3P5KA

P38 inhibitor-bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
332
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of a novel class of non-ATP site DFG-out state p38 inhibitors utilizing computationally assisted virtual fragment-based drug design (vFBDD).
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p5kA01
3PA5A 3SXRA 2SRCA 3CIKA 4IX3A 2Y7JA 4I4FA 1P2AA 5BYZA 3U9NA 3G6HA 4JBQA 5CEPA 4MXCA 4BDDA 1WBWA 4FIFA 3ZBFA 2WO6A 3N51A 2B9FA 3ENHA 3GEQA 4PPCA 3PZEA 3HV6A 4RJ6A 5F95A 3ALOA 4H1JA 3BIZA 3O2MA 4QMYA 3HV5A 3KK8A 3G6GA 2W9ZB 4JT3A 4M68A 4O38A 4XNEA 2VNYA 3LXKA 3BU6A 3DKCA 5E8ZA 4R77A 2PSQA 4Q9ZA 1YWRA 3PVBA 5AR8A 4MKCA 5FDXA 2XCKA 2GS2A 2B7AA 5L6WL 2XS0A 5FWKK 3TZMA 2I6LA 5EFQA 4AN2A 4AW2A 4BWPA 3EL8A 2ERKA 2QR8A 3QLGA 3JS2A 3HDNA 1O9UA 4A9SA 4ZMEA 4EOMA 4A07A 2B9IA 4D1ZA 5AR7A 4JDHA 5LWMA 2XRUA 3D0EA 3KRWA 5KMOA 1GIIA 1P14A 3PVUA 3OT8A 4QMXA 3OCGA 5LVNA 5A54A 3U6HA 5H8GA 5IA5A 1XH4A 4Q5EA 1MQ4A 3ZMMA 3KGAA 2R3IA 2JAMA 4LUDA 2HYYA 3R28A 1VEBA 4F99A 3UPZA 2E9VA 1WVYA 4DAWA 4KSQA 1T46A 5JZNA 4E20A 4AZSA 5GZ9A 5FDPA 4GW8A 4YO6A 2XIKA 4FKTA 4IADA 3U9CA 4PQNA 3LOKA 5AIKA 4FKLA 4F0GA 5J9ZA 5IQEA 3G5DA 4IC8A 4FTQA 3ZEWA 2HAKA 3R9DA 5KZ0A 2DWBA 4FV2A 3W16A 4LG4A 4BC6A 4TYHB 3OP5A 5CEKA 4FT5A 1BL7A 5K0KA 4K2RA 3DB8A 5EQEA 4DTAA 1YRPA 2VTIA 1LP4A 4L3LA 3ZBXA 3CBLA 2WMXA 5LCKA 1OUKA 4KSPA 1LR4A 5AR2A 2G1TA 2HY81 4N4SA 3U87A 2REIA 1NXKA 1Q8YA 2P2HA 4ACCA 4C37A 4BKYA 5HG8A 4O7YA 3K3JA 4FL1A 3D2KA 3KB7A 3N4UA 3FZ1A 1Z57A 3GU5A 3WF5A 4KKEA 5CSHA 5GJDA 4HCTA 4GH2A 4R1YA 3UC4A 4RFZA 3SV0A 4FNZA 1HOWA 2PZIA 4MYGA 4WO5A 1UV5A 4MF1A 4AXAA 5KKRB 1JKTA 4MWHA 2RIOA 4FSYA 1IAHA 4DEDA 4Z3VA 2OG8A 2VUWA 5BQ0A 4DH7A 5CU0A 4YZ9A 3OS3A 4F7JA 4JQEA 5ITAA 4IAFA 3QD0A 3VVHA 2VO7A 2YZAA 3Q96A 2ETMA 4O6LA 4Y85A 3LAUA 5BUJA 2X8IA 4RIXB 4G16A 3UIMA 2PYWA 4RBLA 2ZYBA 3P1AA 4B9DA 2QOIA 4RMZA 4YTHA 2GS7A 4EONA 3A99A 3VQUA 2F7XE 3FLSA 1YI6A 4FT3A 3H4JA 5E8TA 4BCOA 3BE9A 4YLLA 5AAGA 1OB3A 3K54A 4AS0A 1JWHA 5CNNA 5ICPA 2EXCX 3QWJA 4UWBA 1BI8A 5T6KA 3KMUA 2QOOA 1OPJA 4ENXA 1YW2A 3KY2A 4QMOA 4KB8A 5J5SA 4DT9A 3ZUUA 4BDHA 2VO3A 2QO2A 4NTSA 3CGFA 4X3FC 5IUIA 4AACA 2J5FA 2J7TA 4FVPA 4AZTA 2PUPA 2VWWA 4AGDA 4O7NA 4G3GA 4CSVA 2EVAA 3BLRA 4XBRA 4V0GA 3ZZEA 3LMIA 2GNJA 4QP7A 3QXPA 4MAOA 3MS9A 5H2UA 2AC3A 2OWBA 2XK4A 3Q4ZA 4RQKA 2YM6A 4FI1A 5HKMA 1Q5KA 3IONA 3DK3A 4O0VA 3BGQA 4FKQA 3LM5A 4FTNA 4O0YA 4U3ZA 4O82A 2YM4A 3MY0A 4Y72A 4FUXA 2WMVA 4BHZA 1IA9A 1XH6A 3OZ6A 1OITA 4NJDA 4LI5A 4RC2A 5J7BA 3EB0A 3PXKA 4MNEB 5HTBA 4E4NA 2OJGA 2QO7A 5LJJA 3II5A 4U8ZA 4XYFA 1WMKA 3MB6A 1V0OA 4CZYB 4IZYA 3FWQA 4IWOA 5BUEA 3HYHA 3RK9A 3R7EA 2GU8A 3AMYA 5DFPA 3TCPA 4YTFA 3ZONA 4CLIA 4QO9A 2PE2A 2W1IA 3F7WA 2J51A 3FXXA 4WRSA 3FZOA 2O63A 2WMAA 4CV8A 3C4EA 3QQFA 2QO9A 3KXHA 4BGQA 4LGGA 1ZMUA 3OXZA 5C27A 3LQ8A 5E8VA 4C4HA 2GNFA 4FTKA 4PUZA 5AEPA 5H9BA 3QQGA 3ZOSA 4RVKA 1ZLTA 1MQBA 3V8TA 4G5JA 4DEEA 2PY3A 4KWPA 4RVTA 4YZDA 2BPMA 4HPUE 4EBWA 3AC3A 5DT3A 3C4FA 4F0FA 4OW8A 3A4PA 3VAPA 4CG9A 1PHKA 2GQSA 2XYUA 4WG5A 3GB2A 2EUFB 3FC1X 5CS6A 2XJ1A 1Q3WA 2EWAA 3D5WA 5DRDA 4P5QA 4ZSGA 3BGPA 3HDMA 2QOQA 2WELA 5J9YA 3R02A 2O64A 2OXXA 2IVSA 3CS9A 3I60A 4W8DA 5CT0A 5E8UA 4ZSJA 4E6QA 3BLHA 4GVJA 4DG2E 4EQUA 2GHLA 3KN6A 3E93A 3PXRA 4HOKA 5FLFA 1OBDA 3DXPA 1XQZA 1O6YA 3LFEA 4R78A 3KK9A 4WHZA 5L4QA 4IAYA 1WBOA 3KMMA 5BYLA 2E9OA 4YPSA 1CDKA 3LQ5A 4FG8A 4XOYA 3AT3A 4IEBA 3O50A 4BCPA 3JVSA 5AUTA 2R3RA 3W10A 5BVWA 2FSOX 2OKRA 2W1FA 3P23A 3VN9A 4AN3A 3LFFA 3RBWA 3F3VA 1PXOA 2VRXA 3R04A 4J8NA 4EK4A 3EYGA 2WTVA 4FG7A 3W18A 4AGCA 4CMUA 2Z02A 4APPA 3DY7A 5AV1A 1T45A 5HLPA 4JBOA 4GL9A 4QTEA 1W83A 5IQDA 3V5WA 3WZKA 2X39A 3VC4A 3EQFA 3VS2A 5J9LA 2YFXA 3WOWA 1OIUA 3EQHA 4L6QA 4NM7A 4YLKA 3MI9A 4QPSA 3TM0A 2PMLX 3ANRA 3VULA 3R7OA 4F6UA 2C6IA 4O7TA 2YIWA 2C6LA 2W17A 3BELA 3CC6A 4MXZA 2FSMX 4IVBA 4QMTA 3TZ7A 4AWIA 4BKJA 2GFCA 3BEGA 3PY0A 4OTQA 2OIQA 4C3PA 3FDNA 3KC3A 5IQIA 5HE3A 4ZZMA 4BL1A 2QURA 3WI6A 1PXKA 3COHA 1GAGA 4F4PA 5FP6A 4EHZA 2YIXA 4CFWA 3P7CA 4YZCA 2CCHA 2W1DA 5AR3A 3KREA 5BX0A 4U44A 4ZY6A 2C0TA 2VTMA 3R2BA 3QRJA 5CEIA 2W06A 3LM0A 3ZXTA 3W1FA 3NIEA 1DI8A 3MYGA 4J95A 4W4XA 3TACA 3UQCA 4FKRA 3F5UA 3GCSA 1UA2A 3PA4A 4W9WA 4AX8A 4EEVA 2GNHA 4YC8A 5CEQA 4C57A 4W9XA 3PYYA 3WIGA 3ANQA 1B39A 2WXVA 3NR9A 3DAJA 3LFDA 3PVWA 3QLFA 4OLIA 4K77A 5TOZA 4ACGA 3P08A 3LE6A 4MTAA 3SW4A 3RK5A 4FKVA 5HVJA 2XNOA 4EWHA 4CKRA 2CKQA 2FSLX 2O0UA 3CTQA 5ACKA 5CQUA 4OAVB 2V7OA 5TF9A 3HECA 5LVMA 5E7RA 4TW9A 5ANOA 3UNZA 5JT2A 3G0FA 2HXLA 3NUPA 2OK1A 5J95A 4CYJA 2WTKB 1E1XA 2XP2A 3KULA 1H08A 4PDPA 4G34A 3HMIA 3B2TA 4QPAA 5E8WA 2GNGA 3UOHA 4ARKA 2WU6A 2JD5A 2I0VA 4KUJA 4ZMFA 3NMUF 1REJA 2QOBA 4FIGA 4D0WA 4E1ZA 3LMHA 3R8UA 3V5LA 4JQ8A 1CM8A 3VQHA 1KE7A 5JFWA 4E6DA 1ZWSA 2QC6A 3QZIA 3R83A 3NGAA 3V8WA 3HV7A 1MP8A 1YOLA 4BDBA 2W05A 3FZRA 4E4MA 3R6XA 4FR4A 5EDQA 2VWVA 3SC1A 4BDAA 1WBNA 4FKOA 4IAAA 2HZ0A 5M53A 3C7QA 2CNVA 4ZJIA 3O8UA 5K3YA 2C3LA 1XBAA 2WQMA 2XBJA 2VX0A 5KNJA 3QUEA 2JIVA 3QQHA 2Y9QA 4FIIA 