3P5KA

P38 inhibitor-bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
332
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a novel class of non-ATP site DFG-out state p38 inhibitors utilizing computationally assisted virtual fragment-based drug design (vFBDD).
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
total genus 105
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p5kA01
3ZC5A 2XMYA 4NM7A 3EL8A 3MPTA 4ZSJA 2UZNA 4QQ5A 4V04A 4ENYA 1H0WA 2XYUA 3KRLA 1Y6BA 5JSMA 5K9IA 3BYOA 3COKA 1QCFA 3H3CA 4D2TA 2B55A 5F1ZA 4JDJA 3HAMA 4BICA 1OKWA 2BCJA 3RCDA 3F9NA 3KVXA 3V8TA 4C4FA 1H25A 2HXQA 2B53A 5BVKA 3QA0A 2C0OA 3OS3A 2HY0A 3Q32A 3Q96A 4RJ5A 5J8IA 4QYFA 2I0EA 4YC8A 3CKXA 1WMKA 3DJ6A 4FKOA 4EHEA 4G34A 4G17A 2ITPA 2QOCA 2ZB1A 1M52A 4KUJA 2Y4IC 2R3KA 4LM5A 2BZIB 3MH3A 3I0QA 4EOLA 2WNTA 5HTCA 3FV8A 2QVSE 2C6OA 3EQDA 5L2WA 1YW2A 2YM8A 3F66A 1ND4A 4PWNA 4FI1A 4FTNA 5EM5A 2NP8A 3VQHA 3KRJA 4ZLYA 4FUXA 1MQBA 2NO3A 3PVBA 5AP7A 5EW3A 2WEVA 1PXIA 4X2JA 4B8LA 2XRUA 2OWBA 4QMUA 4U43A 5TT7A 4F9AA 2VRXA 2BDWA 4O1OA 3AMAA 5E91A 3I5NA 3RK9A 4TZRA 3CXWA 1VYWA 3D9VA 1Q4LA 4ASDA 3M2WA 4XLVA 4EH8A 4E4XA 5CNOA 4BI1A 5KMMA 3ORTA 5KCVA 4JR3A 2X81A 4RJ4A 4DGNA 4YO6A 2X9FA 1T46A 4FR4A 3OVVA 1ZAOA 3BZ3A 3KXXA 4HGTA 3DS6A 4OTFA 3W2CA 2AC3A 4IVCA 4KKEA 3ITZA 1OL5A 3C4EA 3KQ7A 4GL9A 3LFFA 2F2UA 3FDNA 3M11A 4QMWA 4QYGA 3RP9A 5L4QA 2BPMA 2YZAA 2XZSA 4IC8A 2GQGA 4QPSA 3DK7A 4RBLA 2B9JA 4JBPA 4YPDA 4HW7A 3HP2A 5IQDA 3H0YA 5J79A 2VTRA 3VULA 4XMOA 3NCGA 3G6HA 4DINA 3TDWA 3O96A 4MBLA 4HGSA 3UC3A 2QCSA 3PJ1A 3HV6A 3HNGA 2Z2WA 3POOA 5DR2A 5HBHA 2R3FA 4NM3A 5E4HA 5LOHA 3ZFXA 4FT3A 5HVYA 4JNWA 1WFCA 2W96B 3QKMA 5AADA 3MS9A 2YDJA 5D7AA 2O0UA 3MFTA 2VO0A 3QCQA 1PXMA 2DQ7X 4UALA 2XKEA 3ZDIA 5BVDA 5L2QA 5JFSA 1TQPA 5H2UA 2QC6A 4XP0A 4Y8DA 3TZ9A 3U51A 3ZTXA 5EYCA 1MRYA 4G16A 5LJJA 4ORKA 1IA8A 4PPCA 5AAEA 2W1FA 1LR4A 4QTEA 3LFSA 4KSQA 4N4SA 2BHEA 3FLZA 2C69A 4L43A 1J1CA 4AZEA 3LMHA 3F3VA 3OW4A 5J7BA 4HGEA 1KOAA 2ITYA 3GBZA 2PE2A 2BRNA 2X7FA 4D2PA 3UIMA 3KRXA 3ACKA 3IO7A 4EL9A 3GP0A 1XHAA 1YXXA 3MFRA 4ZS0A 3SDJA 4D1ZA 3P23A 3VS6A 4YSJA 4QP4A 1WBVA 2CGWA 3D7TB 2X2LA 3G5DA 3M1SA 1PRYA 1LUFA 5ETIA 3UG1A 4YJNA 2OFVA 3PPKA 3QLGA 4QQCA 5CT0A 5D12A 4BBMA 4FIGA 3E5AA 3F61A 3KVWA 3TZMA 3NAYA 4A9YA 4HYHA 4UYAA 3QQLA 4AN2A 5DT0A 4IM0A 4RT7A 4OTWA 3PTGA 4IMYA 4HZSA 3R83A 4WNPA 3UVQA 4WG4A 4CCBA 3UZRA 3HVCA 1OKVA 2QOBA 3OWKA 4KKGA 5EDRA 4C33A 4QPMA 5F4NA 4EBVA 3FC1X 1OBGA 1M7NA 4JX7A 5F20A 1W0XC 2YWPA 1QPDA 2HCKA 2XEZA 3JYAA 3LM5A 3O0GA 4DGOA 3I5ZA 3TNPC 4GW8A 3VN9A 4MX9A 2ITVA 3IW7A 4KBAA 3OT8A 4IM3A 4FTMA 4IX3A 3DAKA 2OG8A 5AM6A 5JZJA 4G3FA 2RG6A 3BCEA 5EI2A 3TJCA 1ZMVA 4TWNA 2VTTA 3MFUA 4W9WA 4BTFA 1PKDA 3EYHA 3Q2MA 5KBRA 5M06A 1OVEA 3LXPA 2VWVA 4PPBA 4GIHA 2W5AA 1O6KA 2XK6A 3BBWA 3ULIA 2CSNA 5KKRB 2VO3A 2XP2A 3R6XA 2KULA 4RX9A 2R3PA 3VNTA 4EUTA 2PTKA 5HTIA 2VNWA 3ORPA 4O83A 3IDBA 3FZSA 3GB2A 3FZPA 2JDRA 3UVRA 4DFYA 4EOMA 4O84A 3H9FA 1OBDA 1KSWA 2WTVA 5IA1A 3CQWA 3DY7A 4CXAA 5I9UA 4RIYB 5JKGA 4YHFA 3UJGA 4QYEA 3G15A 1L3RE 4KNBA 4ZJJA 4EZ5A 4AACA 4U7ZA 3KU2A 3W32A 2BRMA 2R4BA 4ZJVA 2IW8A 5M4IA 3OOMA 3LMIA 1PF8A 3MIYA 4UZDA 2YN8A 4ENXA 3QF9A 3GFEA 3PA3A 2WO6A 3A7JA 4FKWA 3IKAA 3QQHA 4YZCA 1JAMA 4LOQA 2YWVA 3D2KA 5HIDA 3CGOA 3RHKA 2ZV7A 2PMOX 4X21A 2WZJA 4EH9A 2P3GX 2R3RA 2Z7QA 5AMNA 3PIYA 4MTAA 5JRQA 1UU9A 3AD6A 4BGQA 2VWZA 3EIDA 1U4DA 3VBQA 4GIIA 5HE2A 3EN4A 3E8CA 1JKSA 4NKSA 4O21A 4YNOA 4M68A 5H8GA 4QMZA 5HE0A 3CCNA 3FLWA 4B7TA 4BI0A 4F9CA 4IJ9A 3ZBXA 2WU7A 2HIWA 4EI4A 3UDBA 1OPKA 4LOPA 2ACXA 4S34A 1Z5MA 1FINA 4FSWA 4GEOA 3MVLA 2X1NA 5HLNA 2XNGA 1REJA 3ATSA 4LL0A 3N4TA 3ZXTA 5CZIA 2GQSA 4FV0A 3MTLA 2ZM4A 5CEQA 4BHZA 3DBDA 4ZY4A 4PDYA 1K9AA 2P55A 2J5EA 3ENHA 4DAWA 1Q8UA 4O0RA 4I5MA 1PMUA 4OTDA 3PSCA 4IWPA 4BDJA 4WA9A 2UW4A 4CFFA 2V55A 2J7TA 5L3AA 3VF8A 4BDKA 3V5TA 3UMXA 4W9XA 1Z57A 4HOKA 3EFLA 4I4EA 1OIYA 2QQ7A 2R7IA 3D4QA 3HP5A 4FVPA 4RZWA 5DA3A 5C27A 4AE6A 5GIPE 1M7QA 3NYXA 3LCKA 4QP7A 2O2UA 3HX4A 3CEKA 5BNJA 2I6LA 3HEGA 4FV2A 2E9UA 4BFMA 4AU8A 3KXHA 5M44A 2HW7A 4TYHA 3CD3A 2YCSA 5M55A 3U9CA 1UNGA 5EI6A 3QCSA 3UE4A 3WF9A 1LP4A 4PL5A 3NGAA 4XV1A 2XNNA 3OXZA 4BIDA 4XOZA 3LJ1A 3OXTA 2ERZE 2C5OA 4QP2A 4TT7A 3FXZA 5M4FA 2Y6OA 4WNOA 3GFWA 4ZTRA 3TXOA 3RCJA 4GJ2A 1NW1A 1OKYA 3PJ3A 1UU7A 5E8ZA 4WIHA 1T45A 4DBNA 3QWKA 5FRIA 4DG2E 2GDOA 2JIIA 5EYMA 4F0IA 4PRJA 2OJFE 5AR4A 4F7SA 4BWXA 4NM5A 4Z16A 4U42A 3VHKA 3HMPA 4YNEA 3W10A 2CLQA 2UVYA 3BHVA 5AR7A 4O0SA 4HVGA 4F9YA 3H9RA 3NUPA 2PSQA 5E8UA 3BHUA 4FSUA 1RW8A 2HZ4A 3ODYX 4LI5A 4IWQA 4Q9SA 4D2RA 3N4VA 4FZDB 3DQWA 4QT1A 2IN6A 4A9TA 4DCEA 1PXLA 4IZYA 1W84A 4QMOA 3Q6WA 5K3YA 2UW8A 4MWIA 4IVAA 4CFMA 4CKJA 2OXYA 4ZTLA 4J97A 3R9HA 1HOWA 4BR3A 3PLSA 5HCZA 4PV0A 3MJ2A 2B7AA 3L8VA 4G6LA 1JVPP 4CGAA 4GVAA 5HESA 3ORXA 3DBQA 3QCXA 1FVRA 5CVGA 3ZUUA 4BI2A 4R3CA 4TYIA 4CFUA 5CEOA 4WOVA 4OBPA 2X6EA 3QZHA 4HCTA 3V8SA 4XNEA 4CKIA 4ITJA 4FSMA 3S00A 3MW1A 4FKIA 5HLWA 3OEFX 1IRKA 4DFLA 3HMIA 3PZEA 2VTMA 5CTPA 3VWAA 3EKNA 4DH8A 3U55A 