA 4Z9LA 4DG0E 3ALOA 3R2YA 4EHZA 2WOTA 5BYYA 3QD3A 4XP0A 4ZTLA 2E9NA 3O50A 1CKIA 3QZGA 3C9WA 5DR9A 4ANLA 2BAQA 3DLSA 5AA9A 4FKGA 4D5KA 5B2LA 4G31A 4OTDA 3WBLA 2QONA 3G51A 3QCXA 4FT0A 3DQXA 3MFSA 4IB3A 4IFGA 4Y46A 4FSWA 1CMKE 1PF8A 3ZFMA 3OROA 2EXCX 4GW8A 4I41A 3HRBA 4EOSA 1OKYA 3PXRA 3R1QA 2EU9A 4I5PA 4OR5A 4TKSA 5KZ0A 4E7WA 3LKMA 4FTJA 4IC8A 3PA3A 4GU9A 5EDPA 3Q5ZA 2FYSA 5M06A 2JFLA 4I6HA 3BGZA 3QRJA 3KQ7A 3MJ2A 4HNFA 5DEWA 4AW0A 3FC2A 1PXPA 3ZUVA 5LWNA 3V51A 4LUEA 4QMQA 4QYFA 4JX3A 5L4QA 2YM7A 2XCHA 1RW8A 4I3ZA 4ZSAA 4MD8E 3QZFA 5HVKA 3Q9YA 5TOZA 2X2LA 3T9TA 4BWKA 5HIDA 2YZLA 3GC8A 5CXHA 1UWHA 3TUDA 4QMUA 4TNDA 3G2FA 4ZTQA 3PXZA 4RX9A 4IM2A 3F7ZA 4CFVA 5HLNA 1YXUA 3HV6A 2GTMA 2WTDA 2V7AA 4FL1A 2VTIA 2BHHA 4U44A 5KX8A 3BCEA 4Z16A 4YJNA 5LMAA 5TKDA 3ZMMA 4BDGA 4BHNA 4CKIA 3IDBA 3GU4A 1ND4A 1UWJA 3KCKA 3VW6A 3BWFA 4JDJA 3QLFA 2YIXA 2BPMA 3A4PA 2VTNA 1TVOA 2YIQA 3DQWA 4G17A 4YHJA 2OW3A 3VQUA 3ZHPC 5KUPA 4GIIA 3U55A 3PXQA 5BX0A 3FPMA 2OFUA 3FZRA 2PVHA 1QPJA 4GL9A 4CRLA 2BDJA 4CV8A 3I4BA 4R3RA 2Y6MA 3RK9A 4DH7A 3EJ1A 2WQEA 3UGCA 2J6MA 3DNDA 3QA8A 4IDVA 4WBBB 2OO8X 4NZWB 1R1WA 3FZPA 3OOMA 4D2PA 4DGMA 4BYJA 3ATSA 2P55A 2IZSA 3QRTA 5ETFA 4CFMA 2J50A 5A4QA 2RFEA 5EKOA 3HLLA 4R7BA 1H0WA 4J99A 5LQFA 3IECA 4AQCA 4XG3A 3KY2A 3UPXA 4LOOA 4RG0A 2PMLX 4F9WA 5FUTA 4DITA 1WAKA 5HNBA 1CTPE 3DTWA 4FTAA 3K5VA 1P4OA 4BC6A 4KUJA 3BELA 4ZZOA 2XB7A 3GENA 2J5EA 3KK8A 4IX5A 4MXAA 4RRVA 4A9TA 3Q5IA 2ESMA 3R30A 1FQ1B 2VU3A 2WFYA 4FG7A 1DI9A 2W06A 4QP9A 3VS4A 1REKA 5E8YA 1JVPP 4TPTA 4XV3A 3TV6A 2BRHA 3U6JA 1T46A 3NW5A 4O96A 5A46A 2PVLA 4FV2A 2C30A 2VTHA 3SLSA 4IMYA 4PDPA 4XCUA 4J1RA 1WVXA 3OXTA 4Y8DA 1UU8A 3W18A 2XNGA 1K9AA 2W7XA 4IANA 4JBOA 2I1MA 2BVAA 2WTWA 2V5QA 4LYNA 2UW6A 3CGOA 4C38A 2P2IA 3ZDIA 3C13A 3VUHA 3EKKA 4KBCA 3R04A 5IEVA 5AR2A 4A4OA 2GNIA 4BWPA 2CN5A 4IVCA 3DXNA 3MA6A 3F61A 4IAKA 3QAME 3FUPA 3ZEPA 3LFQA 4WG5A 3ZFYA 4IB0A 2WEVA 4ZEGA 4C4HA 4FSYA 5CVHA 1OL6A 2WZJA 3G9NA 4UBAA 3LCKA 2W5HA 4AOJA 2XIXA 2E9PA 3OVVA 2VX1A 3PYYA 5E8XA 2XCKA 2ITNA 3P7BA 3PSCA 4QTAA 2JKMA 2J4ZA 3WZJA 2WD1A 4IHPA 4L8MA 4ACCA 2CGXA 4I0RA 4I94A 3MB7A 3DK6A 4M69A 3PG3A 2OK1A 2VV9A 4QP8A 4Y83A 4BKJA 1WCCA 5LJJA 1OIYA 3OY3A 2HZNA 4BDHA 3UQGA 3DKGA 4O2ZA 3D2KA 4AN3A 2WMQA 4R3CA 2JAMA 5BMSA 5KKRB 4L7FA 1XH9A 3OTUA 2ZM1A 1Q61A 4GT5A 2J7TA 5IQCA 2HAKA 4JXFA 5EM6A 1IAHA 1GNGA 2Y9QA 4MD9E 1WBPA 3FZOA 3FKLA 4OTFA 4YPSA 