3P5KA

P38 inhibitor-bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
332
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of a novel class of non-ATP site DFG-out state p38 inhibitors utilizing computationally assisted virtual fragment-based drug design (vFBDD).
pubmed doi rcsb
source organism Mus musculus
total genus 105
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p5kA01
4J99A 2PZPA 2PYWA 1S9JA 4YZCA 4ZZOA 3PIZA 3QKLA 3S95A 3OEZA 3U4UA 1IG1A 2HW6A 3CD3A 3PRIA 3TJDA 3P86A 4BI1A 1OPLA 3OCGA 4O86A 2P4IA 4IACA 3DJ6A 2R5TA 5HVYA 4HVHA 4FV9A 4N0SA 4UMTA 5KKRC 3HP2A 4C3FA 4EK6A 3CQUA 4DGOA 3FZRA 2V7OA 4MWHA 4JLCA 4MTAA 5B2LA 2C6KA 4O83A 5JGAA 4EI4A 4NL0A 5BUIA 2BTRA 5I9ZA 4GFMA 3BLQA 4U3ZA 4QQCA 3MSSA 4PMMA 4NYEA 5BMMA 1K3AA 3Q52A 3GC9A 5IG1A 3DAEA 3I7BA 3GU5A 5JGDA 3W10A 5JFXA 3EFLA 3FKLA 4RLLA 1Y57A 4DHFA 3FMEA 2EB3A 4YZNA 4ANBA 5ANGA 3EMGA 2WOTA 4FVPA 4GRBA 4QYGA 5HBEA 5KBRA 3HVCA 4MK0A 5GJGA 3Q96A 2Y9QA 4FUXA 4L43A 2PSQA 2ZDTA 2E2BA 3KFAA 3VQUA 2WTCA 2B4SB 2Y4IC 5CF4A 2OIBA 3I81A 5GNKA 5BVDA 3ACKA 4K8AA 4PTEA 3BCEA 3PLSA 2QKRA 4PMTA 5IZFA 3LXLA 4H39A 2J0LA 3FMMA 3QU0A 2QQ7A 4IWOA 3S4QA 2ITXA 1GAGA 4GVAA 4S30A 3LQ5A 4TXCA 4BWKA 3FMLA 4RIXA 4F09A 5LXMA 3DFCB 4C57A 2GNGA 1YHSA 4IMYA 4ASDA 5KMKA 1Y8YA 5ITAA 3DXNA 1PXLA 4ZXTA 3P9JA 2J5EA 3KC3A 1OVEA 4YHJA 2PUIA 4D2PA 4DGMA 4G3EA 4FG7A 5C1QB 3II5A 4QMSA 4RX7A 5AM7A 5J7HA 1JSUA 3DZOA 1G3NA 2QONA 3GOPA 3ORPA 1TKIA 4K0YA 3GC0A 2JFLA 4FMQA 4XYFA 3H10A 4AN2A 4ENXA 3HYHA 4R1VA 3KXHA 2DWBA 2OZAA 4U6RA 1M2QA 2HZNA 4A9UA 5IMEA 3WYYA 4E26A 3FLSA 3H4JA 3MVHA 1B39A 4LG4A 4CTBA 5AADA 4UYAA 2XH5A 4I0RA 4MNEA 4ENYA 3NVMB 4KSPA 4AT3A 4RJ6A 3R8LA 3W16A 4DH1A 2WMAA 5IU2A 5IUGA 3DY7A 5LVMA 5AUXA 2RFEA 2ZOQA 3O8TA 2B9JA 2QU6A 4RIYB 3I0QA 3AGLA 5JH6A 3HP5A 3V5WA 1ZYJA 4F0FA 3WYXA 4IM3A 2X7GA 3CEKA 3Q9WA 5DYJA 3MPMA 4E4XA 4XBRA 1DI9A 4WG3A 4L3JA 2ITUA 2VV9A 3ORIA 5DHJA 4O0SA 1KE6A 3FZ1A 2BFYA 4MWIA 4RC4A 4FEXA 2GQGA 2OF4A 2Y7JA 4AZVA 3ZRKA 1PXPA 2GS7A 3FC1X 3IS5A 3LQ8A 4JRNA 3FXZA 3CKXA 2R3QA 4FKVA 4FSTA 4Q5HA 2R3MA 4KAOA 4OBPA 3C4XA 3ZRMA 4F65A 2QD9A 3IQ7A 4F6SA 4MBJA 1BLXA 4NCTC 3E87A 2DUVA 4IVAA 4W4YA 4YJSA 2X4FA 5C9CA 3CTQA 4X2KA 3SXRA 4BKYA 4IX3A 4LRKA 4RFYA 4C4EA 4PTCA 3F3TA 5DMZA 3O8UA 1TQIA 2A0CX 4O7YA 2CKEA 4ITHA 4XRLA 2CN8A 3B2TA 3BYOA 3ERKA 5HEZA 5M4UA 4BIBA 4F0GA 3MFSA 1L8TA 1M7NA 2W1CA 2OXXA 3U9NA 4BCGA 5JKGA 4U8ZA 1FVTA 4E3CA 1QPEA 3GQLA 5ANKA 1PKGA 3DQWA 5EI2A 2W5AA 5EDPA 1FMOE 3FE3A 3JS2A 2VZ6A 2JBOA 4XG2A 1YOLA 4FSWA 4X0MA 5FBNC 5LMKC 5E7RA 4GU6A 4JQEA 2I7QA 4I23A 1M2PA 5BVOA 4YJOA 3NIEA 4FNWA 3R00A 3EQFA 2WTDA 3DV3A 3QCQA 4FC0A 3ZRLA 2XIKA 3ZC6A 3EN7A 4FV8A 2XM8A 2BHEA 4Y72A 4QD6A 1OIYA 3DGKA 3FYKX 4XEYA 4AE6A 1XBCA 1ZYCA 3OXZA 3NEWA 3OUKA 4GG7A 4CVAA 2WMVA 5E8XA 3ZS5A 3L9MA 2GNJA 3NWWA 3N4UA 4OTQA 5AP7A 4FIJA 3DK6A 4HNFA 4F1MA 4WT6A 5A3XA 5KBQA 3GU7A 2WMXA 4AGDA 4QO9A 3LFQA 4BDAA 1ZARA 2PULA 3VN9A 2UW9A 5DT3A 2IZTA 4QTCA 1PYEA 4I4FA 4L9IA 3RAHA 5B7VA 5EYKA 3TZ8A 4TN6A 4JAIA 2VTIA 2RF9A 3DBCA 3E63A 3NAXA 4AW0A 3KN6A 3LMIA 5CXHA 3F7WA 3EYHA 4BBMA 4IIRA 4H3PA 5HU9A 3PE2A 2DYLA 4IB1A 5LVOA 3C5IA 2C1BA 3ACJA 4J8NA 4L7FA 4LUDA 5ETCA 4CKRA 3GENA 2W1FA 3E8NA 2P33A 4FOCA 3HDNA 2E9OA 5BVKA 3A8XA 4HPUE 3S0OA 2J0KA 3HV3A 4CZUA 5ETIA 1RE8A 2BPMA 1CM8A 1H1QA 2W7XA 3GGFA 3BGZA 5FXRA 4K6ZA 5AUUA 4YP8A 4MF1A 4KB8A 2BZJA 3IKAA 5HBJA 1W8CA 3GCPA 1Z57A 4S31A 2GFCA 5A4LA 3OHTA 5FDPA 3DBQA 2C3LA 4FZ6A 4CMUA 4L01A 2G2IA 2BRHA 3DPKA 1GY3A 3PSCA 4WRSA 3ZM4A 2XIZA 2GTMA 3KREA 5AUWA 4FR4A 3RWQA 4PX6A 2JDRA 3ZXTA 2G2FA 4O7VA 4DEAA 3KMWA 3Q3BA 4GYIA 3DNDA 3KRWA 5E1SA 2E9PA 2J6MA 4I6QA 4JVGA 5L2TA 3FL5A 2BDFA 3R8UA 3EQHA 3EL8A 4GW8A 5BVEA 4KSQA 1RDQE 3PWDA 3THBA 4ACCA 5M53A 5EQPA 2EUFB 3RINA 2QOBA 5HI2A 4QTAA 2YLFA 4FTAA 2JKOA 4EZ5A 4ACHA 5L6OA 2FGIA 2V22A 4HOKA 1APME 4G6LA 3OWLA 5M09A 2WU6A 2I6LA 3SW7A 2XNEA 3ZH8A 5AUTA 4YJTA 3KXGA 2OU7A 5CAPA 4DTBA 2I40A 3KY2A 5GJDA 5K0KA 2OO8X 4RC3A 1STCE 1DAWA 3CCNA 3CGFA 4BDCA 2JEDA 4H1JA 2H96A 3G6GA 3LOKA 3TN8A 4CMOA 1ZLTA 2J4ZA 1PXOA 1CDKA 4V0GB 5FD2A 5HD4A 3ZO4A 2GHLA 2X8EA 4WUNA 4FV4A 4A9RA 1GIJA 3PE1A 1YDTE 4TWOA 4FKOA 2ITWA 1HCLA 5ETAA 4N6ZA 4ZP5A 3VUGA 3SD0A 3VS4A 4WNKA 4JL9A 4RQKA 4KWPA 3HRFA 4K9YA 3L9PA 3LXPA 4L42A 4EWHA 3GXLA 3NW5A 3BE9A 5EDQA 5HO8A 5LVPA 3MN3A 3BI6A 4OUCA 3ZSHA 3PXYA 2XB7A 4B9DA 3UMWA 3HAVA 4OTIA 1O9UA 2R7BA 5HIDA 1M14A 3FZOA 5KMJA 5CU2A 5ANDA 5FDXA 3W1FA 3VF8A 1YI4A 4ANSA 3F5XA 5L2SA 3R2BA 1FINA 2ZMCA 4BCMA 2OJFE 2RFSA 4M14A 4TYGA 4V04A 2CJMA 3KRLA 5EKOA 2W4OA 3FV8A 3I79A 5IA5A 1K9AA 2ERKA 2R3GA 2YITA 1HCKA 1CKJA 3NPCA 2PZIA 4GSBA 4IVBA 2C6MA 4AZTA 4FSNA 1Q8ZA 4OAVB 3QTSA 3V5JA 3VS7A 2HWOA 2XRWA 4HYHA 5TR6A 3RI1A 3NZ0A 4DFXE 3BX5A 3OFMA 4AN9A 4QP2A 3QQJA 4UWBA 3G51A 4FGBA 5AP1A 5G1XA 4J52A 4ZJIA 3LFBA 2C6DA 3MGYA 4EYMA 2HYYA 3R73A 3RAIA 1REKA 3GU4A 3WOWA 2CNUA 2LAVA 4NIFB 3C13A 1OKYA 3KN5A 4Y46A 2HOGA 3TG1A 2C30A 3A62A 3NCZA 4EOIA 3QAME 3LVPA 1OUKA 1JNKA 3VW6A 5IQGA 3RALA 4RIWA 4D2VA 2XM9A 3MFRA 3RBWA 1XBBA 3LJ2A 