1WBPA 4GT5A 1R39A 4K6ZA 2VTOA 3HYHA 5GJGA 1BMKA 1YWRA 1XWSA 4I23A 3AMYA 4EOQA 4WBBB 4DFNA 3DZQA 4NH1A 3ODZX 2IZSA 4C4EA 2P4IA 3P08A 4PDPA 4ACMA 3WF8A 2B9IA 3GU7A 2WMAA 2BMCA 4A4XA 3E87A 4I24A 1Z9XA 3LJ2A 4OTPA 3VUTA 4R7BA 3AGLA 5HICA 4RFYA 5JN2A 4R78A 2BAKA 3WIGA 5HVKA 1YOLA 1URWA 4YUQA 4D58A 3EKKA 4D0WA 4NIFB 4DBXA 2WHBA 5IU2A 2JIVA 3WF7A 4CCUA 4FL3A 5DR9A 2W1CA 2JDVA 4PMSA 3WZEA 4AFJA 4GYIA 2X2KA 4P4CA 2X0GA 2OZAA 4F63A 4FG7A 2R3LA 5BVEA 4BYIA 3R2BA 5IH5A 4RZVA 5DMZA 3A8WA 1OL2A 5L8KA 3OFMA 4BDHA 2GNJA 3LXNA 3MBLA 5BMMA 2VN9A 3WARA 5T3QA 3G90X 4NW6A 1VYZA 2QKRA 3F5GA 3SHEA 4DH5A 2W1EA 3WI6A 4CT2A 3BV3A 4KAOA 1OECA 3FUPA 3MA6A 3CP9A 4D2WA 4G5PA 1YRPA 3A60A 4J7BA 4CRSA 3FLYA 3COMA 2OJIA 2I7QA 2X8DA 1AGWA 3QUEA 5ETFA 4X6RA 4AW2A 2OH4A 3L8PA 3RAKA 3W18A 3MB7A 4Q5EA 3OC1A 3BLRA 2VX1A 3SXSA 2A27A 2YM3A 3A4OX 3Q60A 4EWQA 4ALWA 5CSPA 5FG8A 4F64A 4M97A 4RC2A 2QOHA 4E6AA 4NTTA 4I5HA 1QPJA 1YHVA 4RWJA 5DG5A 3PRIA 2JC6A 3RWPA 3KMWA 4XBUA 4DGMA 1YI4A 2V0DA 3BU3A 4YTHA 3CD8A 4ANBA 2E9PA 2XRWA 5ITAA 1ZYCA 2WTJA 2WQMA 5L2TA 3U54A 3C13A 4R7IA 4ALVA 3FLNC 4Q5HA 2QONA 2UW7A 5CF4A 3G33A 2QURA 3L8SA 1JKTA 2RFNA 4Y73A 3MDYA 2ONLA 3ORLA 2AYPA 4I6QA 1Q99A 3LCTA 4FZ7A 4P2KA 4FZ6A 4EOOA 4KRDA 3R9OA 3O71A 3D5WA 4EK5A 3FMMA 4FKQA 4I1ZA 1PMVA 1B6CB 4MD7E 3R8VA 4C34A 4F7NA 2X7GA 1Q8WA 2UW9A 2BZHB 3R7OA 4BWPA 4EYMA 4O7LA 3OWJA 4ASXA 4JQ7A 4AOJA 4C3FA 3KB7A 3Q4CA 3VRYA 4IFGA 5IUGA 5KZ0A 2QOKA 4ZZNA 4QMVA 2GNHA 3EN7A 3N9XA 4FV9A 4QP9A 3PUPA 2C0IA 2JBOA 3HKOA 4ZP5A 1QMZA 3CQUA 4JDHA 3FSKA 3W8QA 3TTJA 3E8DA 3P79A 4YU2A 4XG3A 3DBCA 3DB8A 3DKGA 3ORIA 4QPAA 4HGLA 5M53A 3Q5IA 4MF0A 4XG9A 2YIWA 4AS0A 3G2FA 3PJCA 3QTQA 2QO9A 3DQXA 3WZKA 5KKRC 3O8PA 4WSQA 3QGWA 5FP6A 1J7LA 2C6LA 5C4KA 4UMRA 5J87A 4B9DA 1OM1A 5TE0A 5IMXA 5CX9A 5C8NA 2XA4A 3U4WA 3P5KA 3QFVA 3MPMA 3TL8A 3TV6A 4RLKA 3PY3A 4AFEA 5I9XA 2C6DA 4I92A 4FV8A 2YITA 3OUNB 3BEGA 5CQUA 2LGCA 5KBQA 5EKOA 4XG2A 4ZY6A 5HU3A 4RRVA 5BYZA 5HG7A 2Q0NA 2V62A 4B99A 4EQCA 4RX5A 4AA5A 2VWUA 5IZFA 2IZUA 2C3IB 2PVMA 3TG1A 2HW6A 4F70A 3EQRA 2IW9A 2WTWA 4BCGA 5CENA 4IWDA 4EQUA 3PP1A 3NW7A 4QNYA 3FMJA 3NLBA 4NU1A 1UKHA 4EEVA 2XIRA 4R3RA 2QOQA 4O2ZA 3EFWA 4EH6A 5AP0A 4Y85A 4IAAA 1WZYA 1H4LA 2J5FA 3LCSA 4NEUA 2HYYA 2F7XE 3EQGA 1P5EA 3UOKA 4F7LA 3G9NA 2GNIA 4OR5A 4BCNA 2PK9A 4ZMEA 2Y7JA 1BX6A 4IZ5A 4YP8A 1OI9A 1PMNA 2UVXA 3PDTA 5J9LA 5D1JA 5CAPA 2YM7A 3NUUA 4II5A 2G2FA 4AZFA 2IVTA 2ZVAA 5EHOA 3FLQA 5H8EA 3GOPA 5TR6A 4X6QC 3RK5A 3S4QA 4JIKA 4H05A 1W8CA 3H0ZA 4UMUA 3QQUA 3ORMA 4QYYA 3D7ZA 4DGGA 3TNWA 3NUAA 2VNYA 1YXTA 1FGKA 2VTNA 4PL4A 3ULZA 3LZBA 1PMEA 3BQRA 5DFPA 5AM7A 3QAME 4EOPA 3AD5A 4GG7A 5CASA 2PHKA 3W1FA 5BVOA 1NVRA 3RPVA 2OZOA 3Q6UA 4YZBA 5TKDA 2GCDA 2QR8A 5CEPA 5LWMA 4MNFA 1J1BA 3QTSA 4FTRA 5EM8A 3WOWA 3ZSHA 5EK7A 5A14A 5JQ8A 1TVOA 3PYYA 3QCYA 3COHA 1YHSA 2OI4X 3LOKA 2R0IA 3IW5A 4TPTA 2GU8A 5JK3A 5A46A 3DDQA 4DG0E 5CANA 3MESA 5AUZA 4RJ3A 3LCDA 3W2QA 1XH8A 3ANRA 4K33A 2E9NA 4Z7HA 5CVFA 5I4NA 3ZUTA 3ET7A 4ZLOA 2QKWB 3KF7A 3UQGA 4FTOA 4PTGA 5EYKA 4QTAA 4RPVA 4WUAA 2H96A 3FPMA 3RGFA 2Z8CA 3R8PA 4BDBA 3O50A 4MXOA 4FOBA 3F7WA 4M0ZA 1KE7A 4AN9A 3UQCA 1NY3A 1NXKA 3RWQA 3GCUA 3UP2A 3FZTA 2Z7SA 4BCPA 3RPSA 4CZUA 4IWOA 5HIBA 3VJNA 1P2AA 3NPCA 4V0GB 3DK3A 4YPSA 5AA9A 5GIOE 1O9UA 5IQHA 1QL6A 3BU6A 4F99A 1P4FA 3DJ7A 4JAIA 2CNVA 4NK9A 3PPJA 4YZ9A 2QLQA 3F69A 2XB7A 2J51A 2XM8A 4DTKA 2BZJA 4FEWA 2EB2A 2ITXA 3LLTA 3W2RA 3LMGA 4EJ7A 5K4IA 3JUHA 4ANOA 3CSVA 5L6WL 4BB4A 2R7BA 2UW5A 4FICA 3ORNA 4O38A 4HYUA 2X4FA 4JR7A 1XKKA 3UZPA 3EN6A 3FI8A 2VTHA 5ANGA 2WMXA 4XLIA 3KN6A 4L46A 4JOAA 3LM0A 1ZYLA 3UO5A 4I3ZA 3W2PA 3IW8A 3QQFA 2AC5A 3CY3A 3QHWA 1PXPA 3MV5A 3DXNA 4FIHA 4Y5HA 3GC0A 1GAGA 4UWBA 4DH1A 2Z7RA 3FBVA 4NWMA 4U5JA 3QTIA 5IA3A 2WQBA 4PF4A 3RPOA 5DOSA 3DFCB 4FODA 5EOLA 4J95A 1PYXA 3ZFMA 3UGCA 4I94A 4IX6A 2XNEA 5G6VA 5LMAA 3R22A 5M07A 2PZYA 3GU4A 3UVPA 5I9ZA 3UPZA 3QKKA 1W98A 3Q4TA 3V3VA 3LFAA 2WTCA 1H1PA 1O6YA 4C62A 2W05A 4J71A 1KOBA 2WOUA 4XG8A 4X7QA 4A9UA 5AX9A 2CGVA 2HAKA 4KIPA 2REIA 2E9VA 3P78A 4UWYA 3SG9A 4FKRA 3AGMA 2UZLA 4LGHA 4I5CA 2G01A 1OIQA 2GNGA 4YSMA 3UNZA 4BF2A 4M66A 3ORZA 4PP9A 2O3PA 3H30A 5CF8A 4GSBA 3VUMA 1CMKE 1YWNA 3OD6X 2LAVA 4Y95A 3QBNA 5HGIA 4RIXB 5IG1A 5K0KA 2BDJA 5JH6A 3ZRKA 5ANKA 1OGUA 4UZHA 2Y6MA 2IZRA 5J1WA 4GG5A 3SXFA 3RNYA 4QQJA 2PVRA 2UZOA 3KN5A 5ACKA 4NT4A 4CFVA 4GFGA 4K77A 4ACGA 4DH3A 4E6CA 3JR1A 3N4UA 4F6WA 2YJRA 3VIDA 4AT4A 4F65A 4QQTA 2GHGA 4DT9A 3GU6A 5AUXA 5HHWA 4G3CA 5FLFA 5BVNA 3EMGA 1ZYJA 3FKOA 3M42A 3ZC6A 5BQ0A 1G8AA 4AGWA 4ANQA 4JDIA 4MXCA 1OMWA 3NNXA 4OTHA 2QU6A 2RIOA 3QGYA 4YJOA 5EW8A 2HWOA 3SOCA 2O65A 2QHNA 3JY9A 2OIBA 4L44A 1XO2B 4FG8A 5B2KA 2FSTX 1JSVA 1Q8YA 4E6DA 3BGPA 1YI3A 5CAOA 5CEIA 3C0GA 4PTCA 2PVHA 3LAUA 4OTRA 1FMKA 3P4KA 3REPA 3UC4A 4E4LA 3GI3A 4U3ZA 3F88A 2CJMA 2C5XA 1BLXA 2E2BA 4U0IA 1ZZLA 3JXWA 3WYYA 2WTDA 4C2VA 3IONA 3ZEWA 3VS4A 1WBWA 3F2NA 2ITTA 3KXZA 4H3PA 4BZDA 2PZPA 4J8NA 2FYSA 3FY0A 2CKPA 3HGKA 1SVGA 2PZRA 4J98A 3AC2A 4LYNA 2DUVA 5IMEA 3KY2A 1M17A 4RIOA 3MH2A 