2QLUA 3FKNA 4BZDA 1ZYJA 2PK9A 5HCZA 2PWLA 2YLFA 3DBDA 2W4JA 2UZEA 4UN0C 3QRUA 4TXCA 3ORTA 4S32A 3GC7A 3FC2A 1KV1A 1UU8A 3GOKA 3E5AA 4YC6A 2F2CB 2W99B 4H3BA 2X7OA 2CPKE 3LPBA 2A4LA 1OZ1A 3RZBA 4L42A 3EN5A 2VGOA 4MD7E 3QTSA 4FYOA 2XUUA 4QTAA 3MN3A 4XG2A 5D11A 5IEVA 4DE4A 1OKVA 4YBKA 5CZIA 4L00A 2C30A 1OBGA 2F4JA 2EB2A 3LLTA 2WMQA 2Z7QA 5EM6A 4ZLOA 5BVEA 2UVYA 4NTTA 4DINA 4AZEA 3CXWA 3L9NA 2GTMA 2C3IB 2PE1A 4E6AA 4C36A 2WMTA 2V62A 5LQFA 1OM1A 3CD3A 3WARA 4QTBA 4IB1A 3V8SA 3MTFA 2G2FA 2CMWA 4O1PA 3A2CA 3GFEA 4OT6A 2C6TA 3OHTA 1KE9A 2QKWB 2Y4IC 4S31A 3NX8A 4CXAA 3GU4A 4NM0A 2I0HA 3V3VA 4KA3A 2ITZA 3HV3A 3R9HA 5A6NA 5BMMA 3AT2A 3I6WA 5LCJA 4H36A 4FA2A 4RIWA 5EM5A 2CN5A 4RIYA 4TWPA 5AIRA 3R7GA 4HYIA 1JKSA 3BV2A 5DT0A 2JKQA 3VUIA 3NYNA 3Q5ZA 3B2WA 2X1NA 5CF8A 3KMWA 4FVRA 4N6ZA 3E7VA 4QMMA 4U42A 4FTRA 4GRBA 3I7CA 1WFCA 2EXEA 5DI1A 3DLSA 4C38A 3FLYA 5JZJA 4GYIA 5IH6A 4FTAA 3BPRA 3LFSA 5FBNC 5CI7A 5KMLA 5IUGA 3LXLA 1GNGA 2CGUA 3EL7A 1YHSA 2HOGA 4IC7A 3AGLA 2IJMA 3R0TA 3R30A 3VRYA 4C4EA 2GNIA 4F9CA 5JGAA 1QL6A 1STCE 2ITVA 3L8SA 1NA7A 2FA2A 4I6HA 4O0SA 1V0BA 3ZXZA 2B9HA 3CPBA 2QNJA 3GP0A 1IA8A 5D7VA 1UWHA 3FPQA 4WKQA 2C69A 3IKAA 4ASXA 2X9EA 1E1VA 3KF4A 3RMFA 3RVGA 3F6XA 3R9RA 2LGCA 4BDIA 4J98A 3PDTA 5CENA 4AN9A 4IAIA 4FUYA 5LWNA 3A62A 2XK6A 3C0IA 3MV5A 3PJ3A 1SYKA 3I6UA 4JLCA 3KRLA 3FUPA 1O6LA 2NPQA 3OF0A 5EDRA 4YMJA 5DR6A 5HTIA 1ZY4A 4BCQA 3QTUA 2O8YA 3EN9A 4FZDB 2HIWA 3I0OA 2BZIB 2VTQA 5D7AA 3CP9A 4M12A 4NW5A 4AUAA 3QRIA 4LRKA 5A9UA 1RDQE 3OUNB 4QOXA 3CKWA 1KSWA 3CY3A 5LVOA 4IB3A 3QTQA 4M0YA 3DV3A 2E9PA 4XUFA 5AUVA 5AX3A 4JVGA 2VTTA 1Y57A 5CT7A 4MXOA 3FQSA 4YJVA 3ETAA 5HNBA 1ZMWA 3A7JA 5EI6A 3ZHPC 5KBQA 4AZFA 2Z60A 1DAYA 3Q53A 3VUTA 2J0LA 1F0QA 2W9FB 1KOAA 3P9JA 4JL9A 3QX2A 5EW9A 3TG1A 2IW6A 2OLCA 1Q41A 2ZDUA 4QNAA 3RPYA 5FUTA 4ZLZA 3ZRLA 3SXSA 2R2PA 3TNQB 4AW1A 1CSNA 1OIRA 4ACMA 3KXZA 4G5PA 5E1EA 2XIXA 4BCFA 4CQGA 4D5HA 4TPTA 3TL8A 2PTKA 2JFLA 4FGRA 5B0XA 2RGPA 4R3CA 4ANSA 3L9MA 2ZV8A 3GQIA 4RC4A 4EQMA 5HBJA 1CMKE 2YA9A 4ANLA 3BBTB 4BBMA 4BICA 3GUBA 3AC4A 3DNEA 4GVAA 3RNIA 4DFBA 5M4CA 5JFXA 2B53A 3KKVA 3Q6WA 4J7BA 4G6LA 5C8KA 3F66A 2QOLA 3NYOA 3OXTA 3IW7A 3FSKA 5B7VA 1PY5A 2F57A 5CZHA 1M52A 1WVXA 3B8QA 4Z7HA 2J2IB 5IQGA 4QMNA 3RPRA 4MQ1A 3L8VA 4QQTA 2E2BA 4L9IA 4CD0A 4PWNA 3EN4A 1URWA 4MBJA 4YJUA 4GU9A 5EG3A 4E3CA 4ITHA 2HELA 4F9YA 4XP2A 3EFKA 3R73A 4MCVA 5EW8A 3NDMA 5HG7A 1PMEA 3DGKA 4FEUA 2BRNA 3KVXA 3OCSA 5HO7A 5A46A 4QYYA 3EKNA 3MJ1A 4TKSA 4ORKA 4D4SA 5I3OA 3W2CA 3P0MA 3SAYA 4AOIA 4ZAUA 2WD1A 2FGIA 4IANA 2JKKA 1XKKA 2OZAA 3KQ7A 3RP9A 4AFJA 5M4UA 4D4RA 3Q04A 5ETCA 4ZZNA 4WUNA 2UVXA 4DLIA 3UNKA 4W4WA 3RM6A 3PIYA 4GS6A 4L3JA 3FLNC 4ZSLA 2BALA 2YDIA 4GCJA 4C59A 4FVQA 2B54A 4NFMA 5EM8A 1Q3DA 4ALWA 2ZM3A 2W96B 4OTGA 4XLVA 1EH4A 2KULA 4KS7A 3DDQA 3NSZA 4WSQA 4IM3A 1R3CA 4IW0A 4FF8A 3PY1A 1AGWA 3FI8A 4NIFB 5M57A 2OFVA 3R22A 1LEWA 4IZ7A 5CF4A 4HVHA 1UVRA 3W33A 3MY5A 4N57A 3RNYA 2UZDA 4PNKA 4RVLA 4EUUA 3ZC6A 2XB7A 3MA3A 4ID7A 4MK0A 1F3MC 3PSBA 1FGIA 4RJ8A 3PFQA 1PW2A 5AX9A 2VO6A 3MW1A 3NAXA 4NM3A 1Q62A 4DTBA 2UW0A 4KD1A 3WE4A 1B6CB 4QPMA 3TJDA 2CDZA 4FV9A 4L52A 4QYGA 3OWPA 4CRSA 5CX9A 4IVCA 4B8MA 1BUHA 4NU1A 3DZOA 3E8EA 4QQCA 2JGZA 1ZOEA 5AV3A 2XIRA 3WYXA 3TUBA 5GIOE 3SQQA 4USDA 3BHYA 3ORNA 5C26A 3PWYA 4BGGA 2C6MA 2WTIA 3F5PA 3OFMA 3I79A 4FZFB 4XG3A 4X2FA 2YHVA 3G51A 3OBGA 1YXVA 3ZUVA 4U80A 3R8PA 4BCJA 3NIZA 3VS5A 3ZDUA 1BI7A 4G3CA 3KCFA 4I22A 1BL6A 4USFA 3PG1A 1HCKA 2BAQA 4DCEA 3U8WA 5C01A 4FTIA 4GG7A 5KHWA 4MVFA 4AT3A 1M2RA 5EDPA 3IDCA 4C35A 3CTHA 3TI1A 2C68A 3CD8A 4YJNA 3MIYA 5CSXA 2QQ7A 4JDKA 4D2PA 2VTOA 2A1AB 2J6MA 4E7WA 1M17A 3PVGA 1M7NA 2UZWE 4O7VA 4YSMA 4C7TA 2ESMA 3WF7A 3F3TA 5DPVA 4DFNA 3U55A 1YXTA 4KNBA 1GIHA 4Y95A 4FSUA 1H25A 5DA3A 3TEIA 4LOOA 4B7TA 4B8LA 5CXZA 2NNWB 3CJGA 3QHRA 2VAGA 3ZC5A 5HNIX 4DEAA 5HE1A 5ANDA 5C1QB 2GMXA 1JKKA 4RVMA 4EJ7A 5KZIA 2QODA 3BU3A 3DS6A 2E9NA 2R3PA 3KEXA 5D9HA 4ALVA 1DM2A 3I0QA 3PE2A 3PA3A 3OWLA 1REKA 2WTCA 3EFLA 2YZLA 5AUWA 5J1WA 4DCAA 3ULZA 1U54A 3EKKA 4FKIA 2VX3A 4EOSA 4M8TA 5GIPE 1UU9A 2H9VA 3OOGA 1OI9A 5BVFA 2VWUA 1W84A 3F69A 4TYIA 5CY3A 4QP6A 4LGHA 4U5JA 4ZEGA 2C5YA 4U40A 2A27A 2R3QA 4RWKA 3D94A 4UEUA 4GFOA 4NL0A 5IA0A 4XS2A 4YJTA 2WIPA 4AP7A 5DE2A 4CMOA 4G2FA 2UZLA 4XJ0A 4UWCA 3FLWA 4M97A 1PYEA 4F6SA 5EQYA 5CVHA 4L8MA 3GQLA 3LIJA 3KVWA 1PXNA 2QU5A 2VV9A 4HVGA 1NVSA 3AC5A 3CQEA 4BI1A 2ZM4A 3PPZA 5A4QA 3EJ1A 4UALA 4JOAA 4HW7A 3VUDA 3VWAA 2BAJA 4G9RA 4I5HA 4A7CA 4LYNA 1GIJA 5AR5A 4C3FA 4NT4A 5A14A 1H24A 2X0GA 3A7FA 4HCVA 2QD9A 4GFGA 4M67A 2JFMA 2W4OA 4XV3A 2HZ4A 1YXUA 3VS0A 4J52A 5HHWA 3V01A 4F1OA 1QCFA 3EHAA 1G3NA 1YDRE 2C6EA 3NNWA 4GFMA 5DLSA 3ACKA 5DYJA 5C4LA 4U6RA 4X3FA 4FEXA 3HA6A 3U6IA 3BU5A 4WG4A 2R3MA 3G15A 2WOUA 4RJ5A 3S95A 4AE9A 2G2HA 3AT4A 4HGLA 1Q99A 3PSDA 3R1SA 3R71A 1PMUA 4XG7A 4BIDA 4C4IA 3KRXA 3TDWA 4FV5A 5I5ZA 2UZNA 5FTOA 3S00A 4IJPA 2H6DA 4O0RA 2QCSA 2BHEA 5AP7A 3I7BA 4C2VA 4R5SA 3BHHA 3FI4A 3WF8A 3JUHA 3PXZA 4BIEA 4DN5A 4UMRA 4CT1A 5F20A 4QYFA 3R7UA 2PZPA 