3VBQA 2ETRA 2YDKA 2JDVA 4JDHA 5EM7A 4ASEA 2JBPA 2GNLA 1YI6A 5CSVA 3SOCA 1YRPA 3D5VA 4FT7A 5F94A 2J90A 2J0IA 1KWPA 3P7AA 3Q6WA 3RK9A 4RFMA 3UC3A 1J7LA 4U3YA 2B0QA 2PVJA 2GS2A 3JR1A 4D4YA 4RFZA 3V8TA 4BWXA 2C1AA 2YACA 4EOQA 5C4KA 4F9YA 1T46A 1UWHA 4QTEA 3QRUA 4EOOA 4TT7A 3UGCA 3ZM9A 2G1TA 2C0TA 4WNOA 3QLFA 4PDSA 4C02A 1JLUE 4ZK5A 2F57A 4X6RA 4I5CA 4FTIA 2YCQA 4RA4A 2X39A 2X2LA 4ZS0A 5FEDA 4V01A 3NUYA 2BZIB 2BRNA 4ZY5A 4KRDA 2WMRA 1B6CB 4XCUA 2YJSA 2F7EE 3NUPA 2HZ0A 2UZOA 3UC4A 4EZ7A 1KE9A 3VUIA 2R2PA 3V5TA 5HE0A 4RT7A 2R64A 4EZ3A 1JBPE 3FMKA 1Y8GA 5DRDA 4UZHA 2ACXA 4YSMA 5HO6A 4EK4A 3Q9XA 3UZTA 5HX6A 2GU8A 3KXZA 5HG8A 4FEVA 4ZJJA 4I22A 2H8HA 4W9XA 1GZOA 4FICA 4MHAA 5DR2A 2X8IA 4K1BA 2PPQA 4QNAA 4PDYA 3UIMA 2XJ0A 3G9NA 5HOAA 3UOLA 1W82A 3SQQA 4HNIA 4G5PA 4XHKB 3MWUA 2UW4A 4PUZA 4YBJA 4PNIA 1JWHA 1CTPE 2IO6A 3VUHA 1IEPA 2HZIA 1Q3DA 1OL1A 1WBWA 2QOIA 2QKWB 2QOKA 2BCJA 3P79A 4QPMA 5FP5A 3R83A 1QMZA 2X9EA 2XP2A 4G34A 3WILA 4FT9A 2YWPA 4LOQA 1J3HA 2VGOA 3C4EA 4FIIA 4PPCA 4DLIA 4CLJA 3TV7A 1E1XA 4CSVA 5J7BA 3F2RA 5FXQA 2XIRA 4PP9A 3NGAA 3D83A 4R3CA 3HMPA 4TY1A 5AP6A 5JMSA 4AE9A 1YQJA 3HUCA 4E4LA 2OF2A 2ZV2A 4I1ZA 1XH4A 1UKIA 1WCCA 4MYGA 4J95A 3LQ3A 3FXXA 3DNEA 3VRYA 1PXNA 4WRGA 3Q4CA 5EYCA 3U9CA 4BVUA 5BVNA 5LVNA 5HHWA 4FTCA 2XNMA 4YR8A 3BU6A 1OKVA 1BX6A 3PIYA 4HPTE 3FDNA 2BVAA 5AR7A 3UQFA 4NIFA 2YM5A 2ETMA 5JFSA 2CN5A 4EHGA 5AV0A 3FPQA 4Y8DA 3WZEA 4CYIA 4DG0E 1FBNA 4BCQA 3GB2A 3BWFA 5I9WA 4E6DA 2PZYA 2QO2A 2XRUA 5KNJA 3DAKA 4LGHA 5AMNA 4JX7A 1JSVA 3PVBA 4DC2A 5TF9A 2HIWA 4YURA 3MESA 1SVEA 3EQGA 3SKCA 4F1TA 4F9CA 2HXQA 5AA8A 5A9UA 4FTNA 4UB7A 4AZSA 3EFKA 2JAVA 2OKRA 3D9VA 3F66A 3QC9A 4AF3A 4EC8A 4EH6A 3PP0A 4FV2A 4D9TA 5DBXA 5CF8A 5HLWA 3RWPA 3ZDIA 4L46A 4IWDA 3PVWA 4PP7A 3HMIA 3QX2A 4ZSEA 3CD8A 4FKPA 3QZGA 5GZ9A 3CE3A 2BHHA 3V6SA 4FI1A 3O0GA 3GNIB 3Q5ZA 3DKOA 4MKCA 3VWAA 2CMWA 3V5QA 4DT8A 5D12A 3V5LA 1I44A 4O38A 5E1EA 3WZKA 3MJ1A 4JR7A 4XOYA 2HCKA 4I5MA 4A9TA 4BCPA 2PUUA 3PA4A 5KKRB 2XKEA 2VTRA 5AIRA 2AYPA 3LFDA 1P4OA 5DOSA 4W9WA 2XEZA 1FGKA 2XCHA 3TCPA 4EUTA 4PDPA 4ASZA 4XV9A 2OLCA 3HV4A 2RL5A 4EEVA 3LLTA 3WF5A 4FTMA 4CFUA 2W96B 5BYLA 2R3NA 4FOBA 4RJ3A 1KUTA 4IZ5A 3UBDA 3QQFA 4U5JA 3VO3A 3KXMA 3NX8A 3DTWA 3EQPA 2R3KA 3EN9A 4ACGA 3CR0A 5BNJA 5LCJA 4QPAA 1GIIA 3V04A 4E8AA 5D1JA 4RWIA 3UNKA 5EW8A 3N51A 3ZUVA 2WMSA 3DBEA 3FC2A 5HVJA 3G90X 2Y4IB 2YLEA 1Q5KA 3E8DA 1BI8A 4BDFA 4D1XA 4DEEA 3UQCA 4MVFA 3W2QA 2C3IB 1NXKA 3QCXA 2Z7LA 3WE4A 2X8DA 1XH5A 2J9MA 4P5ZA 3RMFA 5KX8A 3RPSA 3QQGA 5FM3A 4KS7A 4FVQA 5IISA 3RHXA 2VWZA 1Q8WA 4ITIA 2NRUA 3KQ7A 5ACBC 1Q41A 2ITNA 1IA8A 4FSZA 4XG7A 3BE2A 2PL0A 4HJOA 4GT5A 4CT1A 5B2MA 3FLNC 2V0DA 4RJ5A 5LWNA 3RKBA 3IOKA 2FSTX 4O84A 2UW0A 3ZLYA 5JFVA 2B9IA 3N4TA 1CKPA 2CPKE 3EH9A 4IDTA 4BDBA 4F1OA 4Z9LA 2YFXA 5B0XA 5J1VA 4FIEA 3UZRA 5M56A 2YAKA 5I9UA 4NKAA 5DEWA 3HV6A 5J9YA 2C5VA 4RVMA 3KKVA 5CENA 4YTCA 4LL5A 4LYNA 4FT5A 4QMVA 4KUJA 2PE2A 2G15A 2HK5A 4DGGA 2BRGA 3F5GA 5BQ0A 2WKMA 4QMTA 2UZTA 5FG8A 1PXMA 1ZZ2A 2WQMA 2CGWA 2WEVA 4RIXB 5JGBA 2W5BA 1GIHA 2YISA 3LZBA 1NVSA 3ENHA 5FP6A 5GHVA 1W7HA 3UZPA 3ZC5A 1UA2A 4Y85A 5CY3A 3ORMA 4ASXA 4BYJA 4RWKA 5FRIA 1LP4A 4I93A 3COKA 4RC2A 2RSVA 2JAMA 3EL7A 3OC1A 2VTMA 2A1AB 3FQEA 3CTHA 4M66A 3R8VA 4D4RA 3NYXA 2QR7A 3RM7A 4UXLA 5DPVA 4EHEA 2RKUA 4KABA 4QTDA 3FXWA 2OSCA 2JIUA 5H8GA 5K5XA 2G2HA 3KVWA 5EI6A 4CT2A 2PVMA 3UNZA 3HV5A 1UNHA 2A27A 4FKRA 4RX9A 4TWNA 3TKIA 3HMNA 5HX8A 5H2UA 4EH7A 3H30A 3PJ2A 4G3CA 1J7IA 4FV5A 4D2SA 3PIXA 5A46A 4CG9A 4CFWA 3QHRA 2BZHB 4KKEA 1OL6A 4DGLC 4DITA 4BBEA 2C5OA 1VJYA 3RK5A 4LOPA 4B99A 4QQTA 3PY1A 4G31A 4LL0A 5IQDA 2P2IA 1Y6AA 4P5QA 4BY9E 3VBTA 3B8QA 2YA9A 4C4HA 2O3PA 3AXWA 2UZBA 4E4MA 2GNHA 3PYYA 3BZ3A 3D2KA 5AR4A 3Q32A 5LARA 4F70A 4TL0A 2WOUA 2Q83A 5EQEA 1H26A 4NW5A 4A4OA 3VUMA 4ZLOA 4CQEA 3PPJA 5CI6A 3CGOA 4YLKA 5E90A 5IQFA 4PMSA 4D1SA 5LOHA 3T3UA 2Z02A 3AOXA 4C61A 5KZ0A 3TNQB 1V0OA 3VUTA 2W5HA 3BIZA 2OJIA 3UTOA 4H36A 3VHKA 3GC8A 5J5TA 3DFAA 4OTGA 4Y73A 3NMUF 5BX0A 3F6XA 5I9YA 2YM8A 2O0UA 4TYHB 4S32A 3VUKA 5AV1A 4WIHA 3AD6A 3L8VA 4NM5A 5L8KA 5J5SA 3EFWA 4LFIA 2VN9A 4XOZA 5IMXA 3TDWA 3FLYA 3SV0A 1XBAA 4H58A 4D4VA 3W2PA 2BAJA 3EQIA 3K5VA 5CX9A 3G9LX 3H0YA 1QL6A 4WD5A 3UVRA 4JG8A 1HOWA 2OJGA 3PSDA 3ZOSA 2JITA 3MH0A 4X21A 2IVUA 3VBWA 3GUBA 4I24A 4NFMA 4OTRA 4ZTQA 4P4CA 1XJDA 2C4GA 3ELJA 3KCKA 4EOMA 4I92A 5LQFA 3FEGA 3DQXA 2OIDA 3JVRA 4BC6A 4CLIA 1BUHA 1Q61A 5M07A 4K11A 4ZLYA 2UV2A 3AD4A 4XLIA 1R39A 3QBNA 5CSWA 5HQ0A 3EN5A 3RPVA 2SRCA 3MB7A 4F9WA 5J9ZA 2VTTA 5H3QA 4J53A 1QCFA 2YM4A 3Q6UA 3PDTA 1LEWA 2UVXA 2ITTA 5AA9A 4WG4A 3CSVA 3HRCA 4YLJA 3KVXA 4KS8A 4YC3A 5HCXA 4C34A 3BKBA 2GPHA 4QP4A 1VEBA 1PMUA 2R3FA 5K0XA 4RX8A 2J2IB 4FIHA 3RCJA 4QNYA 3P78A 4FSQA 3VS2A 3ID6C 2ZM4A 1ND4A 3NRMA 4MD7E 3OD6X 4OLIA 4JS8A 2XNOA 2VX1A 2W99B 3CJGA 3IPHA 2XK3A 4ANLA 4IWQA 2IZRA 3KK8A 2HY81 4CEGA 4FZDB 2IW9A 2WIPA 1KE5A 3H9OA 5FWKK 1U46A 2WMBA 4KIOA 4NTTA 2QNJA 1R3CA 3R63A 5HE3A 5I3OA 2XS0A 2PVRA 3D2IA 4I0TA 4S2ZA 3NUAA 1V0PA 4B8MA 3RPYA 3T8OA 5IQIA 