2E2BA

Crystal structure of the c-abl kinase domain in complex with inno-406
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
278
structure length
270
Chain Sequence
MDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Structural factors contributing to the Abl/Lyn dual inhibitory activity of 3-substituted benzamide derivatives
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 270
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2e2bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2e2bA01
1XBAA 3FSKA 5HLPA 3G51A 4AW5A 2GNFA 4QMUA 5HE2A 5IA0A 4HNIA 5JEBA 1YXVA 4RZVA 3DZOA 5FG8A 2J50A 2R9SA 2W1EA 3T3VA 4DEDA 5HQ0A 2ZVAA 3P23A 3REPA 4CFNA 4F63A 4YJSA 5M53A 2ZV2A 2ONLC 2C3JA 2X9FA 4AE9A 3VUKA 3ZONA 2ITWA 4JQEA 4M69B 2GHGA 4M69A 2B52A 3DOGA 2XK7A 4S34A 4ZSAA 3K2LA 2EXCX 2P2IA 4O86A 1PXNA 2QOLA 2XA4A 3CEKA 3PJ1A 5A9UA 1URWA 5IMEA 2C4GA 2NP8A 1GOLA 1K2PA 3NUSA 3KMUA 4U3YA 4CQGA 1Z57A 3DNEA 2ETRA 4A9RA 4KUJA 1U46A 2OIDA 4LL0A 2C68A 2SRCA 3WZUA 1SNUA 5HTIA 5B2KA 5CF6A 2B0QA 3FZPA 3F5GA 5DPVA 4O7WA 4HYUA 3CP9A 3GC8A 3LQ3A 2XB7A 4PTCA 3IDPA 4YJUA 5T3QA 3QA8A 2QI8A 4LRKA 4RG0A 1ZLTA 4TRLA 4J1RA 3EZVA 2J5FA 1OUYA 2QR7A 2VX1A 2IO6A 2WTKC 3F2AA 3R04A 4YNEA 3TZ7A 4DITA 3IS5A 4ANLA 3V5PA 2Y6OA 1YWNA 3BV2A 3GQLA 2WOUA 3CPBA 3EQFA 1RJBA 1KE6A 3RGFA 3HMPA 5AADA 3S3IA 2OSCA 2RG6A 1ZXEA 1KV1A 3LM5A 3LCSA 5E8SA 3PLAE 1FPUA 3H3CA 3V04A 5HO6A 4BBMA 3LFNA 4YZDA 4BL1A 5E90A 3OCSA 4QMLA 4IX4A 4O7NA 4CZUA 3O8TA 3MESA 4XBUA 3LFCA 3JY9A 2Y9QA 4ALWA 4ZMEA 1DI8A 2J0JA 2B9HA 3FHIA 4XV3A 1IA9A 5EYMA 4Y95A 2QO7A 5FM2A 2BR1A 4C0TA 2JKOA 3B2TA 4ZJJA 5H8BA 4AW2A 2PMLX 4BHZA 3TJDA 2XRWA 5A4QA 5CF8A 2ITUA 3A62A 4BR3A 3VF8A 5A6OA 4MK0A 3ZC6A 1GIIA 3GT8A 4YPDA 5DGZA 3UOLA 1RDQE 2QNJA 4NFMA 3HA6A 4AN2A 4C35A 3CTJA 1JSTA 4WD5A 3V01A 3ULIA 3QKMA 1U4DA 3FY2A 5LMKA 4BGHA 4AFEA 2BZKB 2X9EA 5EFQA 3RZBA 2BRHA 3EJ1A 2RSVA 3Q32A 4FG9A 4IACA 4RWJA 2QKRA 2Y4IB 4FV6A 2OXXA 3K3JA 4FT9A 2QCSA 3IDBA 4ZS4A 1PMUA 5KE0A 5IA1A 2E2BA 5AV2A 2VTTA 4JRVA 1W8CA 2QHMA 5G6VA 4M13A 4XP3A 4CFWA 2PK9A 4QNAA 4OTRA 4DN5A 4RX8A 2BZHB 1DAYA 4XS2A 1KOBA 2UW6A 3ZSHA 1GZKA 2IN6A 3HKOA 4N70A 4YHFA 5BVEA 4BCKA 4FTTA 4OAUC 1M2PA 3HGKA 3BEAA 3V5TA 3THBA 3PJ2A 4J71A 3AD4A 4R3PA 4BCHA 3N4UA 2CN8A 3PSBA 2UW9A 2R0UA 3CR0A 3ACJA 1FOTA 1SZMA 3AQVA 3BE2A 4GYIA 4FKLA 4IM2A 3CGFA 5F1ZA 2RKUA 3AXWA 5K0KA 4BYJA 3HL7A 1A06A 3Q9WA 2WQOA 3VBXA 4C4GA 2RF9A 5AJQA 4MD7E 4PDSA 3BWFA 4QMNA 2F49A 3TV7A 1Q8UA 3QD2B 4FTKA 4IZ7A 4MX9A 2Y4IC 3IOPA 1MRVA 4I0SA 5TKDA 5BVFA 3OFMA 1OL7A 2R3RA 4V04A 4PY1A 4CKRA 5CWZA 2OKRA 2V7AA 3DAEA 3BV3A 3MJ2A 4F4PA 3NUXA 5KMOA 1PYXA 5C8KA 3FAAA 4G3EA 4O0RA 3SLSA 5AIKA 2VTMA 4ENYA 3G33A 2O0UA 2ZV7A 4FZ7A 4E4MA 3S00A 2W17A 4FSWA 4KRCA 4AACA 4Q5EA 4BCIA 4BIEA 5A54A 5D11A 2VU3A 3HYHA 3LKMA 3WIGA 3PP1A 4ENXA 1ZYDA 4KBKA 3OY1A 4QP9A 3ZO3A 3BU5A 1OKZA 3BYSA 4F65A 4ZTLA 3EQHA 2PVYA 4S30A 2VO6A 4JX3A 3BHVA 4E5BA 3PE2A 4ASXA 4FIFA 4Y73A 4BB4A 2BRBA 3VW6A 4E20A 4C33A 3VS2A 2WEIA 4D4SA 3QCXA 4CV8A 3P08A 2PMOX 1YXUA 3QU0A 4C57A 4L45A 1OPKA 3AC4A 5GHVA 2JDOA 3C4EA 2X1NA 3TNIA 4YC8A 5TE0A 4EWQA 3TJCA 2I0VA 