4MXYA 4YC3A 5GNKA 3DNEA 3EH9A 1P14A 3UOLA 3ZLWA 4AT3A 2DS1A 4EH5A 5GZAA 1GIJA 3AT2A 4O7NA 1KE5A 2X7OA 3FI4A 3W2SA 4LG4A 3B2WA 3WIKA 1H00A 3HL7A 5IA5A 4N57A 1LEZA 1H0VA 5JFXA 2UV2A 3WZDA 3MA3A 4BCQA 3G0EA 1ZRZA 2A0CX 4M15A 5A4QA 3OROA 4XRJA 4UWCA 4L68A 3EQBA 2VO6A 1OIUA 4R1YA 3TDVA 2YAAA 3Q9XA 4G31A 4JG8A 4ZTHA 2C3JA 1NA7A 4E93A 2F7ZE 4G2FA 4V05A 3QRIA 4R8QA 3MVJA 3NUXA 2UVZA 4ASZA 1RDQE 3OWLA 2WMWA 2J6MA 4AGUA 2BAQA 3MSSA 3RKBA 3IGOA 2OFUA 3ALNA 3BQCA 2IJMA 4IC7A 5JMSA 4PP7A 2CKEA 2VWIA 2BIKB 2G15A 1YWVA 4FNZA 3FMDA 4IBMA 3O23A 5EM6A 1AQ1A 1DAYA 3UYTA 5EQEA 1B38A 4AZVA 2WQNA 4B8MA 1PKGA 1KE8A 1WAKA 2R64A 4C02A 4DEHA 5BUIA 1IG1A 2FSOX 4BWKA 4GFMA 4L9IA 3EWHA 3ZRMA 2JBPA 3SRVB 5F94A 3PE2A 5LVMA 5K5XA 4OTGA 3HA6A 4C59A 4FIFA 2ZV8A 3K5UA 3U6HA 3QKLA 5JGAA 3TUBA 4WD5A 4QYHA 3EN5A 4CV9A 4E7WA 3T8OA 3NVKI 3DKFA 5CVHA 3FI2A 1BI7A 2JDTA 4U3YA 3KREA 4FV5A 5IQFA 2PU8A 3LVPA 4RIYA 5HX8A 2KTYA 3ZLXA 3NS9A 5EKNA 2PVKA 2V7AA 2HY81 2JKOA 5A9UA 3VBVA 3FKLA 4M69A 2RL5A 3VO3A 3QD4A 4IXPA 4L3PA 4O82A 3VS3A 4X3FA 4AN3A 2C1BA 3IQ7A 4YJSA 3B8RA 5HG8A 2YACA 4YMJA 5HD4A 2BAJA 2J9MA 2W06A 3HDMA 4QMXA 3AG9A 3C4WA 4FIJA 2PULA 4AX8A 3A61A 4P90A 4NFMA 2CHLA 4CMTA 3VS5A 2GNLA 4GVJA 4GFOA 5CEKA 3OOGA 2YM6A 4LMNA 4U45A 4PX6A 4ZOGA 4CRLA 2JDSA 2F9GA 4V0GA 2R3JA 4GUBA 5HZNA 4QP8A 2I0YA 4AOTA 5IH6A 3BWJA 4IANA 4D5HA 5CAVA 2NNWB 4LV5A 3D83A 4W4WA 2IPXA 4MD8E 1CSNA 5H9BA 2XH5A 4P5QA 2VU3A 2XK9A 4FTQA 4GK4A 2XK7A 5DRBA 3VW6A 2UZWE 3F82A 3SW4A 2JAMA 2QU5A 3V04A 4FTLA 2BRHA 2G2HA 3OWPA 1IR3A 4X3JA 1JBPE 3OF0A 4F1TA 3R02A 3GNIB 4JI9A 3V6SA 4FIEA 3V8WA 3GQLA 4H3QA 3CR0A 2J0JA 3AT3A 2O8YA 1Q8ZA 4FT7A 2XBJA 4O6EA 5B2MA 1DM2A 2F49A 4YZDA 3S1HA 2XNBA 3HV7A 4O6LA 4FKGA 4IHPA 4ZSEA 5HBJA 4FKTA 1Y57A 2BZKB 4FSTA 4LOOA 4H3BA 3R7VA 5K0XA 4L01A 4LRKA 3RMFA 3SOAA 2OIDA 3V5QA 4UY9A 4IW0A 3OZ6A 3ZONA 2BRGA 2RGPA 3O8UA 2I0VA 4XRLA 2R9SA 5J9YA 3ZH8A 3HRFA 2HWPA 3VHEA 3E88A 3MYGA 2W4OA 4M84A 3BE2A 2X8IA 3PY1A 5TO8A 4W8DA 3RAWA 4AE9A 2WMVA 5EG3A 4BRXA 4D0XA 4F9WA 5DE2A 5JEBA 3R7IA 4EK6A 2WPAA 2WAJA 1R0EA 3QXOA 2WTKC 4RX7A 3DFAA 2B9HA 4E5BA 2YHVA 2JEDA 3NEWA 1ZOEA 1UVRA 4D4YA 1H24A 1H01A 4RA5A 2UZVA 3I4BA 3IG7A 2OICA 4BZOA 2UW3A 3DAEA 3E7VA 3MB6A 3QD0A 4K9YA 4RJ8A 2ZB0A 4WRGA 2A2AA 3COIA 4EK3A 2YLEA 2EXCX 3OTUA 5AX3A 4JIAA 4JT3A 4MXXA 3POZA 2V5QA 3DGKA 4IX4A 2O64A 4RIXA 3KEXA 3R21A 1UV5A 2J0KA 5ANJA 1M2PA 5DNRA 4E73A 3LQ3A 3BPRA 3MJ1A 3PRFA 4L3LA 1APME 5KMNA 1OL6A 2VGPA 3PSBA 1R1WA 5LARA 4U80A 3FLSA 3SKCA 1FVTA 2B52A 4CMUA 3O8TA 2CNUA 2FH9A 3IOPA 4I93A 2R3OA 4W4VA 5FBNC 5M4CA 2R3HA 1SYKA 3QHRA 4KD1A 2QG7A 4FZAB 4TYJA 2I1MA 5GJDA 2WMSA 5BPYA 4CD0A 4A7CA 3U8WA 3C0IA 4TL0A 4WT6A 4OW8A 4DFZE 4ZZOA 4AP7A 1SVEA 3BELA 5B7VA 4EORA 1OIRA 3EQHA 2GTNA 3SAYA 4HCVA 3AT4A 4BDGA 5J9ZA 3E93A 4MXAA 4BTKA 5KHXA 3SW7A 2XNPA 4P7EA 3EZVA 1G3NA 4ZZMA 3RTPA 3E62A 3DOGA 4UXQA 1KWPA 2OJ9A 3ZDUA 2CCIA 1MRUA 2ITQA 1U59A 2XVDA 3ROCA 3OY3A 2GHLA 2HZ0A 4YBJA 4DH7A 1RQQA 3GCPA 4J52A 5HCXA 1OUYA 3R8MA 2YDKA 4MWHA 3VUGA 5E8WA 3TI1A 1MUOA 1W83A 3HAVA 2XF0A 4XH6A 3EOCA 4F1MA 4XS2A 5TOZA 3U6JA 3DXQA 2OIQA 5DBXA 2C4GA 2VAGA 4DA5A 2QI8A 4QMMA 3SLSA 4F0GA 4YBKA 3CJGA 1Y6AA 1YDTE 3I0OA 3EQFA 3MVMA 1Q61A 2EU9A 4MQ2A 3WILA 5G1XA 4D28A 3UTOA 1VR2A 2PVYA 4K18A 1OPLA 2IWIA 3UPXA 4KWPA 4FTTA 1UU3A 2W1ZA 3EQPA 3N51A 1FMOE 1OL7A 2YDIA 3R00A 4IDTA 1FPUA 3QQJA 3TV7A 5I9VA 4C0TA 5E1SA 1JQHA 4DLIA 4CYJA 4ZTMA 4TW9A 5IQCA 2BTRA 5IQGA 2ZMDA 1PHKA 3F2AA 4ANLA 2H8HA 2QLUA 5DN3A 4GU9A 4UXLA 4WNMA 2CN8A 4LGGA 4QMQA 2ETKA 2PPQA 4EBWA 1PXJA 2CMWA 4U41A 3TJDA 5AEPA 4M13A 4FEUA 5FBOA 2W5BA 4H39A 3SXRA 4BVUA 4N70A 3K2LA 2PMNX 4UYNA 4MNEA 4Y72A 1M2RA 4O7TA 4MQ1A 2NRYA 4GRBA 1CKIA 1ZMWA 4L7SA 5LCJA 2X6DA 5A6NA 3ZM4A 3F7ZA 3FSFA 5CALA 5AV1A 4J1RA 4O96A 3FMHA 2YERA 3EZRA 3PY0A 2GNFA 5HOAA 3Q9ZA 1BL7A 5AV2A 2W0JA 4BKYA 1F0QA 2H9VA 3D15A 3NUNA 4NM0A 4BDCA 3Q9WA 4RFZA 4KA3A 2IVVA 4D2VA 3TKHA 3VUKA 3UIXA 5KZIA 2EWAA 2UZTA 1R3CA 5CI7A 4EC9A 3HV4A 3TM0A 4DE4A 4LFIA 4YHTA 4G9CA 4XBRA 3R71A 2PY3A 4D4VA 1YXVA 3ENMA 2C5NA 2IVUA 3E92A 4PL3A 5AP5A 2VX3A 3V5WA 3PVUA 3ETAA 5IEXA 5IH4A 2IG7A 5FXRA 3AC4A 5J5TA 4OBQA 4RWIA 5CQWA 4MK0A 1STCE 3ZOSA 2ZYBA 3CJFA 2ITOA 2PVNA 3BWFA 1QPEA 1V1KA 3RK7A 4TTHB 4E5AX 2C6MA 4F9BA 3GU8A 4IJPA 3CTQA 5IF1A 5KMIA 3CTHA 1ZOGA 2OXDA 5FTQA 4C8BA 3UNJA 4LUEA 4EHGA 1Q62A 1R0PA 3PWDA 5M08A 3KFAA 4Z7GA 4IB5A 2V7OA 3VBYA 3ATTA 4KINA 4BCFA 2CNQA 2G9XA 5HE3A 2P2HA 4NKAA 1IA9A 4E4MA 4FK3A 2CKOA 3FXWA 1GZKA 2W4KA 3KCFA 5IQBA 4C4HA 3VQUA 5IUHA 2PUNA 2WXVA 3II5A 2QOOA 5IA4A 3DDPA 4DEEA 4K2RA 3RHXA 1KV2A 4U40A 2WTKB 2GFSA 2QD9A 3PE1A 1QPCA 4NW5A 3OBGA 4FEXA 4LQMA 3QWJA 3VJOA 2JIUA 3NW5A 3EN9A 4E4NA 1GOLA 3ALOA 4U81A 4XG4A 2XIKA 4JLCA 4C7TA 2V22A 3HV5A 3KXNA 3RALA 4R1VA 4S30A 4C3RA 4CKRA 3BRBA 1WVWA 2XEYA 2ITZA 4Y46A 2WU6A 4WG3A 4WO5A 4E1ZA 3I1AA 3D0EA 4ZK5A 2ITNA 3FEGA 1DAWA 2VTIA 1V0OA 3PZHA 4FL2A 4E5WA 3V5LA 4S33A 3KXGA 2ERKA 2GTMA 5EM7A 2BRBA 4GMYA 2FO0A 4YJVA 3R9DA 1J7IA 3HMOA 2QHMA 4FX3A 2G2IA 3ANQA 5DVRA 3CC6A 2PWLA 4M14A 2R0UA 