3TNHA 4BTMA 3UIUA 3ZUTA 1Y91A 4JX3A 4GJ3A 4XG6A 2IN6A 1ZMUA 3AT2A 2VX0A 2WTVA 3ORKA 5KHXA 3I6WA 3BLRA 3Q5IA 3QRKA 3WF7A 4F7NA 4C37A 3QTXA 4E6AA 4CZYB 3BYMA 3OT3A 4DFYA 4ZSJA 2BROA 4IANA 2V62A 2UZDA 3G0EA 4G3DA 4E5WA 2B52A 2PU8A 4U45A 4C4FA 2VO0A 3SOAA 4FSUA 4QMUA 5KMIA 1XWSA 2WPAA 3IW7A 3BHVA 1K2PA 4ZSLA 4DT9A 4J8MA 4XV1A 4CFMA 4ERWA 4OBQA 4MAOA 2EVAA 4V05A 5AAFA 3VQHA 4FV6A 5ANOA 2WEIA 2PMIA 2PHKA 5CU3A 1JKKA 3Q4TA 4FNXA 1BL6A 3I60A 4XRJA 3LIJA 2X2MA 3F3WA 3BBTB 2O5KA 3HDMA 3QCYA 2UUEA 2XEYA 3TZ9A 3WZDA 2BIKB 3B8RA 3UE4A 4AA0A 5FEQA 4F08A 4U43A 4G1WA 3PJ1A 4QMXA 2X9FA 4YNEA 5CSHA 3UYSA 4C38A 3UPZA 4DBXA 3ET7A 3PVGA 4TYHA 4JDJA 1B38A 3DJ7A 4ONAA 5TT7A 4M97A 4A9YA 5CVFA 4H3BA 3OW4A 3R9HA 3VAPA 5CAOA 1PY5A 3PXQA 5GZ8A 4IZYA 3HX4A 3F3VA 3MS9A 3QTIA 4JDIA 3ZEPA 1UV5A 2B53A 4D2RA 2P3GX 4FTLA 4ZTHA 3C1XA 3ORXA 4AGCA 5KMOA 4W4WA 3IO7A 3SX9A 3D0EA 3PXZA 4FBXA 2QR8A 1YKRA 3VF9A 4TZRA 4IE9A 3KRXA 4FODA 3R7OA 2GNFA 2ZB1A 4XJ0A 3E62A 3QQKA 4L67A 5EHYA 1IAJA 4FG9A 2FVDA 1JKSA 5DR6A 5CF6A 1PXJA 2QU5A 4WSQA 4G9RA 3O2MA 5IA2A 5CVHA 2XA4A 3BU5A 3CC6A 4Y5QA 3TUDA 4WSYA 1PF8A 2PVLA 4EKLA 2IZUA 3FKOA 4NKSA 3DJ5A 2IW6A 1DS5A 2PVHA 3W32A 4D0WA 3N9XA 5J79A 3R1QA 2P0CA 3HRBA 4IWPA 4G6OA 4KKGA 4L44A 5EH0A 3SDJA 3VUDA 4EK5A 4D4SA 1IASA 4HVDA 2B54A 5CAQA 2QHNA 1IRKA 2R3PA 5DGZA 3NUUA 1LEZA 2F4JA 3M42A 4IX6A 1P14A 4QMMA 4D55A 3ZONA 1ZY4A 4X3FC 1ZOGA 3AC4A 4MXXA 3MTFA 2IW8A 4BDHA 4YSJA 5F4NA 4Q9ZA 2YABA 5EM6A 2XK9A 5HTBA 3R22A 5BPYA 3PA5A 4AOTA 3OP5A 4U97A 4HVIA 3CS9A 3ZBXA 3QX4A 1ZZLA 2R3JA 1X8BA 2WZJA 2Z7QA 3G0FA 5AAGA 5CT0A 3CJFA 5A6OA 5KZIA 2R3RA 3R9NA 2RIOA 1JKLA 3R04A 4ZY4A 4ZS4A 4RIWB 4O7NA 5HNBA 3BYVA 4CYJA 5L6WL 4U42A 4UYNA 3C4WA 3G5DA 3D5UA 2WB8A 1GZ8A 4CCBA 3MA3A 3EQRA 3LW0A 2HY0A 5L4QA 3L1SA 4HZRA 1BYGA 5GJFA 3WARA 1LUFA 4LGGA 3OT8A 2EU9A 4R7IA 5ACKA 4BKJA 3DT1A 3PPKA 3FAAA 5TE0A 2OGVA 2O65A 3AC5A 5JQ5A 3NUXA 3E5AA 4J97A 3BV2A 4L8MA 3LAUA 5BYZA 1ZWSA 5E91A 2XK8A 3EZRA 4ZZNA 3TV4A 3QQHA 2C6IA 4PRJA 5DFPA 1H25A 4RX5A 5TKDA 4GCJA 4TPTA 4W4VA 3VS5A 1YWRA 3ULZA 4YMJA 3D14A 4USFA 2ITVA 4YZDA 3BV3A 3EKNA 1JOWB 2YZAA 3GU6A 4LGDA 4LM5A 3HNGA 3H9FA 4JDKA 4A4XA 2B55A 4R5SA 4D9UA 2WTKB 3AC2A 3B2WA 3BGQA 5BUEA 4ZMEA 4UBAA 3FMHA 1URCA 5CI7A 2GHGA 4JI9A 5K4JA 2YZLA 4D5HA 4QTBA 3ZFYA 4QP6A 4KBAA 2IPXA 3OXIA 2CCHA 4FZFB 4PF4A 3V51A 2XBAA 4OTWA 4AZEA 2Z2WA 5EK7A 3VBVA 2XNBA 1Q4LA 3A7GA 5L6PA 2ZAZA 2YCSA 3F69A 1O6KA 3NUNA 5HD7A 5IKWA 5HVKA 2C47A 1U5RA 5JK3A 4IB0A 4O0TA 1WBNA 3FJQE 4AW5A 1NVRA 3LM0A 3QZIA 1VZOA 4GKIA 3QF9A 3H9RA 4LRJA 1YWVA 3BQCA 4R3RA 4I20A 3BQRA 3O17A 3OWKA 5CT7A 3R7YA 5EW9A 5AR8A 2W9ZB 5IQHA 3BHTA 1UWJA 2PMNX 3QTZA 3KB7A 4FTOA 3LKMA 2ZYBA 5IDPA 3NAYA 3OMVA 4KD1A 4MQ1A 2KTYA 3NUSA 4IAZA 2YM7A 1F5QA 4BCFA 5J9LA 5EYMA 4IFGA 4IM2A 4XX9A 4FKSA 2ZV8A 4G3GA 3ZU7A 3Q53A 3G15A 4JRVA 5HIBA 3MH2A 3IGGA 3QWKA 3PLAE 4KINA 3ZFMA 3PZHA 3R9OA 4C4IA 3MI9A 3CKWA 5I0BA 1FOTA 3BGPA 1Q8TA 3LFCA 4BDEA 3W55A 4KBKA 3RZFA 3R9RA 2BTSA 4AW2A 1DAYA 5C26A 5CALA 3OBGA 5LVLA 4MF0A 4FKJA 4QOXA 2ONLC 3NW7A 4FKIA 3ULIA 4EQCA 2J51A 3ZLWA 4GIIA 5IA1A 3DS6A 1WFCA 3VS0A 4H05A 2RG6A 2E9VA 2ERZE 2YN8A 5D7VA 2OBJA 2OH4A 4FNZA 2C69A 3D7ZA 3SGCA 3IOPA 2FA2A 5L2IA 3DKFA 1AQ1A 3C4FA 2BZKB 3ZLXA 3FMJA 4IEBA 2A4LA 2ITYA 3OZ6A 3VRZA 3PY0A 4CKJA 3FZPA 4AW1A 1PHKA 5IA4A 1SVGA 5DR9A 2WAJA 1EH4A 4L6QA 4YO6A 5FXSA 4TYJA 4EJNA 3QUEA 4BCNA 2GHMA 4O6EA 5IH6A 4I0SA 3I5NA 4TTHB 3MB6A 3FI4A 4OW8A 1UU3A 2PWLA 2WHBA 2Z7SA 3OY3A 5AR5A 3UVQA 4CQGA 1M17A 3BWJA 5BYYA 3KU2A 2IWIA 2JFMA 3ZTXA 3HL7A 5G6VA 1GZKA 4PPAA 5DVRA 3FL4A 4IW0A 4EQMA 3R01A 3R2YA 1NT2A 4UY9A 4DTKA 2GNIA 2PUNA 1ZOEA 4TRLA 4Z7HA 5EQYA 1FVRA 3ZBFA 2I0EA 4X2FA 5AP0A 3GCQA 1W84A 3GVUA 3QWJA 3A7FA 5AUZA 3UVPA 4UX9A 3RJCA 5ICPA 3PP1A 5HTIA 4JG7A 1UU7A 4C35A 1IAHA 3MV5A 4L53A 3TNPC 4ZTLA 3V8SA 3GEQA 5F1ZA 3R8ZA 4AACA 2UZVA 2PZ5A 4XG4A 3JY0A 4YJPA 3DDPA 4I6HA 4TWCA 3EQBA 4HGEA 3OVVA 5J87A 4P2KA 5CAVA 4NEUA 1YHWA 2CNQA 1SM2A 1SNXA 4N70A 4JQ8A 5IA0A 3F2AA 2WTIA 4LMUA 5CSPA 3AMBA 3S3IA 5T6KA 1OL7A 3BPRA 5AWMA 3HAMA 2G01A 4EHVA 4AU8A 3TTIA 2FO0A 4BDJA 4XP2A 4C3RA 4EKKA 4NU1A 2ITQA 3D15A 5C27A 4EQUA 2YEXA 4GH2A 5HGIA 2QC6A 2W1HA 3F3UA 4PL3A 4XV2A 2OW3A 4I21A 5E8SA 5JEBA 2YCRA 3VIDA 1GNGA 2JIVA 4EHZA 1IA9A 3LFAA 3T9IA 4CZTA 1ZRZA 2PE0A 1H1WA 2BDJA 3P7CA 2JD5A 4KBCA 2GS6A 4LUEA 5AUVA 4BHNA 2VGPA 2QLQA 5DNRA 4Q2AA 3QKMA 4L45A 3EZVA 5CEIA 5AFVA 1YXSA 4DG2E 1XO2B 3LJ0A 5HORA 4ACDA 2WMTA 3QL8A 1OIUA 4EH9A 2QOHA 1OI9A 2EXEA 4KIQA 1VR2A 2WXVA 1GZNA 3QFVA 3R1YA 4H3QA 5CWZA 5CU6A 3NSZA 3ZFXA 2UZEA 1MQ4A 5JT2A 3OTUA 1BMKA 4OTFA 2PMOX 5IEYA 3PPZA 3OWJA 3TI1A 5AP2A 4QMLA 4O0UA 4GT4A 3GFEA 4FTUA 2H34A 2FSLX 1FGIA 3E8EA 4NUSA 4XLVA 3NW6A 1ATPE 4GFOA 2PY3A 3FSKA 2VTQA 5D41A 1KSWA 3KEXA 4FGRA 4RSSA 3WF8A 3O7LB 4LRMA 4FTKA 3O50A 4JBVA 2WNTA 3FLWA 1H8FA 4YJUA 3W18A 5A4QA 4O0YA 5LMBA 2H6DA 1IR3A 2QURA 4WNPA 3HECA 4TWPA 4FSMA 3FQSA 2GDOA 3MPTA 2QCSA 4IDVA 1XH6A 2I0YA 1F0QA 5AP3A 5HO7A 3E64A 3ZO3A 2CGUA 4CV9A 1H1RA 4BCKA 4CKIA 5L8JA 3COMA 3RK7A 4II5A 