5IUIA 2C3LA 2PZ5A 4FF8A 2DWBA 3BGPA 3KXZA 3A2CA 4G6NA 4G9CA 3W10A 5AP3A 3D7TB 2H9VA 3V8SA 3IW6A 3L8PA 3D7TA 4MHAA 5LCKA 4AOJA 3VUMA 2GU8A 3BYVA 3VQHA 2R3OA 3F9NA 1R0EA 2UW7A 5E8XA 2UZEA 4YZBA 5ETAA 3GGFA 1H0WA 2J0MB 2PVNA 5DEYA 4BHNA 3I1AA 3AT4A 4IAKA 4B9DA 4H3PA 5IQFA 1E1XA 3HV7A 4IXPA 4EKLA 1PHKA 3OWKA 5FD2A 4EORA 2PMNX 5HX6A 2OLCA 4FEWA 2REIA 4ALUA 3VRZA 3ZYAA 2H6DA 3QQKA 4Z7GA 5AP0A 1QPCA 3OXIA 3CQWA 2W4KA 3MIAA 2FYSA 2R5TA 2P0CA 3EYGA 4TY1A 4ZTSA 4O38A 5L2IA 5LMKC 3F7ZA 2YWPA 4GK2A 2VGPA 2XK6A 3AC5A 3QWJA 4F7LA 4O96A 3FEGA 4F08A 2AC3A 5C27A 1JNKA 4D2PA 4UXLA 4YO4A 4ANQA 4YLKA 3QTIA 3UYSA 4CKJA 2R3HA 3OUNB 1MUOA 3C4CA 3NYXA 4OGRA 5EYDA 5KKRC 3MB6A 4YTFA 1Q8WA 2VTLA 3GCQA 4IAZA 5GJFA 4BGGA 4U8ZA 5KMKA 3IECA 4IHPA 3BHYA 3ZUTA 2HELA 1YHWA 4L01A 3E8CA 3F6XA 4M97A 4PQNA 2OJFE 3TEIA 1NT2A 2P55A 1XQZA 4H3BA 4DFBA 2JLDA 4OW8A 1DS5A 3EFLA 3NR9A 4YLLA 3TM0A 4U5JA 2H8HA 3NAXA 3FKOA 5CYIA 4I41A 3R83A 3ZDUA 4E6DA 4ASEA 4D4RA 3RM7A 1H1RA 2JDSA 5A4LA 1OBDA 1YXXA 4YJTA 2YN8A 3K54A 3V5JA 3ANRA 4I0RA 1APME 1GY3A 2QODA 3G9NA 2C6EA 1WCCA 1MQBA 2X0GA 4LL5A 4D0XA 4R78A 1CDKA 3CXWA 4GUEA 4E8AA 4OT5A 4LQMA 1JPAA 2VTNA 5B2LA 5L3AA 3OVVA 3QC4A 1FINA 3MY0A 3PY1A 3PA5A 3DT1A 4I21A 3TUDA 1IAJA 2O65A 2OGVA 1E9HA 1PXLA 2XVDA 3EQRA 3GC9A 5HIDA 2VWWA 5CT0A 5TO8A 4FKJA 4BY9E 3DBCA 3BHHA 4GL9A 1UV5A 3ELJA 1PXIA 3F7WA 3SQQA 1OL2A 4RVLA 3WF6A 2JAVA 4UXQA 4MEDA 4ZTHA 4FV3A 3U6JA 5I5ZA 1Y8GA 3E3PA 1PKDA 2IVUA 2UW8A 4AXAA 4D1XA 3QQJA 3DPKA 3C50A 3C9WA 4DEBA 3M11A 3BELA 4N6YA 4C4IA 2CSNA 3KRJA 3DK7A 5CSHA 5F4NA 3ZFMA 3FPMA 1V1KA 3F5UA 2KULA 2WMBA 4HJOA 4D9TA 3TZMA 1AGWA 3DGKA 4S32A 4G3GA 5BYLA 3ZC5A 4CCBA 5J9LA 4EH6A 3FLZA 3HZTA 3UOKA 5HG9A 3PFQA 4CMTA 4EOPA 2EU9A 1SVHA 2YLFA 3AMBA 2PVFA 4KABA 1R0PA 2IJMA 4FTAA 3RKBA 5K5NA 1SMHA 3S0OA 5HNBA 3PPZA 5HBJA 3OBJA 1TQMA 2PUNA 1VR2A 5DT0A 5EK7A 1ZYJA 2QO2A 3R7UA 4I24A 3TKHA 2OH0E 3QTWA 5CZIA 4AZTA 4DE4A 5HO8A 3FI4A 4FA2A 5DRDA 4KKGA 2B54A 4WNMA 4YJNA 3V5LA 5M4UA 3BBTB 5IQAA 3P1AA 4IJ9A 3QCQA 4BDFA 3QKKA 3R0TA 2W0JA 4X2NA 2X8DA 3FQHA 3MB7A 4UMQA 5I4NA 2QOFA 2JITA 5CU3A 1W0XC 1Q3WA 4L9IA 2ETKA 2EB3A 4MD8E 3WIKA 5J5SA 3LFAA 4HGSA 1MRYA 3D5VA 3RMFA 3R8VA 4V01A 4ZEGA 4FTUA 4ORKA 1H25A 2Y4PA 3SXRA 3Q6UA 5J5TA 1PW2A 3JYAA 2BFYA 3SXSA 4UYAA 5FXSA 3V8WA 4E3CA 2VWBA 2ITYA 1KSWA 1IR3A 2I40A 3NIEA 3Q2MA 2OICA 4BWKA 3RCDA 2KTYA 3EYHA 4BZOA 3E7VA 4S33A 3RTPA 5IZFA 5J1WA 4XH6A 4FKTA 4G5PA 4BFMA 1DAWA 2WD1A 3ITZA 3PVGA 2XIYA 5EW9A 4GK4A 3LFEA 4YSMA 2QOKA 3GP0A 2QOQA 4QTBA 2QONA 4E5WA 3QXPA 4K2RA 3LE6A 3PYYA 4RWLA 3NYOA 4O82A 1PY5A 4HYSA 5DEWA 5L2QA 2JKQA 3ZXTA 3VS6A 3CKWA 5I9YA 1BI8A 4AZWA 1YDSE 4ZSLA 4D0WA 4O84A 2UVXA 2XIZA 4IVCA 2V7OA 2W5BA 3H9FA 4KS8A 4M15A 4NM0A 2WTCA 3AOXA 4GMYA 3Q9XA 4MBLA 4ANSA 4JG6A 1Q3DA 3PXZA 3A7JA 5K5XA 3F3UA 3ORKA 4I6QA 4BWPA 4JBVA 2R3FA 3C51A 4I4EA 4CG9A 1LR4A 4ZSGA 4PPAA 3BCEA 4FNXA 3LFBA 5J9ZA 2W05A 3MY1A 4JNWA 4PDPA 4D4VA 1Z5MA 4EH5A 4G1WA 2G1TA 3HUBA 4DC2A 3O51A 3A7HA 4G6OA 5IEVA 1FVVA 2EVAA 2WQBA 3WE4A 1UNGA 5DHJA 1VZOA 4E93A 4MF0A 2JIVA 1FMKA 1QPDA 3GNIB 4RJ6A 5C8NA 2W4OA 2ZMDA 4AT5A 3DJ7A 5HEZA 3R7OA 4DGOA 4Y72A 