4M15A 3ZZEA 3Q60A 4JG7A 5J5TA 3NZ0A 4ACMA 2WTKC 4XRLA 1KE8A 3COMA 4RJ6A 3PIZA 2P4IA 3EFLA 3G90X 1BL6A 5HE1A 5JQ8A 4N70A 2YM8A 4HYSA 1H08A 5CXZA 4LGDA 5JFXA 1HOWA 3DBFA 3HP2A 2ZYBA 3UQCA 1EH4A 3ANRA 3RALA 4YZBA 2R9SA 4OGRA 3IW8A 3COHA 2UZTA 3QX2A 4ARKA 2C5NA 1BI7A 2WMVA 3UVPA 4CMTA 3GUBA 3VUKA 3D7TA 5L2QA 3O96A 2ACXA 2Z60A 2HZIA 2UVZA 3ORKA 2RFNA 3GU5A 3LM5A 4CRSA 2BCJA 2C6MA 4UMRA 2FSMX 2RKUA 3KRJA 3BBWA 4JG8A 4O0VA 4BGGA 4RJ5A 4LM5A 5H8EA 3K2LA 5HX8A 3ROCA 3Q4TA 1FINA 3GXLA 4ZTMA 1KOAA 4BCHA 2JC6A 2PHKA 5GJDA 4DEIA 4BZNA 2R3OA 4EOQA 3RPSA 4WNMA 3ZBFA 3QUEA 4S34A 3VWAA 2PVJA 3VBYA 5GZAA 1H27A 1PXOA 3S2PA 5BUJA 5IH4A 4M66A 4X21A 5IA4A 1UV5A 4XYFA 4DTKA 5A4TA 2AC3A 4G16A 2ETRA 1FGIA 3I0OA 2W1EA 3AGLA 3FKOA 4O0UA 3V6RA 5LMKC 1OBDA 4QPSA 2UW3A 4O38A 4R5YA 1JQHA 5CT7A 4C57A 5HZNA 5E91A 2XJ2A 3DK3A 3I5NA 3OXZA 4O0WA 4GFOA 3QKLA 3C0IA 3OHTA 4C2VA 3A2CA 5AUWA 2J9MA 3EZRA 5DRBA 3OBJA 3W2SA 3QYWA 5EM8A 3IO7A 4C33A 1JBPE 3UIBA 4JRVA 3ZONA 4IZYA 5KMNA 1K3AA 4V0GA 3QTQA 4O0YA 5JFWA 4HGLA 5CVFA 4DGNA 4HW7A 4HPUE 2OXDA 4FSTA 4KIKA 2WB8A 3TNWA 3WF7A 4L46A 3QCSA 1H1WA 2QI8A 1WVWA 3VHKA 4AA4A 4C4FA 3VUTA 4RIYB 4XX9A 4F64A 4UV0A 4MX9A 2QOHA 4XBUA 3PG1A 4BDFA 5F94A 3FLNC 4ITJA 4BCGA 4RVMA 2PUIA 2WIHA 3CTQA 4EWHA 2C47A 3FLWA 2WGJA 4J7BA 3VUMA 4C3FA 1Y6AA 1KE5A 1PXKA 4U80A 4UMPA 3ORTA 3PZEA 3BWJA 5BUIA 4ZY6A 4OLIA 5ETAA 4HOKA 2BDFA 3IS5A 5FM3A 4O6EA 1PHKA 4AF3A 1H1RA 2XK7A 3H9OA 3TNIA 4K77A 4ACHA 5HOAA 1WZYA 2ZJWA 4LV8A 5HG7A 5HBHA 4QMWA 1OPKA 5CNNA 5CTPA 1I09A 1LP4A 4IWDA 5EW3A 3A4OX 3PWYA 4FF8A 4QMXA 3MPMA 2W5BA 3QQLA 1NW1A 4FTLA 1FGKA 4Y73A 5JH6A 2R3FA 3HP5A 1JAMA 3I6WA 3DB8A 4OTIA 3EB0A 5DBXA 3OWKA 3UBDA 3ZLSA 5IG1A 2XKEA 4MVFA 4WOVA 3R1SA 4FTNA 5IQHA 2XNEA 4D55A 2ITOA 5AAEA 3DKCA 2BDWA 4AGCA 4D4SA 5DR6A 3LXNA 5A3XA 4JOAA 4DYMA 1MRVA 4EK3A 4YO4A 4O7TA 2E9OA 1OGUA 3CY2A 4EI4A 5KMKA 3BEAA 4F7NA 3N51A 5L6WL 3LFEA 4JQ8A 2PZYA 3MY0A 4CFWA 3R63A 5JMSA 3ZLWA 4DFBA 2YCRA 3C5IA 4H39A 3MVLA 3NYVA 2DWBA 3PVGA 4C4EA 4I6QA 5FM2A 3VBWA 4MXOA 4LL5A 3F7WA 3V6SA 1PMUA 2HXLA 3TJCA 3LM0A 4JVGA 4EZ7A 4RC2A 3QKMA 3V8WA 4MXXA 2WQMA 4ZSJA 1PRYA 5GZ9A 4NW6A 4ASEA 1ZXEA 4IXPA 4JI9A 2F49A 3C4XA 4TW9A 2RL5A 1SVHA 4AZVA 2ETKA 3QTUA 4FKTA 4RC3A 3EFWA 3DA6A 5CNOA 5CSVA 2X81A 2JFMA 3UIMA 4E4XA 2R7BA 1Q8TA 3QZHA 5FTGA 2A1AB 4MYGA 4FT3A 4R7IA 4YZ9A 2X7FA 3O0GA 4DCEA 3AGMA 3KULB 4QRCA 3RKBA 3C4ZA 4KINA 4BWXA 2BZKB 1FPUA 