5IDNA 5F95A 1A06A 5FUTA 1GOLA 1VYZA 4GV1A 3KL8A 1XKKA 3BBWA 4R7HA 4TKSA 3RNIA 2JDOA 4IXPA 4BKZA 5CXZA 5HIEA 2C68A 3A99A 3LM5A 2Y8OA 3D5XA 4EK8A 1WBSA 4RRVA 3TUBA 5EW3A 1BL7A 1S9IA 3TKUA 3W8LA 4EOPA 4WBBB 5EOLA 2CKPA 5CTPA 5CASA 1F3MC 2PVNA 4DA5A 1V1KA 4E20A 1JSTA 4YHFA 4GG5A 2F49A 4M12A 4K77A 2BMCA 2UVZA 2VAGA 1JKTA 4UMRA 5IQBA 4OAUC 2B1PA 3AT4A 4G17A 5LWMA 2YHVA 3AC1A 4O27B 4NM3A 4IB5A 4AA4A 4AFJA 3GFWA 3ZZEA 4H1MA 2C5YA 3UO6A 1M2RA 2BR1A 2Q0NA 3I7CA 1AD5A 5CZIA 4FK3A 3QGYA 4DFUA 4XMOA 4JAJA 2R3IA 3W2RA 1UU8A 1QPDA 3POOA 3V3VA 2BKKA 4EONA 4F4PA 3OCTA 4E6CA 5FM2A 4YTFA 1CMKE 5BVWA 3MIAA 3ZYAA 4A7CA 3U6HA 3QD0A 4UV0A 3KMMA 4AZFA 4JJRA 4HW7A 1NVQA 3WIKA 2AC3A 2EWAA 3D4QA 3LJ1A 3WZUA 1U5QA 4CD0A 1OPKA 4IVDA 3RAWA 4ANNA 4GK2A 2C6EA 5C4LA 3U8WA 5E8ZA 5C8NA 2C6LA 4HYUA 3TM0A 4GVJA 4AOIA 4MCVA 4FL1A 1H0WA 1Q99A 2VO3A 2QLUA 4U41A 2AUHA 4DH8A 4DFLA 4DGNA 3IDPA 2VWVA 5FLFA 4BHZA 4YZ9A 5M44A 3Q04A 2Z7RA 2HWPA 4L3PA 1KE8A 3RNYA 4QMQA 3A7IA 3SG9A 4IX5A 1CSNA 1O6YA 5B2KA 3LPBA 3RZBA 5EI8A 4M15A 4NJ3A 4BZNA 2CSNA 1NW1A 4NSTA 3C0GA 4BTJA 3FY0A 3QA8A 4YTIA 1VYWA 1Q24A 2XKDA 2VRXA 3QHWA 1KOBA 3NNWA 4EL9A 4O0RA 4A4LA 4AX8A 4E5AX 4FYOA 3LFEA 3EQDA 3LHJA 1OKZA 3FQHA 4FV1A 2YWVA 5DT0A 4RIOA 4C8BA 4O91A 1NY3A 2VNYA 4FK6A 3SW4A 3LMHA 4GJ2A 3AG9A 2DQ7X 4EH3A 4RVLA 3RPRA 4PMPA 3EFJA 3EKKA 3DKCA 3C0IA 3DK3A 5HE1A 3VBYA 4F0IA 4EBVA 4U80A 5KMLA 3D7TB 3BLHA 3QD2B 3VS3A 4O7LA 4JQ7A 4I41A 2PE1A 2F2UA 2OI4X 5J8IA 3UP2A 4O22A 3OS3A 4PPBA 3ANRA 4YBKA 2JLDA 1WMKA 4YZBA 4I5PA 4AA5A 3UOJA 3TIYA 2QVSE 4CFXA 3I4BA 3OF0A 4X2NA 4YJVA 3PA3A 5KMNA 3W2OA 5L8LA 2GCDA 4C2VA 3TUCA 5AV3A 2HAKA 4I4EA 1YVJA 3IDCA 2X2KA 4R1YA 2J7TA 1UNLA 4RGJA 1H1SA 1QPCA 4NFNA 4BZOA 3K2LA 1ZYSA 3U87A 2GQSA 3FPMA 4WHZA 2VTSA 3AQVA 3BU3A 2CHLA 5ETFA 5EHLA 4AS0A 1KV1A 4D2WA 2BALA 4TYIA 5KUPA 1ZY5A 3GC7A 4ZZMA 2ITZA 3MVMA 4N57A 2R9SA 4ARKA 4IADA 3E88A 1OECA 3RM6A 4DFBA 4IAIA 4QYEA 4RWLA 4KIKB 1H0VA 4DH3A 4YHTA 3NNVA 4PDOA 4QQJA 2VTPA 2ZMDA 2F9GA 2C3KA 2ZB0A 2X81A 3DOGA 4O7ZA 1PYXA 4B4LA 4EWQA 2IJMA 2OFVA 4WOVA 4XV3A 1FVVA 1WZYA 4U7ZA 3R7EA 4XP3A 4OTPA 5H9BA 3TNWA 4OR5A 3RP9A 3NDMA 4TYEA 1LPUA 4DEIA 1QPJA 4FSYA 3ITZA 4EK3A 1G8SA 4X6QC 5HESA 2CCIA 4RA5A 2WQEA 1L3RE 1AGWA 3OUNB 5DLSA 2VO7A 4MXOA 5CS6A 5ANIA 5EYDA 5FTQA 5JFWA 5K9IA 3KF4A 3MH3A 5KHWA 3PTGA 3OOMA 3R1SA 4Q5EA 4QMNA 4JBPA 5JSMA 4L00A 3L9LA 5E8WA 2C5XA 1REJA 3ROCA 3ATTA 1E9HA 3U4WA 3HEGA 4MXZA 3AD5A 3HMOA 2Z8CA 4FKUA 3F7ZA 4ZEGA 4EJ7A 4Q9SA 2Y4PA 3R6XA 3MFTA 2YDJA 3OY1A 3E93A 3ZCLA 1T45A 1MRUA 2WQOA 5JRSA 1JQHA 2BKZA 1H00A 4AT4A 2W0JA 4UWCA 4ANMA 2GSFA 2CNVA 3W33A 4AN3A 3NCGA 4DEDA 1JVPP 4MQ2A 2VTNA 4QP7A 3VHEA 4O0WA 5JN2A 4KRCA 4YU2A 4DAWA 3K3JA 5E8VA 2VWXA 3JVSA 4Z3VA 4DTAA 3ORTA 2NNWB 1ERKA 3EQCA 4ALWA 2C6OA 3CY3A 4XBUA 3FBVA 4KA3A 3BYSA 4RZWA 2YIWA 4M0YA 4BIDA 4C58A 1ZYDA 4FKQA 3K5UA 4FV3A 5D7AA 2NRYA 4MEDA 5HBHA 2XK6A 3ORNA 4AGWA 2XNNA 4C2WA 5IEXA 3DXPA 1H27A 5HNGA 2OJ9A 4FE2A 4PTGA 1Q62A 2VWYA 1PMVA 3FMDA 3G2FA 3R7IA 4AGUA 1TVOA 2JC6A 3MFUA 5HU3A 2FSMX 3AGMA 3D7TA 2VTOA 3UO4A 3GOKA 4A9SA 2WTWA 3A7JA 4CFNA 5FBOA 5M08A 4IJ9A 1OBGA 4JBQA 1OL5A 4TW9A 4UEUA 3A60A 2YJRA 3OTVA 4X3FB 4BCJA 1Q8YA 2Y6OA 2WD1A 4CFVA 3FLQA 4QMYA 4XG9A 4NJDA 3QQUA 5CU4A 4HVGA 2IG7A 5L2QA 4ORKA 2RGPA 1RW8A 3QD4A 4FNYA 1OL2A 3FKNA 4HGSA 4FKLA 5HCYA 3EN6A 4JG6A 4Z16A 1Q8UA 2ESMA 3EYGA 5TOZA 2UW6A 4I3ZA 5AP4A 3Q4UA 1PMNA 4ZSGA 3Q2MA 2BFXA 4UWYA 2WIHA 3TZ7A 3W8QA 3WZJA 4IVCA 4C33A 2PVKA 3IGOA 4UALA 4DF3A 5CYIA 1A9UA 4EH5A 2BRBA 3OBJA 1XH8A 4RVKA 5LCKA 4M68A 4ZMFA 5IH4A 4C62A 2JDSA 3DDQA 3PFQA 2J5FA 4CGAA 1WVXA 2I0HA 2W1ZA 4UZDA 1SNUA 3UIXA 4S33A 1J7UA 5FEEA 3NYNA 2XK7A 4KIKA 2W1DA 3LE6A 2XIXA 3QTQA 3QZFA 3A2CA 4RZVA 4DCEA 3DXQA 4FEQA 2NO3A 2QO9A 4QMPA 3UOKA 4GKHA 4BZDA 5IA3A 4ITJA 4OT5A 3WIGA 3MY5A 4BDGA 4Y83A 5HG5A 5M57A 2OG8A 3FHIA 4F7JA 4OTDA 1J1CA 3QUDA 4NCTA 4BTKA 3O7LD 2VU3A 5A4CA 4R78A 3I0OA 4MD8E 3RTPA 3V6RA 3LCKA 3QYZA 5KE0A 2Z60A 3EN4A 5HZNA 2VX3A 3LFSA 1A48A 2XNGA 5HTCA 3A61A 1LR4A 2FSOX 4YLLA 2DS1A 3F9NA 1U59A 3KXNA 3VBXA 4MXYA 3A4PA 2RFNA 4XH6A 4PWNA 4IZAA 2WMQA 3TWJA 2X6EA 4O0VA 3GCVA 5CF5A 2PTKA 1H01A 3PWYA 3C5UA 2ETKA 3MYGA 5EFQA 2VWIA 4USEA 1CKIA 3QRIA 4CNHA 5LMKA 2IVSA 2W05A 3QXOA 3WE8A 2JIIA 2CLQA 3UMXA 2EXMA 5AM6A 3DB8A 5BMSA 3U6IA 4L7SA 4GMYA 1MP8A 3NR9A 4HCTA 3NNXA 5C8MA 5CVGA 5AR2A 4WNMA 4YJRA 4C36A 1I09A 3P5KA 3ROYA 2GMXA 5K4IA 4XNEA 4YJQA 5JQ8A 4PL4A 3P23A 4QP1A 4FA2A 3DB6A 4MD9E 3GU8A 3LXNA 3BHHA 5IPJA 2LGCA 3R7UA 2OFUA 4RLKA 5CQWA 2XKFA 5DEYA 1UKHA 4C4GA 5CEMA 2OJJA 4QMOA 5M55A 3CPCA 1ZMVA 2J0JA 3KA0A 4BCHA 4FL3A 4M7IA 5IUIA 1OZ1A 3IW5A 1YDSE 5CQUA 3KGAA 3QD3A 3UIBA 2C0IA 3SRVB 4ANOA 3UDBA 1PRYA 4L68A 4ZSAA 4W8EA 3POZA 4G6NA 4AG8A 2C6TA 1ZAOA 2WGJA 4LV5A 4MXAA 4FL2A 3HUBA 4DYMA 5ANEA 1XR1A 3QTRA 4UMQA 4J98A 3N4VA 3SXFA 3O23A 3OEFX 4ERKA 4X3FA 4APCA 4GL9A 5GIOE 2PVFA 2IVVA 2VWBA 2XYNA 3F2NA 3LMGA 3LXKA 1SVHA 2EXCX 4M0ZA 4QP8A 2PK9A 3HLLA 5HG7A 4B7TA 4IBMA 5EKNA 3ODYX 2O2UA 4BWPA 4CFFA 3F82A 4EH4A 5IUHA 3PXKA 5E4HA 2X7FA 1DM2A 