3DBEA 2PE0A 2F9GA 4YHTA 4FOBA 5HCZA 4C3FA 3NUYA 4I6HA 3QQUA 3EQCA 1YHSA 5CEQA 3CLYA 2OJIA 4WRSA 5JGAA 2ITPA 3DBQA 2H96A 1Y91A 3ZS5A 4BDEA 3TTJA 4FSZA 3C5UA 4I23A 3Q6WA 2QOHA 4O0WA 5ANIA 3NNVA 2WMUA 3DB8A 2QURA 4DGLC 4HNFA 2C5OA 4JIAA 4ZAUA 3FQSA 3MFUA 2PHKA 2VTJA 4ZP5A 5E91A 1TVOA 5TT7A 5AUZA 2VWUA 3A7FA 1PXPA 4TYEA 3FV8A 2HYYA 3COKA 3EWHA 4M3QA 3P7AA 4EWHA 1OECA 3LQ5A 1XH6A 2IVTA 4BVUA 2XNEA 5IDPA 2FSMX 3ZFYA 2OZOA 4P7EA 3OTVA 2GHMA 4ZIMA 5HD7A 3RHKA 4TT7A 4LUDA 2YM5A 4E6QA 4ZTMA 1AD5A 4DT8A 1CMKE 2CHLA 3BPRA 4EOSA 4K11A 4LMNA 3MI9A 4AG8A 4KSPA 4C59A 5J7BA 1Q24A 5BMSA 3L9LA 1XH8A 3HV5A 1KE9A 4NH1A 4IWQA 3L8XA 4L3JA 5CAUA 4M8TA 2V5QA 3LFDA 4FGRA 1I09A 2BILB 3AGLA 2YACA 3ZM9A 2X6EA 3I81A 3LCDA 5IUGA 5AP5A 3KRRA 3LZBA 3QYZA 2C1AA 3Q5ZA 4L46A 3R7YA 4RVKA 3CC6A 4FSNA 1G3NA 4Y85A 1P4FA 4YC3A 2VV9A 2WMXA 3VBWA 3CKXA 5AMNA 3DLSA 3U51A 3MA3A 4IAYA 4LGHA 4YZ9A 4QMYA 4DGNA 4GJ3A 1OKYA 3QRIA 1O6YA 3Q5IA 4KAOA 5GIOE 2NRYA 3FKLA 1P5EA 4Z7HA 2FH9A 3R9HA 3O17A 4FL3A 4EJNA 3HMMA 3ZH8A 4DCAA 5KZIA 1OPJA 1OPLA 4F9CA 3MV5A 1JSUA 3K5VA 3MH2A 2BTRA 2R2PA 4U3ZA 3E8DA 2WMWA 5TOZA 2C3KA 4ITJA 3DB6A 4BCNA 4BN1A 5BNJA 2BFXA 2YM3A 5CLPA 4EH7A 3DKFA 3SVVA 3SW4A 3PXKA 1ERKA 3Q4TA 2WTIA 1UNLA 2UZNA 3PXQA 4NM7A 4ACHA 3RWPA 1V0OA 4OBOA 3NNWA 3P5KA 4QP3A 2CMWA 3OF0A 4APCA 4DG3E 3UNJA 2Y6MA 3FC2A 3CY2A 3MYGA 5HG5A 5IQBA 4EH8A 3D0EA 3W2QA 2J6MA 2JFMA 2ZB1A 3GENA 4IVAA 3QZGA 4B4LA 4PP7A 1FQ1B 3PA4A 5CEMA 3E92A 1U54B 4F9WA 5AR7A 4PWNA 2Z2WA 2G2IA 4K18A 3HAMA 4F70A 2EXEA 4WNKA 3DAKA 4RBLA 3WF8A 2ZJWA 5DR2A 4MXOA 4GVAA 3QZFA 3E63A 4QPMA 2BAJA 4O0VA 4J95A 1H07A 1OITA 4I93A 4DAWA 2CDZA 2XKCA 3PZHA 2PE1A 2UUEA 4O7SA 5D9HA 2A27A 5JZNA 3LAUA 5DIAA 3RNYA 2GFSA 3QXOA 2V0DA 1SM2A 2PSQA 3QTXA 4GKHA 4RFYA 3BKBA 4IB0A 4NKSA 3R02A 3GCVA 5JFSA 2YFXA 4FTLA 3WE8A 4BBFA 2Z7QA 4EOOA 3F2RA 1YKRA 4MH7A 5FQDC 4GJ2A 3F61A 5EHYA 4C37A 5IQEA 5D10A 5GIPE 2YA9A 3CTHA 4G3CA 4RJ7A 1K9AA 2XBJA 2PUUA 5CVGA 4USFA 2C6LA 4EK4A 4DH3A 3AC8A 5EDRA 2A4LA 4KIQA 4QTEA 3DFCB 2QVSE 2YCFA 4AZVA 4C2WA 4WSYA 3IGGA 4IBMA 4IZAA 2OF2A 2YAKA 1R39A 2C5YA 2XZSA 3LXNA 5KHWA 4ZSJA 3DV3A 2ACXA 4RA4A 3T9TA 1CSNA 3PY0A 2W9FB 3R21A 4Y83A 4OBPA 4O1PA 4EOLA 2GTMA 2O2UA 2ITNA 4B6LA 2NRUA 4DLJA 1R3CA 4AGUA 4X2JA 3RAIA 4O7TA 2WNTA 3ZBFA 1U59A 2PTKA 1OB3A 3EFKA 3PP0A 3QTSA 4IW0A 4JR7A 4D1SA 3GU8A 3ORZA 1W84A 3G0FA 4YUQA 4FKSA 4D28A 4PMPA 2JEDA 3NSZA 1IRKA 1OGUA 1OL5A 2ZOQA 4QNYA 4FZDB 3RWQA 4K1BA 4FTMA 4KKHA 2X2LA 3QALE 2ONLA 3UMXA 1ZYCA 2XJ0A 3BU6A 4B8LA 2XKEA 3VS1A 4JBOA 3EL8A 3VUTA 5KMIA 4I5MA 3OP5A 3C4FA 3PRIA 5HBEA 5J9YA 1JAMA 2BZIB 3K5UA 4DEIA 3FLQA 3ZHPC 3ZEPA 3CPCA 1GZNA 3UZTA 3QHWA 4DINA 2R3PA 3BHTA 3BZ3A 3PG3A 4R3RA 5CQUA 1RQQA 3ZO4A 3UTOA 2CJMA 3SDJA 3MS9A 3LCTA 4OT6A 5J87A 4M68A 5E8UA 3VJOA 3NIZA 4HOKA 5AAEA 4KRDA 3HLLA 3MGYA 4AAAA 5LQFA 2CKQA 2CKOA 4IDTA 3H10A 3KN6A 4FT7A 4O6EA 2XNGA 3PXYA 4JQ7A 4RVTA 4NIFB 4WKQA 4XV1A 5HBHA 4NIFA 5HVYA 4H05A 4F7NA 2QO9A 3U9NA 3VUDA 4EOMA 4C58A 5KUPA 3QX2A 3L1SA 2ITVA 2WTKB 3W8QA 3MPTA 5DG5A 3F82A 3MH1A 3BQCA 5FBNC 1PRYA 1I44A 1VJYA 1GIJA 2UW5A 1WZYA 5LVMA 3NRMA 3LJ2A 3FZSA 4ZTRA 4I94A 4BZDA 