3G0FA 4FEVA 5CWZA 3IW6A 4V01A 1A48A 4AF3A 3MFSA 2VTAA 3E3BX 5FDPA 3ZFYA 2E9OA 2XIXA 5HNBA 4FBXA 2WD1A 3IK3A 5A4EA 1X8BA 5IKWA 3RVGA 4F08A 4FVQA 2CN5A 4XP2A 4DGLC 4IE9A 1YOMA 3P7BA 3HZTA 1S9JA 4EC8A 3QLFA 3TKUA 3C5UA 4H58A 4XJ0A 1ZLTA 4PDOA 2RFSA 3UMWA 3LFNA 3JPVA 3JVSA 1TKIA 4CQEA 4UN0C 5A4TA 3C5IA 1ZWSA 4JRNA 4LL5A 3C4XA 2W1IA 5AUTA 3MPAA 1H1RA 3OP5A 4U6RA 4HVSA 2BIYA 3P7CA 4I21A 2C6KA 1Q41A 5LWNA 4H36A 5DT4A 1OUKA 5DWRA 5AUYA 5AV0A 3QUDA 3UBDA 3AC5A 3R7GA 5DT3A 4I6FA 4UV0A 4K1BA 4A4LA 4DEIA 2XM9A 3BE9A 3NZ0A 3PP0A 2BILB 3U9NA 3BKBA 4A9SA 4IX5A 4BBEA 4R6VA 5IISA 5E7RA 4FK6A 1I09A 4OAUC 3GCVA 4CTBA 1IAJA 3O7LB 4MF1A 5FEDA 3RM7A 2VTSA 4F6SA 4D55A 2JD5A 2UZEA 4RIWA 4ASEA 2YIYA 3NIEA 5IQEA 3B8QA 2IW6A 2NPQA 3FMNA 3FQHA 4NCTC 4QMPA 4BIEA 4XG7A 2P33A 2UW6A 1SNXA 4TYGA 3FMLA 3THBA 5C1QB 3L9NA 4IAFA 1HCKA 4B6LA 3TCPA 2ZAZA 3FHIA 2PMLX 3QYWA 4K11A 3O17A 1SM2A 1ATPE 4USDA 4IACA 5AP4A 1ZARA 2C6IA 4MKCA 5AP6A 4QD6A 1ZXEA 3A7FA 3UNKA 1H8FA 5GZ8A 3LPBA 3KRRA 3R30A 5KE0A 4UBAA 4NUSA 4RA4A 4C2WA 3FZ1A 3F3WA 3NUSA 2J4ZA 4JXFA 3VS1A 3NMUF 2VV9A 2OKRA 4DYMA 4KIOA 4ID7A 4YR8A 2OZAB 3D2IA 2BR1A 4PUZA 5CSHA 5EHYA 2ITUA 2QR7A 3JS2A 3KULB 4EH2A 4MXZA 4CEGA 3CS9A 4LV8A 4CZYB 1FBNA 3ID6C 1LEWA 2BFYA 4M7IA 4EJNA 3TZ7A 4J96A 5HKMA 5M51A 1WVYA 5L6OA 4DCAA 5B0XA 4NTSA 4XUFA 1UNHA 3CKWA 5KMJA 4BTMA 3DXPA 2YAKA 4AW5A 3RAIA 5HQ0A 5A54A 5FM2A 2ONLC 3U4UA 4S31A 3QC4A 4XYFA 2PL0A 3R04A 3TIZA 2QOFA 4D4RA 4O0UA 4O0XA 4D2SA 4DG3E 3VS0A 4YURA 4NJDA 3PA4A 4FNWA 4AOIA 3C0HA 4CZTA 3EFKA 2W1GA 3R2YA 3CPCA 4WSYA 1W82A 5HNIX 2CKQA 3R1SA 3Q53A 1PY5A 3TEIA 2X9EA 4AT5A 5I5ZA 3EQCA 2YFXA 4CMOA 5KHWA 4GK2A 4CLIA 2PE0A 4FIIA 5M57A 2C3KA 3QTWA 2BKKA 2UUEA 2FSMX 4EUUA 4EOIA 3SGCA 4L00A 3EFJA 4O7RA 2C1AA 4QNAA 4E20A 5AAFA 5HLPA 5CXZA 2VWWA 5HEZA 2HELA 3DAJA 2P0CA 4CSVA 3MH0A 4FNXA 2R3NA 3DNDA 1JLUE 1TQIA 4MEDA 1M2QA 2J2IB 3C51A 4Q2AA 4FVRA 1GNGA 2WMTA 5DGZA 5EW9A 5J95A 2F7EE 3CLYA 2DWBA 1FVVA 3A99A 4Y5QA 1LPUA 1ZMUA 4U97A 4A07A 4RVTA 4O7YA 2W17A 3OY1A 4KIKB 5LVPA 4D1SA 2ZJWA 4G9RA 5C8KA 2F4JA 1GIHA 3S95A 3ZZWA 5LCKA 3PXRA 3EQIA 1H1SA 3A7GA 4O7WA 3ZBFA 1ZOHA 3W16A 3ZZEA 3FZRA 4JDKA 3RINA 3FL4A 3TACA 5AJQA 4FYOA 5ANEA 5CNNA 2C6EA 2C5VA 5AFVA 5CXHA 2WIHA 1XH6A 2EVAA 3GCSA 3PWYA 2XKCA 3CY2A 4IB1A 3HMNA 3A7HA 2OU7A 4J99A 3D5XA 3C50A 4F7JA 4MD9E 5GZ9A 5IEYA 3FYJX 4NJ3A 2QO7A 4BIBA 5IQIA 4PMMA 2CDZA 2XUUA 4AZTA 3LJ0A 2R5TA 3NWWA 4DLJA 4EKLA 4O81A 4PPAA 3WYXA 3LW0A 4KABA 4N6ZA 5FWKK 3ZM9A 1FQ1B 3R9RA 1CKJA 5CAUA 3D7TA 3DLZA 5CSVA 1H07A 2WFYA 3IDPA 5C03A 3SVVA 1ERKA 4A4OA 2JAVA 4TXCA 2X39A 1PYEA 4CFWA 4EWHA 3HA8A 3OCBA 1U46A 4AQCA 4C38A 4TNBA 1JPAA 5CU2A 2GS7A 4CFXA 1G5SA 2QOIA 4I20A 4LMUA 3TWJA 1XR1A 3TZ8A 1ZYDA 2ZM3A 4DTBA 5JGBA 1OB3A 3BYMA 1BUHA 3H4JA 3RI1A 1K3AA 3KGAA 1WBSA 4C4GA 2O5KA 3PSDA 3BGQA 5HCYA 3NCZA 3F3ZA 1S9IA 4PMPA 3HUCA 3QD2B 5I9YA 1Q3WA 4BCJA 3KL8A 2X8EA 2SRCA 3OMVA 3ZS5A 5KNJA 3R1QA 3FHRA 4FZFB 4DFBA 3EJ1A 4LRMA 4M8TA 2WOTA 4XHKB 3RM6A 3A7IA 3DBFA 3R01A 4KS7A 5L8JA 4IAIA 4JL9A 4ZLZA 1J91A 3QTUA 3QXPA 3F5XA 4B0GA 2C6TA 4CV8A 3AC1A 4IAYA 4MBJA 4S2ZA 3EB0A 4JQEA 3FXXA 4L52A 3S3IA 1ZYSA 3E8NA 3ERKA 2Y9QA 3ZEPA 3L9LA 4AA4A 4HPTE 3PVGA 1JWHA 1CKPA 2YABA 4J8MA 4MCVA 3FC2A 3Q4ZA 4I6BA 1L8TA 3HV3A 3KXMA 3AC8A 3BX5A 5HG5A 2ZMCA 4QOXA 4QMLA 3T9IA 4BCMA 5CF5A 3P86A 4DN5A 4WG5A 5FM3A 1E1XA 4BCKA 4O0YA 4HCUA 1WBNA 5EHLA 1JOWB 2ESMA 3E63A 4DEBA 4DFUA 3OCTA 3QALE 2B54A 4RMZA 3FAAA 3GT8A 4ACCA 3ZSIA 2OW3A 4ERWA 4ERKA 2WEIA 2XIZA 4TKSA 5HNGA 4FC0A 1OPJA 4EYJA 5LVNA 1XH4A 4ZTNA 2PUIA 3NR9A 2UZUE 3G51A 4XV3A 1FGIA 1PXNA 3GC9A 3PXQA 4EKKA 5I3RA 1IASA 5D11A 3PIZA 4OUCA 3NIZA 3UQFA 3ZU7A 5EYDA 2EUFB 4C57A 3DKOA 4IZAA 3PIXA 2J0MB 1DI8A 3GENA 3RNIA 4AAAA 3KA0A 4NL0A 5IA0A 5H3QA 1HCLA 2OXXA 1XBCA 4FV3A 3VS2A 2R2PA 5TF9A 2XK8A 5LMKA 3PVWA 3E7OA 2JKQA 4RVLA 4I0TA 4BKJA 1B39A 2FB8A 3VAPA 4RG0A 4WRSA 1YOJA 4K8AA 1YQJA 4ITHA 3BIZA 2C47A 4LGDA 4F1OA 4O0WA 1JKLA 4U44A 4Z3VA 4FKPA 1FOTA 4ANMA 5FTOA 3MH1A 3AOXA 2WQOA 3I6UA 3R8LA 3NSZA 5AUUA 3W33A 3GVUA 3I7CA 4MVFA 2GS2A 3FPQA 3UIBA 4H1MA 3R8ZA 4R5YA 3QX4A 4CNHA 1UA2A 3E3PA 4MNEB 5L6PA 4WKQA 1Q97A 4OTIA 4EK8A 1G8SA 3IGGA 2I40A 3A8XA 2Z60A 1YI6A 3RPRA 5CY3A 3WF6A 3BYUA 3FWQA 5FGKA 3KULA 4FGBA 2WELA 3QU0A 5DEYA 4ANNA 3DJ5A 3S2PA 3K3IA 4XG6A 4FSQA 1YXUA 5EFQA 4YO4A 4YJUA 1MQ4A 1SMHA 4IB3A 2B0QA 5E8TA 2Y4IB 4UMPA 3BHTA 5J1VA 2CLXA 1E9HA 2UZDA 4AGCA 3DLSA 3OXIA 4MBIA 2B4SB 5BUEA 3CIKA 3MN3A 2XK4A 3ORKA 3E8EA 4CG8A 3K54A 3Q52A 3UYSA 1J7UA 4FTJA 5F9EA 2RFEA 3TT0A 4GK3A 4F09A 5D41A 3L9PA 5EDPA 1NVQA 2PVFA 4I0RA 4YZNA 1PJKA 4PTEA 2Y4PA 3R8UA 1I44A 4TY1A 4KIKA 4TNDA 2BTSA 5GHVA 3R7EA 4BDFA 3DBEA 2ETMA 2A1AB 4RJ7A 4R3PA 4L53A 2XIYA 3DA6A 3VBXA 4E26A 5KMLA 3KK8A 2WQEA 1Q5KA 4HYSA 4UMQA 3TV4A 2YCQA 3ZXZA 4B4LA 5HIEA 3FY2A 2HXLA 3MWUA 3O51A 3IS5A 4L3JA 5CU4A 4FKSA 2BUJA 4FT5A 4JVGA 4W4XA 2EXEA 3NW6A 1H26A 4U8ZA 4WNKA 4RFMA 3BLHA 5GINE 3PJ2A 3QX2A 3GOKA 5F95A 2VWBA 4JJRA 3GEQA 4WHZA 3I60A 2BHHA 2XK3A 1BYGA 4QP6A 1NT2A 2Z02A 3NAXA 4GT3A 5FUTA 2B9FA 