4D58A 5HG9A 5C01A 3E3PA 2JKQA 2Y6MA 3E92A 4R6VA 5CU0A 3F3ZA 4EORA 4QMZA 5BVFA 4O1PA 5H8BA 1Z9XA 3FHRA 1Y6BA 3VW8A 3ALNA 4I5HA 4IJPA 5KCVA 1R78A 3DBFA 3KRRA 3IW4A 3IW6A 4XP0A 4YPDA 2HZ4A 4EH2A 2VTJA 2W17A 3ZMMA 4P7EA 2OICA 5ANJA 3UYTA 3EWHA 4EYJA 3I6UA 4D0XA 3ORLA 3ZO1A 4BYIA 3R0TA 2XVDA 4Y95A 3MDYA 1P2AA 1Z5MA 3F5PA 4E7WA 3ATSA 1U4DA 4U44A 4XS2A 4C4JA 2E9UA 2ZM3A 4A07A 5A4EA 2WQNA 4X7QA 4O7WA 2YIXA 5M06A 2XJ1A 3IDBA 1FPUA 3DK7A 2JDTA 2UVYA 5IQEA 1JAMA 5DIAA 1XQZA 2PMLX 2W4KA 5CNNA 4BIEA 1Q97A 1ZMWA 3TDVA 4JR3A 3JUHA 2PZRA 4ZJVA 3QKKA 4BDDA 3FMNA 1TQPA 2BIYA 2ITPA 5AV2A 4N4SA 3COIA 3V01A 4MXCA 5FQDC 2YIQA 4BRXA 4IHPA 4Y5HA 2XF0A 3DBDA 2X6DA 3EOCA 4IC7A 4YC6A 5E8UA 4M8TA 3EJ1A 4RIYA 4D2TA 2E9NA 2HXLA 3FYJX 4I94A 3FZTA 2VWUA 3DAJA 4APPA 5D10A 4IFCA 1YWNA 3TKHA 5L2WA 4BL1A 3MW1A 5I5ZA 4BICA 3VS6A 3TACA 3IK3A 5D9HA 4FSRA 2B7AA 1OB3A 4BBFA 4EUUA 3FY2A 4ALUA 2F7XE 2H9VA 3TXOA 2CKQA 5E9EA 1M7QA 2V7AA 3Q9YA 3R71A 1WBPA 1PXIA 3HV7A 4DFNA 2OWBA 1KOAA 4WG5A 3FZSA 3V5PA 1OGUA 3NS9A 4QYYA 4FEWA 3IG7A 2ZVAA 4RWJA 4DH5A 5A6NA 2P2HA 3D5WA 1H4LA 2O8YA 4RMZA 3SRVA 3L8XA 4F7SA 3UP7A 4W4XA 3VS1A 5E92A 4FIFA 5I9XA 5D11A 3MBLA 3TZMA 1MRVA 4DH7A 1H1PA 4S34A 1P4FA 5AX9A 5C8KA 3QUPA 3RPOA 4B6LA 5DI1A 2ZDUA 2HELA 3GT8A 4PL5A 2XCKA 4EOLA 2GTNA 4FV7A 5AR3A 3UJGA 2W1IA 2F7ZE 2BILB 5E8YA 3KK9A 4F9BA 5T3QA 3L8SA 2UW5A 4YGAA 2ONLA 2QHMA 4YC8A 3TTJA 3O51A 3ZXZA 3WF9A 1PMEA 3CQEA 4ZLZA 4GK3A 2QO7A 4XG3A 1H24A 3R02A 3WBLA 5J1WA 2FYSA 2WELA 3PXFA 4IZ7A 2GQRA 4IQ6A 4EOJA 4M84A 3P08A 4A06A 4BN1A 4C7TA 1WVWA 4UXQA 2KULA 5HLPA 4IAAA 4O2ZA 4I6BA 3JYAA 4AAAA 4WUAA 3OROA 4EOKA 2XZSA 2BRMA 4ALVA 3P0MA 5DWRA 4ZAUA 3Q2JA 4HZSA 4YJNA 4F99A 2BAQA 2R0UA 2W4JA 4FG8A 5CEKA 3M1SA 4O82A 3K3IA 4FX3A 4JT3A 3CBLA 3PZEA 2XIYA 3HZTA 1WBOA 4RVTA 3QTUA 3LLAA 1XH9A 2P55A 4O0XA 2YDIA 3CY2A 3SC1A 4HGLA 4PY1A 4K18A 3C50A 3T9TA 5KMMA 2YAAA 3MA6A 2CKOA 3ETAA 2OXYA 4EH8A 2AC5A 1J1BA 1XHAA 4GFGA 2UZLA 4GUEA 3C7QA 4QPSA 3VULA 4F6UA 2FB8A 2UZNA 5AIKA 3U54A 2HENA 3CLYA 3QQLA 4BI0A 2JGZA 1MUOA 3KRJA 3PSBA 4E4NA 1URWA 3GCSA 5JZNA 4NTSA 4FT3A 2NP8A 5M51A 4QP9A 4NH1A 4O7TA 4JOAA 4R3PA 5EM8A 3MY1A 3QXPA 4QMWA 2XKCA 3PY3A 4QQ5A 2R0IA 5AJQA 4E5BA 4LOOA 5DT4A 2VNWA 3R9DA 5HLNA 2ZV7A 4FVRA 5DN3A 3TT0A 3S1HA 2WMUA 1KV2A 2FUMA 3FWQA 3VNTA 5HICA 4NK9A 4BDIA 2IZSA 3G6HA 3SHEA 1Q3WA 4MNFA 3CPBA 3LFFA 1H28A 3NYVA 1YDRE 3F61A 5M4FA 4Z55A 3E7OA 3CXWA 4OBOA 3C4ZA 5F9EA 5GINE 5DG5A 4CRLA 4I6FA 3TEIA 2I0VA 1G8AA 4OTHA 4DEHA 4U0IA 3I5ZA 3U55A 4FYNA 4F9AA 3RVGA 5KO1A 1O6LA 3HA6A 2QOLA 4IC8A 4IX4A 2J0MB 4M67A 3NIZA 4YPSA 5JRQA 4N6YA 3UG1A 1YOJA 2HW7A 3O71A 4IAYA 4DLJA 3CTJA 4DFZE 3QYWA 3ANQA 4FIGA 4AXAA 3F88A 4ZY6A 3AT3A 5CLPA 4NWMA 3PRFA 4IH8A 3OCSA 4FKGA 4J96A 4MBIA 4AZWA 4DG3E 5L3AA 3DLSA 3CP9A 4G2FA 5DRBA 4UMPA 3TV6A 3R7GA 2W9FB 4M69B 2VUWA 4KKHA 2XJ2A 3GI3A 3GQIA 4YNOA 5IQCA 5HE2A 4IM0A 4RJ7A 5EG3A 5EHOA 3BELA 4X3JA 5C03A 3FUPA 4F7LA 1NA7A 4AOJA 2VTLA 1BI7A 4O2PA 4AFEA 2CDZA 3DZQA 3R8PA 1M52A 4CG8A 2I1MA 4GU9A 3LCTA 4KNBA 5IQAA 3ZO2A 1OKWA 2V55A 1YXTA 4RBLA 4IB3A 4HCVA 4V0GA 4YTHA 3NYOA 2F2CB 4JIKA 3BEAA 4USDA 3FLZA 4GYGA 1U54B 4K2RA 4ANQA 3IECA 5T68A 4BGGA 4CMTA 1MRYA 3CIKA 3H0ZA 4J71A 5I9VA 2CLXA 2WTJA 1WVYA 2W06A 3C0HA 5CZHA 4ZOGA 3QLGA 5CSXA 4J7BA 3HA8A 4FUYA 4DN5A 4HCUA 4X2GA 3HGKA 4AWIA 4M3QA 2X4ZA 3AMAA 5CEQA 4WBOA 3P1AA 4FTRA 4QRCA 5F20A 4G5JA 4C3PA 2CGVA 4L52A 4R7BA 2A19B 4FKTA 2WTKC 3ALOA 4HVSA 3U6JA 4DE4A 3MTLA 3PXRA 2VWWA 3P7BA 1UNGA 1PXKA 4DEGA 3UQGA 4MH7A 4U81A 3WI6A 5IEVA 2VO6A 4YUQA 3ODZX 5M4CA 3DU8A 3QA0A 2YM3A 4RG0A 5GIPE 5AP5A 3GP0A 2PUPA 3FSFA 4PV0A 3E7VA 1RJBA 4FTQA 4NW6A 4U9AA 4DCAA 2R4BA 3KULB 4FZAB 1SYKA 3KMUA 3LCDA 3UO5A 2UW7A 4ACMA 3DLZA 4ID7A 3V8WA 2O64A 3QCSA 2YIRA 1YOMA 3WF6A 3RHKA 2RFDA 4GEOA 2WU7A 1P5EA 4C59A 1TQMA 2QG7A 3PJCA 4RQVA 3BHUA 3OG7A 4UMUA 3KF7A 2C0OA 4GK4A 2YIYA 2UZUE 4EC9A 3S00A 1R0EA 3PUPA 2XK4A 2QODA 3NNUA 3ZLSA 4BI2A 2WQBA 4O1OA 4PQNA 4FV0A 4F6WA 1OM1A 3QGWA 3TL8A 3ZSIA 1YXUA 2XMYA 2OZOA 3QTWA 3O96A 1UVRA 4JNWA 4U79A 2UW8A 5AAEA 3FI3A 1YXXA 5FTGA 2VD5A 2X0GA 3R21A 2R7IA 2W1GA 5BUJA 1WBVA 3ZHPC 3QC4A 5H8EA 3SLSA 4HGTA 4KIPA 5K5NA 4FZ7A 3FI2A 1PJKA 2NPQA 3T3VA 5IF1A 3KCFA 2JKMA 5HNIX 2FH9A 3A8WA 1W0XC 4P90A 3REPA 5A14A 1XH7A 2XBJA 4BB4A 4AQCA 3A4OX 2C5NA 2QOFA 3M2WA 4G16A 5CNOA 1H07A 2R3OA 4JXFA 3MVJA 2G9XA 3Q9ZA 3TNIA 3R30A 3R1NA 1OBDA 4B8LA 4HYSA 4ZTMA 3Q60A 2RG5A 4E1ZA 4IAKA 4M69A 4WA9A 5EOBA 5FGKA 1R1WA 4J1RA 4LQMA 3HMMA 1MQBA 2VTHA 2ZV9A 4BR3A 1BKXA 1DI8A 3MY0A 3MVLA 3E3BX 3QRJA 4R8QA 3C9WA 2ZJWA 3NLBA 3C51A 5I4NA 3MIYA 4RJ4A 5JZJA 3ZEWA 3IONA 3BHYA 2UZWE 1WAKA 3H3CA 4TNDA 3ZZWA 2EB2A 4BF2A 3G33A 5E8TA 3RGFA 1SZMA 3UNJA 3SG8A 4U40A 2JKKA 1U54A 2IVTA 3JY9A 4ZTSA 5A54A 1H08A 2R3LA 3ORZA 4E93A 3SAYA 2J50A 4LV8A 1SMHA 3LFNA 4MBLA 5AX3A 4K33A 3DTCA 2REIA 4O81A 1FQ1B 1YW2A 4CXAA 1PW2A 4GIHA 4ZTRA 3BRBA 2OK1A 3COHA 3IW8A 4MX9A 3ZUUA 2B9FA 3ZSGA 1PKDA 5CANA 4GT3A 4UN0C 3UODA 2XUUA 4YO4A 2YM6A 4O6LA 5DE2A 3FI8A 3MPAA 4RPVA 3LCSA 3RAKA 5EM5A 4QT1A 4C0TA 