4F0FA 2FVDA 1EH4A 5H8EA 2PZYA 3FZRA 4FV7A 3NGAA 1H26A 4IFGA 3KL8A 5FUTA 5IG1A 3ET7A 5IISA 3SG9A 3U4WA 3OEFX 4FC0A 4K9YA 2VO0A 2IPXA 2UW4A 1HCKA 5C9CA 1W98A 3PDTA 2R3IA 3OT3A 5JK3A 4RT7A 5T68A 4G2FA 3OXZA 3D5WA 3HMIA 3OUKA 3RBWA 4WNOA 1YI6A 4E1ZA 5KCVA 2HY81 4K0YA 1L3RE 5JQ5A 2IVVA 4C61A 4PP9A 5FTGA 2PVRA 4DEHA 2E9PA 3OBGA 5GINE 2GNHA 3RPOA 3OOGA 4EYMA 3UOJA 3QD3A 4RIYB 4O2ZA 4RIYA 2VWYA 3UNZA 4JJRA 3ZLWA 2YM8A 2FB8A 4DH5A 1Y57A 5EDPA 5K0XA 4F6UA 4GT3A 3KB7A 5K4JA 2IZRA 3U4UA 2ERZE 2OK1A 3PJ8A 4UALA 3KRLA 3F5XA 2EXMA 3RAHA 5HICA 5CU4A 3R30A 1SNXA 2XNPA 2QU5A 5DN3A 3U9CA 3KREA 3DXQA 5AA9A 1M14A 2XS0A 4RIXA 2VZ6A 4FYNA 4RIOA 3GVUA 1PMNA 3R8UA 4L68A 2CNVA 5BUIA 4A7CA 5C03A 3F3ZA 4FV1A 3OZ6A 2XMYA 4YGAA 4IM3A 4QQCA 3IKAA 1YWRA 5L8KA 2BKKA 3MPMA 4XP2A 1WBVA 4A4LA 4AGDA 3RVGA 2RGPA 4BDKA 4BCMA 5E9EA 1J1CA 4NJ3A 1W82A 2E9OA 2PZRA 5BPYA 4A9SA 5E8VA 4G3DA 4QT1A 5JZJA 2PUPA 5KZ0A 4FSQA 3LM0A 3M2WA 4FX3A 4DFLA 4YURA 4Y5HA 2BRGA 5J1VA 4EZ3A 3DY7A 1XR1A 4IZ5A 4YTCA 5FTOA 4BTKA 4UYNA 4PX6A 4A06A 2R4BA 3HRFA 1UWJA 3PVWA 3VNTA 4BDAA 4CFMA 3IDCA 2Z7LA 3PE1A 4AU8A 4FV0A 3HP5A 2YJSA 2OWBA 4QMPA 4DF3A 2XK8A 4KBCA 3HAVA 2OW3A 2W06A 2G15A 1JSVA 3PSCA 3FL4A 3O50A 4FTNA 2Z7RA 4MXZA 4QQJA 4ALVA 3ENHA 3PZEA 4CD0A 3KMWA 4FI1A 4IB5A 3QRTA 4G5JA 4HGEA 1H28A 3DJ6A 4NEUA 5CALA 3TNHA 1JKKA 2QU6A 4IAFA 3ORNA 4J53A 4LOQA 5CZHA 5CEIA 4L7FA 3FLYA 3SGCA 5HZNA 4RMZA 2CGWA 5BVWA 4ASDA 1IAHA 3KC3A 4RC3A 1YHVA 3ETAA 4BCPA 3KVXA 4MQ1A 2ZV8A 2PVHA 2RFNA 4IE9A 5HU9A 5AP1A 5ACBC 4YTIA 5IA2A 4CV9A 3QX4A 4DTAA 3NMUF 5DT3A 2O64A 1UNHA 4HGTA 3OW3A 4O21A 2BTSA 3HVCA 5DNRA 4BRXA 2JAMA 2OZAB 2OZAA 3RJCA 2XUUA 5HIBA 4Q5HA 5K4IA 3KK8A 3RCJA 3H30A 4EL9A 3QKLA 3VS0A 2JFLA 1G5SA 2C0TA 4GEOA 4MXCA 5AR4A 4UMRA 4W4VA 1HOWA 1R1WA 3MIYA 4LV5A 4LOOA 4EK5A 5ANKA 4L7SA 4ARKA 3VO3A 4ANNA 4F1MA 2W1FA 1Z9XA 3Q4ZA 4RRVA 2XH5A 4A4OA 4FSYA 1V0BA 2XK4A 4JVGA 3BIZA 4BIDA 2Z7SA 3N9XA 4YPSA 2X2MA 4W9XA 2VX0A 3P78A 1NA7A 2HK5A 3PG1A 3OMVA 4JX7A 3VBQA 5LARA 4D2RA 3LMIA 3U6IA 4Y46A 4CRSA 2XK9A 4M67A 4FT5A 2JDVA 2PY3A 5DYJA 5IH4A 3TKUA 4CFUA 4A9UA 4FYOA 5HTBA 2C1BA 1IEPA 3ZMMA 3C1XA 4RJ5A 4G17A 4I6FA 1KE8A 3EIDA 4MWIA 3DLZA 4EHZA 5D7VA 1Q99A 1YOJA 2JKKA 2YJRA 3KU2A 4GVJA 4F7JA 4I5PA 4JR3A 5B2MA 5EQEA 2PYWA 3QTRA 5FTQA 5GJDA 1WVWA 3G6GA 5EKNA 4H1MA 4YMJA 3BLRA 1ZZ2A 4QMVA 5KBQA 1CKPA 3POOA 4XRJA 3D15A 1Q41A 5JH6A 3FXXA 4I5CA 4MNFA 1STCE 3H0ZA 5GNKA 5JRSA 3BHUA 5KMNA 2OJJA 5CEKA 4FKPA 2YLEA 2XP2A 5DFPA 5GZ9A 3UYTA 4C7TA 2XF0A 4D2SA 2OJGA 5BUJA 5KKRB 4O7ZA 4AFJA 4AT3A 2CNQA 2CN5A 4FL1A 2YDJA 3R7IA 5KO1A 1J7LA 4RWIA 1ND4A 4UWCA 3S2PA 4W8EA 4EEVA 2J90A 4C8BA 1WFCA 4EZ5A 4I3ZA 1Q8YA 4JXFA 1F5QA 4JT3A 1XO2B 4P90A 1REKA 4YNOA 2UW3A 2ITOA 4CVAA 4NM3A 3FMNA 3KQ7A 5L6PA 2UZTA 2WO6A 1OIUA 4QMZA 3V5WA 2CLQA 2JDTA 2X7OA 3QL8A 5HE0A 5M4FA 4L3PA 2RFDA 4XG8A 1M7NA 5E8ZA 5AUVA 4H39A 1ZRZA 5H8GA 3ANQA 2HXLA 2G9XA 5HLWA 2EWAA 4FG8A 3TZ8A 4TWPA 3FWQA 4RIWB 2OXDA 2VO3A 4RIWA 5CS6A 5AEPA 4BDGA 3JY0A 2VWIA 1Q8ZA 4UZDA 4MQ2A 4OLIA 4W9WA 1KOAA 4QP2A 1PMVA 4G3FA 2IZUA 3FSFA 4X0MA 1F0QA 3KXGA 4BZNA 4YBJA 4DFXE 2XIKA 4LRMA 1YOLA 4XBRA 5KBRA 