5LVOA 3MIAA 4FKUA 1UWHA 4EOKA 2YIXA 3U6IA 3Q04A 1JSUA 1PXOA 2F2CB 4OT6A 5J7HA 5KX8A 2BVAA 3ZHPC 3FMEA 3ZO4A 1TQMA 4XV2A 5AIKA 3SA0A 3IECA 1GZ8A 3QQKA 2YIRA 4FSNA 4ZTSA 4YTIA 4BDEA 2GHMA 2UZBA 5DI1A 5E8VA 1R78A 2PUUA 4APPA 4G6NA 4BL1A 4GH2A 4X2GA 5FXSA 1REKA 2CCHA 4QO9A 2EXMA 4W4YA 3E64A 2J0LA 2WTIA 4IVDA 2X4ZA 2PVLA 4BN1A 4O0VA 4APCA 3O2MA 3OT3A 3LKMA 1VZOA 4NZWB 2PUPA 4S32A 3GC8A 3PXFA 3BLQA 4WBOA 4ZJIA 2P2IA 5CS6A 4Z55A 4X3FC 4GYGA 4EZ3A 3CBLA 2WKMA 3LHJA 3L8XA 5JT2A 3QZIA 5CI6A 3OTVA 3QC9A 5CF6A 3SV0A 2W5HA 5M56A 4TWOA 4FTCA 4F0FA 2R3IA 3P0MA 5ANOA 5FD2A 4RQVA 3FE3A 3BHYA 4KKHA 3A62A 4A9RA 5HE1A 2J50A 5AAGA 1E1VA 2OK1A 3ZRLA 4JBOA 5AP1A 3C4FA 3EYGA 4M0YA 3ZMMA 3DT1A 4AWIA 4HVHA 3SC1A 3ELJA 4IADA 4YLLA 5AR3A 4USEA 4E3CA 3LFDA 4YJPA 2YM5A 5M4UA 4OT5A 3VUHA 4ZAUA 4LRJA 3KC3A 4FT0A 5DHJA 1XH5A 3G6GA 4R5SA 2OSCA 4TWPA 4NIFA 3ZYAA 3UP7A 1VEBA 2Y0AA 5HU9A 5C8MA 3VUIA 3TUCA 5CSXA 4IDVA 4FMQA 3DV3A 4FNYA 4IIRA 1MP8A 4O7SA 3B2TA 3ZO1A 1UKIA 3PLAE 4O7ZA 4M69B 4ZSGA 4HNIA 4IM2A 2YIQA 3CTJA 1BI8A 4RWLA 5HTBA 5I0BA 2PYWA 3AMBA 2FVDA 4G3EA 4BYJA 3PA5A 4OTQA 1WBTA 4GUEA 4JBQA 1V0BA 2JDOA 2FUMA 1H08A 1JNKA 3MY5A 4LUDA 4O1PA 2WMUA 5M09A 4DT8A 4EK4A 3HDNA 5IPJA 4JS8A 4GS6A 2ZV2A 3SRVA 3A2CA 1OZ1A 3BEAA 3WZJA 4AW0A 3DPKA 4JG7A 4BTJA 2XS0A 3BU5A 1DI9A 4O91A 2OH0E 4PQNA 5KMOA 2RFDA 3PPZA 2C5YA 3OEZA 5HD7A 4AW1A 4CFNA 2ZDTA 1XH9A 3IOKA 2WB8A 4C4IA 4JRVA 4RWKA 2C0TA 2C3LA 1GZNA 2CPKE 2FGIA 4I22A 4NCTA 4YGAA 4BDAA 3D5VA 4OGRA 2XJ1A 5AIRA 5LQFA 2BFXA 2XNOA 3PXKA 5AWMA 3ZO3A 4Q9ZA 3GC7A 4ACHA 1XBAA 3NX8A 4UEUA 2VO7A 5C4LA 4DITA 3KMMA 5A3XA 1BKXA 3MGYA 1K2PA 5FEEA 4X3FB 3JY0A 4IH8A 4KS8A 2YZLA 5E9EA 4YJRA 3NYNA 4K0YA 4BCIA 4X0MA 2EB3A 4EOJA 5HO7A 5AUVA 3OBJA 4G5JA 1YXSA 3QQGA 2ZV9A 4RVMA 3P1AA 4AZWA 4KBKA 3HMMA 4I6HA 1ZY4A 1JKKA 4MHAA 1YHWA 4RVKA 4FE2A 4ACDA 1WBOA 3R7UA 2A4LA 3UOJA 2IO6A 2J0IA 2YEXA 4RJ6A 4BHNA 4I41A 1H27A 3NNWA 5EDQA 3F3TA 1U5QA 3NVMB 5FEQA 2HOGA 1A06A 2H34A 1H1WA 2R3MA 3DU8A 4QTDA 4RC3A 4U9AA 5E8XA 4FKJA 5DPVA 4JX3A 3DZOA 1YDRE 2W99B 4M3QA 3NUYA 3OCGA 3F5UA 4TYHB 3RBWA 3BGZA 4OBOA 3VBTA 2GMXA 3F6XA 3Q2JA 3Q3BA 3VF9A 5CU3A 5ICPA 1V0PA 5C01A 4ARKA 3LQ5A 3V5PA 3H9OA 2XJ0A 3F2RA 2R3GA 4BBFA 1PW2A 4X2KA 3TKIA 3QRTA 1UU8A 3KK9A 2ITWA 3LIJA 3NNVA 1H28A 4HNFA 3VW8A 4BY9E 4D1XA 1MRVA 1W7HA 3T3UA 3D5UA 5DH3A 4PNKA 2QNJA 5L2SA 4D5KA 2VWXA 2ETRA 3TN8A 2HZIA 2Z7LA 2RKUA 3O7LD 5B2LA 3K5VA 3HRBA 1GY3A 3C1XA 3BV2A 3L1SA 4A06A 3IPHA 1SNUA 1Y8YA 5FP5A 2GSFA 2VTLA 3QTXA 4MH7A 4IVBA 3IW4A 4YJQA 5HO8A 3GUBA 3A4PA 2PZIA 5E90A 2XYNA 4ZEGA 4D9TA 3VS7A 1BL6A 3AC3A 5JRSA 1YVJA 1IEPA 4DEAA 4AA0A 2OBJA 4FL1A 4EH3A 1ZY5A 2OJGA 3LFCA 2JKKA 4GCJA 3TNHA 1CDKA 2W1HA 4NSTA 2Q0BA 2HK5A 3QD3A 4KSPA 3UOHA 1DS5A 1OL1A 5D7VA 3UODA 4EH4A 5JGDA 3GXLA 5HI2A 4C61A 3TTIA 4FGRA 5CZHA 4FOCA 4O86A 5E8YA 4FKLA 1Y8GA 5T68A 3WBLA 4FV6A 2A19B 4HVIA 4R7HA 2VUWA 1GZOA 1KE9A 2XNMA 3R1NA 4P5ZA 3RZFA 3F3UA 4PDSA 3UIUA 2XCHA 3LFEA 1XQZA 2C30A 2XKDA 1SZMA 2JLDA 2YISA 1F5QA 5E8SA 4ZSLA 3SX9A 4BC6A 4DEGA 5KUPA 2PZ5A 3RPYA 4QMNA 5AV4A 3ACJA 3MY1A 5DLSA 2NRUA 4L8MA 5ETCA 3ZO2A 4DEDA 4HVDA 5H8BA 3PFQA 5KMKA 4ZY5A 2JGZA 4XCUA 4Z9LA 3Q4UA 3KMUA 4IQ6A 4M67A 5CT7A 5A6OA 4L67A 5I3OA 4OAVB 4I0SA 4O27B 4QMTA 4GV1A 4FKVA 4AGDA 4UMTA 1RE8A 3Q5ZA 4ZIMA 4HPUE 1UWJA 5BMSA 3I79A 4TN6A 3NNUA 5AP3A 5JZNA 4I5PA 4ZSAA 5KO1A 4HJOA 5FXQA 3LCOA 4F6UA 2FSLX 5C9CA 3DTWA 1VJYA 4YTCA 3R9NA 2QO2A 4MYGA 4EONA 2QODA 2BROA 2J90A 5CYIA 2OGVA 4C3PA 3NYVA 4PNIA 1Q3DA 5CAQA 2W9ZB 4J53A 1U5RA 3PXYA 3QRKA 3QZGA 4KIQA 2VTJA 1GJOA 2PMIA 4RGJA 2PVJA 4EHVA 2RF9A 3LXKA 4XEYA 3GCQA 4Y83A 3I81A 3UZTA 3C7QA 3ZLYA 3V01A 4O22A 4X2FA 2JFLA 4BCHA 2BDFA 3OUKA 4HYIA 4XX9A 3V6RA 4AG8A 4BKZA 3D14A 3NDMA 3TNQB 5AUWA 1KV1A 2XJ2A 4L45A 5A4CA 3NYOA 4FTUA 2VZ6A 4F4PA 1EH4A 5DR6A 3WZUA 3TNIA 4FEQA 2GQRA 4I4FA 3C4CA 4FUYA 2YCFA 3ZSGA 1XBBA 3FYKX 3LQ8A 4H1JA 4QRCA 4BGHA 3MY0A 3QYZA 3T3VA 4RLLA 5HORA 5EQYA 4YJTA 4O2PA 3HRCA 3UG2A 5K5NA 5EQPA 4C37A 3CQEA 4FA2A 5HO6A 3R0TA 4IB0A 3BI6A 4WUNA 4YZMA 2W1DA 5ETAA 4PY1A 2JFMA 3W8LA 2XCKA 4DC2A 2WMQA 4RX8A 3I7BA 3OCSA 5AR2A 3DK6A 1A9UA 4DTAA 3CGFA 3V5JA 5IEVA 3LFQA 4UX9A 5ANDA 3HECA 4BCOA 3I6WA 3RAHA 4EOSA 2WMRA 3VBWA 3R73A 2OO8X 3R7YA 5A4LA 4C36A 5LMBA 3PXZA 5EOBA 3H10A 3GQIA 4N0SA 4EQMA 5DRDA 3P9JA 5EI8A 4JBVA 4FSZA 5CU6A 4M12A 5GJFA 4BZNA 3CE3A 4YLJA 3FMKA 2ZOQA 4CYIA 3MI9A 4GJ3A 3C9WA 4BDIA 2RG5A 5J5SA 4E8AA 2JKMA 5BUJA 1KE6A 1SVHA 2YM4A 3MTFA 3AD4A 3UO6A 4AUAA 5E1EA 5L8LA 1OITA 3LFBA 5AV3A 3VVHA 3QA8A 3JVRA 4ZTQA 4C35A 5BYLA 3FL5A 2PE1A 4XP3A 3VC4A 2OF4A 3PG3A 2OJJA 4CLJA 4O7VA 4GKIA 4FT9A 4L7FA 3SD0A 5AR5A 4ZXTA 3S0OA 5CLPA 2CGUA 5K4JA 3SG8A 1AD5A 3T9TA 4AZSA 2OLCA 4XOYA 1XJDA 4D9UA 4ITIA 4FTIA 3DTCA 2QOLA 2VGOA 2IZTA 3KF4A 3ZUVA 2XBAA 4QTCA 1OKZA 3D94A 5FQDC 4CTCA 3FI3A 3AXWA 4QTBA 2GPHA 3EL7A 1JSTA 4FV1A 5LVLA 4FSRA 2VD5A 5T6KA 1M14A 4TRLA 2W4JA 3RZBA 2QG5A 4NFNA 5FTGA 1NVSA 4EHZA 3TUDA 2HENA 3ROYA 1PXKA 4L6QA 3L9MA 2JITA 4IAKA 3FQSA 5HBEA 4G6OA 4HZRA 4GKHA 5D10A 2R3QA 3PJ8A 3SQQA 3HLLA 