2QR7A 5BMMA 3IW6A 3SA0A 3LFDA 3GC7A 2VWZA 5EHLA 4E26A 4EEVA 4UYNA 4N6YA 4A7CA 4WG3A 2QU6A 1H26A 1KE7A 2PVRA 4IC7A 4I20A 5CZHA 3UC3A 1E1XA 2C3KA 1WFCA 2VWIA 3D5WA 4CMUA 4HVGA 5L2TA 5FTOA 3F5PA 2GNJA 4O7YA 3SOAA 3Q3BA 3I79A 4GH2A 4XG9A 5DG5A 3SXFA 2UZLA 3O71A 5FD2A 5EK7A 5KKRC 3E8CA 3FZSA 2OXXA 4XOYA 3GFEA 3FC1X 1Z5MA 4XJ0A 2OJFE 2W5AA 3K3JA 4X2JA 2ZB0A 4OBQA 3RP9A 4I4FA 1YXSA 3QXOA 4PRJA 4DFZE 1FBNA 3D5VA 2XEYA 1J7LA 4O91A 2CHLA 2QCSA 4EOPA 2EXMA 4IW0A 1H4LA 4IH8A 5LMKA 4ANNA 2BUJA 4AA5A 2WMBA 4IAAA 3EQBA 2WELA 4RQKA 2HZ0A 2GNFA 3T9IA 4QTEA 2YIYA 3V5QA 3WZDA 2OICA 4O1OA 5HTCA 3CLYA 4YLLA 4C37A 2WTCA 3PXFA 4RFZA 2XBAA 3H3CA 4FV0A 4JT3A 2XRWA 4BFMA 3MBLA 1GIIA 2PUUA 2G15A 3UE4A 3CPBA 2WU6A 5I9YA 2PVYA 2ZV8A 4HGSA 4UXQA 4FKOA 3UTOA 2WMXA 3R7VA 5ANDA 3UOJA 4AT4A 2X7GA 4APCA 2IN6A 2YAKA 4YBJA 2H34A 3LW0A 4TYEA 1H1PA 4TYGA
chains in the Genus database with same CATH superfamily
2F2UA 2XMYA 3H9FA 4KKGA 2NRUA 5KMOA 3F6XA 3NNVA 3SDJA 3KKVA 3ZO4A 3F9NA 3SW4A 3W2QA 4QMYA 3HEGA 3QRKA 3NNUA 4EORA 2YEXA 3UIUA 5CS6A 3HRCA 4YC8A 4Z7HA 4FOCA 4RLLA 3MFUA 4DEAA 3D15A 1YRPA 5ITAA 2CCIA 1TQIA 4DTAA 5TO8A 3A7FA 3FMDA 1JSVA 3IQ7A 4FT5A 3H0ZA 4YHTA 4ZXTA 3R7YA 3W2OA 3ORIA 4MNEB 3W55A 3ETAA 1NY3A 3LQ8A 5CU0A 5K0XA 3IW7A 3FMHA 3UYTA 3CXWA 1Q24A 2XYNA 5DH3A 4FKVA 3CBLA 3QLGA 3W32A 1LEWA 4GVJA 2R5TA 4CZYB 3KEXA 2QURA 2YDJA 5L6OA 4S33A 4XH6A 5FXQA 2IW8A 4DDIA 2AEGA 1U5QA 4DTBA 1GJOA 4PPCA 4B6LA 3NRMA 4CMOA 4L52A 3WI6A 4DN5A 4GKIA 2HYYA 3AC3A 4DG3E 3ULIA 2UZEA 1FMOE 1QPDA 2WAJA 4BCNA 3QUPA 4U9AA 3DCVA 2QOOA 4HCUA 4W4WA 2YDKA 3E64A 3S3IA 3QD4A 4Q2AA 1OM1A 3FMNA 3QWJA 4FEVA 4JAJA 3W33A 1PW2A 4EJNA 3RK5A 1ZLTA 4IWQA 5M51A 2VO3A 2XARA 1R39A 3CP9A 3F5UA 4EK5A 2YJSA 3KREA 2C6TA 5JRSA 2GFSA 1M7QA 5H8BA 5L8KA 5I0BA 2XNOA 1Q8WA 4EH8A 3KXZA 3GC0A 4RJ4A 4DH1A 2YM4A 2IZUA 4U8ZA 4UWCA 3A8WA 5LARA 5C4LA 2X0PA 3EQFA 2W0JA 5G6VA 1W7HA 3FLSA 3NUAA 2XK9A 3VUIA 2ZV9A 1XH6A 3CE3A 2A19B 4ZTRA 5TE0A 2VTJA 5E92A 4RIOA 1U46A 3S0OA 3CQWA 3BHHA 3IOPA 4PUZA 5J9LA 4GKHA 3U54A 3FI4A 1Y8YA 2NRYA 1QL6A 3FL5A 2Z7QA 1ZYSA 2IWIA 3HUCA 3QTWA 2OIQA 4G6LA 4GYIA 4RX8A 4M0YA 2GQRA 3F3UA 1PMVA 3HYHA 5HG5A 3R8ZA 3DAJA 3HV3A 4ZSGA 3R9OA 3ZU7A 2PU8A 4FTIA 4BJJA 1ST4A 3N4TA 3DDQA 1YHWA 3PLAE 3OY1A 4P90A 4TWNA 3EFKA 1O9UA 3HV4A 5CEQA 4MK0A 2B9JA 2P0CA 4F9BA 4CNHA 1VJYA 4ZLYA 4M0ZA 3TKIA 3HV5A 4YNOA 3TZ7A 3ZLYA 3MIAA 4YC3A 5IQGA 4IZ5A 4PP7A 