3UQGA 2PWLA 3BLQA 2GTNA 4U97A 4DA5A 3NPCA 1GIHA 2WMTA 3NW7A 4CFVA 2I6LA 1MP8A 1BI7A 3UDBA 5FBOA 4XRLA 3SC1A 3TACA 3WBLA 3TG1A 1FGIA 3CD3A 2PMIA 3JPVA 4BC6A 4C3RA 4DCEA 1UA2A 3GC7A 4BI1A 3CJGA 5H2UA 4BYIA 4U9AA 3FBVA 2C5VA 3KF4A 3KRXA 3MFSA 5BMMA 3W32A 3R2BA 4DFNA 2YEXA 3GU4A 3ENMA 5EYKA 3LLAA 5E8YA 4C4JA 2HW7A 3O7LD 4AZFA 2Y8OA 3DJ5A 1YVJA 2IW6A 1JKTA 1PKGA 4GUBA 2B7AA 4FSTA 5TR6A 2XIRA 3C4XA 1UWHA 5EHLA 2WEVA 3EFWA 4W4YA 4WSQA 3UQCA 5E1SA 4Z55A 2X39A 4JBPA 2YCQA 3I60A 3QRUA 3E5AA 3FMJA 4TXCA 4FV5A 4IANA 5J95A 1H08A 4J96A 4FT3A 4IFCA 3NDMA 3ZUUA 4E4NA 1CKJA 4WT6A 5BVOA 2HCKA 2GHLA 3COHA 5F9EA 2UVZA 4ASZA 4L3LA 3P7BA 4K33A 3OWJA 4R5SA 4D2TA 2FUMA 2IG7A 4L8MA 4EQMA 1WBNA 2C3IB 2QG7A 4TZRA 5IEYA 1SVGA 3RK7A 4HVIA 2PULA 3D7ZA 4PTGA 1M2QA 1Q5KA 4XYFA 1HCLA 3VBTA 5D7AA 4ZLZA 2PU8A 4EK6A 4KSQA 4R7HA 2P2HA 5CEOA 2XJ1A 3BLHA 2FGIA 4GIHA 4KIKB 4TYIA 4R1VA 4MXYA 5EG3A 4KIKA 3PRFA 3LJ1A 2AUHA 4LOPA 4E4LA 1J3HA 4PMTA 2GNGA 1R78A 4EK3A 2HWPA 4BDDA 5DMZA 1M52A 2UW0A 4QMWA 4QMTA 3COIA 2AYPA 3SXFA 5L6OA 2C69A 4E7WA 3H0YA 3UPZA 2C6KA 3VQUA 5F94A 2CGVA 4ZTQA 5CSWA 4DEGA 3ZSIA 3BGZA 5HNGA 4JS8A 3FPQA 4L44A 1NVRA 3Q4UA 4RSSA 4IJPA 3EB0A 3KK9A 4WG4A 3LOKA 4BDJA 4CT1A 4P2KA 2WU7A 2J0IA 2J7TA 4IM0A 4M84A 4FTCA 3TT0A 3F2NA 2F2UA 3DCVA 5LJJA 2HXQA 2ZM1A 3PTGA 3R6XA 2LAVA 4CYJA 3DDPA 1QCFA 5DVRA 4RX9A 3TL8A 2GCDA 2UV2A 2JBOA 4IC7A 2GS2A 3CCNA 1Q61A 2YZAA 3FJQE 4KKEA 5CSVA 2ZDUA 2BRMA 2FO0A 1YOMA 1UKHA 1UU9A 4WOVA 3FI8A 5HVKA 4UX9A 5AR8A 3V6SA 2HW6A 4AN9A 4DHFA 5C26A 4GU9A 4FGBA 4XG3A 4CTBA 5T6KA 3FMDA 2GNJA 4W8DA 4CLJA 2B1PA 3Q9YA 1ZMVA 5IU2A 4YBKA 4H58A 2WTWA 3DAJA 5LWMA 2XRUA 3C5IA 3P4KA 3R1YA 4L43A 3LFQA 3ROCA 4EONA 3VF9A 4CTCA 3MVLA 2VTAA 2BROA 1VYWA 2O5KA 3VIDA 3V5QA 4BKYA 4LUEA 4IDVA 3NNUA 3E64A 3PPKA 1ZOGA 3I6WA 3ZM4A 2BIYA 4JDKA 3W2OA 4IAIA 4G6LA 4FKOA 3HA8A 4ONAA 3JS2A 1B39A 3DZQA 3CTQA 5G1XA 4S31A 4O7YA 1YDTE 5EHOA 4R1YA 4R8QA 3DKCA 3KXXA 4PNIA 4ID7A 1Q8TA 1XH7A 2BHHA 4J99A 4F9BA 5DR9A 3Q3BA 3GEQA 2XKFA 2C0IA 2X8EA 4J98A 4FEXA 3C0HA 3KA0A 1PMEA 3IPHA 4QP6A 4QTAA 2X7FA 4IQ6A 4CGAA 3GOPA 2IZSA 1XJDA 3SA0A 4AZSA 1B38A 3PJCA 3UQFA 3SKCA 2QOCA 5EQPA 3IG7A 3M42A 3HX4A 4X7QA 4EYJA 4R77A 2C0OA 4PV0A 3TWJA 4C02A 4EHGA 2OJ9A 3E8EA 2FSTX 3S1HA 4RWKA 4HCTA 5ANOA 3W2CA 2HZIA 4NCTA 2E9VA 1OMWA 2QHNA 4ZMFA 4YSJA 3KVWA 3ODYX 5EDQA 2I7QA 3CQUA 3DQWA 3DKGA 5LVNA 3C13A 4O91A 3FLNC 4UMTA 4ANBA 3QLGA 4RPVA 2BKZA 4ZLYA 4ZY4A 3L8VA 5FWKK 2JC6A 4QMMA 3ORMA 3Q96A 2XCKA 1YI4A 2F4JA 4XCUA 2X8IA 5AUYA 4O7RA 3FI3A 5IDNA 4U80A 1YI3A 1M17A 4OTIA 1CKIA 5AWMA 2QLUA 3EN9A 3VS5A 2BHEA 1OL6A 3Q4CA 1TQIA 5C1QB 5DWRA 4K6ZA 3VW8A 4L42A 3LIJA 1PXMA 1H24A 4C62A 3VUHA 3BBWA 3SHEA 1F3MC 3OOMA 3VBYA 4HCUA 5CVFA 3CBLA 4FIHA 4JL9A 4TYGA 5ICPA 4MYGA 1OVEA 3VHKA 2CNUA 4NCTC 4X3FA 5I9ZA 1H0VA 3A8XA 2A0CX 3QQGA 3OD6X 4FEUA 4RQKA 5H9BA 3Q52A 4MBJA 1OIYA 2CPKE 4ZTNA 5FXQA 5I3OA 4YJOA 3EKKA 2J0KA 2W1IA 4O2PA 3FXWA 3FUPA 4L6QA 2ZMCA 2HOGA 5DLSA 1ZOHA 4N6ZA 3W8LA 5E7RA 4ZLOA 3CS9A 4BTMA 3MSSA 4BIBA 2OFUA 3LFFA 4EBWA 1OL1A 4AW1A 4ACDA 2VTIA 2WMAA 1WBSA 3A4PA 5HLNA 4NK9A 5I9XA 1OZ1A 2BMCA 3EHAA 4EHVA 1K3AA 4OR5A 