4O7SA 3UOHA 2WO6A 3QRTA 3R7VA 3OOGA 1J91A 4BDKA 3DKGA 3D94A 4CCUA 5HKMA 3AC3A 5I3RA 4XG8A 3ENMA 5LMAA 1YXVA 3R8MA 3BEGA 5DH3A 5EDRA 5AV4A 4O21A 2Q0BA 4EBWA 2ITOA 3W2SA 2B9HA 3Q4ZA 4JBOA 3VVHA 2QOQA 3OCBA 2CGXA 2QI8A 3LCOA 3R28A 4XUFA 1OITA 1JPAA 3KULA 4HYIA 4EOSA 4FEUA 5A4TA 1OIQA 1OUYA 3C4CA 3I1AA 4G9CA 1OMWA 4CRSA 2BAKA 3QZHA 3VC4A 3SVVA 3O8PA 3NVKI 4BCIA 1W83A 3RCDA 4AP7A 2OH0E 1V0BA 5AUYA 1G5SA 4O96A 4QP3A 4FTJA 5FTOA 4E6QA 5IH5A 3ZDUA 3QALE 3SA0A 2WMWA 3CQWA 5M4IA 4NZWB 4BGQA 2ZM1A 4WKQA 3L9NA 5J95A 4W8DA 2QOCA 3AMYA 1OIRA 2YERA 2C3JA 2X7OA 3HKOA 3UG2A 2VTAA 3GCUA 2BDWA 4D1ZA 3GBZA 4TNBA 3F5UA 4NM0A 4IAFA 1ZOHA 3DCVA 3PG1A 3PJ8A 5CAUA 3BYUA 2Y0AA 3JXWA 3OWPA 5HCZA 4L3LA 4F64A 2A2AA 2UW3A 3A7HA 4G3FA 4RJ8A 1YI3A 2XNPA 3S2PA 3TIZA 4NT4A 3W2CA 2V5QA 4BTFA 4DEBA 3DA6A 1E1VA 3MJ2A 4WO5A 3UPXA 4GUBA 4QYFA 5DA3A 5GZAA 2QG5A 4OT6A 2BUJA 4D28A 4FF8A 3OXTA 3VJNA 2OZAB 1RQQA 5LJJA 3P4KA 1WBTA 4NM7A 4BGHA 4R77A 4PNKA 3E8CA 4BCOA 4B0GA 3PJ3A 4D5KA 1YHVA 4QYHA 4BFMA 4DBNA 5CEOA 4OGRA 4MNEB 1KE7A 3OW3A 3U51A 2X1NA 2OIQA 4FT0A 5TO8A 3M11A 3L8PA 2O63A 2WFYA 3EHAA 1FMKA 1GJOA 2PVYA 2W1EA 2XYUA 5K3YA 4LI5A 3EB0A 4AUAA 4GS6A 1ZXEA 2GFSA 2OXDA 4M13A 3MH1A 5AEPA 4FKWA 1ZYLA 4FTTA 4AT5A 1OPJA 3SXSA 2YCFA 3AC8A 3VJOA 2R3HA 3EIDA 4DINA 5CEPA 4X2JA 3PG3A 3KXXA 4CTCA 4F63A 3TJCA 4JIAA 4ZIMA 1W98A 1R0PA 4Z7GA 3PVUA 4R5YA 4CV8A 4ZTNA 2QOOA 1UU9A 3JPVA 4LMNA 4O7RA 4E73A 3K54A 4YZMA
chains in the Genus database with same CATH superfamily
4J99A 2PZPA 2PYWA 1S9JA 4YZCA 3AKJA 4ZZOA 3PIZA 3QKLA 3S95A 3OEZA 3U4UA 1IG1A 2HW6A 3CD3A 3PRIA 3TJDA 3P86A 4BI1A 1OPLA 3OCGA 4O86A 2P4IA 4IACA 3DJ6A 2R5TA 5HVYA 4HVHA 4FV9A 4N0SA 4UMTA 5KKRC 3HP2A 4C3FA 4EK6A 3CQUA 4DGOA 3FZRA 2V7OA 4MWHA 4JLCA 4MTAA 5B2LA 2C6KA 4O83A 5JGAA 4EI4A 4NL0A 5BUIA 2BTRA 5I9ZA 4GFMA 3BLQA 4DHJA 2XAOA 4U3ZA 4QQCA 3MSSA 4PMMA 4NYEA 5BMMA 1K3AA 3Q52A 3GC9A 5IG1A 3DAEA 3I7BA 3GU5A 5JGDA 3W10A 5JFXA 2XAMA 3EFLA 3FKLA 4RLLA 1Y57A 4DHFA 3FMEA 2EB3A 4YZNA 4ANBA 3P5JC 5ANGA 3EMGA 2WOTA 4FVPA 4GRBA 4QYGA 5HBEA 5KBRA 3HVCA 4MK0A 5GJGA 3Q96A 2Y9QA 4FUXA 4L43A 2PSQA 2ZDTA 2E2BA 3KFAA 3VQUA 2WTCA 2B4SB 2Y4IC 5CF4A 2OIBA 3I81A 5GNKA 5BVDA 3ACKA 4K8AA 4PTEA 3BCEA 3PLSA 2QKRA 4PMTA 5IZFA 3LXLA 4H39A 2J0LA 3FMMA 3QU0A 2QQ7A 4IWOA 3S4QA 2ITXA 1GAGA 4GVAA 4S30A 3LQ5A 4TXCA 4BWKA 3FMLA 4RIXA 4F09A 5LXMA 3DFCB 4C57A 2GNGA 1YHSA 4IMYA 4ASDA 5KMKA 1Y8YA 5ITAA 3DXNA 1PXLA 4ZXTA 3P9JA 2J5EA 3KC3A 1OVEA 4YHJA 2PUIA 4D2PA 4DGMA 4G3EA 4FG7A 5C1QB 3II5A 4QMSA 4RX7A 5AM7A 5J7HA 1JSUA 3DZOA 3TMOA 1G3NA 2X0PA 2QONA 3GOPA 3ORPA 4AQKA 1TKIA 4K0YA 3GC0A 2JFLA 4FMQA 4XYFA 3H10A 4AN2A 4ENXA 3HYHA 4R1VA 3KXHA 2DWBA 2OZAA 4U6RA 1M2QA 2HZNA 4A9UA 5IMEA 3WYYA 4E26A 3FLSA 3H4JA 3MVHA 1B39A 4LG4A 4CTBA 5AADA 4UYAA 2XH5A 4I0RA 4MNEA 4ENYA 3NVMB 4KSPA 4AT3A 4RJ6A 3R8LA 3W16A 4DH1A 2WMAA 5IU2A 5IUGA 3DY7A 5LVMA 5AUXA 2RFEA 2ZOQA 3O8TA 2B9JA 2QU6A 4RIYB 3I0QA 3AGLA 5JH6A 3HP5A 3V5WA 1ZYJA 4F0FA 3WYXA 4IM3A 2X7GA 3CEKA 3Q9WA 5DYJA 3MPMA 4E4XA 4XBRA 1DI9A 4WG3A 4L3JA 2ITUA 2VV9A 3ORIA 5DHJA 4O0SA 1KE6A 3FZ1A 2BFYA 4MWIA 4RC4A 4FEXA 2GQGA 2OF4A 2Y7JA 4AZVA 3ZRKA 1PXPA 2GS7A 3FC1X 3IS5A 3LQ8A 4JRNA 3FXZA 3CKXA 2R3QA 4FKVA 4FSTA 4Q5HA 2R3MA 4KAOA 4OBPA 3C4XA 3ZRMA 4F65A 2QD9A 3IQ7A 4F6SA 4MBJA 1BLXA 4NCTC 3E87A 2DUVA 4IVAA 4W4YA 4YJSA 2X4FA 5C9CA 3CTQA 4X2KA 3SXRA 4BKYA 4IX3A 4LRKA 4RFYA 4C4EA 4PTCA 3F3TA 5DMZA 3O8UA 1TQIA 2A0CX 4O7YA 2CKEA 4ITHA 4XRLA 2CN8A 3B2TA 3BYOA 3ERKA 5HEZA 3W0OA 5M4UA 4BIBA 4F0GA 3MFSA 1L8TA 1M7NA 2W1CA 2OXXA 3U9NA 4BCGA 5JKGA 4U8ZA 1FVTA 4E3CA 1QPEA 3GQLA 5ANKA 1PKGA 3DQWA 5EI2A 2W5AA 5EDPA 1FMOE 3FE3A 3JS2A 2VZ6A 1ST0A 2JBOA 4XG2A 1YOLA 4FSWA 4X0MA 5FBNC 5LMKC 5E7RA 4GU6A 4JQEA 2I7QA 4I23A 1M2PA 5BVOA 4YJOA 3NIEA 4FNWA 3R00A 3EQFA 2WTDA 3DV3A 3QCQA 4FC0A 3ZRLA 2XIKA 3ZC6A 3EN7A 4FV8A 2XM8A 2BHEA 4Y72A 4QD6A 1OIYA 3DGKA 3FYKX 4XEYA 4AE6A 1XBCA 1ZYCA 3OXZA 3NEWA 3OUKA 4GG7A 4CVAA 2WMVA 5E8XA 3ZS5A 3L9MA 2GNJA 3NWWA 3N4UA 4OTQA 5AP7A 1OGYA 4FIJA 3DK6A 4HNFA 4F1MA 4WT6A 5A3XA 5KBQA 3GU7A 2WMXA 4AGDA 4QO9A 3LFQA 4BDAA 1ZARA 2PULA 3VN9A 2UW9A 5DT3A 2IZTA 4QTCA 1PYEA 4I4FA 4L9IA 3RAHA 2XALA 5B7VA 5EYKA 3TZ8A 4TN6A 4JAIA 2VTIA 2RF9A 3DBCA 3E63A 3NAXA 4AW0A 3KN6A 3LMIA 5CXHA 3F7WA 3EYHA 4BBMA 4IIRA 4H3PA 5HU9A 3PE2A 2DYLA 4IB1A 5LVOA 3C5IA 2C1BA 3ACJA 4J8NA 4L7FA 4LUDA 5ETCA 4CKRA 3GENA 2W1FA 3E8NA 2P33A 4FOCA 3HDNA 2E9OA 5BVKA 4FRFA 3A8XA 4HPUE 3S0OA 2J0KA 3HV3A 4CZUA 5ETIA 1RE8A 2BPMA 1CM8A 1H1QA 2W7XA 3GGFA 3BGZA 5FXRA 4K6ZA 5AUUA 4YP8A 4MF1A 4KB8A 4JMQA 2BZJA 3IKAA 5HBJA 1W8CA 3GCPA 1Z57A 4S31A 2GFCA 5A4LA 3OHTA 5FDPA 3DBQA 2C3LA 4FZ6A 4CMUA 4L01A 2G2IA 2BRHA 3DPKA 1GY3A 3PSCA 4WRSA 3ZM4A 1G8KA 2XIZA 2GTMA 3KREA 5AUWA 4FR4A 3RWQA 4PX6A 2JDRA 3ZXTA 2G2FA 4O7VA 4DEAA 3KMWA 3Q3BA 4GYIA 3DNDA 3KRWA 5E1SA 2E9PA 2J6MA 4I6QA 4JVGA 5L2TA 3FL5A 2BDFA 3R8UA 3EQHA 3EL8A 4GW8A 5BVEA 4KSQA 1RDQE 3PWDA 3THBA 4ACCA 5M53A 5EQPA 2EUFB 3RINA 2QOBA 5HI2A 4QTAA 3VONA 2YLFA 3AKKA 4FTAA 2JKOA 4EZ5A 4ACHA 5L6OA 2FGIA 2V22A 