3PSBA 3FMKA 4RIWB 4ERWA 5DNRA 4IX4A 3QQKA 5HG8A 4MQ1A 4O4DA 3UG1A 3PA4A 5H3QA 2QKRA 3G0EA 4ENXA 2CNVA 2NP8A 5E1EA 3S1HA 3BL7A 5L8JA 4MF0A 4NCTC 3F69A 3SAYA 4TWOA 4ZK5A 1JKSA 4YJUA 4YTIA 4E4NA 2JAVA 3LQ3A 3EYHA 3QA0A 3EMGA 3W2CA 3OCTA 4ZTNA 4EHGA 3ORNA 3PXKA 2VTOA 3EHAA 2JDVA 4CG8A 3CS9A 5CT0A 3E88A 4A9RA 2EB3A 4I5HA 5AP7A 4G5JA 5CEIA 1BMKA 3GFWA 3R9NA 3KXHA 3G6HA 4KIPA 4QMZA 5E1SA 4D2RA 4MUQA 4UYAA 3ZO2A 3E3BX 5L8LA 2AC5A 2BZJA 5CU4A 3HV7A 4AE6A 2PE1A 3NEWA 3OT3A 4DINA 4Y5QA 4LQMA 5E7RA 2OXYA 4UMQA 4O4CA 1U54B 4ALUA 4F0FA 3QHRA 3PP0A 4UEUA 2DS1A 2XNPA 2IVUA 3BIZA 1UNHA 4FTRA 5HD7A 3FEGA 2B4SB 5EOBA 3H9RA 2XK8A 4CQGA 4M3QA 1IAJA 3NUYA 3T3UA 3RPVA 4D0WA 4F6SA 2YCQA 5KHWA 3R0TA 4BCQA 5IDPA 5F20A 2OBJA 4FV1A 3UPZA 1V0BA 2ZMDA 3E87A 4IE9A 4FI1A 1SNUA 3RPRA 4C58A 1UNLA 4IX6A 1XJDA 2J0KA 4PNIA 4CXAA 4IVAA 2BILB 4ONAA 4RC4A 5FTQA 4DFNA 4O27B 2W96B 2R0IA 2QLUA 1XMMA 4B0GA 2RG5A 5D12A 4J98A 5TR6A 2CGUA 3ORXA 1RQQA 4APPA 5E4HA 2A98A 4JMQA 3RWPA 2W1IA 4O0SA 2G2IA 2B55A 2F9GA 3UDSA 2PUNA 5EHYA 1JLUE 5IKWA 5CEMA 1LUFA 5AX3A 4F6WA 3MPAA 5HI2A 4O4BB 4AAAA 4FEWA 5HNGA 5HQ0A 3H10A 1JKTA 2R3GA 3BYUA 4GFGA 2HW6A 4UZHA 1TQMA 3TXOA 5IU2A 3L9NA 3WE4A 4ZSLA 5I9ZA 3S00A 2JDTA 3LFFA 3LFCA 3OCBA 3BV3A 3O2MA 4OT5A 4FK3A 1TZDA 2B0QA 5F4NA 4TN6A 4L01A 3TV4A 1NVQA 2VGOA 5K3YA 3KRXA 5CY3A 3FY2A 3OEFX 4RIYA 1AQ1A 2F7ZE 3KU2A 4Z7GA 1ZOHA 4BBFA 4ZAUA 2R7IA 2XANA 3VBXA 2O64A 2XUUA 3R22A 5AV4A 3NW7A 3MESA 1LEZA 5C8KA 5AP1A 1YW2A 4RA4A 1J3HA 2VWUA 5EW8A 4DHIB 4F0IA 4C4IA 2BHEA 3NVKI 1GAGA 4BBMA 3KN6A 4BYIA 4FKUA 1KUTA 2BFXA 2PZ5A 2VWVA 4JL9A 4K9YA 2ZMCA 4FV6A 3RAKA 4NM7A 4DH5A 3EFJA 4MHAA 4PX6A 4DGGA 1W0XC 3QTIA 4YJVA 4L67A 4YC6A 2XJ0A 2WTJA 4FZFB 2XK6A 4AU8A 4DEDA 1XBBA 4MQ2A 4BGHA 2CNUA 3KXGA 3HA8A 4XV1A 3TJDA 1ZOGA 2YITA 1ZZLA 5AM6A 3LQ5A 3VVHA 3D83A 4LGHA 5KMIA 2YJRA 3I7CA 5D7AA 4F6UA 3R00A 3GC9A 3QZIA 3VQHA 1GZKA 2GTNA 3F3TA 4XG6A 5EOLA 4Q9SA 3SOCA 2GFCA 2OI4X 4X3FA 4GFMA 2O5KA 3DOGA 4N0SA 1CKJA 3R8UA 4B8LA 2QOLA 2Z02A 4QP6A 3NYOA 5BPYA 1U59A 3EIDA 2A2AA 4I21A 3LCSA 2WTVA 4FTUA 5LXMA 1XH5A 4PNKA 2X0GA 5HICA 1SZMA 2F57A 4RJ3A 5LCKA 3OWJA 4PL5A 3FPQA 1SNXA 4MWIA 3VUDA 3GP0A 4B8MA 4NCTA 3ORZA 4PDYA 4FEQA 4J71A 5EHOA 2QNJA 4C62A 4OTPA 2WPAA 2HELA 5CLPA 3R9HA 4V04A 4AZTA 5FEDA 4YSJA 2IVSA 4K8AA 4TY1A 3NAYA 5HESA 3T8OA 3TNQB 3N9XA 3WIGA 4QPAA 3QQJA 4TTHB 3UO5A 4AXFA 2RGPA 3LJ1A 5HTIA 3PP1A 4FMQA 4RFYA 