5M4IA 1H01A 4UBAA 3LW0A 1DI9A 1ZWSA 5FDPA 4IB1A 3TNQB 3MTLA 2WPAA 4XG4A 3CY3A 4UY9A 4LYNA 2BZJA 2X4ZA 2GS6A 4XMOA 5D1JA 3UMWA 4USEA 5AP4A 4PL3A 3G0EA 2F7XE 5IMXA 4R7IA 4X3FC 4D4YA 1J7UA 3ALOA 4DT9A 3GOKA 3D4QA 3OW4A 4FTOA 4NU1A 3NUAA 5CI7A 4QTCA 4WUAA 2ERKA 1V0PA 1ZYLA 5FEEA 4M66A 4X6RA 4ZJVA 3GFEA 3A7GA 4C4EA 5IUHA 3I6UA 4TWCA 3RZFA 4A9YA 3OCBA 2VTRA 3PPJA 4YJPA 1P4OA 4F64A 3QRJA 4QQ5A 3LMHA 3R8PA 4G16A 2R3MA 3ZFXA 4FKUA 5E8WA 2XIXA 4PL5A 5FP6A 1DM2A 3CSVA 2BPMA 3ZZEA 3D5UA 2JKMA 3DBFA 2ZB0A 5IEXA 4QMXA 3C0IA 5M4CA 4AQCA 2I0HA 4KS7A 2W99B 2WMRA 5A46A 3AC2A 2XEYA 4FV2A 5E92A 4AE6A 2YM6A 1M2RA 3IW8A 3R63A 4NM5A 5EW8A 4FUYA 5JKGA 4DG0E 5A14A 4FEVA 3NX8A 4PMMA 3BYUA 3GU6A 4F1TA 4DBXA 4J97A 3WI6A 4E6AA 1Q97A 5CQWA 4JBQA 3TI1A 2BRNA 3GUBA 3UODA 3PWDA 4WHZA 3WYXA 2P3GX 4L00A 3Q53A 3NVKI 4I5HA 5C8MA 3EOCA 3U8WA 3U6HA 3F3TA 4BCFA 4N57A 3E7OA 4X21A 2XK3A 2G2HA 5F95A 3HV4A 4B99A 4UWYA 3NCGA 3P0MA 3RK5A 5J8IA 2WQEA 3E87A 4BBEA 2G2FA 2W1DA 4O0XA 3F66A 3VS4A 4YJQA 3NLBA 3E93A 5EM7A 4AT4A 3PWYA 4C4FA 4HZSA 4X3JA 4BKZA 3LPBA 4W4WA 3OXTA 2BAQA 3EN6A 4QYGA 4DH1A 3KXHA 2QOBA 5HESA 4FV4A 4YJRA 5EM8A 1L8TA 4YHJA 2PZIA 2QD9A 2WTVA 1NVSA 3LMGA 3O2MA 4MD9E 4U42A 4XLIA 3RI1A 3NWWA 5FDXA 3S95A 4DBNA 5L4QA 3NNXA 3O23A 5CTPA 3MVHA 5M56A 1UU8A 3KRWA 4OUCA 2UZOA 3PJ3A 5CF5A 2WIHA 2X7GA 4O81A 2YABA 4YZNA 5D12A 3ZRLA 3D83A 1JWHA 1IG1A 2A1AB 3JUHA 5IQCA 2QKWB 3NS9A 1ZMUA 2UZUE 1W7HA 4IX5A 3UG2A 3ORPA 2W5AA 4B7TA 4MAOA 4EHEA 2W1GA 4QP7A 4CYIA 1OKVA 3W55A 2WHBA 3MA6A 4O1OA 3AMYA 3WZJA 5CSPA 3O8UA 3SD0A 2X4FA 3WOWA 2WQNA 1QMZA 3TV6A 4DH7A 3MW1A 3UIMA 4QMOA 5AP6A 5ETFA 4LG4A 1S9IA 1PYEA 2DQ7X 3TKIA 3UG1A 3V8TA 3MJ1A 3O71A 4LGGA 2WTDA 4PRJA 4KIOA 2W7XA 2WELA 4TWOA 3V6RA 4E4XA 4IWOA 3KEXA 4FT0A 1OIQA 3FQEA 2CCHA 4FIIA 5HO7A 3ATTA 3VJNA 2RFSA 5HVJA 3KKVA 4AF3A 4XOZA 4BCJA 4DEEA 3UZRA 5BVKA 2DS1A 5DA3A 5B0XA 5IH5A 3ZLXA 5EM5A 4X2KA 1BYGA 4XG6A 2QC6A 3I5ZA 4FZAB 4L52A 5BYZA 3W33A 4BDCA 4Q9ZA 3DA6A 5CASA 3ZU7A 4UB7A 2BDFA 5KX8A 1NW1A 1NVQA 3F88A 2P33A 4F0IA 1H1SA 3Q60A 1LUFA 1Y6AA 2WMVA 5J7HA 3TCPA 4J7BA 3W16A 2BCJA 4FSRA 3P79A 3ZSGA 3UIXA 3UNKA 3ZRKA 2J4ZA 3MFTA 3R8MA 4FODA 1OUKA 2XNOA 5IPJA 3G6HA 2C6DA 5ITAA 3A99A 4JG8A 3ODZX 5AR5A 3TUBA 2BUJA 3PXRA 4BTJA 5HCXA 3COMA 3IGOA 1PJKA 3SOAA 4FG7A 3PVBA 1JLUE 1ZY4A 1NXKA 3O0GA 3L8SA 3QTZA 4NSTA 5AUXA 2FSOX 3I4BA 2IW8A 4EZ7A 4TNBA 1PF8A 2O8YA 4TWNA 1ZOEA 4NKAA 5HHWA 3QBNA 5AAGA 5FM3A 1JQHA 2W9ZB 1REJA 3FL5A 4GU6A 5CI6A 5JN2A 1CM8A 5L2SA 2Z02A 4OTPA 1LEZA 5EM6A 4FUXA 1JVPP 3BEGA 5AP7A 4QQTA 5CSXA 4FR4A 3UC3A 5KMJA 5CT7A 2OU7A 1Y6BA 3G90X 1T45A 4XJ0A 3RPRA 4BGQA 3JR1A 3EN5A 1YDRE 4IWDA 4YZCA 2PVKA 3DXNA 2YIYA 4XX9A 5HE3A 4BTFA 5IA4A 5HE1A 2R64A 2PVMA 4CXAA 2R3NA 2HIWA 3FY0A 3R2YA 4J8NA 3U87A 4C3PA 4CZYB 5JQ8A 3H9OA 3CE3A 3DU8A 2OI4X 1WBPA 3FHRA 3SAYA 2W1CA 3BI6A 2YM4A 4GH2A 1OIRA 1JBPE 4U44A 3QGWA 2ZAZA 3ZO2A 3R9NA 3PXFA 4Q9SA 4RIXB 4BKJA 5GZ8A 2J5EA 2VNYA 4AA0A 1A9UA 3EQBA 4QD6A 4GV1A 1FBNA 4I1ZA 4B0GA 3V3VA 2HWOA 3RPYA 3W2SA 1BL6A 1XBCA 2FA2A 5M57A 4O0UA 4CRLA 1KV2A 3LLTA 3LXKA 4H36A 4UN0C 4IVBA 3BYOA 1JOWB 3FLWA 4OTHA 5LXMA 3AMAA 3QA0A 