1P4OA 5FDXA 4W8EA 2ZDUA 2Y8OA 3VRZA 5BX0A 4QP1A 5AR8A 4CVAA 3UO4A 4EZ7A 5CU0A 3MVHA 2C68A 2FA2A 4FG9A 2HZNA 3K3JA 3DCVA 3QTZA 4TWCA 4ZMFA 4DHFA 3QL8A 4PMTA 5IDNA 3GGFA 4RSSA 4YLKA 4CG9A 3FKNA 3KKVA 3QRUA 2ZM1A 5HG9A 5DIAA 5BVFA 5ANIA 3LE6A 5JQ5A 3BYSA 1WCCA 3EHAA 3OW3A 4IFCA 4IAZA 3DB6A 3G9LX 3QRJA 4MAOA 5IDPA 2BALA 3W55A 1ZZ2A 3LXLA 4IZ7A 3WF5A 3FQEA 3R63A 4YHJA 4USFA 3P7AA 5E92A 3GU5A 5EH0A 3ZLSA 2YJSA 1YDSE 2WMBA 2G1TA 4KBCA 4FV4A 3R28A 3TIYA 4DF3A 4DFXE 2IVSA 2F57A 3ZCLA 1F3MC 4XV9A 4BGGA 1Q24A 4E6QA 5IA2A 4JAJA 5LXMA 2GS6A 4OLIA 4GT4A 3LLAA 4QP3A 2VWYA 5CSWA 4U79A 4IEBA 1Y91A 5CEMA 2W9FB 4AXAA 5JFVA 3BYVA 1YKRA 2VX0A 2WGJA 4N6YA 1H1QA 2GFCA 5HX6A 2WIPA 3BHHA 1J3HA 4O0TA 5BVWA 4C4JA 5C26A 5AP2A 3KCKA 3QZFA 3DKCA 3OG7A 1O6LA 4RC4A 2UW0A 3IDCA 4D4SA 5LMKC 2AUHA 5DEWA 3C4ZA 2W7XA 4L42A 3PG1A 4FF8A 4FV7A 2O63A 1WVXA 2H6DA 5IUIA 5I9WA 2DYLA 4BDDA 3VUDA 1KUTA 3NRMA 3FJQE 4KB8A 4ANSA 4G1WA 5ACBC 3QUPA 4GU6A 2VTQA 3FZOA 4JQ8A 4ALUA 2BKZA 4YC6A 3W2OA 5D9HA 3F5PA 2OF2A 4G3DA 3RJCA 4FYNA 2I0HA 2B1PA 2YLFA 2XKFA 5BYYA 1U54B 4FTKA 4ZS4A 3U87A 3WE4A 3BBTB 5IQAA 3QTRA 1CTPE 4R77A 4FTAA 4RQKA 3KRWA 5L2IA 1GIIA 2CGXA 2YA9A 3Q9YA 4YTFA 4QMSA 4TYEA 4EH7A 1XH7A 2RSVA 3OHTA 4QMYA 1RJBA 5DYJA 1U54A 1URCA 3AQVA 3R1YA 1Q8TA 4JG6A 2X2MA 4RIWB 4X2NA 3CPBA 3WE8A 4CT1A 2Q83A 5AA8A 2YCRA 4G3GA 4C58A 4NYEA 1CM8A 3HUBA 4FSYA 4ONAA 3V51A 5JFWA 1IAHA 4CQGA 1UNLA 4UB7A 2VTPA 5HVJA 4KRCA
chains in the Genus database with same CATH superfamily
3ZC5A 2XMYA 4NM7A 3EL8A 3MPTA 4ZSJA 2UZNA 4QQ5A 4V04A 4ENYA 1H0WA 2XYUA 3KRLA 1Y6BA 5JSMA 5K9IA 3BYOA 3COKA 1QCFA 3H3CA 4D2TA 2B55A 5F1ZA 4JDJA 3HAMA 4BICA 1OKWA 2BCJA 3RCDA 3F9NA 3KVXA 3V8TA 4C4FA 1H25A 2HXQA 2B53A 5BVKA 3QA0A 2C0OA 3OS3A 2HY0A 3Q32A 3Q96A 4RJ5A 5J8IA 3ML1A 4QYFA 2I0EA 4YC8A 3CKXA 1WMKA 3DJ6A 4FKOA 4EHEA 4G34A 4G17A 2ITPA 2QOCA 2ZB1A 1M52A 4KUJA 2Y4IC 2R3KA 4LM5A 2BZIB 3MH3A 3I0QA 4EOLA 2WNTA 5HTCA 3FV8A 2QVSE 2C6OA 3EQDA 5L2WA 1YW2A 2YM8A 3F66A 1ND4A 4PWNA 4FI1A 4FTNA 5EM5A 2NP8A 3VQHA 3KRJA 4ZLYA 4FUXA 1MQBA 2NO3A 3PVBA 5AP7A 5EW3A 2WEVA 1PXIA 4X2JA 4B8LA 2XRUA 2OWBA 4QMUA 4U43A 5TT7A 4F9AA 2VRXA 2BDWA 4O1OA 3AMAA 5E91A 3I5NA 3RK9A 1ST0A 4TZRA 3CXWA 1VYWA 3D9VA 1Q4LA 4ASDA 3M2WA 4XLVA 4EH8A 4E4XA 4QDEA 5CNOA 4BI1A 5KMMA 3ORTA 5KCVA 4JR3A 2X81A 4RJ4A 4DGNA 4YO6A 2X9FA 1T46A 4FR4A 3OVVA 1ZAOA 3BZ3A 3KXXA 4HGTA 3DS6A 4OTFA 3W2CA 4LV7A 2AC3A 4IVCA 4KKEA 3ITZA 1OL5A 3C4EA 3KQ7A 4GL9A 3LFFA 2F2UA 3FDNA 3M11A 4QMWA 4QYGA 3RP9A 5L4QA 2BPMA 2YZAA 2XZSA 4IC8A 2GQGA 4QPSA 3DK7A 4RBLA 2B9JA 4JBPA 4YPDA 4HW7A 3HP2A 5IQDA 3H0YA 5J79A 2VTRA 3VULA 4XMOA 3NCGA 3G6HA 4DINA 3TDWA 3O96A 4MBLA 4HGSA 3UC3A 2QCSA 3PJ1A 3HV6A 3HNGA 2Z2WA 3POOA 5DR2A 5HBHA 2R3FA 4NM3A 1ST4A 5LOHA 3ZFXA 5E4HA 4FT3A 5HVYA 4JNWA 1WFCA 2W96B 3QKMA 5AADA 4QEBA 3MS9A 2YDJA 5D7AA 2O0UA 3MFTA 2VO0A 3QCQA 1PXMA 2DQ7X 4UALA 2XKEA 3ZDIA 5BVDA 5L2QA 5JFSA 1TQPA 5H2UA 2QC6A 4XP0A 4Y8DA 3TZ9A 3U51A 3ZTXA 1W2CA 5EYCA 1MRYA 4G16A 5LJJA 4ORKA 1IA8A 4PPCA 5AAEA 2W1FA 1LR4A 4QTEA 3LFSA 4KSQA 4N4SA 2BHEA 3FLZA 2C69A 4L43A 1J1CA 4AZEA 3LMHA 3F3VA 3OW4A 5J7BA 4HGEA 1KOAA 2ITYA 3GBZA 2PE2A 2BRNA 2X7FA 4D2PA 3UIMA 3KRXA 3ACKA 3IO7A 4EL9A 3GP0A 1XHAA 1YXXA 3MFRA 4ZS0A 3SDJA 4D1ZA 3P23A 3VS6A 4YSJA 4QP4A 1WBVA 2CGWA 3D7TB 2X2LA 3G5DA 3M1SA 1PRYA 1LUFA 5ETIA 3UG1A 4YJNA 2OFVA 3PPKA 3QLGA 4QQCA 5CT0A 5D12A 4BBMA 4FIGA 3E5AA 3F61A 3KVWA 3TZMA 3NAYA 4A9YA 4HYHA 4UYAA 3QQLA 4AN2A 5DT0A 4IM0A 4RT7A 4OTWA 3PTGA 4IMYA 4HZSA 3R83A 4WNPA 3UVQA 4WG4A 4CCBA 3UZRA 3HVCA 1OKVA 2QOBA 3OWKA 4KKGA 5EDRA 4C33A 4QPMA 5F4NA 4EBVA 3FC1X 1OBGA 1M7NA 4JX7A 5F20A 1W0XC 2YWPA 1QPDA 2HCKA 2XEZA 3JYAA 3LM5A 3O0GA 4DGOA 3I5ZA 3TNPC 4GW8A 3VN9A 4MX9A 2ITVA 3IW7A 4KBAA 3OT8A 4IM3A 4FTMA 4IX3A 3DAKA 2OG8A 5AM6A 5JZJA 4G3FA 2RG6A 3BCEA 5EI2A 3TJCA 1ZMVA 4TWNA 2VTTA 3MFUA 4W9WA 4BTFA 1PKDA 3EYHA 3Q2MA 5KBRA 5M06A 1OVEA 3LXPA 2VWVA 4PPBA 4GIHA 2W5AA 1O6KA 2XK6A 3BBWA 3ULIA 2CSNA 5KKRB 2VO3A 2XP2A 3R6XA 2KULA 4RX9A 2R3PA 3VNTA 4EUTA 2PTKA 5HTIA 2VNWA 3ORPA 4O83A 3IDBA 3FZSA 3GB2A 3FZPA 2JDRA 3UVRA 4DFYA 4EOMA 4O84A 3H9FA 1OBDA 1KSWA 2WTVA 5IA1A 3CQWA 3DY7A 4CXAA 5I9UA 4RIYB 5JKGA 4YHFA 3UJGA 4QYEA 3G15A 1L3RE 4KNBA 4ZJJA 4EZ5A 4AACA 4U7ZA 3KU2A 3W32A 2BRMA 2R4BA 4ZJVA 2IW8A 5M4IA 3OOMA 3LMIA 1PF8A 3MIYA 4UZDA 2YN8A 4ENXA 3QF9A 3GFEA 3PA3A 3BL7A 2WO6A 3A7JA 4FKWA 3IKAA 3QQHA 4YZCA 1JAMA 4LOQA 2YWVA 3D2KA 5HIDA 4MUQA 3CGOA 3RHKA 2ZV7A 2PMOX 4X21A 2WZJA 4EH9A 2P3GX 2R3RA 2Z7QA 5AMNA 3PIYA 4MTAA 5JRQA 1UU9A 3AD6A 4BGQA 2VWZA 3EIDA 1U4DA 3VBQA 4GIIA 5HE2A 3EN4A 3E8CA 1JKSA 4NKSA 4O21A 4YNOA 4M68A 5H8GA 4QMZA 5HE0A 3CCNA 3FLWA 4B7TA 4BI0A 4F9CA 4IJ9A 3ZBXA 2WU7A 2HIWA 4EI4A 3UDBA 1OPKA 4LOPA 2ACXA 4S34A 1Z5MA 1FINA 4FSWA 4GEOA 3MVLA 2X1NA 5HLNA 2XNGA 1REJA 3ATSA 4LL0A 3N4TA 3ZXTA 5CZIA 2GQSA 4FV0A 3W0RA 3MTLA 2ZM4A 5CEQA 4BHZA 3DBDA 4ZY4A 4PDYA 1K9AA 2P55A 2J5EA 3ENHA 4DAWA 1Q8UA 4O0RA 4I5MA 1PMUA 4OTDA 3PSCA 4IWPA 4BDJA 4I6LA 4WA9A 2UW4A 4CFFA 2V55A 2J7TA 5L3AA 3VF8A 4BDKA 3V5TA 3UMXA 