4DGNA 3F3WA 4J99A 3OY1A 2ZAZA 4FYNA 4UZDA 2CGVA 2ITNA 4CQEA 3QYZA 3FAAA 4BZOA 3SG8A 2UW9A 3M2WA 5LOHA 4XRLA 4RA5A 5GJFA 1SM2A 1H28A 4BDEA 4EH3A 3UQGA 5JH6A 3V5TA 3EWHA 3RPOA 3DDPA 5IF1A 5CI6A 2BZHB 4EQCA 4MF0A 2PVYA 5DR9A 1XJDA 4AE6A 5TKDA 4PTCA 5FGKA 3UZTA 2F9GA 5KX8A 3PLAE 4HNIA 4G3DA 2CKEA 1KE5A 4RFMA 3IS5A 1UNGA 3QAME 3SG9A 3T9IA 3ZM4A 4TTHB 4NJ3A 4TWCA 3OROA 4I93A 2EB3A 2OIDA 4DITA 3FMHA 5T68A 2PUIA 4L43A 2VTNA 5LMAA 3LMGA 5K0XA 3EYHA 4RSSA 2C0IA 3OW4A 3PXYA 3CR0A 2G01A 5CSVA 5M55A 2XVDA 3UC3A 3KU2A 2HXQA 3VNTA 3ZEPA 2R0UA 4XG8A 3V04A 3OVVA 2XNGA 3UG2A 4C62A 3CKXA 2R3OA 1OIYA 1ZRZA 3GCPA 2BKKA 2UW5A 4TY1A 4NYEA 4F9AA 4KINA 3VBYA 5AP5A 4Y83A 4GV1A 2XEZA 3BI6A 4BDKA 1L3RE 3D7TB 4YP8A 4MX9A 3DU8A 4O27B 2X4FA 2X2KA 3ZLXA 3SOAA 3ET7A 5DHJA 2W5HA 4GK2A 3RWQA 2Z7LA 4EOPA 4GJ3A 3HVCA 4PTEA 1OPKA 4RA4A 3VBXA 4FKWA 4FG9A 3HUBA 2BDWA 1QPEA 2OJJA 2XNMA 2JKMA 4IQ6A 4WG3A 2X9FA 2WTDA 4FOBA 4JDIA 4QYHA 3ZZWA 2PMNX 3LJ1A 4K1BA 1P4OA 3QXOA 4X2KA 2G15A 5AM7A 4F63A 1PYXA 1WBTA 4RJ4A 1XH9A 2YJRA 5FQDC 1JLUE 3GCQA 2V0DA 4GMYA 3HX4A 2LAVA 4BI2A 2HZNA 1URCA 4MH7A 3UZRA 2ERZE 4J53A 2ZV7A 1QPJA 5CU4A 4LV8A 5EHLA 3UP2A 4EJNA 3F9NA 4NKAA 2C6DA 3EQDA 4PRJA 3V51A 4MBLA 4GIHA 2JKOA 3TNHA 2P2IA 3PIXA 3NCGA 3CPCA 4GEOA 4EH9A 3SHEA 3S3IA 2CGWA 2IZUA 5CNOA 3OWKA 2KTYA 4IFCA 3GU6A 5BVKA 2ITOA 4F09A 5CANA 3FYJX 4IDTA 4KIOA 5KE0A 3OY3A 3R8LA 4AOJA 1TQMA 5EYCA 5JGBA 4DEBA 5DWRA 3RAHA 4EC8A 5L8JA 4HPTE 5FEEA 2W1GA 3JVRA 2XNEA 4O0WA 3HA8A 4XEYA 1Q8WA 3NUXA 3TXOA 3E62A 2BZJA 3ZLWA 5HIDA 3TDVA 5HD4A 1ZY5A 4I1ZA 4QQ5A 2F2UA 4JQ7A 4D1SA 5C4KA 4UY9A 2WQNA 4BCKA 4EYMA 3RKBA 3TIYA 3DKGA 5FEQA 3NLBA 5B2MA 3ENMA 3P5KA 2WB8A 3DXNA 3BLQA 3OBJA 4RWLA 2OSCA 4QTCA 4YU2A 4IZ5A 2RFEA 3NYXA 2BCJA 3EFWA 5F4NA 4PPBA 5IQBA 2RFDA 3SW7A 5DN3A 4R7BA 3W2QA 3QX4A 5DEYA 2UZVA 4FK3A 4QRCA 5CAPA 2C5OA 4X6RA 1BYGA 4CMTA 2UW7A 3Q4UA 1JPAA 4PMPA 1ZYCA 2ITWA 3VUHA 2W5AA 5AMNA 2BFXA 3Q3BA 4YUQA 3UOLA 3ZO1A 4FTLA 4JAIA 3QQLA 4EZ3A 2HWPA 3BEAA 5LVLA 1CKJA 2R9SA 4FOCA 5BMSA 4FIHA 2I7QA 3OEFX 4BBEA 1RJBA 4I94A 3CSVA 3OEZA 3MFUA 3ZYAA 2HWOA 1BKXA 1YDTE 2PMIA 3PSCA 4C34A 4E4XA 2YDJA 4HNFA 3P79A 1K9AA 1H00A 3MVJA 3UE4A 1NT2A 4TNBA 3Q2MA 2W0JA 1WBSA 5FTQA 2WMSA 4YO4A 5E90A 5HICA 4XG6A 3L9PA 4BCMA 3NUYA 4FSQA 4B99A 5JEBA 2BR1A 3NS9A 2OBJA 5C8MA 5D10A 3EQIA 3ROCA 4DHFA 2QG7A 2ITYA 5E92A 2B0QA 3A7HA 4MD8E 4TRLA 4AAAA 4JNWA 5J87A 5AA9A 3ZM9A 4PPAA 2OZOA 5K4JA 5KCVA 2OW3A 3FY2A 4FV8A 4HGSA 3AC2A 2ITPA 1A9UA 2J90A 4PTGA 5HORA 1TKIA 4EHVA 3DA6A 4E4LA 3NWWA 1YWVA 1GZ8A 4WIHA 5EKOA 4FSMA 4FK6A 2FSTX 4GT3A 5EH0A 3UO6A 2BTRA 3ZU7A 4BN1A 4D9UA 5K5XA 3DT1A 2GDOA 2GTNA 2PVLA 4IXPA 3R9NA 2OXDA 5CLPA 3EQRA 3VBQA 5I9WA 3O7LD 2WQOA 5IH5A 3MBLA 2JIIA 4FSNA 4ERKA 4AA0A 1XH7A 2G9XA 2R3LA 3BRBA 4ZS0A 4KIKB 3LQ3A 5TO8A 3MA6A 3A7GA 4TYGA 3QKKA 1JSUA 4PMSA 2PZRA 3RALA 2NP8A 3Q52A 4H39A 2XIZA 3WZEA 2V5QA 2HZIA 3WZJA 4TL0A 2XH5A 3HMNA 4NSTA 4GKHA 1J1CA 2I0EA 2V55A 3LJ2A 2A0CX 3PE1A 4I20A 4QP9A 3F5XA 3Q4TA 4QTDA 4A4OA 3PWDA 1A48A 2QKRA 2W1ZA 3ZSIA 1H1PA 1OL1A 2XJ0A 3NW5A 3R8MA 4PDSA 2QLQA 1KE6A 4BBFA 4C8BA 4YNEA 4BIBA 3AD4A 4EH2A 3BHVA 2IZRA 2X2MA 2YLEA 3ORPA 2DYLA 1YI3A 2ZV2A 1YWNA 3QBNA 3TV6A 5CAVA 2R3JA 4C3RA 5AUYA 3UBDA 1OL7A 4FBXA 4OTWA 4XV1A 2HENA 2Q83A 4XG4A 3QZGA 3FL4A 3D83A 2R7IA 2YISA 3E88A 4M69B 4CFVA 2PVFA 4JG6A 5IPJA 2GS6A 2UZBA 3RZFA 3TKHA 4EC9A 5I9ZA 3E87A 3ZLSA 5IDPA 1JKLA 5IMEA 3ODYX 4KABA 3VS6A 5HU9A 3QFVA 4U7ZA 5DH3A 5AWMA 5CF5A 3CQWA 2O5KA 3QCQA 4FMQA 3PP0A 4RIXA 4IDVA 3KCKA 2FH9A 4PMMA 1OECA 4EOJA 4O83A 1FINA 2CJMA 2OXYA 3C50A 2YCRA 4AF3A 3ELJA 3F2RA 1UNHA 3MPAA 3QD4A 1PKDA 2BUJA 4O1OA 4QMLA 4PX6A 3E7OA 5EW3A 3T3VA 4FC0A 3PJCA 4CT2A 3K5VA 3TZ9A 3UP7A 5DBXA 1Q97A 3HEGA 4WBOA 5HE0A 4FIEA 2B4SB 3RAKA 4FNYA 4FT9A 1P4FA 2XEYA 3FBVA 2DUVA 4IE9A 4IVAA 4K11A 4K8AA 4BDGA 4O0UA 3QU0A 1APME 2YIYA 3DLZA 4BRXA 4FEQA 2GHMA 1PF8A 3R1NA 4I6FA 1PJKA 3FLQA 4I6QA 1GOLA 4FX3A 4S34A 4YZNA 5KMKA 3ULIA 4ERWA 5HZNA 5A6OA 1UWJA 2YEXA 4BWXA 3O96A 2QOHA 1R39A 2XA4A 3G33A 3PY3A 3QA0A 2WTJA 2VZ6A 4UXQA 4ZZOA 5IEYA 4F64A 3VF9A 2OH0E 5HESA 3FZTA 4EOIA 2R5TA 2XCHA 2XK7A 4YLJA 2PZ5A 4FODA 4O91A 3EIDA 4FL3A 2I0YA 4I5MA 2HK5A 4CCUA 5JQ8A 3FJQE 4A9RA 4X7QA 5HX8A 3SRVB 5EI2A 2PZYA 3QYWA 4JG7A 4NUSA 4P2KA 2A2AA 1BMKA 4FKUA 4A9UA 4D58A 3GOPA 3VHKA 5HIEA 1H01A 2GSFA 4MNEA 3CE3A 3C5UA 4CEGA 3D14A 4E5AX 3BCEA 3HP5A 4AZVA 4EH5A 3NUUA 2Y6OA 1W98A 3BE2A 4E6CA 3TV4A 4FV1A 3VJNA 3FQEA 5L2QA 5FG8A 3DB6A 4ZY4A 1RQQA 3UQFA 3KL8A 1YXXA 5D12A 3UJGA 2YM7A 4MEDA 5BVOA 2O65A 2BHHA 5G1XA 4D5KA 5CAOA 2XJ2A 3O8PA 1VZOA 2IWIA 2JDSA 2XK9A 4AT4A 2B1PA 4XV9A 5KKRC 4QMPA 2VD5A 4FZ6A 4R8QA 2WOTA 3D9VA 1H1RA 2OO8X 4V05A 3MH0A 5AR4A 5GZ8A 4FE2A 3IK3A 2C0OA 2IZTA 4I0SA 3EQGA 1ERKA 2PVMA 3LXPA 4M84A 4RX9A 3R00A 2PL0A 3KN5A 1FVVA 2WFYA 4PY1A 4UYNA 2Z8CA 5TE0A 3G90X 2OGVA 3F7ZA 3TNPC 1ZAOA 4YJSA 4L44A 2J0IA 1YDSE 1W8CA 3KXGA 3I5ZA 1OVEA 4FIJA 3VUMA 4CZUA 3IDPA 4EKLA 3HL7A 3IQ7A 3MFRA 2ITQA 3OC1A 4WSYA 3WF9A 2UV2A 4FT0A 3FI2A 4IHPA 4ENYA 2E9UA 3HAMA 