5GHVA 2PYWA 4AZFA 3EQHA 5JK3A 2JDOA 4AOIA 3WF8A 5IF1A 2FH9A 4MTAA 3SX9A 1G8AA 3KC3A 5E8TA 3KULA 4LFIA 4YNEA 3ZXZA 4JX7A 4YP8A 3QCQA 5E9EA 1UU3A 3KMWA 4JDHA 3HDMA 4XG2A 4CG9A 4EBWA 3DKOA 3BYSA 3GNIB 5HBEA 2CJMA 4O7WA 4D2VA 5E8VA 3VJNA 4BVUA 3EQDA 4JQEA 3ATTA 3PDTA 5BV3A 4F78A 3BHYA 3LIJA 4NFMA 1OZ1A 4I93A 3ELJA 1XKKA 1YDRE 3NIEA 3W10A 4DF3A 4RGJA 1H28A 1XWSA 3ZYAA 1F5QA 1OIUA 2QKWB 2YERA 3HMMA 1IRKA 5FXSA 5IZFA 3DAEA 3II5A 3FSFA 3SHEA 1GIHA 4S32A 5DPVA 3JPVA 5AP5A 5IH6A 1O6KA 2WMTA 3G0FA 2Z8CA 4X7QA 5ANOA 2X7OA 3G5DA 4BDCA 2KULA 1OI9A 2BMCA 4BKYA 4EHVA 4QP3A 3RCDA 5EYMA 4DEHA 4U6RA 2P3GX 4K6ZA 5HE0A 3RNIA 3FBVA 2NO3A 4ASZA 1Q99A 2GNLA 4FL3A 3SRVB 2C5YA 4E3CA 3OC1A 4FZAB 4D0XA 2GQSA 4FEUA 4XG8A 3NYXA 1YQJA 3R7IA 4D4YA 2X0QA 4ALVA 3LCDA 3GOKA 2R3NA 5AV1A 4GRBA 1YDTE 4M12A 4E1ZA 4C4JA 2PVNA 4F08A 3F2AA 4L68A 3L9LA 4BCIA 1JNKA 3PY0A 3GCSA 2JBPA 5IA0A 4NKAA 3EL7A 1URWA 3LFBA 5DE2A 3ZRKA 1M17A 2X6EA 1W83A 1BLXA 3DLZA 3VBTA 2XAMA 3MFTA 2WEIA 5EYDA 4LV7A 5E8UA 5ANIA 3UIXA 4LI5A 3V3VA 2X2MA 3SGCA 4ZS0A 3TZ9A 3HAVA 2CGWA 2IZRA 3BLQA 1IR3A 4F9YA 4NEUA 4MEDA 5EYCA 3JVSA 2QVSE 3GCPA 3RCJA 4D5HA 3LFAA 5CF6A 2G01A 3UODA 4IWOA 3ZSIA 3TDVA 5J7HA 1HCLA 4TWPA 4O7VA 5B0XA 4F63A 3W8LA 4H05A 2FVDA 4QYYA 4E8AA 3E3PA 2HWPA 4MNEA 4IVDA 4QNYA 3I6UA 3BQRA 4R7HA 3GQIA 3W2RA 1PXLA 1ZOEA 3TUCA 4JS8A 2JLDA 4YTCA 2BR1A 3QQGA 4W4YA 4BB4A 1ERKA 2C68A 2OH4A 4FIIA 4GYGA 4IM3A 4ANOA 3O8UA 2Y4IB 3FAAA 4Q5HA 3FI8A 5GJGA 4ZP5A 4O7RA 1STCE 5FP5A 5KO1A 3DAKA 3JUHA 4YJRA 1NXKA 3MIYA 2PZRA 4RWKA 3RPYA 2XBJA 3DJ6A 4JQ7A 4CQEA 3D5UA 4WO5A 4CCBA 3WZUA 4YGAA 1Q4LA 1IG1A 5KNJA 3C4EA 4O21A 3QQUA 1QCFA 2B54A 2XKFA 3MY5A 3PJ1A 3QHWA 5A4LA 3ERKA 4BCFA 3UQFA 2GHLA 3OS3A 4DG2E 4F99A 2YN8A 3M2WA 3KF4A 3DT1A 4NTTA 3VS0A 5F1ZA 4MXZA 3SV0A 3TCPA 5ACKA 3PJ8A 3TYKA 4IZAA 5HLPA 2X8EA 2YWPA 3QX4A 5IUIA 4JNWA 4FTTA 4C59A 4GJ2A 1FMKA 1V0PA 3BYVA 3EL8A 1R78A 3CTHA 3JXWA 3ZUUA 5AUXA 2YFXA 5AUZA 2I0EA 3ACKA 3MY1A 4NM3A 4HVSA 4RLKA 3DBDA 3O17A 4JDKA 4K0YA 5AIKA 3CSVA 3OOGA 4FNXA 5CSHA 4LV5A 3KMUA 4BCOA 2C0OA 2GHMA 4AG8A 5CANA 4U42A 3BPRA 5I5ZA 1J7UA 4QDVA 4Y95A 2I0VA 4O0XA 1Q41A 2UW8A 2ITQA 2B7AA 3FJQE 3R1NA 4G9CA 5DLSA 4EOMA 4DH3A 4O81A 2WQNA 2W1FA 4YJQA 2Z7LA 3ORPA 4BL1A 3CD3A 2XYUA 3K54A 3QALE 4YZMA 5EQEA 4O0TA 2XS0A 4C0TA 3TT0A 2QG5A 5IH5A 3WIKA 3IOKA 3WF9A 4AA0A 3ZM4A 3U4WA 1XO2B 4FV9A 3FLQA 2ZDTA 3PPJA 4EBVA 1WBOA 3FLZA 1KE9A 3LXKA 