4W9XA 1Z57A 4HOKA 3EFLA 4I4EA 1OIYA 2QQ7A 2R7IA 3D4QA 3HP5A 4FVPA 4RZWA 5DA3A 5C27A 4AE6A 5GIPE 1M7QA 4BJJA 3NYXA 3LCKA 4QP7A 4DHZA 2O2UA 3HX4A 3CEKA 5BNJA 2I6LA 3HEGA 4FV2A 2E9UA 4BFMA 4AU8A 3KXHA 5M44A 2HW7A 4TYHA 3CD3A 2YCSA 5M55A 3U9CA 1UNGA 5EI6A 3QCSA 3UE4A 3WF9A 1LP4A 4PL5A 3NGAA 4XV1A 2XNNA 3OXZA 4BIDA 4XOZA 3LJ1A 3OXTA 2ERZE 2C5OA 4QP2A 4TT7A 3FXZA 5M4FA 2Y6OA 4WNOA 3GFWA 4ZTRA 3TXOA 3RCJA 4GJ2A 1NW1A 1OKYA 3PJ3A 1UU7A 5E8ZA 4WIHA 1T45A 4DBNA 3QWKA 5FRIA 4DG2E 2GDOA 2JIIA 5EYMA 4F0IA 4PRJA 2OJFE 5AR4A 4F7SA 4BWXA 4NM5A 4Z16A 4U42A 3VHKA 3HMPA 4YNEA 3W10A 2CLQA 2UVYA 3BHVA 5AR7A 4O0SA 4HVGA 4F9YA 3H9RA 3NUPA 2PSQA 5E8UA 3BHUA 4FSUA 1RW8A 2HZ4A 3ODYX 4LI5A 4IWQA 4Q9SA 4D2RA 3N4VA 4FZDB 3DQWA 4QT1A 2IN6A 4A9TA 4DCEA 1PXLA 4IZYA 1W84A 4QMOA 3Q6WA 5K3YA 2UW8A 4MWIA 4IVAA 4CFMA 4CKJA 2OXYA 4ZTLA 4J97A 3R9HA 1HOWA 4BR3A 3PLSA 5HCZA 4PV0A 3MJ2A 2B7AA 3L8VA 4G6LA 1JVPP 4CGAA 4GVAA 5HESA 3ORXA 3DBQA 3QCXA 1FVRA 5CVGA 3ZUUA 4BI2A 4R3CA 4TYIA 4CFUA 5CEOA 4WOVA 4OBPA 2X6EA 3QZHA 4HCTA 3V8SA 4XNEA 4CKIA 4ITJA 4FSMA 3S00A 3MW1A 4FKIA 5HLWA 3OEFX 1IRKA 4DFLA 3HMIA 3PZEA 2VTMA 5CTPA 3VWAA 3EKNA 4DH8A 3U55A 1WBPA 4GT5A 1R39A 4K6ZA 2VTOA 3HYHA 5GJGA 1BMKA 1YWRA 1XWSA 4I23A 3AMYA 4EOQA 4WBBB 4DFNA 3DZQA 4NH1A 1VLRA 3ODZX 2IZSA 4C4EA 2P4IA 3P08A 4PDPA 4ACMA 3WF8A 2B9IA 3GU7A 2WMAA 2BMCA 4A4XA 3E87A 4I24A 1Z9XA 3LJ2A 4OTPA 3VUTA 4R7BA 3AGLA 5HICA 4RFYA 5JN2A 4R78A 2BAKA 3WIGA 5HVKA 1YOLA 1URWA 4YUQA 4D58A 3EKKA 4D0WA 4NIFB 4DBXA 2WHBA 5IU2A 2JIVA 3WF7A 4CCUA 4FL3A 5DR9A 2W1CA 2JDVA 4PMSA 3WZEA 4AFJA 1TFFA 4GYIA 2X2KA 4P4CA 2X0GA 2OZAA 4F63A 4FG7A 2R3LA 5BVEA 4BYIA 3R2BA 5IH5A 4RZVA 5DMZA 3A8WA 1OL2A 5L8KA 3OFMA 4BDHA 2GNJA 3LXNA 3MBLA 5BMMA 2VN9A 3WARA 5T3QA 3G90X 4DHIB 4NW6A 1VYZA 3F5GA 2QKRA 3SHEA 4DH5A 2W1EA 3WI6A 4CT2A 3BV3A 4KAOA 1OECA 3FUPA 3MA6A 3CP9A 4D2WA 4G5PA 2XANA 1YRPA 3A60A 4J7BA 4CRSA 3FLYA 3COMA 2OJIA 2I7QA 2X8DA 1AGWA 3QUEA 5ETFA 4X6RA 4AW2A 2OH4A 3L8PA 3RAKA 3W18A 3MB7A 4Q5EA 3OC1A 3BLRA 2VX1A 3SXSA 2A27A 2YM3A 3A4OX 3Q60A 4EWQA 4ALWA 5CSPA 5FG8A 4F64A 4M97A 4RC2A 2QOHA 4E6AA 4NTTA 4I5HA 1QPJA 1YHVA 4RWJA 5DG5A 3PRIA 2JC6A 3RWPA 3KMWA 4XBUA 4DGMA 1YI4A 2V0DA 3BU3A 4YTHA 3CD8A 4ANBA 2E9PA 4O4DA 2XRWA 5ITAA 1ZYCA 2WTJA 2WQMA 5L2TA 3U54A 3C13A 4R7IA 4ALVA 3FLNC 4Q5HA 2QONA 2UW7A 5CF4A 3G33A 2QURA 3L8SA 1JKTA 2RFNA 4Y73A 3MDYA 2ONLA 3ORLA 2AYPA 4I6QA 1Q99A 3LCTA 4FZ7A 4P2KA 4FZ6A 4EOOA 4KRDA 3R9OA 3O71A 3D5WA 4EK5A 3FMMA 4FKQA 4I1ZA 1PMVA 1B6CB 4MD7E 3R8VA 4C34A 4F7NA 2X7GA 1Q8WA 2UW9A 2BZHB 3R7OA 4BWPA 4EYMA 4O7LA 3OWJA 4ASXA 4JQ7A 4AOJA 4C3FA 3KB7A 3Q4CA 3VRYA 4IFGA 5IUGA 5KZ0A 2QOKA 4ZZNA 4QMVA 2GNHA 3EN7A 3N9XA 4FV9A 4QP9A 3PUPA 2C0IA 2JBOA 3HKOA 4ZP5A 1QMZA 3CQUA 4JDHA 3FSKA 3W8QA 3TTJA 3E8DA 3P79A 4YU2A 4XG3A 3DBCA 3DB8A 3DKGA 3ORIA 4QPAA 4HGLA 5M53A 3Q5IA 4DHJA 4MF0A 4XG9A 2YIWA 4AS0A 3G2FA 3PJCA 3QTQA 2QO9A 3DQXA 3WZKA 5KKRC 3O8PA 4WSQA 3QGWA 5FP6A 1J7LA 2C6LA 5C4KA 4UMRA 5J87A 4B9DA 1OM1A 5TE0A 5IMXA 5CX9A 5C8NA 2XA4A 3U4WA 3P5KA 3QFVA 3MPMA 3TL8A 3TV6A 4RLKA 3PY3A 4AFEA 5I9XA 2C6DA 4I92A 4FV8A 2YITA 3OUNB 3BEGA 5CQUA 2LGCA 5KBQA 5EKOA 4XG2A 4ZY6A 5HU3A 4RRVA 5BYZA 5HG7A 2Q0NA 2V62A 4B99A 4EQCA 4RX5A 4AA5A 2VWUA 5IZFA 2IZUA 2C3IB 2PVMA 3TG1A 2HW6A 4F70A 3EQRA 2IW9A 2WTWA 4BCGA 5CENA 4IWDA 4EQUA 3PP1A 3NW7A 4QNYA 3FMJA 3NLBA 4NU1A 1UKHA 4EEVA 2XIRA 4R3RA 2QOQA 4O2ZA 3EFWA 4EH6A 5AP0A 4Y85A 4IAAA 1WZYA 1H4LA 2J5FA 3LCSA 4NEUA 2HYYA 2F7XE 3EQGA 1P5EA 3UOKA 4F7LA 3G9NA 2GNIA 4OR5A 4BCNA 2PK9A 4ZMEA 2Y7JA 1BX6A 4IZ5A 4YP8A 1OI9A 1PMNA 2UVXA 3PDTA 5J9LA 5D1JA 5CAPA 2YM7A 3NUUA 4II5A 2G2FA 4AZFA 2IVTA 2ZVAA 5EHOA 3FLQA 5H8EA 3GOPA 5TR6A 4X6QC 3RK5A 3S4QA 4JIKA 4H05A 1W8CA 3H0ZA 4UMUA 3QQUA 3ORMA 4QYYA 3D7ZA 4DGGA 3TNWA 3NUAA 2VNYA 1YXTA 1FGKA 2VTNA 4PL4A 3ULZA 3LZBA 1PMEA 3BQRA 5DFPA 5AM7A 3QAME 4EOPA 3AD5A 4GG7A 5CASA 2PHKA 3W1FA 5BVOA 1NVRA 3RPVA 2OZOA 3Q6UA 4YZBA 5TKDA 2GCDA 2QR8A 5CEPA 5LWMA 4MNFA 1J1BA 3QTSA 4FTRA 5EM8A 3WOWA 3ZSHA 5EK7A 5A14A 5JQ8A 1TVOA 4DDGA 3PYYA 3QCYA 3COHA 1YHSA 2OI4X 3LOKA 2R0IA 3IW5A 4TPTA 2GU8A 5JK3A 5A46A 3DDQA 4DG0E 5CANA 3MESA 5AUZA 4RJ3A 3LCDA 3W2QA 1XH8A 3ANRA 4K33A 2E9NA 4Z7HA 5CVFA 5I4NA 3ZUTA 3ET7A 4ZLOA 2QKWB 3KF7A 3UQGA 4FTOA 4PTGA 5EYKA 4QTAA 4RPVA 4WUAA 2H96A 3FPMA 3RGFA 2Z8CA 3R8PA 4BDBA 3O50A 4MXOA 4FOBA 3F7WA 4M0ZA 1KE7A 4AN9A 3UQCA 1NY3A 1NXKA 3RWQA 3GCUA 3UP2A 3FZTA 2Z7SA 4BCPA 3RPSA 4CZUA 4IWOA 5HIBA 3VJNA 1P2AA 3NPCA 4V0GB 3DK3A 4YPSA 5AA9A 5GIOE 1O9UA 5IQHA 1QL6A 3BU6A 4F99A 1P4FA 3DJ7A 4JAIA 2CNVA 4NK9A 3PPJA 4YZ9A 2QLQA 2XALA 3F69A 2XB7A 2J51A 2XM8A 4DTKA 2BZJA 4FEWA 2EB2A 2ITXA 3LLTA 3W2RA 3LMGA 4EJ7A 5K4IA 3JUHA 4ANOA 3CSVA 5L6WL 4BB4A 2R7BA 2UW5A 4FICA 3ORNA 4O38A 4HYUA 2X4FA 4JR7A 1XKKA 3UZPA 3EN6A 3FI8A 2VTHA 5ANGA 2WMXA 4XLIA 3KN6A 3BL9A 4L46A 4JOAA 3LM0A 1ZYLA 3UO5A 4I3ZA 3W2PA 3IW8A 3QQFA 2AC5A 3CY3A 3QHWA 1PXPA 3MV5A 3DXNA 4FIHA 4Y5HA 3GC0A 1GAGA 4UWBA 2XAMA 4DH1A 2Z7RA 3FBVA 4NWMA 4U5JA 3QTIA 5IA3A 2WQBA 4PF4A 4AXCA 3RPOA 5DOSA 3DFCB 4FODA 