3O8TA 3BGZA 2YN8A 4JG8A 5FXQA 5GZAA 4K6ZA 2C1BA 4AGWA 5K4IA 4HYHA 1Y8GA 4AU8A 4FTUA 5CAQA 3SD0A 1ZMVA 3O23A 4QMZA 5CF6A 3PLSA 5LXMA 4WUAA 3VUKA 5HG9A 4DH5A 4CVAA 3R63A 4BDJA 2BKZA 4ZTRA 2RF9A 2C5VA 1SVEA 4E93A 4DGOA 3MFTA 1OKWA 4I23A 3AXWA 1PXLA 3E8DA 5E8YA 1RW8A 2WTWA 4HYUA 3T3UA 2J0MB 1X8BA 2VU3A 1ZZ2A 2YIRA 3R21A 4JBVA 3WIKA 3QALE 5HQ0A 3Q5IA 3GGFA 2X6DA 3UVQA 5IA4A 5KMIA 1PKGA 3EZRA 4WBBB 2QHNA 3OD6X 4J97A 4QYEA 1JQHA 3KXMA 4RIOA 4AW5A 4YTIA 4B4LA 4LMNA 4BCIA 1WBPA 3BX5A 3LCSA 5JRSA 4EOLA 4YR8A 4ANNA 4IBMA 5HU3A 3F61A 3DJ6A 5B2LA 5F9EA 4U97A 3TTIA 2C47A 4IWQA 3DTCA 2R3NA 4BB4A 4BYJA 3NUNA 4TN6A 5KMMA 5IQCA 5HVYA 2FB8A 2O2UA 3FLZA 1KV2A 4RQVA 3UNJA 3JY0A 3QD2B 4JDJA 5DNRA 4IB5A 2QG5A 2X8EA 3JY9A 2ZM1A 2CCIA 4EKKA 4XV2A 2XNNA 3BYUA 3JR1A 2PMOX 2DQ7X 2JAVA 4LGDA 3RJCA 3KFAA 4D1XA 4CKIA 5LMKC 2R3GA 2HW6A 3IW4A 3JXWA 5AUXA 4H1MA 3IW8A 3NRMA 3QQUA 3O0GA 3Q60A 4MD9E 3ZFXA 4IACA 3ZSHA 3DAKA 5DR2A 4RX5A 5KMNA 3M42A 2BFYA 2X2LA 4BWKA 4ZSEA 3TT0A 4F0IA 3HV4A 3P78A 5I9UA 3UO4A 4WNKA 3UIXA 3UYSA 2RL5A 3FZPA 4GU6A 4JRNA 3VBTA 1J7IA 2PVRA 2ZJWA 4YZBA 1QPCA 3W55A 5E8SA 4BDCA 1OL6A 2CLQA 3COMA 3QC9A 3RM7A 5J1VA 3E8NA 2VWYA 3KXXA 4YBJA 3RINA 3BYVA 5CU6A 3FKOA 3FHIA 5HLNA 4ZIMA 4C02A 4ZP5A 4GK4A 4D9TA 4M13A 4PL5A 4WT6A 3P7AA 5B2KA 3FQHA 2BIKB 1IAJA 3NCZA 3TNIA 1YHWA 4L01A 4YPDA 3PG3A 4JIKA 4FEVA 3LFQA 3TNWA 2JBPA 2IO6A 2VN9A 3MVHA 3C4WA 4OTFA 4OTPA 4IM2A 3QF9A 3IDBA 1H07A 3LCDA 3PJ8A 5DOSA 4JX3A 4CCBA 1H26A 3SKCA 4AFEA 3F3UA 4RJ3A 3TKUA 2BRGA 4BTMA 2W7XA 1J3HA 2WGJA 3AOXA 3A60A 3A61A 3FMJA 1UU7A 4HGEA 4A9TA 3VJOA 5ANGA 3OCTA 1ZYLA 3OMVA 3UPXA 1PRYA 3VW8A 4C33A 5IZFA 4QP8A 4I0RA 4JIAA 3BZ3A 2ACXA 3ZRKA 4YZMA 4QMVA 3E3PA 5DGZA 3O17A 4BY9E 1Q4LA 3CTJA 4DC2A 5L8LA 3LFCA 4FT7A 3K2LA 4G3FA 3COKA 5BUIA 2OF4A 3FMDA 5HGIA 2R0IA 2YM8A 3Q6UA 3L8XA 3R1YA 4BTKA 3COIA 4YSJA 2PVNA 3NNUA 4PMTA 2XMYA 4EI4A 3G2FA 3GNIB 1AD5A 3NZ0A 4LM5A 4G17A 1IG1A 1OL2A 2F7ZE 2ZMDA 4ASDA 5FP5A 4ZTLA 5M44A 3QRTA 3SX9A 3TIZA 1PXPA 1SVHA 2B55A 2QI8A 3R1QA 4D55A 4DH1A 4OAUC 4BDFA 1V0PA 1FQ1B 3F82A 4ZS4A 3UODA 4NK9A 2QHMA 4IWPA 3EOCA 4FZ7A 4FV4A 4F70A 5ETIA 4O6EA 4EWQA 2X4ZA 3GU7A 4MXYA 4P90A 2IVUA 5EYMA 3ORXA 3MDYA 1Z9XA 3E63A 3TUDA 2Z2WA 3BQCA 3C0HA 2QOFA 3MY1A 3N9XA 4KBAA 4N0SA 5E8XA 4V0GB 5A4CA 5M08A 2H96A 4EOQA 1P5EA 4DYMA 3BBWA 1JSTA 1Y6AA 2ZDTA 3KRRA 3UTOA 4C4FA 5LMBA 2OH4A 4BFMA 3HRFA 1OKYA 2IW9A 1K2PA 1TVOA 3E3BX 4OR5A 4O81A 4ZTQA 2IVTA 1RE8A 2ETRA 1M14A 1UNLA 1W0XC 1W7HA 2EU9A 3D15A 4P4CA 3RAIA 4BVUA 3ATTA 2P55A 2WMBA 3I4BA 2OU7A 4BF2A 2W4KA 2WTKC 3C0GA 5FM3A 2UZUE 1GY3A 4UYAA 4O7ZA 3DBQA 4Z16A 4YHFA 4GJ2A 5DRBA 5AA8A 3HNGA 4KS8A 5ANJA 3GI3A 2J9MA 5E4HA 5IQFA 5CASA 4ASEA 2Z7RA 4S30A 4CFNA 5FRIA 1Y8YA 2OIBA 4ZLYA 4ZOGA 3PJ1A 3MH2A 3DQWA 1Q61A 5M51A 3UO5A 4YURA 2PVHA 3FMEA 3SDJA 2ZVAA 3ZH8A 1IEPA 2VWZA 3I5NA 3RGFA 4Q2AA 4DG0E 4NH1A 3RWPA 2JDVA 5IA2A 4V04A 5AUUA 3GC9A 5C03A 4XG9A 4D28A 4YHTA 1DS5A 2Y0AA 5HO6A 3CCNA 4ZY5A 3IGGA 4L67A 3KRJA 4GUEA 4F7SA 4M15A 3W2RA 3ZS5A 4DGMA 3QQKA 3DFCB 5IA3A 3ZO2A 2IZSA 5HBHA 3ZO4A 5IQHA 1Q8ZA 1I09A 3SLSA 5M06A 2QOKA 4IX5A 5F94A 5HVKA 4XOZA 5D1JA 2YERA 4DFZE 3ITZA 3GBZA 2R7BA 5HE2A 5KHXA 3MB7A 3OCBA 4YTCA 4ALUA 4QMSA 2F49A 5CSWA 2AC5A 1FVRA 3VW6A 4DEIA 4Y46A 5FBOA 4MHAA 2C3JA 2RFNA 3PRIA 3QTWA 4EZ7A 3VO3A 5AP0A 4OTIA 2BIYA 3NAYA 4WOVA 5I0BA 1R1WA 4CRLA 3LJ0A 3R01A 5IG1A 4R1VA 3UG1A 2VTSA 4JAJA 4U3YA 3REPA 3LFBA 5AV4A 4H3PA 4NWMA 3FXZA 3ACJA 3DJ7A 3L9LA 4RZWA 5HBEA 4BGHA 4JXFA 5HTCA 1FGKA 2OI4X 3SVVA 5JN2A 4IIRA 4IX4A 5AADA 4A4LA 1W82A 3VIDA 4PV0A 2XM8A 3QD3A 5DG5A 5GNKA 3F88A 2GQRA 4YGAA 3Q2JA 5FEDA 4FTMA 5HI2A 4C4JA 4RLKA 2RKUA 4WNMA 3HMMA 4RWJA 4CFXA 2OFUA 3R7VA 1ZYDA 4TT7A 1XH5A 5EOBA 1DAWA 2GPHA 1WAKA 2YABA 2V22A 1KWPA 5E1SA 3SGCA 3QGYA 3C5IA 2VX1A 1OUYA 3QUPA 4U81A 2X7GA 4O7RA 5CWZA 3IOKA 3LVPA 1VJYA 1UU3A 3GFWA 4UB7A 4AG8A 5H8BA 4UZHA 5L2TA 2C3KA 5KO1A 1XR1A 4IMYA 2YM3A 1JNKA 2JIUA 1XWSA 3G9LX 5CVFA 5IUHA 1L8TA 1J7LA 1GZKA 5K5NA 3NVKI 4R3PA 2UUEA 4ZJJA 4APCA 4EHEA 1J7UA 4G6NA 3ALNA 5DT4A 2BVAA 1HCLA 1ZARA 5ETAA 3DFAA 5JK3A 4U43A 2Z7SA 4XCUA 5CU3A 2Y4IB 5E9EA 3C4CA 5FTGA 5GINE 4XP3A 4FEWA 3U6JA 3PUPA 4OGRA 2X8DA 4PL3A 3LHJA 2GQGA 5FXRA 2X81A 3N4VA 4NKSA 1SZMA 3MPMA 4O84A 2QVSE 4D4YA 5BNJA 3WZDA 2R4BA 4GK3A 3VS1A 4A9YA 4UXLA 4C61A 5AM6A 2JITA 4ASZA 3POOA 3KULB 3V5QA 3UGCA 5AAEA 5EKNA 3RHKA 5BVDA 2JDRA 3O51A 5EYDA 1ATPE 3FPMA 4O21A 5FXSA 1WVWA 4S2ZA 2Y6MA 4DA5A 1U5QA 3B8RA 2RSVA 4NIFA 3V6SA 2BRMA 4GYGA 4TNDA 5KBRA 2OJ9A 3SOCA 3U4UA 4USEA 3P86A 3PRFA 3QTRA 4DBNA 1XBBA 2OICA 5L2IA 5M56A 1LEZA 2GFSA 3ORKA 3MVMA 3Q4CA 4HCUA 3Q32A 4IWDA 4ANMA 3W2PA 2BDFA 3R7IA 1ZZLA 4E5BA 2I40A 2JDTA 2VTRA 3NEWA 3QCYA 3C9WA 4GT4A 2HY0A 3H30A 4KKGA 4RG0A 3AC1A 1FOTA 3C51A 4ZXTA 3U51A 4BKZA 4DGGA 2WEIA 4F1TA 5AV2A 3RI1A 2PVJA 5DVRA 4QP4A 4R7IA 4ZTMA 4Y5QA 4I0TA 4RC3A 3T8OA 5L3AA 3QCSA 4C2WA 3F2AA 4IAKA 4ZSAA 5IH4A 1S9JA 3DK6A 5CALA 4LUEA 3ZFMA 2UZOA 2XKFA 5CAUA 5IEXA 2WHBA 3FY0A 3QC4A 3NW7A 4RX8A 4J71A 3GCVA 2CKOA 2XRWA 5JFSA 4LL0A 