4HOKA 1APME 4G6LA 3OWLA 5M09A 2WU6A 2I6LA 3SW7A 2XNEA 3ZH8A 5AUTA 4YJTA 3KXGA 2OU7A 5CAPA 4DTBA 2I40A 3KY2A 5GJDA 5K0KA 2OO8X 4RC3A 1STCE 1DAWA 3CCNA 3CGFA 4BDCA 2JEDA 4H1JA 2H96A 3G6GA 3LOKA 3TN8A 4CMOA 1ZLTA 2J4ZA 1PXOA 1CDKA 4V0GB 5FD2A 5HD4A 3ZO4A 2GHLA 2X8EA 4WUNA 4FV4A 4A9RA 1GIJA 3PE1A 1YDTE 4TWOA 4FKOA 2ITWA 1HCLA 5ETAA 4N6ZA 4ZP5A 3VUGA 3SD0A 3VS4A 4WNKA 4JL9A 4RQKA 4KWPA 3HRFA 4K9YA 3L9PA 3LXPA 4L42A 4EWHA 4LV7A 3GXLA 3NW5A 3BE9A 5EDQA 5HO8A 5LVPA 3MN3A 3BI6A 4OUCA 3ZSHA 3PXYA 2XB7A 4B9DA 3UMWA 3HAVA 4OTIA 1O9UA 2R7BA 5HIDA 1M14A 3FZOA 1W2FA 5KMJA 5CU2A 5ANDA 5FDXA 3W1FA 3VF8A 1YI4A 4ANSA 3F5XA 5L2SA 3R2BA 1FINA 2ZMCA 4BCMA 2OJFE 2RFSA 4M14A 4TYGA 4V04A 2CJMA 3KRLA 5EKOA 2W4OA 3FV8A 3I79A 5IA5A 1K9AA 2ERKA 2R3GA 2YITA 1HCKA 1CKJA 3NPCA 2PZIA 4GSBA 4IVBA 2C6MA 4AZTA 4O4BB 4FSNA 1Q8ZA 4OAVB 3QTSA 3V5JA 3VS7A 2HWOA 2XRWA 4HYHA 5TR6A 3RI1A 3NZ0A 4DFXE 3BX5A 3OFMA 4AN9A 4QP2A 3QQJA 4UWBA 3G51A 4FGBA 5AP1A 5G1XA 4J52A 4ZJIA 3LFBA 2C6DA 3MGYA 4EYMA 2HYYA 3R73A 3RAIA 1REKA 3GU4A 3WOWA 2CNUA 2LAVA 4NIFB 3C13A 1OKYA 3KN5A 4Y46A 2HOGA 3TG1A 2C30A 3A62A 3NCZA 4EOIA 3QAME 3LVPA 1OUKA 5BV3A 1JNKA 3VW6A 5IQGA 3RALA 4RIWA 4D2VA 2XM9A 3MFRA 3RBWA 1XBBA 3LJ2A 3VBQA 2ETRA 2YDKA 2JDVA 4JDHA 2X0OA 5EM7A 4ASEA 2JBPA 2GNLA 1YI6A 5CSVA 3SOCA 1YRPA 3D5VA 4FT7A 5F94A 2J90A 2J0IA 1KWPA 3P7AA 3Q6WA 3RK9A 4RFMA 3UC3A 1J7LA 4U3YA 2B0QA 2PVJA 2GS2A 3JR1A 4D4YA 4RFZA 3V8TA 4BWXA 2C1AA 2YACA 4EOQA 5C4KA 4F9YA 1T46A 1UWHA 4QTEA 3QRUA 4EOOA 4TT7A 3UGCA 3ZM9A 2G1TA 2C0TA 4WNOA 3QLFA 4PDSA 4C02A 1JLUE 4ZK5A 2F57A 1XMMA 4X6RA 4I5CA 4FTIA 2YCQA 4RA4A 2X39A 2X2LA 4ZS0A 5FEDA 4V01A 3NUYA 2BZIB 2BRNA 4ZY5A 4KRDA 2WMRA 1B6CB 4XCUA 2YJSA 2F7EE 3NUPA 2HZ0A 2UZOA 3UC4A 4EZ7A 1KE9A 3VUIA 2R2PA 3V5TA 5HE0A 4RT7A 2R64A 4EZ3A 1JBPE 3FMKA 1Y8GA 5DRDA 4UZHA 2ACXA 4YSMA 5HO6A 4EK4A 3Q9XA 3UZTA 5HX6A 2GU8A 3KXZA 5HG8A 4FEVA 4ZJJA 4I22A 2H8HA 4W9XA 1GZOA 4FICA 4MHAA 5DR2A 2X8IA 4K1BA 2PPQA 4QNAA 4PDYA 3UIMA 2XJ0A 3G9NA 5HOAA 3UOLA 1W82A 3SQQA 4HNIA 4G5PA 4XHKB 3MWUA 2UW4A 4PUZA 4YBJA 4PNIA 1JWHA 1CTPE 2IO6A 3VUHA 1IEPA 2HZIA 1Q3DA 1OL1A 1WBWA 2QOIA 2QKWB 2QOKA 2BCJA 3P79A 4QPMA 5FP5A 3R83A 1QMZA 2X9EA 2XP2A 4G34A 3WILA 4FT9A 2YWPA 4LOQA 1J3HA 2VGOA 3C4EA 4FIIA 4PPCA 4DLIA 4AAYA 4CLJA 3TV7A 1E1XA 4CSVA 5J7BA 3F2RA 5FXQA 2XIRA 4PP9A 3NGAA 3D83A 4R3CA 3HMPA 4TY1A 5AP6A 5JMSA 4AE9A 1YQJA 3HUCA 4E4LA 2OF2A 2ZV2A 4I1ZA 1XH4A 1UKIA 1WCCA 4MYGA 4J95A 3LQ3A 3FXXA 3DNEA 3VRYA 1PXNA 4WRGA 3Q4CA 5EYCA 3U9CA 4BVUA 5BVNA 5LVNA 2AEGA 5HHWA 4FTCA 2XNMA 4YR8A 3BU6A 1OKVA 1BX6A 3PIYA 4HPTE 3FDNA 2BVAA 5AR7A 3UQFA 4NIFA 2YM5A 2ETMA 5JFSA 2CN5A 4EHGA 5AV0A 3FPQA 4Y8DA 3WZEA 4CYIA 4DG0E 1FBNA 4BCQA 3GB2A 3BWFA 3ML1A 5I9WA 4E6DA 2PZYA 2QO2A 2XRUA 5KNJA 1W2CA 3DAKA 4LGHA 5AMNA 4JX7A 1JSVA 3PVBA 4DC2A 5TF9A 2HIWA 4YURA 3MESA 1SVEA 3EQGA 3SKCA 4F1TA 4F9CA 2HXQA 5AA8A 5A9UA 4FTNA 4UB7A 4AZSA 3EFKA 2JAVA 2OKRA 3D9VA 3F66A 3QC9A 4AF3A 4EC8A 4EH6A 3PP0A 4FV2A 4D9TA 5DBXA 5CF8A 5HLWA 3RWPA 3ZDIA 4L46A 4IWDA 3PVWA 4PP7A 3HMIA 3QX2A 4ZSEA 3CD8A 4FKPA 3QZGA 5GZ9A 3CE3A 2BHHA 3V6SA 4FI1A 3O0GA 3GNIB 3Q5ZA 3DKOA 4MKCA 3VWAA 2CMWA 3V5QA 3BL7A 4DT8A 5D12A 3V5LA 1I44A 4O38A 5E1EA 3WZKA 3MJ1A 4JR7A 4XOYA 2HCKA 4I5MA 4A9TA 4BCPA 2PUUA 3PA4A 5KKRB 2XKEA 2VTRA 5AIRA 2AYPA 3LFDA 1P4OA 5DOSA 4W9WA 2XEZA 1FGKA 2XCHA 3TCPA 4EUTA 4BJJB 4PDPA 4ASZA 4XV9A 2OLCA 3HV4A 2RL5A 4EEVA 3LLTA 3PUFC 3WF5A 4FTMA 4CFUA 2W96B 5BYLA 2R3NA 4FOBA 4RJ3A 1KUTA 4IZ5A 3UBDA 3QQFA 4U5JA 3VO3A 3KXMA 3NX8A 3DTWA 3EQPA 2R3KA 3EN9A 4ACGA 3CR0A 5BNJA 5LCJA 4QPAA 1GIIA 3V04A 4E8AA 5D1JA 4RWIA 3UNKA 5EW8A 3N51A 3ZUVA 2WMSA 3DBEA 3FC2A 5HVJA 3G90X 2Y4IB 2YLEA 1Q5KA 3E8DA 1BI8A 4BDFA 4D1XA 4DEEA 3UQCA 4MVFA 3W2QA 2C3IB 1NXKA 3QCXA 2Z7LA 3WE4A 2X8DA 1XH5A 2J9MA 4P5ZA 3RMFA 5KX8A 3RPSA 3QQGA 5FM3A 4KS7A 4FVQA 5IISA 3RHXA 2VWZA 1Q8WA 4ITIA 2NRUA 3KQ7A 5ACBC 1Q41A 2ITNA 1IA8A 4FSZA 4XG7A 3BE2A 2PL0A 4HJOA 4GT5A 4CT1A 5B2MA 3FLNC 2V0DA 4RJ5A 5LWNA 3RKBA 3IOKA 2FSTX 4O84A 2UW0A 3ZLYA 5JFVA 2B9IA 3N4TA 4DHIB 1CKPA 2CPKE 3EH9A 4IDTA 4BDBA 4F1OA 4Z9LA 2YFXA 5B0XA 2IF8A 4FIEA 5J1VA 3UZRA 5M56A 2YAKA 5I9UA 4NKAA 5DEWA 3HV6A 5J9YA 2C5VA 4RVMA 3KKVA 5CENA 4YTCA 3O5AA 4LL5A 4DDIA 4LYNA 4FT5A 4QMVA 4KUJA 2PE2A 2AQXA 2G15A 2HK5A 4DGGA 2BRGA 3F5GA 4DDGA 5BQ0A 2WKMA 4QMTA 2UZTA 5FG8A 1PXMA 1ZZ2A 2WQMA 2CGWA 2WEVA 4RIXB 5JGBA 2W5BA 1GIHA 2YISA 3LZBA 1NVSA 3ENHA 5FP6A 5GHVA 1W7HA 3UZPA 3ZC5A 1UA2A 4Y85A 5CY3A 3ORMA 4ASXA 4BYJA 4RWKA 5FRIA 1LP4A 4I93A 3COKA 4RC2A 2RSVA 2JAMA 3EL7A 3OC1A 2VTMA 2A1AB 3FQEA 3CTHA 4M66A 3R8VA 4D4RA 3NYXA 2QR7A 3RM7A 4UXLA 5DPVA 4EHEA 2RKUA 4KABA 4QTDA 3FXWA 2OSCA 2JIUA 5H8GA 5K5XA 2G2HA 3KVWA 5EI6A 4CT2A 2PVMA 3UNZA 3HV5A 1UNHA 2A27A 4FKRA 4RX9A 4TWNA 3TKIA 3HMNA 5HX8A 5H2UA 4EH7A 3H30A 3PJ2A 4G3CA 1J7IA 4FV5A 4D2SA 3PIXA 5A46A 4CG9A 4CFWA 3QHRA 2BZHB 4KKEA 1OL6A 4DGLC 4DITA 4BJJA 4BBEA 2C5OA 1VJYA 3RK5A 4LOPA 4B99A 4QQTA 3PY1A 4G31A 4LL0A 5IQDA 2P2IA 1Y6AA 4P5QA 4BY9E 3VBTA 3B8QA 2YA9A 4C4HA 2O3PA 3AXWA 2UZBA 4E4MA 