4FE2A 2BVAA 2H34A 1RE8A 4I20A 3ROYA 4QP8A 3TN8A 4AOIA 3LXLA 5AAFA 3DS6A 5IQGA 5E4HA 5J79A 4EJ7A 3SV0A 4N0SA 2CGUA 3II5A 5IF1A 5HTCA 2C47A 1H00A 3HNGA 4RFMA 4LM5A 3RPSA 4GS6A 3AGMA 4LMUA 3FXZA 3OROA 1QL6A 4KBAA 5AX9A 4ZZMA 3WYYA 4WO5A 4RA5A 2VAGA 3FE3A 2CKPA 4GIIA 4WNPA 5ANDA 3MTFA 2BIKB 4HPUE 3TV4A 4AX8A 2X2KA 5CENA 5F20A 2YDKA 3F3VA 1Q4LA 3DQXA 5A4TA 4O0SA 5L8LA 3D2KA 5FGKA 4USDA 3UO6A 4GSBA 5ACKA 2IVSA 3QZHA 3EKNA 3VN9A 4D58A 2BALA 4EUUA 5E1EA 3C0GA 5I0BA 4RGJA 4CZTA 4UEUA 2R3JA 1T46A 4ZS0A 3TIZA 5M55A 5AUUA 5CXHA 2B9IA 3ATSA 3RAKA 2GPHA 4O6LA 1WBWA 3DFAA 4YO6A 2ETMA 4G9RA 4CEGA 3I7CA 3QTQA 5AR3A 4C36A 4HGLA 5LMAA 3VUIA 4FIJA 3GQIA 4QTDA 2JIIA 4MXAA 4JI9A 4ANMA 3TNPC 3Q2JA 2DUVA 3SRVB 3MPAA 3SRVA 2P4IA 2ZV9A 3QZIA 4ZSEA 1QPEA 4BDBA 4OTGA 4X6QC 4Z3VA 3KCFA 5IQHA 4TL0A 3PY3A 3FI2A 4AW0A 4C38A 2I1MA 2YISA 3OCGA 3MBLA 2CGXA 4QP1A 1XH9A 3EQPA 3QRKA 4TKSA 5DH3A 4FIGA 4FV8A 3VRYA 4JDIA 5AA8A 4AUAA 4FK3A 1SYKA 2V55A 3IK3A 3T8OA 3HDMA 2PE2A 1P2AA 3C4WA 3ORTA 3ZLSA 5HX8A 4OTFA 4XG2A 4W4XA 3H4JA 3NW5A 2B53A 4O7VA 3QUDA 4UMPA 3VHEA 4CMUA 1BMKA 2OF4A 1J91A 3ZLYA 5JT2A 3ULZA 2WXVA 4OTDA 3G5DA 4R3CA 1WBTA 3VUGA 5M08A 4UMUA 3VAPA 4FSUA 3IQ7A 5E8TA 2YIXA 4O7LA 3GI3A 4GK3A 2YIRA 3MVMA 2NNWB 3G15A 3GU5A 4BDHA 4BCOA 5EOLA 5HU3A 3CQEA 2XEZA 4O0TA 4FV9A 2Z8CA 3Q04A 5DT4A 4AGCA 2IW9A 4RJ8A 4M7IA 5LWNA 1BLXA 4B8MA 4IX6A 3ZCLA 3ZXZA 2C6OA 2GFCA 4GCJA 4XNEA 5AR2A 3RALA 3NYNA 3R8ZA 2WB8A 4II5A 5JGDA 4XOYA 4EH4A 4HW7A 4FVRA 2E9NA 4XUFA 3KGAA 4DYMA 5I9WA 4NJDA 5CU2A 5BUEA 2ZM4A 4ACGA 4YP8A 2F57A 5CANA 3BE9A 4K77A 5CNOA 3RM6A 4XV9A 4FNYA 5HI2A 3UIBA 5AIRA 1LPUA 3UVQA 4E73A 4RQVA 4EOIA 5JSMA 2YCSA 3EMGA 4MNEB 4QMQA 1XWSA 3I79A 4MNEA 4HZRA 2BAKA 3R71A 4E26A 5CAQA 3MFRA 3OWLA 4NW6A 5M44A 3BRBA 3FYKX 4QYYA 2ITQA 3PUPA 3TIYA 2ITTA 5ANGA 4IB3A 5FLFA 4EH3A 4BF2A 3PIYA 4G34A 3LVPA 5FRIA 2WIPA 2Q0BA 2YM7A 2OO8X 1H27A 4GRBA 5DI1A 4JDHA 4WA9A 2GS7A 4MTAA 2F7EE 4TN6A 4RJ4A 4OBQA 5KMMA 3ALNA 4PTEA 1WBOA 4X2FA 4CG8A 3V51A 4U79A 3FDNA 2OG8A 3MVJA 4AA4A 4UWBA 4RVMA 1BX6A 1M7QA 4AS0A 5FP5A 3PLSA 3RK9A 5CAPA 5BQ0A 2VTPA 2YHVA 3MWUA 2E9UA 5L2WA 3M1SA 3ZZWA 3KFAA 2ITZA 3QAME 4TPTA 5GJGA 4GT4A 4JAJA 2Q0NA 3GXLA 3NW6A 3W2RA 4P4CA 3TXOA 3P7CA 3QUPA 3K3IA 3R28A 4WBOA 3R22A 1GAGA 3FMHA 4FK6A 4A4XA 5FXRA 2J2IB 3BQRA 3WZEA 4EUTA 4FKGA 5IH6A 4IX3A 3B8QA 4C34A 2YITA 3AC3A 4CNHA 2CCIA 2R7IA 1YQJA 5AM6A 5A6NA 2WU6A 3OCTA 1G8SA 4TW9A 2B9FA 3FKNA 3POZA 4EH2A 4BWXA 5L2TA 2XJ2A 4EH9A 4D9UA 5LOHA 3UVPA 4MVFA 1IA8A 3GFWA 4QYHA 2A19B 2WFYA 4OTWA 1W83A 3EQGA 3I0QA 3IO7A 2VO7A 3TNWA 3VVHA 4ZK5A 2UZVA 3GCUA 2VGOA 4K8AA 4BCQA 3VC4A 5JRQA 4GFMA 3QTUA 3B2WA 4GG7A 1XKKA 4RJ3A 5HG8A 3R01A 2PUIA 3EFJA 2GDOA 3R7VA 4GW8A 4CMOA 4GFOA 4YLJA 4IEBA 3OT8A 1YXSA 5CU0A 4PDYA 2YIWA 3FMEA 3N51A 4FTJA 5HOAA 4EQCA 5DBXA 3GB2A 4NTTA 1JKLA 3OTUA 3LQ8A 2V62A 3D9VA 3DK3A 3D14A 3RP9A 2BDWA 5EI8A 2QOOA 4PMSA 5CX9A 4NZWB 3ID6C 2OBJA 2VTOA 2VD5A 1O9UA 4NTSA 4IAAA 4MCVA 1OKWA 3WF5A 4EQUA 3PVUA 4JQ8A 4WIHA 2XYUA 2AC5A 5EYCA 3ZDIA 4CLIA 3CIKA 4U43A 3ZTXA 2GSFA 3EL7A 2B9JA 2OFVA 5LVPA 4BCGA 1BUHA 2EUFB 3A4OX 1X8BA 2CKEA 3EZRA 3E3BX 