1NW1A 3WZUA 4RGJA 4W4YA 5AP3A 3TKIA 3E64A 3Q9WA 4G6OA 3QKLA 2P33A 5LVPA 3DBCA 4DTKA 2WKMA 4U0IA 4JX7A 4EK8A 3LLAA 3DNDA 4BZNA 3DKFA 1JOWB 3QCXA 4FSWA 3MGYA 4GKIA 4L46A 2XF0A 4HVIA 2GHGA 3EQBA 5JRQA 1VR2A 4CFUA 4CKJA 1G8SA 2PUUA 3K3IA 4ONAA 4FGBA 4IAZA 3D5VA 1FBNA 3O7LB 3OW3A 4HVSA 1MRVA 3BWJA 5L2WA 4WA9A 4FKJA 3UOKA 2UVZA 4O2ZA 1PXJA 1R0PA 3GCUA 4KBKA 2I1MA 4RIWB 4U41A 3TUCA 1CTPE 1GJOA 4RIYB 3ORLA 5HX6A 4DEHA 2XKEA 1XHAA 1Y91A 5IDNA 1IR3A 4N6YA 3F3ZA 4CYIA 3PP1A 4LOQA 4M0ZA 2FO0A 3NPCA 4F7LA 1OPLA 2ZMCA 5EK7A 4QMUA 4WD5A 4E73A 2WQEA 4OTDA 5HG5A 4EH7A 2PU8A 2A19B 5LARA 3EFJA 4DH8A 3LCTA 4BCGA 2ITUA 4QMQA 5KUPA 3HRCA 5TR6A 4F08A 1MUOA 3MIAA 1LUFA 5C9CA 2IG7A 4EHGA 3S2PA 3MTLA 3HP2A 3L1SA 3BHUA 3DOGA 4FTJA 2JDOA 4HGTA 4R7HA 4DF3A 2X6EA 4DFYA 2GNLA 3LXNA 4X2NA 4R3RA 5GHVA 4G3EA 4U45A 3OTVA 2AUHA 4FZAB 1TQIA 3EQCA 2YDKA 2WQBA 1H1SA 3MH1A 4P7EA 1YVJA 1H0WA 3ZRMA 3BHTA 2DS1A 1ZYSA 5HO8A 2BRBA 1XH8A 2BROA 2VTAA 3AMAA 3R8VA 4D2WA 4GSBA 4YJOA 2UW8A 3UMXA 2UW4A 3ID6C 4HZRA 4O7LA 4DH3A 4EH6A 3CQUA 3FE3A 1U4DA 1KUTA 3FHRA 3FZSA 4BHNA 2VO0A 5I3RA 2JBOA 2IN6A 1SVGA 3CEKA 3PPKA 1YKRA 3G0EA 1O6KA 3FL5A 4O7WA 4PF4A 3Q9ZA 2YJSA 4AQCA 4OT5A 4EK5A 1SNXA 4FSZA 4PP9A 5HCYA 3LKMA 4MNFA 1QMZA 3LW0A 3T9TA 4XX9A 3UZPA 4Y5HA 4TYHA 5M09A 4I3ZA 1U5RA 4BCNA 3POZA 4X6QC 3UYTA 4DT8A 5JMSA 3HKOA 4O0XA 4W4VA 5L2SA 2C5NA 3BKBA 4EYJA 3W2SA 4QNYA 3C13A 1R0EA 3IG7A 1M2PA 2H34A 1CKPA 4PDOA 2JEDA 1KE8A 3EN7A 3WF6A 1H27A 5EQPA 2GCDA 3QUDA 2IW8A 4UX9A 1PXIA 2XK3A 3A8WA 4EZ5A 2IVVA 3Q9XA 2C6KA 4GG5A 4FTTA 2YAAA 4WNPA 5AAFA 1FMKA 4II5A 3HGKA 3UVPA 2UW6A 2B52A 2ONLA 3GENA 3LCKA 3NNVA 3HAVA 2XYNA 3N4TA 3D5UA 3BYMA 3VS4A 2QU6A 1ZXEA 3IECA 2XNBA 3WYYA 4NZWB 2XNPA 1S9IA 1OGUA 3NNXA 2C1AA 4I5PA 4Z9LA 4KIPA 5ETFA 3R2YA 4P5ZA 2R64A 3BWFA 4HYSA 4Q5HA 4LMUA 3EQPA 2PULA 5A3XA 2C6OA 5I9YA 4GIIA 2YIQA 4JI9A 4XLIA 5D41A 3DCVA 2OF2A 3WE8A 1GZOA 1NY3A 4RT7A 3K5UA 3L8PA 4I4EA 3UIUA 1Q24A 2UZTA 2BAKA 2H8HA 3D7TA 4CLJA 3RPSA 4CZTA 3W32A 4FTCA 3NUSA 5IMXA 3IPHA 1CKIA 5IU2A 5HCXA 3UIBA 3BQRA 3CJFA 2PVKA 2VNWA 3VUGA 4CNHA 4CV9A 2NO3A 3DZQA 4EORA 1PMVA 3OT3A 1SNUA 4PP7A 4Q9SA 4MWIA 5T3QA 2X7FA 3FMKA 1M7QA 1G8AA 4J1RA 2W5BA 4IX6A 3TV7A 2OZAB 1XBCA 2OJIA 1TQPA 2YM5A 4PL4A 2CGXA 1Z5MA 3MVLA 3OG7A 3QZFA 4QT1A 2FVDA 3QTIA 1OKZA 2G2IA 3AG9A 5CEMA 2RFSA 3THBA 4CGAA 3QHWA 1PXMA 4YC3A 4DLJA 4LFIA 5IA1A 5JKGA 4D2TA 1J91A 4F7NA 1IRKA 2HCKA 4EH8A 3FSFA 3WILA 4NW6A 4QMWA 3JYAA 1YQJA 3C4XA 3F2NA 5I4NA 3IW5A 3DK7A 2OJFE 4ANBA 4U79A 4FKGA 4DG3E 3O71A 5E91A 2W1EA 3HRBA 4Z7GA 3NVMB 3D5XA 4L53A 3H9RA 4PNIA 5DIAA 2VTHA 3VS3A 4AGUA 4B6LA 4DFXE 4NFNA 2BTSA 4IM0A 5EM7A 4BR3A 1NVQA 2AYPA 3FEGA 1U59A 4LQMA 1ND4A 4XBUA 1V1KA 5HEZA 5BPYA 1I44A 3AQVA 4WRGA 5FM2A 1FPUA 4I41A 4AA4A 3ZLYA 3TN8A 3ZO3A 2ONLC 3S4QA 5LMKA 3UDBA 1J1BA 3U4WA 2ZB1A 2WZJA 3OXIA 1BX6A 3E92A 1H1WA 3RPVA 4B0GA 4EOOA 4K18A 5EI8A 2ETKA 4Y73A 4RRVA 1PMNA 1OMWA 3GVUA 5H3QA 1UKIA 5IQAA 3FV8A 4TZRA 2BRHA 3S0OA 4L3PA 3OUKA 3ZFYA 4QQJA 5A4TA 5AP4A 3ERKA 4G9CA 3F5GA 4F9BA 3W8LA 3PPJA 3WBLA 5TT7A 2ZV9A 5AJQA 3QA8A 4J96A 4ANQA 5KMJA 4RJ7A 5ANKA 2FUMA 2J4ZA 3PIZA 4WNOA 4XMOA 4YNOA 4AZWA 4J8MA 3QKMA 4GT5A 4O22A 2QOCA 2YCSA 3I1AA 5CSPA 4BTJA 5HOAA 1Q8UA 4ITIA 2VTLA 4EK6A 4EL9A 3MESA 5J79A 2YACA 1LPUA 3ZSGA 4FICA 4NM5A 3HZTA 1NVRA 1VYZA 3H10A 4DEGA 3PXFA 3ZTXA 1YXSA 1BLXA 4FNWA 2C4GA 3AD5A 3D2IA 3R7YA 2YITA 4QP1A 3TWJA 3DAEA 1Y6BA 4RZVA 5CTPA 5CEOA 2NRYA 3RCDA 5A4EA 3HLLA 4AA5A 3FXWA 4C4GA 5CU2A 3BYSA 4TYJA 3KF7A 3OOMA 4FKSA 4X0MA 1U54B 2ITTA 4A4XA 5GJGA 4X3JA 2RG6A 4BCHA 3DXQA 3MH3A 2WMWA 4IFGA 3RCJA 4IH8A 3HMOA 2WNTA 4M3QA 4O96A 5M07A 5JFVA 3BV3A 5CVGA 3FMNA 1U46A 2PUNA 4X2JA 2P3GX 3DBEA 3H3CA 3C1XA 4X21A 3PTGA 3H9OA 4M66A 5IISA 2FYSA 3QTZA 4ANOA 4PDYA 5L6PA 4CG8A 1M2QA 4Z55A 5JQ5A 2P4IA 2R3KA 2YWPA 4RFYA 1H1QA 4RLLA 3QQJA 3IOPA 4RWIA 3RTPA 5JSMA 1K3AA 4K9YA 4L45A 3EN6A 2WAJA 3QWKA 4FL2A 3ROYA 3VS7A 2CNQA 5EHYA 2VGPA 2XM9A 4X2GA 5EHOA 4HJOA 4KIKA 2QR7A 3DTWA 3I81A 4FV3A 3ATSA 2J50A 4JBPA 5CXHA 3EZVA 2O3PA 4F6WA 1OL5A 2C5XA 2J5EA 4UMPA 4F9WA 3G9NA 4MXAA 3SA0A 4NCTA 4D2SA 4XHKB 3AC8A 2CLXA 4D2VA 1B38A 3VF8A 4AOTA 3MJ2A 4CFFA 2WMUA 3Q9YA 4BTFA 5A4LA 2CSNA 2YCQA 4EK3A 2YAKA 4X3FB 2YCFA 3CLYA 3FKLA 4IVDA 3ZUTA 4EUTA 2J0KA 4EH4A 1E9HA 3E8CA 4LL5A 3P7BA 4KIQA 4CTBA 1WCCA 3R8ZA 3QRKA 4LRMA 4O2PA 4QD6A 2VTPA 4NEUA 3TZ8A 2NRUA 4XP0A 2BMCA 3R9OA 3TTJA 3VBVA 4H05A 1MRYA 4O7SA 1Q8TA 3FI3A 3PXQA 4DFLA 5J5TA 2IPXA 5ACBC 1WBVA 2BILB 3A8XA 2PPQA 2Q0BA 4OBPA 5AFVA 3FYKX 3UOJA 1JBPE 3GXLA 1H8FA 3DQXA 3V5PA 1A06A 3ZCLA 1OIQA 4M69A 4D4VA 4IB0A 4R6VA 2VWXA 5I9XA 1KOBA 3RHXA 1QPDA 4FV6A 2W1HA 2XKDA 3QGWA 5CYIA 3CGOA 4ACDA 3VRZA 3UMWA 4FSRA 1XO2B 2JC6A 4IJ9A 2J0JA 4FKPA 3IW6A 1UKHA 4L68A 3IGOA 4TYEA 3W8QA 4F65A 5DMZA 2CNUA 3NUAA 1DI9A 2WIHA 4MXXA 3V6RA 4DFUA 3TJCA 4KAOA 4LRJA 2ZB0A 4K0YA 1WZYA 2W1CA 3VBWA 4C58A 2PHKA 3ORZA 4TWOA 4UWYA 2R3FA 3VHEA 4K33A 4BI0A 4AT5A 3M11A 1YOJA 4UV0A 2XIYA 4I6BA 2XKCA 3NW6A 5BYYA 3HMPA 4G1WA 3D7ZA 1FVTA 5AP1A 4KRDA 3H0YA 2QONA 