5FBNC 4CFUA 4RIWA 4Y85A 4DT9A 4ITHA 1Y6BA 5DOSA 4O84A 1UKIA 4FIJA 3R7EA 5C26A 4CZTA 1OBGA 1VYWA 3N4VA 4YZDA 3FMJA 4UY9A 3UDBA 2BIKB 2UZNA 5H2UA 2RFDA 1YXVA 2CLXA 2Z7RA 3FYJX 2PZIA 3MH0A 3RNYA 2CKPA 2XALA 2CNQA 2OSCA 1MP8A 2WTIA 1UA2A 3KL8A 3OP5A 2QD9A 4PWNA 1YHVA 2PZPA 3C50A 4OTGA 4R77A 4HYUA 1GOLA 3MN3A 1H07A 3ORLA 1WVYA 2J5FA 4FR4A 1T45A 3DZQA 2YLEA 3RVGA 4NTSA 4XV2A 2R2PA 2HW7A 5KZIA 5J1VA 4RX5A 4G5PA 4OT6A 3FL4A 5D10A 3HVCA 4YBKA 3PZHA 2XM8A 2GSFA 4G3EA 4U3YA 4A4LA 2FA2A 2YM3A 4EK8A 1PJKA 3EQCA 5ANKA 4EOJA 4FT7A 2WXVA 4FJVA 3RHKA 2FB8A 5GIOE 2GU8A 3NIZA 1U54A 4LGGA 4GUEA 4EH9A 2ETMA 1G3NA 2YIRA 3R8PA 4WSQA 2IW9A 3ZCLA 4R78A 3QXPA 5TT7A 5L2IA 2BAKA 5EI6A 3BE9A 2QR8A 3QBNA 4ZZNA 1OPJA 5HLWA 1J91A 4PP9A 1YI4A 2GS2A 5FEEA 1M2PA 3E93A 3G33A 4I4EA 4FKSA 4QTDA 3RK7A 3THBA 3U87A 3UDTA 3MV5A 3E5AA 3KK9A 4CFNA 3EQGA 2V22A 3LCOA 4PMPA 4KIQA 4X3FB 5FLFA 5CVGA 4ANBA 2WQOA 3G15A 4DE4A 3T3VA 3LXLA 3NUNA 3VHEA 3SVVA 2GHGA 4IVBA 1KV1A 3ENHA 1BX6A 4MCVA 4FX3A 1OL2A 5ETCA 4E20A 2XNMA 3LMGA 3OG7A 4E5AX 1DM2A 2CN8A 2XNNA 4FTOA 5EW9A 4J96A 4QTCA 4D28A 5FP6A 4GK3A 3UP2A 1J1BA 4L44A 4BDBA 4CT1A 3QC9A 3A7JA 2VWYA 1HCKA 1RE8A 2YHVA 3SD0A 4F7SA 2I40A 5KMMA 2PMOX 3GVUA 4QNAA 4BI0A 1J7IA 4QOXA 2Q0BA 4KSPA 4NFNA 4X2KA 4EH6A 1XH8A 2C6OA 3EN7A 3NCZA 5LVLA 2OGVA 3U6IA 1S9JA 3DPKA 3R8VA 4O83A 3NNWA 4BDIA 2X8DA 1IA9A 3PXYA 3QL8A 5D7VA 3E8DA 4I5MA 4BICA 4G9RA 4MKCA 3RTPA 4FT9A 3NLBA 3LFSA 4WNOA 5C8MA 5JFVA 1OECA 4I1ZA 1G8KA 3VBVA 5K5XA 5AUTA 4D4RA 4O7SA 1H00A 4W8EA 1M2RA 2VO7A 4LUDA 4IBMA 2C0IA 4ZZMA 2DQ7X 3D2IA 1PYXA 2IPXA 2QLQA 2F2CB 2PVMA 2QC6A 1OL5A 3BRBA 1SVEA 2HY0A 4DBXA 4M67A 4L9IA 4M7IA 4PTGA 5LVOA 4AXAA 1CSNA 5CAVA 1Y8GA 4KNBA 4QMTA 4N57A 3KFAA 4BBEA 2CKOA 3VIDA 4AAYA 4W9WA 4HPTE 4C3PA 2PL0A 1B39A 1YWNA 2I7QA 3UVQA 2G2FA 4AGUA 1W2CA 2ONLA 3RAHA 3V01A 4ZJJA 2QO9A 3QC4A 4PMSA 2YABA 3RPOA 4ASXA 2C3JA 2C0TA 5CU2A 5IQBA 3E7OA 2ZM4A 1YKRA 4RJ8A 5F9EA 3ACJA 3ZRLA 3QYZA 2R3QA 2WMUA 3AXWA 3K5UA 4IAFA 5FDXA 3W0PA 2R3IA 3FY0A 4HNIA 2YCFA 4JR3A 3UZPA 3BYOA 2VTQA 3UG2A 2DUVA 3AC8A 4QP4A 4FEXA 1Q8UA 3RZBA 3RHXA 4MAOA 3R1YA 3LVPA 5DWRA 4FV7A 5IA2A 3F88A 4OAUC 1UNGA 3DFAA 3FLYA 3IGGA 2H6DA 5HKMA 3ZEWA 2YZAA 4FZ6A 5EI2A 2WQBA 4AS0A 4QEBA 3AMYA 3AC5A 4FNYA 4CT2A 3DXPA 2CMWA 5HVYA 3PIXA 4EYJA 3Q6WA 5HGIA 1CM8A 4XHKB 4CCUA 2XIKA 4O82A 3GU8A 1ZZ2A 2PE0A 2ITTA 3A8XA 3QD2B 5T6KA 4FV8A 5HCXA 2HK5A 3OMVA 2QQ7A 