5EOLA 4J95A 1PYXA 3ZFMA 3UGCA 4I94A 4IX6A 2XNEA 5G6VA 5LMAA 3R22A 5M07A 2PZYA 3GU4A 3UVPA 5I9ZA 3UPZA 3QKKA 1W98A 3Q4TA 3V3VA 3LFAA 2WTCA 2XARA 1H1PA 1O6YA 4C62A 2W05A 4J71A 1KOBA 2WOUA 4XG8A 4X7QA 4A9UA 5AX9A 2CGVA 2HAKA 4KIPA 2REIA 2E9VA 3P78A 4UWYA 3SG9A 4FKRA 3AGMA 2UZLA 4LGHA 4I5CA 2G01A 1OIQA 2GNGA 4YSMA 3UNZA 4BF2A 4M66A 3ORZA 4PP9A 2O3PA 3H30A 5CF8A 4GSBA 3VUMA 1CMKE 1YWNA 3OD6X 2LAVA 4Y95A 3QBNA 5HGIA 4AXFA 4RIXB 5IG1A 5K0KA 2BDJA 5JH6A 3ZRKA 2XAOA 5ANKA 1OGUA 4JMQA 4UZHA 2Y6MA 2IZRA 5J1WA 4GG5A 3SXFA 3RNYA 4QQJA 2PVRA 2UZOA 3KN5A 5ACKA 4NT4A 4CFVA 4GFGA 4K77A 4ACGA 4DH3A 4E6CA 3JR1A 3N4UA 4F6WA 1W2DA 2YJRA 3VIDA 4AT4A 4F65A 4QQTA 2GHGA 4DT9A 3GU6A 5AUXA 5HHWA 4G3CA 5FLFA 5BVNA 3EMGA 1ZYJA 3FKOA 3M42A 3ZC6A 5BQ0A 1G8AA 4AGWA 4ANQA 4JDIA 4MXCA 1OMWA 3NNXA 4O4FA 2QU6A 2RIOA 3QGYA 4OTHA 4YJOA 2HWOA 5EW8A 2O65A 2QHNA 3JY9A 2OIBA 4L44A 1XO2B 4FG8A 3SOCA 5B2KA 2FSTX 1JSVA 1Q8YA 4E6DA 3BGPA 1YI3A 5CAOA 5CEIA 3C0GA 4PTCA 2PVHA 3LAUA 4OTRA 1FMKA 3P4KA 3REPA 3UC4A 4E4LA 3GI3A 4U3ZA 3F88A 2CJMA 2C5XA 1BLXA 2E2BA 4U0IA 1ZZLA 3JXWA 3WYYA 2WTDA 2X0QA 4C2VA 3IONA 3ZEWA 3VS4A 1WBWA 3F2NA 2ITTA 3KXZA 4H3PA 4BZDA 2PZPA 4J8NA 2FYSA 3FY0A 2CKPA 3HGKA 1SVGA 2PZRA 4J98A 3AC2A 4LYNA 2DUVA 5IMEA 3KY2A 1M17A 4RIOA 3MH2A 4MXYA 4YC3A 5GNKA 3DNEA 3EH9A 1P14A 3UOLA 3ZLWA 4AT3A 2DS1A 4EH5A 5GZAA 1GIJA 3AT2A 4O7NA 1KE5A 2X7OA 3FI4A 3W2SA 4LG4A 3B2WA 3WIKA 1H00A 3HL7A 5IA5A 4N57A 1LEZA 1H0VA 5JFXA 2UV2A 3WZDA 3MA3A 4BCQA 3G0EA 1ZRZA 2A0CX 4M15A 5A4QA 3OROA 4XRJA 4UWCA 4L68A 3EQBA 2VO6A 1OIUA 4R1YA 3TDVA 2YAAA 3Q9XA 4G31A 4JG8A 4ZTHA 2C3JA 1NA7A 4E93A 2F7ZE 4G2FA 4V05A 3QRIA 4R8QA 3MVJA 3NUXA 2UVZA 4ASZA 1RDQE 3OWLA 2WMWA 2J6MA 4AGUA 2BAQA 3MSSA 3RKBA 3IGOA 2OFUA 3ALNA 3BQCA 2IJMA 4IC7A 5JMSA 1XMLA 4PP7A 2CKEA 4FJVA 2VWIA 2BIKB 2G15A 1YWVA 4FNZA 3FMDA 4IBMA 3O23A 5EM6A 1AQ1A 1DAYA 3UYTA 5EQEA 1B38A 4AZVA 2WQNA 4B8MA 1PKGA 1KE8A 1WAKA 2R64A 4C02A 4DEHA 5BUIA 1IG1A 2FSOX 4BWKA 4GFMA 4L9IA 3EWHA 3ZRMA 2JBPA 3SRVB 5F94A 3PE2A 5LVMA 5K5XA 4OTGA 4O4EA 3HA6A 4C59A 4FIFA 2ZV8A 3K5UA 3U6HA 3QKLA 5JGAA 3TUBA 4WD5A 4QYHA 3EN5A 4CV9A 4E7WA 3T8OA 3NVKI 3DKFA 5CVHA 3FI2A 1BI7A 2JDTA 4U3YA 3KREA 4FV5A 5IQFA 2PU8A 3LVPA 4RIYA 5HX8A 2KTYA 3ZLXA 3NS9A 5EKNA 2PVKA 2V7AA 2HY81 2JKOA 5A9UA 3VBVA 3FKLA 4M69A 2RL5A 3VO3A 3QD4A 4IXPA 4L3PA 4O82A 3VS3A 4X3FA 4AN3A 2C1BA 3IQ7A 3UDTA 4YJSA 3B8RA 5HG8A 2YACA 4YMJA 5HD4A 2BAJA 2J9MA 2W06A 3HDMA 4QMXA 3AG9A 3C4WA 4FIJA 2PULA 4AX8A 3A61A 4P90A 4NFMA 2CHLA 4CMTA 3VS5A 2GNLA 4GVJA 4GFOA 5CEKA 3OOGA 2YM6A 4LMNA 4U45A 4PX6A 4ZOGA 4CRLA 2JDSA 2F9GA 4V0GA 2R3JA 4GUBA 5HZNA 4QP8A 2I0YA 4AOTA 5IH6A 3BWJA 4IANA 4D5HA 5CAVA 2NNWB 4LV5A 3D83A 4W4WA 4AQKA 2IPXA 4MD8E 1CSNA 5H9BA 2XH5A 4P5QA 2VU3A 2XK9A 4FTQA 4GK4A 2XK7A 5DRBA 3VW6A 2UZWE 3F82A 3SW4A 2JAMA 2QU5A 3V04A 4FTLA 2BRHA 2G2HA 3OWPA 1IR3A 4X3JA 1JBPE 3OF0A 4F1TA 3R02A 3GNIB 4JI9A 3V6SA 4FIEA 3V8WA 3GQLA 4H3QA 3CR0A 2J0JA 3AT3A 2O8YA 1Q8ZA 4FT7A 2XBJA 4O6EA 5B2MA 1DM2A 2F49A 4YZDA 3S1HA 2XNBA 3HV7A 4O6LA 4FKGA 4IHPA 4ZSEA 5HBJA 4FKTA 1Y57A 2BZKB 4FSTA 4LOOA 4H3BA 3R7VA 5K0XA 4L01A 4LRKA 3RMFA 4QDVA 3SOAA 2OIDA 3V5QA 4UY9A 4IW0A 3OZ6A 3ZONA 2BRGA 2RGPA 3O8UA 2I0VA 4XRLA 2R9SA 5J9YA 3ZH8A 3HRFA 2HWPA 3VHEA 3E88A 3VONA 3MYGA 2W4OA 4M84A 3BE2A 2X8IA 3PY1A 5TO8A 4W8DA 3RAWA 4AE9A 2WMVA 5EG3A 4BRXA 4D0XA 4F9WA 2AEGA 5DE2A 5JEBA 3R7IA 4EK6A 2WPAA 2WAJA 1R0EA 3QXOA 2WTKC 4RX7A 3DFAA 2B9HA 4E5BA 2YHVA 2JEDA 3NEWA 1ZOEA 1UVRA 4D4YA 1H24A 1H01A 4RA5A 2UZVA 3I4BA 3IG7A 1G8KA 2OICA 4BZOA 2UW3A 3DAEA 3E7VA 3MB6A 3QD0A 4K9YA 4RJ8A 2ZB0A 4WRGA 2A2AA 1W2FA 3COIA 2YLEA 2X0OA 4EK3A 2EXCX 3OTUA 5AX3A 4JIAA 4JT3A 4MXXA 3POZA 2V5QA 1G8JA 3DGKA 4IX4A 2O64A 4RIXA 3KEXA 3R21A 1UV5A 2J0KA 5ANJA 1M2PA 5DNRA 4E73A 3LQ3A 3BPRA 3MJ1A 3PRFA 4L3LA 1APME 5KMNA 1OL6A 2VGPA 3PSBA 1R1WA 5LARA 3TYKA 4U80A 3FLSA 3SKCA 1FVTA 2B52A 4CMUA 3O8TA 2CNUA 2FH9A 3IOPA 4I93A 2R3OA 4W4VA 5FBNC 5M4CA 2R3HA 1SYKA 3QHRA 4KD1A 2QG7A 4FZAB 4TYJA 2I1MA 5GJDA 2WMSA 5BPYA 4CD0A 4A7CA 3U8WA 3C0IA 4TL0A 4WT6A 4OW8A 4DFZE 4ZZOA 4AP7A 1SVEA 3BELA 5B7VA 4EORA 1OIRA 3EQHA 2GTNA 3SAYA 4HCVA 3AT4A 4BDGA 5J9ZA 3E93A 4MXAA 4BTKA 5KHXA 3SW7A 2XNPA 4P7EA 3EZVA 1G3NA 4ZZMA 3RTPA 3E62A 3DOGA 4UXQA 1KWPA 2OJ9A 3ZDUA 2CCIA 1MRUA 2ITQA 1U59A 2XVDA 3ROCA 3OY3A 2GHLA 2HZ0A 4YBJA 4DH7A 1RQQA 3GCPA 4J52A 5HCXA 1OUYA 3R8MA 2YDKA 4MWHA 3VUGA 5E8WA 3TI1A 1MUOA 1W83A 3HAVA 2XF0A 4XH6A 3EOCA 4F1MA 4XS2A 5TOZA 3U6JA 3DXQA 2OIQA 5DBXA 2C4GA 2VAGA 4DA5A 2QI8A 4QMMA 3SLSA 4F0GA 4YBKA 3CJGA 1Y6AA 1YDTE 3I0OA 3EQFA 3MVMA 1Q61A 3PFYA 2EU9A 4MQ2A 3WILA 5G1XA 3W0NA 4D28A 3UTOA 1VR2A 2PVYA 4K18A 1OPLA 2IWIA 3UPXA 4AAYA 4KWPA 4FTTA 1UU3A 2W1ZA 3EQPA 3N51A 1FMOE 1OL7A 2YDIA 3R00A 4IDTA 1FPUA 3QQJA 3TV7A 5I9VA 4C0TA 5E1SA 1JQHA 4DLIA 4CYJA 4ZTMA 4TW9A 5IQCA 2BTRA 5IQGA 2ZMDA 1PHKA 3F2AA 4ANLA 2H8HA 2QLUA 5DN3A 4GU9A 4UXLA 4WNMA 2CN8A 4LGGA 4QMQA 2ETKA 2PPQA 4EBWA 1PXJA 2CMWA 4U41A 3TJDA 5AEPA 4M13A 4FEUA 5FBOA 2W5BA 4H39A 3SXRA 4BVUA 4N70A 3K2LA 2PMNX 4UYNA 4MNEA