3C4ZA 3FMLA 4UMQA 4QP3A 4ACHA 3ORIA 5EOLA 4ZTSA 3GC8A 5L8KA 4ZJVA 2WMRA 4OBQA 2WU7A 4KBCA 4MQ2A 4OUCA 2EXMA 3D4QA 3PJ2A 4U9AA 2PE0A 3CY2A 3KXNA 3QTXA 4UMTA 2XBAA 5EYKA 4G31A 4IZAA 3ORMA 1F5QA 5JGDA 3DPKA 1JSVA 2F7EE 2XK8A 5HD7A 4HZSA 4OBOA 4UBAA 3ODZX 4L7FA 3OWJA 4FV0A 3S1HA 4O86A 4V01A 2V7AA 3DKOA 3LCOA 5FD2A 1VYWA 3H0ZA 3MWUA 4FNXA 2RG5A 2HW7A 4NCTC 5AP2A 4YJQA 5HNGA 3SRVA 4EOKA 1YI4A 5AV0A 4C0TA 4N70A 3BYOA 5ANEA 2YWVA 4AW0A 4ZK5A 4OTRA 4FSTA 1H0VA 4YHJA 1R78A 2ZOQA 4H3QA 4YJPA 5G6VA 5AUZA 4ZTHA 4W8EA 5M4IA 4E26A 2VWBA 3H9FA 5J8IA 3W2OA 3OTUA 4JS8A 5J7HA 2VTJA 4TWNA 3RK7A 3LFNA 3LFAA 4I21A 5ANIA 4I5CA 4L7SA 5IKWA 3LZBA 4UMUA 2B9JA 4JR7A 1JVPP 4F1MA 2CKPA 1YHVA 4EBVA 4FTOA 2Y4PA 3MSSA 5H8EA 2VWIA 4CFMA 3DJ5A 4LOPA 4S33A 3IO7A 4JRVA 2XZSA 1MRUA 1FMOE 3A7IA 3MFSA 5CQWA 3EH9A 2CN8A 3HUCA 3ZDIA 4CTCA 5L6OA 5AP6A 3GU8A 5BVNA 2UW3A 4LV5A 4M14A 4O0TA 3AD6A 3SXFA 3KA0A 1ZOHA 4XH6A 2BZKB 4BYIA 1AQ1A 2Y8OA 4D0XA 4OTHA 5C8NA 4M7IA 3NYVA 4D2RA 1YOMA 4H58A 5I9VA 3DBFA 1IASA 3FMMA 3A4OX 4DBXA 1GZNA 4JR3A 4KKHA 4QP2A 4RX7A 4Y8DA 2JLDA 4RPVA 4KRCA 4YJRA 2P0CA 3U54A 4E8AA 4I24A 3EMGA 1SMHA 5M4FA 4FV7A 2WPAA 1H4LA 3M1SA 4XRJA 1ZOGA 4HVDA 3QL8A 2R3HA 4GUBA 3MPTA 3GC0A 4I92A 2Q0NA 3GT8A 4MBIA 5HLWA 5DEWA 4R5YA 4JJRA 3AGMA 2BDJA 3PZHA 5F1ZA 4E5WA 1JAMA 2WEVA 2ITXA 4A06A 3AMBA 4ITJA 3JPVA 3P4KA 4ZTNA 1G5SA 5HIBA 3RAWA 3UVRA 2CHLA 3QZHA 5K9IA 4DGLC 3V5JA
chains in the Genus database with same CATH superfamily
3PA5A 3SXRA 2SRCA 3CIKA 4IX3A 2Y7JA 4I4FA 1P2AA 5BYZA 3U9NA 3G6HA 4JBQA 5CEPA 4MXCA 4BDDA 1WBWA 4FIFA 3ZBFA 2WO6A 3N51A 2B9FA 3ENHA 3GEQA 4PPCA 3PZEA 3HV6A 4RJ6A 5F95A 3ALOA 4H1JA 3BIZA 3O2MA 4QMYA 3HV5A 3KK8A 3G6GA 2W9ZB 4JT3A 4M68A 4O38A 4XNEA 2VNYA 3LXKA 3BU6A 3DKCA 5E8ZA 4R77A 2PSQA 4Q9ZA 1YWRA 3PVBA 5AR8A 4MKCA 5FDXA 2XCKA 2GS2A 2B7AA 5L6WL 2XS0A 5FWKK 3TZMA 2I6LA 5EFQA 4AN2A 4AW2A 4BWPA 3EL8A 2ERKA 2QR8A 3QLGA 3JS2A 3HDNA 1O9UA 4A9SA 4ZMEA 4EOMA 4A07A 2B9IA 4D1ZA 3ML1A 5AR7A 4JDHA 5LWMA 2XRUA 3D0EA 3KRWA 5KMOA 1GIIA 1P14A 3PVUA 3OT8A 4QMXA 3OCGA 5LVNA 5A54A 3U6HA 4O4FA 5H8GA 5IA5A 1XH4A 4Q5EA 1MQ4A 3ZMMA 3KGAA 2R3IA 2JAMA 4LUDA 2HYYA 3R28A 1VEBA 4F99A 3UPZA 2E9VA 1WVYA 4DAWA 4KSQA 1T46A 5JZNA 4E20A 4AZSA 5GZ9A 5FDPA 4GW8A 4YO6A 2XIKA 4FKTA 4IADA 3U9CA 4PQNA 3LOKA 5AIKA 4FKLA 4F0GA 5J9ZA 5IQEA 3G5DA 4IC8A 4FTQA 3ZEWA 2HAKA 3R9DA 5KZ0A 2DWBA 4FV2A 3W16A 4LG4A 4BC6A 4TYHB 3OP5A 5CEKA 4FT5A 1BL7A 5K0KA 4K2RA 3DB8A 5EQEA 4DTAA 1YRPA 2VTIA 1LP4A 4L3LA 3ZBXA 3CBLA 2WMXA 5LCKA 1OUKA 4KSPA 1LR4A 5AR2A 2G1TA 2HY81 4N4SA 3U87A 2REIA 1NXKA 1Q8YA 2P2HA 4ACCA 3AKJA 4C37A 4BKYA 5HG8A 4O7YA 3K3JA 4FL1A 3D2KA 3KB7A 3N4UA 3FZ1A 1Z57A 3GU5A 3WF5A 4KKEA 5CSHA 5GJDA 4HCTA 4GH2A 4R1YA 3UC4A 4RFZA 3SV0A 4FNZA 1HOWA 2PZIA 4MYGA 4WO5A 1UV5A 4MF1A 4AXAA 5KKRB 1JKTA 4MWHA 2RIOA 4FSYA 1IAHA 4DEDA 4Z3VA 2OG8A 2VUWA 5BQ0A 4DH7A 2X0OA 5CU0A 4YZ9A 3OS3A 4F7JA 4JQEA 5ITAA 4IAFA 3QD0A 3VVHA 2VO7A 2YZAA 3Q96A 2ETMA 4O6LA 4Y85A 3LAUA 5BUJA 2X8IA 4RIXB 4G16A 3UIMA 2PYWA 4RBLA 2ZYBA 3P1AA 4B9DA 2QOIA 4RMZA 4YTHA 2GS7A 4EONA 3A99A 3VQUA 2F7XE 3FLSA 1YI6A 4FT3A 3W0RA 3H4JA 5E8TA 4BCOA 3BE9A 4YLLA 5AAGA 1OB3A 3K54A 4AS0A 1JWHA 5CNNA 5ICPA 2EXCX 3QWJA 4UWBA 1BI8A 5T6KA 3KMUA 2QOOA 1OPJA 4ENXA 1YW2A 3KY2A 4QMOA 4KB8A 5J5SA 3BLAA 4DT9A 3ZUUA 4BDHA 2VO3A 2QO2A 4NTSA 3CGFA 4X3FC 5IUIA 4AACA 2J5FA 2J7TA 4FVPA 4AZTA 2PUPA 2VWWA 4AGDA 4O7NA 4G3GA 4CSVA 2EVAA 3BLRA 4XBRA 4V0GA 3ZZEA 3LMIA 2GNJA 4QP7A 3QXPA 4MAOA 3MS9A 5H2UA 2AC3A 2OWBA 2XK4A 3Q4ZA 4RQKA 2YM6A 4FI1A 5HKMA 1Q5KA 3IONA 3DK3A 4O0VA 3BGQA 4FKQA 3LM5A 4FTNA 4O0YA 4U3ZA 4O82A 2YM4A 3MY0A 4Y72A 4FUXA 2WMVA 4BHZA 1IA9A 1XH6A 3OZ6A 1OITA 4NJDA 4LI5A 4RC2A 5J7BA 3EB0A 3PXKA 4MNEB 5HTBA 4E4NA 2OJGA 2QO7A 5LJJA 3II5A 4U8ZA 4XYFA 1WMKA 3MB6A 1V0OA 4CZYB 4IZYA 3FWQA 4IWOA 5BUEA 3HYHA 3RK9A 3R7EA 2GU8A 3AMYA 5DFPA 3TCPA 4YTFA 3ZONA 4CLIA 4QO9A 2PE2A 2W1IA 3F7WA 2J51A 3FXXA 4WRSA 3FZOA 2O63A 2WMAA 4CV8A 3C4EA 3QQFA 2QO9A 3KXHA 4BGQA 4LGGA 4AXCA 1ZMUA 3OXZA 5C27A 3LQ8A 5E8VA 4C4HA 2GNFA 4FTKA 4PUZA 5AEPA 4DHZA 5H9BA 3QQGA 3ZOSA 4RVKA 1ZLTA 1MQBA 3V8TA 4G5JA 4DEEA 2PY3A 4KWPA 4RVTA 4YZDA 2BPMA 4HPUE 4EBWA 3AC3A 5DT3A 3C4FA 4F0FA 4OW8A 3A4PA 3VAPA 4CG9A 1PHKA 2GQSA 2XYUA 4AQKA 4WG5A 3GB2A 2EUFB 3FC1X 5CS6A 2XJ1A 1Q3WA 2EWAA 3D5WA 5DRDA 4P5QA 4ZSGA 2ZFYA 3BGPA 3HDMA 2QOQA 2WELA 5J9YA 3R02A 2O64A 2OXXA 2IVSA 3CS9A 3I60A 4W8DA 5CT0A 5E8UA 4ZSJA 4E6QA 3BLHA 4GVJA 4DG2E 4EQUA 2GHLA 3KN6A 3E93A 3PXRA 4HOKA 5FLFA 1OBDA 3DXPA 1XQZA 1O6YA 3LFEA 4R78A 3KK9A 4WHZA 5L4QA 4IAYA 1WBOA 3KMMA 5BYLA 2E9OA 4YPSA 1CDKA 3LQ5A 4FG8A 4XOYA 3AT3A 4IEBA 3O50A 4BCPA 3JVSA 5AUTA 2R3RA 3W10A 5BVWA 2FSOX 2OKRA 2W1FA 3P23A 3VN9A 4AN3A 3LFFA 3RBWA 3F3VA 1PXOA 2VRXA 3R04A 4J8NA 4EK4A 3EYGA 2WTVA 4FG7A 3W18A 4AGCA 4CMUA 2Z02A 4APPA 3DY7A 5AV1A 1T45A 5HLPA 4JBOA 4GL9A 4QTEA 1W83A 5IQDA 3V5WA 3WZKA 2X39A 3VC4A 3EQFA 3VS2A 5J9LA 2YFXA 3WOWA 1OIUA 3EQHA 4L6QA 4NM7A 4YLKA 3MI9A 4QPSA 3TM0A 2PMLX 3ANRA 3VULA 3R7OA 4F6UA 2C6IA 4O7TA 2YIWA 2C6LA 2W17A 