1Y57A 3P23A 5DT3A 2VNYA 2VD5A 4U7ZA 3I5ZA 3BYMA 1U4DA 4ANQA 2JKKA 3ZC6A 1VLRA 4X3JA 4QMPA 4U41A 2C4GA 4FNZA 4U43A 4XG7A 4DA5A 3IDPA 1QMZA 1H1QA 3LFNA 1O6YA 4USDA 5GNKA 4F1TA 3PTGA 4MF1A 2OIBA 3QTSA 4KA3A 4QPMA 3SQQA 3CTJA 5B2KA 2EWAA 4FTMA 2CLQA 3TZ8A 4EYMA 2C6DA 2QOIA 4QQ5A 4QT1A 4QQTA 4OW8A 2ZOQA 4EWQA 3CIKA 2JEDA 1IA8A 3BGPA 4PF4A 4RFMA 4BZOA 5AUUA 2QOCA 3COIA 3UOHA 4F9AA 2ITZA 3G9LX 4D2SA 4MXCA 1FVVA 2RIOA 3TEIA 5HTBA 5IA1A 3BKBA 4NUSA 5HO8A 3UOLA 4EOKA 3VF8A 1OVEA 3NUXA 4F09A 1E1VA 4RPVA 5K5NA 3VULA 5LVMA 4GMYA 4K33A 4XS2A 2QOKA 4JJRA 4G6OA 3R6XA 3TIZA 1H1SA 3VS2A 4O1PA 3RMFA 3U6HA 3MDYA 4F7JA 5CU3A 4FG9A 1B6CB 2XZSA 4U81A 4ZIMA 4FSUA 3FDNA 3G6GA 3R7GA 4HGEA 4ALWA 5FRIA 2FSOX 2OJGA 3OXIA 3OD6X 4M68A 4TYIA 4C8BA 4NYEA 2PWLA 4L43A 5IISA 4FBXA 2VWBA 4FRFA 3ALNA 3IK3A 3M11A 4I24A 4WA9A 4NM5A 3WF5A 3SRVA 4DFLA 3TI1A 3P5KA 4YPDA 5IA5A 2NNWB 4F7LA 2VTTA 3BZ3A 4IWPA 2A0CX 2WOUA 3MWUA 3HRFA 4QD6A 5I9WA 5M53A 5EDRA 3Q2JA 5A54A 2GNHA 4Y72A 4DLJA 3TACA 2X1NA 3L1SA 4DC2A 5ICPA 3CJFA 2OZOA 3P7AA 2YISA 5HE3A 3R9RA 4GJ3A 4YMJA 2QOFA 1BUHA 5LVNA 4RQVA 3ZDUA 4FTQA 1JKLA 2B9IA 3KA0A 4N6ZA 5K0KA 3RM6A 3CGFA 5TF9A 2CKEA 4G2FA 3O23A 5EDQA 3GEQA 2Y4PA 3IKAA 3NUUA 4ZLZA 2Y7JA 4FG8A 5EFQA 2B53A 5AV3A 5KE0A 3DJ5A 3Q6UA 4X3FC 5BUEA 5JQ5A 3C4FA 2R3RA 3QFVA 4N4SA 3TNPC 5C01A 4ITIA 4FK6A 3CCNA 4JAIA 5CQWA 4E6CA 1APME 5M4IA 3RBWA 3QUDA 3U8WA 4I6FA 1RDQE 2BAJA 2BTSA 3PFYA 3PIYA 3D4QA 5BVFA 4AGWA 3BV2A 2SRCA 4H3QA 3HL7A 3U4UA 1MUOA 2G1TA 4FIGA 4AZSA 5HNIX 4KKEA 4XP3A 3GT8A 4YO6A 2UVYA 2B9FA 2XRUA 3R02A 3PRFA 4OBOA 2WIPA 4S31A 3CY3A 4PPAA 4LDTA 3NSZA 4B99A 4FV5A 3ZC5A 1ZMUA 2OG8A 4B4LA 3BHVA 3HECA 2H8HA 1H8FA 5IQEA 1PXJA 3KXNA 5A6NA 2O0UA 4EQUA 1ZY4A 4BI1A 4DFYA 3CD8A 3LZBA 4ZOGA 3TKHA 2XM9A 3QQFA 4H1JA 4U40A 1ZYDA 3AT2A 1YOJA 4FIEA 1PKGA 4EHEA 3BEGA 2EB2A 5CF4A 4EKKA 4RSSA 5AV2A 4E6AA 5IQAA 4Q5EA 3AKJA 4D1ZA 1NT2A 5BVOA 4IQ6A 4YJOA 4FC0A 1DS5A 4NKSA 5GJFA 4XNEA 2ITYA 3FI2A 2QO2A 3ORMA 4AP7A 2OU7A 4BDDA 5LMBA 4EQCA 4LMUA 4IAZA 4A9YA 3HMOA 4WG4A 1H0VA 1OIQA 2I6LA 2VTAA 2VWXA 3O7LB 3QGYA 4J52A 2PULA 3UMXA 4R6VA 2PPQA 1NVRA 3WARA 3PPKA 2QU5A 3MGYA 3UO6A 4WSYA 3PJ3A 1ZYLA 3FE3A 2ITPA 3ZO3A 4E6QA 4IADA 5IEXA 1JSTA 4AX8A 3PJ2A 4AQKA 4FKWA 3B8QA 3NYNA 3Q2MA 2OFVA 4PY1A 4LMNA 4TRLA 3PFQA 2C5VA 4TL0A 2WNTA 3O5AA 3CC6A 2VUWA 1YXXA 2ZAZA 1S9IA 1VR2A 1YOLA 4AGDA 3EN5A 3PSDA 2GPHA 1PXNA 2LGCA 3BI6A 1CDKA 