2GNHA 3PYYA 3BZ3A 3D2KA 5AR4A 3Q32A 5LARA 4F70A 4TL0A 2WOUA 2Q83A 5EQEA 1H26A 4NW5A 4A4OA 3VUMA 4ZLOA 4CQEA 3PPJA 5CI6A 3CGOA 4YLKA 5E90A 5IQFA 4PMSA 4D1SA 5LOHA 3T3UA 2Z02A 3AOXA 4C61A 5KZ0A 3TNQB 1V0OA 3VUTA 2W5HA 3BIZA 2OJIA 3UTOA 4H36A 3VHKA 3GC8A 5J5TA 3DFAA 4O4DA 4OTGA 4Y73A 3NMUF 5BX0A 3F6XA 5I9YA 2YM8A 2O0UA 4TYHB 4S32A 3VUKA 5AV1A 4WIHA 3AD6A 3L8VA 4NM5A 5L8KA 5J5SA 3EFWA 4LFIA 2VN9A 4XOZA 5IMXA 3TDWA 3FLYA 3SV0A 1XBAA 4H58A 4D4VA 3W2PA 2BAJA 3EQIA 3K5VA 5CX9A 3G9LX 3H0YA 1QL6A 4WD5A 3UVRA 3UDSA 4JG8A 1HOWA 2OJGA 3PSDA 3ZOSA 2JITA 3MH0A 4X21A 2IVUA 3VBWA 3GUBA 4I24A 4NFMA 4OTRA 4ZTQA 4P4CA 1XJDA 2C4GA 3ELJA 3KCKA 4EOMA 4I92A 5LQFA 3FEGA 3DQXA 2OIDA 3JVRA 4BC6A 4CLIA 1BUHA 1Q61A 5M07A 4K11A 4ZLYA 2UV2A 3AD4A 4XLIA 1R39A 3QBNA 5CSWA 5HQ0A 3EN5A 3RPVA 2SRCA 3MB7A 4F9WA 5J9ZA 2VTTA 5H3QA 4J53A 1QCFA 2YM4A 3Q6UA 3PDTA 1LEWA 2UVXA 2ITTA 5AA9A 4WG4A 3CSVA 3HRCA 4YLJA 3KVXA 4KS8A 4YC3A 5HCXA 4C34A 3BKBA 2GPHA 4QP4A 1VEBA 1PMUA 2R3FA 5K0XA 4RX8A 2J2IB 4FIHA 3RCJA 4QNYA 3P78A 4FSQA 3VS2A 3ID6C 2ZM4A 1ND4A 3NRMA 4MD7E 3OD6X 4OLIA 4JS8A 2XNOA 2VX1A 2W99B 3CJGA 3IPHA 2XK3A 4ANLA 4IWQA 2IZRA 3KK8A 2HY81 4CEGA 4FZDB 2IW9A 2WIPA 1KE5A 3H9OA 5FWKK 1U46A 2WMBA 4KIOA 4NTTA 2QNJA 1R3CA 3R63A 5HE3A 4LDTA 5I3OA 2XS0A 2PVRA 3D2IA 4I0TA 4S2ZA 3NUAA 1V0PA 4B8MA 3RPYA 3T8OA 5IQIA 3TNHA 4BTMA 3UIUA 1XMLA 3ZUTA 1Y91A 4JX3A 4GJ3A 4XG6A 2IN6A 1ZMUA 3AT2A 2VX0A 2WTVA 3ORKA 5KHXA 3I6WA 3BLRA 3Q5IA 3QRKA 3WF7A 4F7NA 4C37A 3QTXA 4E6AA 4CZYB 3BYMA 3OT3A 4DFYA 4ZSJA 2BROA 4IANA 2V62A 2UZDA 3G0EA 4G3DA 4E5WA 3W0MA 2B52A 2PU8A 4U45A 4C4FA 2VO0A 3SOAA 4FSUA 4QMUA 5KMIA 1XWSA 2WPAA 3IW7A 3BHVA 1K2PA 4ZSLA 4DT9A 4J8MA 4XV1A 4CFMA 4ERWA 4OBQA 4MAOA 2EVAA 4V05A 5AAFA 3VQHA 4FV6A 5ANOA 2WEIA 2PMIA 2PHKA 5CU3A 1JKKA 3Q4TA 4FNXA 1BL6A 3I60A 4XRJA 3LIJA 2X2MA 3F3WA 3BBTB 2O5KA 3HDMA 3QCYA 2UUEA 2XEYA 3TZ9A 3WZDA 2BIKB 3B8RA 3UE4A 4AA0A 5FEQA 4F08A 4U43A 4G1WA 3PJ1A 4QMXA 2X9FA 4YNEA 5CSHA 3UYSA 4C38A 3UPZA 4DBXA 3ET7A 3PVGA 4TYHA 4JDJA 1B38A 3DJ7A 4ONAA 5TT7A 4M97A 4A9YA 5CVFA 4H3BA 3OW4A 3R9HA 3VAPA 5CAOA 1PY5A 3PXQA 5GZ8A 4IZYA 3HX4A 3F3VA 3MS9A 3QTIA 4JDIA 3ZEPA 1UV5A 2B53A 4D2RA 2P3GX 4FTLA 4ZTHA 3C1XA 3ORXA 4AGCA 5KMOA 4W4WA 3IO7A 3SX9A 3D0EA 3PXZA 4FBXA 2QR8A 1YKRA 3VF9A 4TZRA 4IE9A 3KRXA 4FODA 3R7OA 2GNFA 2ZB1A 4XJ0A 3E62A 3QQKA 4L67A 5EHYA 1IAJA 4FG9A 2FVDA 1JKSA 5DR6A 5CF6A 1PXJA 2QU5A 4WSQA 4G9RA 3O2MA 5IA2A 5CVHA 2XA4A 3BU5A 3CC6A 4Y5QA 3TUDA 4WSYA 1ST4A 1PF8A 2PVLA 4EKLA 2IZUA 3FKOA 4NKSA 4AXDA 3DJ5A 2IW6A 1DS5A 2PVHA 3W32A 4D0WA 3N9XA 5J79A 3R1QA 2P0CA 3HRBA 4IWPA 4G6OA 4KKGA 4L44A 5EH0A 3SDJA 3VUDA 4EK5A 4D4SA 1IASA 4HVDA 2B54A 5CAQA 2QHNA 1IRKA 2R3PA 5DGZA 3NUUA 1LEZA 2F4JA 3M42A 4IX6A 1P14A 4QMMA 4D55A 3ZONA 4AXEA 1ZY4A 4X3FC 1ZOGA 3AC4A 4MXXA 3MTFA 2IW8A 4BDHA 4YSJA 5F4NA 4Q9ZA 2YABA 5EM6A 2XK9A 5HTBA 3R22A 5BPYA 3PA5A 4AOTA 3OP5A 4U97A 4HVIA 3CS9A 3ZBXA 3QX4A 1ZZLA 2R3JA 1X8BA 2WZJA 2Z7QA 3G0FA 5AAGA 5CT0A 3CJFA 4F78A 5A6OA 5KZIA 2R3RA 3R9NA 2RIOA 1JKLA 3R04A 4ZY4A 4ZS4A 4RIWB 4O7NA 5HNBA 3BYVA 4CYJA 5L6WL 4U42A 4UYNA 3C4WA 4FJVA 3G5DA 3D5UA 2WB8A 1GZ8A 4CCBA 3MA3A 3EQRA 3LW0A 2HY0A 5L4QA 3L1SA 4HZRA 1BYGA 5GJFA 3WARA 1LUFA 4LGGA 3OT8A 2EU9A 4R7IA 5ACKA 4BKJA 3DT1A 3PPKA 3FAAA 5TE0A 2OGVA 2O65A 3AC5A 5JQ5A 3NUXA 3E5AA 4J97A 3BV2A 4L8MA 3LAUA 5BYZA 1ZWSA 5E91A 2XK8A 3EZRA 4ZZNA 3TV4A 3QQHA 2C6IA 4PRJA 5DFPA 1H25A 4RX5A 5TKDA 4GCJA 4TPTA 4W4VA 3VS5A 1YWRA 3ULZA 4YMJA 3D14A 4USFA 4AXCA 2ITVA 4YZDA 3BV3A 3EKNA 1JOWB 2YZAA 3GU6A 4LGDA 4LM5A 3HNGA 3H9FA 4JDKA 4A4XA 2B55A 4R5SA 4D9UA 2WTKB 3AC2A 3B2WA 3BGQA 5BUEA 4ZMEA 4UBAA 3FMHA 1URCA 5CI7A 2GHGA 4JI9A 5K4JA 2YZLA 4D5HA 4QTBA 3ZFYA 4QP6A 4KBAA 2IPXA 3OXIA 2CCHA 4FZFB 4PF4A 3V51A 2XBAA 4OTWA 4AZEA 2Z2WA 5EK7A 3VBVA 2XNBA 1Q4LA 3A7GA 5L6PA 2ZAZA 2YCSA 3F69A 1O6KA 3NUNA 5HD7A 5IKWA 5HVKA 2C47A 1U5RA 5JK3A 4IB0A 4O0TA 1WBNA 3FJQE 4AW5A 1NVRA 3LM0A 3QZIA 1VZOA 4GKIA 3QF9A 3H9RA 4LRJA 1YWVA 3BQCA 4R3RA 4I20A 3BQRA 3O17A 3OWKA 5CT7A 3R7YA 5EW9A 5AR8A 2W9ZB 5IQHA 3BHTA 1UWJA 2PMNX 3QTZA 3KB7A 4FTOA 3LKMA 2ZYBA 5IDPA 3NAYA 3OMVA 4KD1A 4MQ1A 2KTYA 3NUSA 4IAZA 2YM7A 1F5QA 4BCFA 5J9LA 5EYMA 4IFGA 4IM2A 4XX9A 4FKSA 2ZV8A 4G3GA 3ZU7A 3Q53A 3G15A 4JRVA 3W0SA 5HIBA 3MH2A 3IGGA 3QWKA 3PLAE 4KINA 3ZFMA 3PZHA 3R9OA 4C4IA 3MI9A 3CKWA 5I0BA 1FOTA 3BGPA 1Q8TA 3LFCA 4BDEA 3W55A 4KBKA 3RZFA 3R9RA 2BTSA 4AW2A 1DAYA 5C26A 5CALA 3OBGA 5LVLA 4MF0A 4FKJA 4QOXA 2ONLC 3NW7A 4FKIA 3ULIA 4EQCA 2J51A 3ZLWA 4GIIA 5IA1A 3DS6A 1WFCA 3VS0A 4H05A 2RG6A 2E9VA 2ERZE 2YN8A 5D7VA 2OBJA 2OH4A 4FNZA 2C69A 3D7ZA 3SGCA 3IOPA 2FA2A 5L2IA 3DKFA 1AQ1A 3C4FA 2BZKB 3ZLXA 3FMJA 4IEBA 2A4LA 2ITYA 3OZ6A 3VRZA 3PY0A 4CKJA 3FZPA 4AW1A 1PHKA 5IA4A 4MUQA 1SVGA 5DR9A 2WAJA 1EH4A 4L6QA 4YO6A 5FXSA 4TYJA 4EJNA 3QUEA 4BCNA 2GHMA 4O6EA 5IH6A 4I0SA 3I5NA 4TTHB 3MB6A 3FI4A 4OW8A 1UU3A 2PWLA 2WHBA 2Z7SA 3OY3A 5AR5A 3UVQA 4CQGA 1M17A 3BWJA 5BYYA 3KU2A 2IWIA 2JFMA 3ZTXA 3HL7A 5G6VA 1GZKA 4PPAA 5DVRA 3FL4A 4IW0A 4EQMA 3R01A 3R2YA 1NT2A 4UY9A 4DTKA 2GNIA