3BELA 3CC6A 4MXZA 2FSMX 4IVBA 4QMTA 3TZ7A 4AWIA 4BKJA 2GFCA 3BEGA 3PY0A 4OTQA 2OIQA 4C3PA 3FDNA 3KC3A 5IQIA 5HE3A 4ZZMA 4BL1A 2QURA 3WI6A 1PXKA 3COHA 1GAGA 4F4PA 5FP6A 4EHZA 2YIXA 4CFWA 3P7CA 4YZCA 2CCHA 2W1DA 5AR3A 3KREA 5BX0A 4U44A 4ZY6A 2C0TA 2VTMA 3R2BA 3QRJA 5CEIA 2W06A 3LM0A 3ZXTA 3W1FA 3NIEA 1DI8A 3MYGA 4J95A 4W4XA 3TACA 3UQCA 4FKRA 3F5UA 3GCSA 1UA2A 3PA4A 4W9WA 4AX8A 4EEVA 2GNHA 4YC8A 5CEQA 4C57A 4W9XA 3PYYA 3WIGA 3ANQA 1B39A 2WXVA 3NR9A 3DAJA 3LFDA 3PVWA 3QLFA 4OLIA 4K77A 5TOZA 4ACGA 3P08A 3LE6A 4MTAA 3SW4A 3RK5A 4FKVA 5HVJA 2XNOA 4EWHA 4CKRA 2CKQA 2FSLX 2O0UA 3CTQA 5ACKA 5CQUA 4OAVB 2V7OA 5TF9A 3HECA 5LVMA 5E7RA 3PFYA 4TW9A 5ANOA 3UNZA 5JT2A 3G0FA 2HXLA 3NUPA 2OK1A 5J95A 4CYJA 2WTKB 1E1XA 2XP2A 3KULA 1H08A 4PDPA 4G34A 3HMIA 3B2TA 4QPAA 5E8WA 2GNGA 3UOHA 4ARKA 2WU6A 2JD5A 2I0VA 4KUJA 4ZMFA 3NMUF 1REJA 2QOBA 4FIGA 4D0WA 4E1ZA 3LMHA 3R8UA 3V5LA 4JQ8A 1CM8A 3VQHA 1KE7A 5JFWA 4E6DA 1ZWSA 2QC6A 3QZIA 3R83A 3NGAA 3V8WA 3HV7A 1MP8A 1YOLA 4BDBA 2W05A 3FZRA 4E4MA 3R6XA 4FR4A 5EDQA 2VWVA 3SC1A 4BDAA 1WBNA 4FKOA 4IAAA 2HZ0A 5M53A 3C7QA 2CNVA 4ZJIA 3O8UA 5K3YA 2C3LA 1XBAA 2WQMA 2XBJA 2VX0A 5KNJA 3QUEA 2JIVA 3QQHA 3BL9A 2Y9QA 4FIIA 2QLUA 3FKNA 4BZDA 1ZYJA 2PK9A 5HCZA 2PWLA 1TZDA 2YLFA 2W4JA 2UZEA 3DBDA 3QRUA 4TXCA 3ORTA 4UN0C 4S32A 3GC7A 3FC2A 1KV1A 1UU8A 3GOKA 3E5AA 4YC6A 2F2CB 2W99B 4H3BA 2X7OA 2CPKE 3LPBA 2A4LA 1OZ1A 3RZBA 4L42A 3EN5A 2VGOA 4MD7E 3QTSA 4FYOA 2XUUA 4QTAA 3MN3A 4XG2A 5D11A 5IEVA 1ST4A 1OKVA 4YBKA 4DE4A 5CZIA 4L00A 2C30A 1OBGA 2F4JA 2EB2A 3LLTA 2WMQA 2Z7QA 5EM6A 4ZLOA 5BVEA 2UVYA 4NTTA 4DINA 4AZEA 3CXWA 3L9NA 2GTMA 2C3IB 2PE1A 4E6AA 4C36A 2WMTA 2V62A 5LQFA 1OM1A 3CD3A 3WARA 4QTBA 4IB1A 3V8SA 3MTFA 2G2FA 2CMWA 4O1PA 3A2CA 3GFEA 4OT6A 2C6TA 3OHTA 1KE9A 2QKWB 2Y4IC 4S31A 3NX8A 4CXAA 3GU4A 3W0NA 4NM0A 2I0HA 3V3VA 4KA3A 2ITZA 3HV3A 3R9HA 5A6NA 5BMMA 3AT2A 3I6WA 5LCJA 4H36A 4FA2A 4RIWA 5EM5A 2CN5A 4RIYA 4TWPA 5AIRA 3R7GA 4HYIA 1JKSA 3BV2A 5DT0A 2JKQA 3VUIA 3NYNA 3Q5ZA 3B2WA 2X1NA 5CF8A 3KMWA 4FVRA 4N6ZA 3E7VA 4QMMA 4U42A 4FTRA 4GRBA 3I7CA 1WFCA 2EXEA 5DI1A 3DLSA 4C38A 3FLYA 5JZJA 4GYIA 5IH6A 4FTAA 3BPRA 3LFSA 5FBNC 5CI7A 5KMLA 5IUGA 3LXLA 1GNGA 2CGUA 3EL7A 1YHSA 2HOGA 4IC7A 3AGLA 2IJMA 3R0TA 3R30A 3VRYA 4C4EA 2GNIA 4F9CA 5JGAA 1QL6A 1STCE 2ITVA 3L8SA 1NA7A 2FA2A 4I6HA 4O0SA 1V0BA 3ZXZA 2B9HA 3CPBA 2QNJA 3GP0A 1IA8A 5D7VA 1UWHA 3FPQA 4WKQA 2C69A 3IKAA 4ASXA 2X9EA 1E1VA 3KF4A 3RMFA 3RVGA 3F6XA 3R9RA 2LGCA 4BDIA 4J98A 3PDTA 5CENA 4AN9A 4IAIA 4FUYA 5LWNA 3A62A 2XK6A 3C0IA 3MV5A 3PJ3A 1SYKA 3I6UA 4JLCA 3KRLA 3FUPA 1O6LA 2NPQA 3OF0A 5EDRA 4YMJA 5DR6A 5HTIA 1ZY4A 4BCQA 3QTUA 2O8YA 3EN9A 4FZDB 2HIWA 4AXFA 3I0OA 2BZIB 2VTQA 5D7AA 3CP9A 4M12A 4NW5A 4AUAA 3QRIA 4LRKA 5A9UA 1RDQE 2AEGA 3OUNB 4QOXA 3CKWA 1KSWA 3CY3A 5LVOA 4IB3A 3QTQA 4M0YA 3DV3A 2E9PA 4XUFA 5AUVA 5AX3A 4JVGA 2VTTA 1Y57A 5CT7A 4MXOA 3FQSA 4YJVA 3ETAA 5HNBA 1ZMWA 3A7JA 5EI6A 3ZHPC 5KBQA 4AZFA 2Z60A 1DAYA 3Q53A 3VUTA 2J0LA 1F0QA 2W9FB 1KOAA 3P9JA 4JL9A 3QX2A 5EW9A 3TG1A 2IW6A 2OLCA 1Q41A 2ZDUA 4QNAA 3RPYA 5FUTA 4ZLZA 3ZRLA 3SXSA 2R2PA 3TNQB 4AW1A 1CSNA 1OIRA 4ACMA 3KXZA 4G5PA 5E1EA 2XIXA 4BCFA 4CQGA 4D5HA 4TPTA 3TL8A 2PTKA 2JFLA 4FGRA 5B0XA 2RGPA 4R3CA 4ANSA 3L9MA 2ZV8A 3GQIA 4RC4A 4EQMA 5HBJA 1CMKE 2YA9A 4ANLA 3BBTB 4BBMA 4BICA 3GUBA 3AC4A 3DNEA 4GVAA 3RNIA 4DFBA 5M4CA 5JFXA 2B53A 3KKVA 3Q6WA 4J7BA 4G6LA 5C8KA 3F66A 2QOLA 3NYOA 3OXTA 3IW7A 3FSKA 5B7VA 1PY5A 2F57A 5CZHA 1M52A 1WVXA 3B8QA 4Z7HA 2J2IB 5IQGA 4QMNA 3RPRA 4MQ1A 3L8VA 4QQTA 2E2BA 4L9IA 4CD0A 4PWNA 3EN4A 1URWA 4MBJA 4YJUA 4GU9A 5EG3A 4E3CA 4ITHA 2HELA 4F9YA 4XP2A 3EFKA 3R73A 4MCVA 5EW8A 3NDMA 5HG7A 1PMEA 3DGKA 4FEUA 2BRNA 3KVXA 3OCSA 5HO7A 5A46A 4QYYA 3EKNA 3MJ1A 4TKSA 4ORKA 4D4SA 5I3OA 3W2CA 3P0MA 3SAYA 4AOIA 4ZAUA 2WD1A 2XARA 2FGIA 4IANA 2JKKA 1XKKA 2OZAA 3KQ7A 3RP9A 4AFJA 5M4UA 4D4RA 3Q04A 5ETCA 4ZZNA 4WUNA 2UVXA 4DLIA 3UNKA 4W4WA 3RM6A 3PIYA 4GS6A 4L3JA 3FLNC 4ZSLA 2BALA 2YDIA 4GCJA 4C59A 4FVQA 2B54A 4NFMA 5EM8A 1Q3DA 4ALWA 2ZM3A 2W96B 4OTGA 4XLVA 1EH4A 2KULA 4KS7A 3DDQA 3NSZA 4WSQA 4IM3A 1R3CA 4IW0A 4FF8A 3PY1A 1AGWA 3FI8A 4NIFB 5M57A 2OFVA 3R22A 1LEWA 4IZ7A 5CF4A 4HVHA 1UVRA 3W33A 3MY5A 4N57A 3RNYA 2UZDA 4PNKA 4RVLA 4EUUA 3ZC6A 2XB7A 3MA3A 4ID7A 4MK0A 1F3MC 3PSBA 1FGIA 4RJ8A 3PFQA 1PW2A 5AX9A 2VO6A 3MW1A 3NAXA 4NM3A 1Q62A 4DTBA 2UW0A 4KD1A 3WE4A 1B6CB 4QPMA 3TJDA 2CDZA 4FV9A 4L52A 4QYGA 3OWPA 4CRSA 5CX9A 4IVCA 4B8MA 1BUHA 4NU1A 3DZOA 3E8EA 4QQCA 2JGZA 1ZOEA 5AV3A 2XIRA 3WYXA 3TUBA 5GIOE 3SQQA 4USDA 3BHYA 3ORNA 5C26A 3PWYA 4BGGA 2C6MA 2WTIA 3F5PA 3OFMA 3I79A 4FZFB 4XG3A 4X2FA 2YHVA 3G51A 3OBGA 1YXVA 3ZUVA 4U80A 3R8PA 4BCJA 3NIZA 3VS5A 3ZDUA 1BI7A 4G3CA 3KCFA 4I22A 1BL6A 4USFA 3PG1A 1HCKA 2BAQA 4DCEA 3U8WA 5C01A 4FTIA 4GG7A 5KHWA 4MVFA 4AT3A 1M2RA 5EDPA 3IDCA 4C35A 3CTHA 3TI1A 2C68A 3CD8A 3UDTA 4YJNA 3MIYA 5CSXA 2QQ7A 4JDKA 4D2PA 2VTOA 2A1AB 2J6MA 4E7WA 1M17A 3PVGA 1M7NA 2UZWE 4O7VA 4YSMA 4C7TA 2ESMA 3WF7A 3F3TA 5DPVA 4DFNA 3U55A 1YXTA 4KNBA 1GIHA 4Y95A 4FSUA 1H25A 5DA3A 3TEIA 