4JG6A 4DAWA 5BYZA 1P14A 4AACA 2UZDA 3MS9A 3FXZA 3L8VA 3VBQA 1SMHA 2IVVA 4J8NA 2WMRA 3TTJA 3EOCA 2X39A 5IUGA 5HIEA 3FQSA 3VN9A 1BI8A 4D9TA 3FZTA 5JN2A 3AD4A 3RINA 2ITUA 5AUVA 2C69A 2E2BA 3MA3A 4UZDA 5KMJA 4XUFA 4C34A 3H0YA 3DY7A 2OWBA 4FKIA 3WF6A 1ZYCA 3E63A 4IZ7A 3OFMA 3ZO1A 4GSBA 5DYJA 2FO0A 2UVXA 3MI9A 3LMIA 1YOMA 3VS3A 2I0YA 1BYGA 4RA5A 3WE8A 5JKGA 1FVTA 5JZNA 2X8IA 3M1SA 5CALA 1A9UA 5CWZA 3I60A 2GNGA 3IG7A 3MW1A 4WBOA 4TYHB 3HDNA 5AUYA 3ID6C 4FZ7A 1JKKA 3LLAA 5CEOA 4XOZA 2HIWA 3OW4A 4CVAA 5EH0A 4WNPA 3BHTA 2X0OA 4MXYA 2RG6A 3TN8A 3MH1A 5JGDA 3OZ6A 3UVRA 2VTLA 2XVDA 4DT8A 2QHNA 4KKHA 1E9HA 4NWMA 4RIXB 3HX4A 3ZM9A 1OPLA 1YDSE 2QHMA 3FHRA 2VNWA 3Q9WA 5E8WA 4K18A 4EC9A 1KSWA 1F3MC 2UW5A 3JYAA 5AAGA 4P2KA 4AWIA 4G3GA 3ZRMA 3POOA 3AMBA 4FICA 4OTQA 3EKNA 5E8ZA 3TUBA 2VX0A 2ITWA 4AT3A 4BTFA 5BVEA 4H58A 1W84A 2G9XA 5EKNA 5HO7A 4YZCA 4ZS4A 3NGAA 5DI1A 4RZVA 5AP2A 3FKNA 2R64A 2QOQA 2CGVA 5AX9A 3PA5A 5C4KA 2C3LA 5AR7A 1U5RA 5KMLA 2YM5A 4ZMEA 4GG5A 3UDZA 5FEQA 5DT4A 3V5LA 4AZWA 2XJ1A 1BKXA 2XKDA 4CKJA 3GQLA 4GK2A 3R8MA 4GEOA 1XH4A 1O6LA 3OT8A 4IB1A 4JDIA 4KRCA 2PE2A 2QO7A 3MTFA 4FODA 1MQ4A 1GIJA 5HHWA 4QYGA 3F66A 3F3ZA 4YURA 5CSXA 4IFCA 3OWPA 2QG7A 5J79A 4EK6A 1M7NA 2C6KA 3H30A 3MB6A 4C36A 5DEYA 2W99B 3LLTA 5CSPA 5GZ8A 3PVWA 1URCA 4AW5A 3WYXA 4FUXA 5AIRA 2X4FA 2YLFA 3ZLXA 1Z57A 2V62A 4EK4A 4F4PA 5CAUA 4GT3A 4EH4A 2VAGA 2EUFB 4FTCA 4BY9E 3NCGA 2V0DA 4FZDB 2ZDUA 3FZ1A 4D9UA 1V1KA 2BKZA 4AN2A 5CASA 4GG7A 1F0QA 3PVBA 1GZ8A 2JBOA 3D94A 4IAIA 5LCJA 3CEKA 2PVKA 4X2NA 3PWDA 3VNTA 3FSKA 4E4LA 5AWMA 3POZA 3GBZA 2BZHB 2IG7A 4BCMA 3K3IA 4EUTA 4IEBA 4NSTA 2XP2A 5M4CA 4ZJVA 3JR1A 4O2PA 5AADA 3Q52A 5CQUA 4EZ3A 2GQGA 3UC4A 3LOKA 3GCVA 4CYJA 1DAYA 4HZSA 2BROA 4YTHA 2BRNA 2WHBA 3I81A 3TDWA 3E8EA 2PVFA 3E7VA 3MSSA 5JT2A 2X9EA 4FE2A 3ANQA 4NJ3A 4CFFA 4KS7A 2A4LA 3C51A 4JR7A 1M14A 4AXCA 1K2PA 3VS5A 3F82A 4MD7E 4TXCA 2YIWA 3NFGB 4EJ7A 2UW7A 4XP2A 3DB6A 4GK4A 4FKLA 5DFPA 4D1XA 3UZTA 5I9XA 4FKQA 4FKPA 4H36A 5HORA 3LAUA 2RF9A 3UO4A 4C3RA 1G5SA 4P4CA 2H9VA 5JGBA 3DFCB 2BRGA 3PJCA 1OKVA 4H1MA 3DZOA 3P86A 3TTIA 3ROYA 4DHFA 3QGWA 2XH5A 4ZY4A 5GIPE 3JY0A 4DEEA 1A48A 3LPBA 5EYKA 2J0LA 3V04A 3NX8A 3FYKX 4PV0A 3OWLA 5HCZA 3OTVA 2YDIA 2JGZA 2JITA 3L9MA 2WMSA 3B2TA 3KMMA 2PTKA 1LR4A 3TM0A 1CKPA 4KABA 1GZNA 1JSUA 2JIVA 3R73A 4HZRA 3AT3A 4USFA 4Y5HA 2CSNA 3L8SA 4FVQA 2IVTA 4X6RA 4QP7A 5JRQA 3CJGA 2E9VA 4DFUA 4JBVA