4LOOA 4B7TA 4B8LA 5CXZA 2NNWB 3CJGA 3QHRA 2VAGA 3ZC5A 5HNIX 4DEAA 5HE1A 5ANDA 5C1QB 2GMXA 1JKKA 4RVMA 4EJ7A 3P5JC 5KZIA 2QODA 3BU3A 3DS6A 2E9NA 2R3PA 3KEXA 5D9HA 4ALVA 1DM2A 3I0QA 3PE2A 3PA3A 3OWLA 1REKA 2WTCA 3EFLA 2YZLA 5AUWA 5J1WA 4DCAA 3ULZA 1U54A 3EKKA 4FKIA 2VX3A 4EOSA 4M8TA 4O4BB 5GIPE 1UU9A 2H9VA 3OOGA 1OI9A 5BVFA 2VWUA 1W84A 3F69A 4TYIA 5CY3A 4QP6A 4LGHA 4U5JA 4ZEGA 2C5YA 4U40A 2A27A 2R3QA 4RWKA 3D94A 4UEUA 4GFOA 4NL0A 5IA0A 4XS2A 4YJTA 2WIPA 4AP7A 5DE2A 4CMOA 4G2FA 2UZLA 2X0PA 4UWCA 3FLWA 4M97A 1PYEA 4XJ0A 4F6SA 5EQYA 5CVHA 4L8MA 3GQLA 3LIJA 3KVWA 1PXNA 2QU5A 2VV9A 4HVGA 1NVSA 3AC5A 3CQEA 4BI1A 2ZM4A 3PPZA 5A4QA 3EJ1A 4UALA 4JOAA 4HW7A 3VUDA 3VWAA 2BAJA 4G9RA 4I5HA 4A7CA 4LYNA 1GIJA 5AR5A 4C3FA 4NT4A 5A14A 1H24A 2X0GA 3A7FA 4HCVA 2QD9A 4GFGA 4M67A 2JFMA 2W4OA 4XV3A 2HZ4A 1YXUA 3VS0A 4J52A 5HHWA 3V01A 4F1OA 1QCFA 3EHAA 1G3NA 1YDRE 2C6EA 3NNWA 4GFMA 5DLSA 3ACKA 5DYJA 5C4LA 3PUFC 4U6RA 4X3FA 4FEXA 3HA6A 3U6IA 3BU5A 4WG4A 2R3MA 3G15A 2WOUA 4RJ5A 3S95A 4AE9A 2G2HA 3AT4A 4HGLA 1Q99A 3PSDA 3R1SA 3R71A 1PMUA 4XG7A 4BIDA 4C4IA 3KRXA 3TDWA 4FV5A 5I5ZA 2UZNA 5FTOA 3S00A 4IJPA 2H6DA 4O0RA 2QCSA 2BHEA 5AP7A 3I7BA 4C2VA 4R5SA 3BHHA 3FI4A 3WF8A 3JUHA 3PXZA 4BIEA 4DN5A 4UMRA 4CT1A 5F20A 4QYFA 3R7UA 2PZPA 4DGNA 3F3WA 4J99A 3OY1A 2ZAZA 4FYNA 4UZDA 2CGVA 2ITNA 4CQEA 3UDSA 3QYZA 3FAAA 4BZOA 3SG8A 2UW9A 3M2WA 5LOHA 4XRLA 4RA5A 5GJFA 1SM2A 1H28A 4BDEA 4EH3A 3UQGA 4AXDA 5JH6A 3V5TA 3EWHA 3RPOA 3DDPA 5IF1A 5CI6A 2BZHB 4EQCA 4MF0A 2PVYA 5DR9A 1XJDA 4AE6A 5TKDA 4PTCA 5FGKA 3UZTA 2F9GA 5KX8A 3PLAE 4HNIA 4G3DA 2CKEA 1KE5A 4RFMA 3UDZA 3IS5A 1UNGA 3QAME 3SG9A 3T9IA 3ZM4A 4TTHB 4NJ3A 4TWCA 3OROA 4I93A 2EB3A 2OIDA 4DITA 3FMHA 5T68A 2PUIA 4L43A 2VTNA 5LMAA 3LMGA 5K0XA 3EYHA 4RSSA 2C0IA 3OW4A 3PXYA 3CR0A 2G01A 5CSVA 5M55A 4DHIB 2XVDA 3UC3A 3KU2A 2HXQA 3VNTA 3ZEPA 2R0UA 3W0OA 4XG8A 3V04A 3OVVA 2XNGA 3UG2A 4C62A 3CKXA 2R3OA 1OIYA 1ZRZA 3GCPA 2BKKA 2UW5A 4TY1A 4NYEA 4F9AA 4KINA 3VBYA 5AP5A 4Y83A 4GV1A 2XEZA 3BI6A 4BDKA 1L3RE 3D7TB 4YP8A 4MX9A 3DU8A 4O27B 2X4FA 2X2KA 4O4DA 3ZLXA 3SOAA 3ET7A 5DHJA 2W5HA 4GK2A 3RWQA 2Z7LA 4EOPA 4GJ3A 3HVCA 4PTEA 1OPKA 4RA4A 3VBXA 4FKWA 4FG9A 3HUBA 2BDWA 1QPEA 2OJJA 2XNMA 2JKMA 4IQ6A 4WG3A 2X9FA 2WTDA 4FOBA 4JDIA 4QYHA 3ZZWA 2PMNX 3LJ1A 4K1BA 1P4OA 3QXOA 4X2KA 2G15A 5AM7A 4F63A 1PYXA 1WBTA 4RJ4A 1XH9A 2YJRA 5FQDC 1JLUE 3GCQA 2V0DA 4GMYA 3HX4A 2LAVA 4BI2A 2HZNA 1URCA 4MH7A 3UZRA 2ERZE 4J53A 2ZV7A 1QPJA 5CU4A 4LV8A 5EHLA 3UP2A 4EJNA 3F9NA 4NKAA 2C6DA 3EQDA 4PRJA 3V51A 4MBLA 4GIHA 2JKOA 3TNHA 2P2IA 3PIXA 3NCGA 3CPCA 4GEOA 4EH9A 3SHEA 3S3IA 2CGWA 2IZUA 5CNOA 3OWKA 2KTYA 4IFCA 3GU6A 5BVKA 2ITOA 4F09A 4QDVA 5CANA 3FYJX 4IDTA 4KIOA 5KE0A 3OY3A 3R8LA 4AOJA 1TQMA 5EYCA 5JGBA 4DEBA 5DWRA 3RAHA 4EC8A 5L8JA 4HPTE 5FEEA 2W1GA 3JVRA 2XNEA 4O0WA 3HA8A 4XEYA 1Q8WA 3NUXA 3TXOA 3E62A 2BZJA 3ZLWA 5HIDA 3TDVA 5HD4A 1ZY5A 4I1ZA 4QQ5A 2F2UA 4JQ7A 4D1SA 5C4KA 4UY9A 2WQNA 4BCKA 4EYMA 3RKBA 3TIYA 3DKGA 5FEQA 3NLBA 5B2MA 4DDIA 3ENMA 3P5KA 2WB8A 3DXNA 3BLQA 3OBJA 4RWLA 2OSCA 4QTCA 4YU2A 4IZ5A 3W0PA 2RFEA 3NYXA 2BCJA 3EFWA 5F4NA 4PPBA 5IQBA 2RFDA 3SW7A 5DN3A 4R7BA 3W2QA 3QX4A 5DEYA 2UZVA 4FK3A 4QRCA 5CAPA 2C5OA 4X6RA 1BYGA 4CMTA 2UW7A 3Q4UA 1JPAA 4PMPA 1ZYCA 2ITWA 3VUHA 2W5AA 5AMNA 2BFXA 3Q3BA 4YUQA 3UOLA 3ZO1A 4FTLA 4JAIA 3QQLA 4EZ3A 2HWPA 3BEAA 5LVLA 1CKJA 2R9SA 4FOCA 5BMSA 4FIHA 2I7QA 3OEFX 4BBEA 1RJBA 4I94A 3CSVA 3OEZA 3MFUA 3ZYAA 2HWOA 1BKXA 1YDTE 2PMIA 3PSCA 4C34A 4E4XA 2YDJA 4HNFA 3P79A 1K9AA 1H00A 3MVJA 3UE4A 1NT2A 4TNBA 3Q2MA 2W0JA 1WBSA 5FTQA 2WMSA 4YO4A 5E90A 5HICA 4XG6A 3L9PA 4BCMA 3NUYA 4FSQA 4B99A 5JEBA 2BR1A 3NS9A 2OBJA 5C8MA 5D10A 3EQIA 3ROCA 4DHFA 2QG7A 2ITYA 5E92A 2B0QA 3A7HA 4MD8E 4TRLA 4AAAA 4JNWA 5J87A 5AA9A 3ZM9A 4PPAA 2OZOA 5K4JA 4O4CA 5KCVA 2OW3A 3FY2A 4FV8A 4HGSA 3AC2A 2ITPA 2XANA 1A9UA 2J90A 4PTGA 5HORA 1TKIA 4EHVA 3DA6A 4E4LA 3NWWA 1YWVA 1GZ8A 4WIHA 5EKOA 4FSMA 4FK6A 2FSTX 4GT3A 5EH0A 3UO6A 2BTRA 3ZU7A 4BN1A 4D9UA 5K5XA 3DT1A 2GDOA 2GTNA 2PVLA 4IXPA 3R9NA 2OXDA 5CLPA 3EQRA 3VBQA 5I9WA 3O7LD 2WQOA 5IH5A 3MBLA 2JIIA 4FSNA 4ERKA 4AA0A 3BRBA 1XH7A 2G9XA 2R3LA 4ZS0A 4KIKB 3LQ3A 5TO8A 3MA6A 3A7GA 4TYGA 3QKKA 1JSUA 4PMSA 1XMLA 2PZRA 3RALA 2NP8A 3Q52A 4H39A 2XIZA 3WZEA 2V5QA 2HZIA 3WZJA 4TL0A 2XH5A 3HMNA 4NSTA 4GKHA 1J1CA 2I0EA 2V55A 3LJ2A 2A0CX 3PE1A 4I20A 4QP9A 3F5XA 3Q4TA 4QTDA 4A4OA 3PWDA 1A48A 2QKRA 2W1ZA 3ZSIA 1H1PA 1OL1A 2XJ0A 3NW5A 3R8MA 4PDSA 2QLQA 1KE6A 4BBFA 4C8BA 4YNEA 4BIBA 3AD4A 4EH2A 3BHVA 2IZRA 2X2MA 2YLEA 3AKKA 3ORPA 2DYLA 1YI3A 2ZV2A 1YWNA 3QBNA 3TV6A 5CAVA 2R3JA 4C3RA 5AUYA 3UBDA 1OL7A 4FBXA 4OTWA 4XV1A 2HENA 2Q83A 4XG4A 3QZGA 3FL4A 3D83A 2R7IA 2YISA 3E88A 4M69B 4CFVA 2PVFA 4JG6A 5IPJA 2GS6A 2UZBA 1XMMA 3RZFA 3TKHA 4EC9A 5I9ZA 3E87A 3ZLSA 5IDPA 1JKLA 5IMEA 3ODYX 4KABA 3VS6A 5HU9A 3QFVA 4U7ZA 5DH3A 5AWMA 5CF5A 3CQWA 2O5KA 3QCQA 4FMQA 3PP0A 4RIXA 4IDVA 3KCKA 2FH9A 4PMMA 1OECA 2X0QA 4JMQA 4EOJA 4O83A 1FINA 2CJMA 2OXYA 3C50A 2YCRA 4AF3A 3ELJA 3F2RA 1UNHA 3MPAA 3QD4A 1PKDA 2BUJA 4O1OA 4QMLA