3NYVA 3QQLA 4NWMA 3DXPA 3QFVA 5JGBA 3NVMB 2VTQA 2C5XA 3FZOA 2UZWE 4ERKA 2UZDA 3AC1A 3RHXA 2R3LA 4DFZE 2PVLA 4GKIA 3VWAA 4LV8A 3R9OA 4J8MA 4IWPA 4TYHB 4V05A 5IQDA 4FVQA 2JD5A 4TYHA 4RLKA 4FL2A 4PDOA 1Y8YA 3D2IA 3EN7A 3UP7A 3HDNA 4D1ZA 5K9IA 3DKOA 5KNJA 2R3QA 2WKMA 4I22A 3TZ9A 1J1BA 4ZOGA 2J51A 4NUSA 3L9MA 5C01A 3HUCA 3R1NA 3R9DA 4ANOA 3KN5A 3FMLA 5BYYA 2YZLA 4GG5A 1IASA 4RLLA 4FTRA 2HZ4A 3FC1X 2I0EA 4I92A 4WG5A 4D5HA 4GFGA 4DGGA 3D5XA 4FOCA 2QG5A 2JGZA 2DYLA 3ORIA 4IH8A 3QF9A 3FMMA 4BDIA 3R1QA 4U0IA 3DBDA 4XP0A 5IKWA 4AWIA 4XHKB 5EH0A 3HRBA 3HEGA 3IOKA 3T9IA 3F69A 4FKWA 4U40A 5FEDA 1ZY5A 3CGOA 4IC8A 1QPJA 2WMSA 4YJVA 1OM1A 4FMQA 4AN3A 1TQPA 1B6CB 3BU3A 5B7VA 2GQGA 3WARA 1KUTA 3LCOA 3B8RA 4F9YA 4JG7A 4CKIA 4F6WA 4AP7A 4FEQA 2JIUA 3I7BA 2YCRA 4RX5A 4JDJA 3QD0A 3R8LA 5HIEA 3QQHA 4CQEA 3E88A 3ZBXA 5EI2A 5HGIA 3EQIA 1ATPE 4EK8A 3BGQA 3NUPA 3KMMA 2XNBA 4DFYA 4Z16A 3AG9A 3JXWA 4QOXA 2HY0A 1PXJA 4DFUA 3OG7A 3DDQA 2VUWA 2VX3A 3WZDA 1KWPA 3HMNA 3ZUVA 1LEWA 2GQSA 4U81A 4R7BA 4ZZOA 4TYJA 3OEZA 4O27B 3UP2A 4L53A 5FEQA 5LVLA 5AV0A 3KY2A 4Y5QA 2VN9A 1Q62A 5A3XA 2OH4A 5AUTA 1WAKA 4FKVA 2UZBA 3WILA 3H9RA 4WG3A 2RIOA 4AGWA 3OS3A 3KULB 2B55A 5AUWA 4PNKA 2VNWA 5K3YA 3KULA 2LGCA 2Q83A 3GCPA 3P9JA 3LFSA 4FTIA 5EQYA 3I5NA 5ANJA 2YWVA 4NFNA 4PPBA 3NCZA 1SVEA 3O8PA 2RFEA 4BI0A 1PXKA 4M0YA 1YW2A 3CJFA 3UC4A 3O96A 2VWZA 4UZHA 4Y8DA 4YR8A 3C4ZA 1E1VA 4N4SA 2VTHA 3AD6A 1UVRA 5AP2A 4EOKA 5M51A 1MRUA 5M09A 3PIXA 4FIEA 3HECA 5IA3A 3T3UA 5AM7A 3FYJX 4NT4A 1FGKA 3GC0A 4F09A 5AX3A 3GU7A 4FZ6A 4CCUA 2HZNA 4FNWA 4MXXA 4QPSA 3OC1A 4XG7A 2XM9A 3TUCA 4E6CA 4NYEA 3QWKA 3HRCA 4D5KA 2XNMA 1WVXA 4DGMA 4MF1A 2C6TA 5HNIX 3PA3A 2YAAA 5LVOA 3MH0A 3N4TA 5CY3A 2WMQA 5CF4A 3F5PA 5HCYA 3UOHA 3ZO1A 3HV3A 2ZYBA 2PVJA 4MBIA 4EBVA 4ACCA 4M0ZA 2C5NA 4QO9A 3UJGA 5ETIA 4ZY5A 2R3GA 1A48A 4P5ZA 1P14A 1H1PA 5BVDA 4LRJA 2WOTA 1KE5A 2O63A 3RNIA 3ERKA 3UGCA 1ZZLA 2PL0A 3EN4A 3HMOA 1XH4A 4JAIA 4D55A 2UVYA 2XCHA 1GZOA 2YERA 3A61A 4F9AA 3DTCA 4D2VA 1O6KA 4QP4A 2B4SB 5CU6A 3R73A 1XBBA 4I4FA 3S4QA 1ZYSA 3QUEA 2NO3A 3R7GA 4X3FB 4U41A 2Z60A 3SG8A 3W18A 2Y7JA 3P86A 3VULA 4WRGA 3CD8A 4ZY6A 3W1FA 3FZ1A 3E8NA 4WUNA 4J52A 2XKDA 3IONA 5JFWA 3SX9A 3QQFA 4HVDA 3BX5A 4MWHA 4NW5A 4FVPA 3PIZA 5IQIA 2WZJA 3KXNA 3D94A 3OY3A 3G9LX 2WAJA 4IIRA 4ITIA 4JIKA 4LI5A 1O6LA 5AV1A 5KHXA 3QGYA 2VWXA 1GNGA 2EB2A 1H1WA 4RC2A 4XLVA 3ZRMA 3U54A 3QHRA 2HZ0A 2WTJA 4HCVA 3A7IA 3TTIA 4H1JA 3UZPA 4CFXA 4F99A 4HVGA 4QRCA 4G31A 4O0YA 1OBGA 4NL0A 4OAVB 4U7ZA 1UU3A 4QMSA 2C6IA 1RW8A 2R3KA 5H3QA 5AV4A 5AFVA 2XNNA 3UO4A 2XYNA 5GZAA 3R1SA 4KB8A 3JVRA 4YC6A 1NY3A 3FLSA 3UPXA 2W4JA 4I6BA 4M12A 4ZZNA 5DR6A 2JDRA 3BYMA 3PSDA 5D41A 5HG7A 2VWVA 3L9PA 2CLXA 4A07A 2FSLX 3KXMA 4D2WA 5KMLA 1ZAOA 3LCKA 3QC9A 1H1QA 3QCSA 4RC4A 5ETCA 5A4EA 5CAOA 4DLIA 3W2PA 3HV6A 3QYWA 3C7QA 2Y0AA 1BKXA 4AA5A 1XHAA 4P5QA 2PZPA 4YTHA 1J7IA 4C2VA 4XEYA 5LMBA 3WF9A 5M07A 4A9TA 4U6RA 4EOQA 5L8JA 2R0IA 1FMOE 4CT2A 1ZMWA 3R7EA 1AQ1A 1PXOA 3O7LB 2QLQA 3DNDA 4KINA 5HORA 4JLCA 4TNDA 3RAWA 3RPVA 1U5RA 3LXPA 4ZJIA 4GT5A 3OHTA 2QOIA 4TTHB 4ITHA 2IZTA 4DH8A 4QYEA 3TDWA 4CSVA 4WBBB 2F2CB 2ZM3A 5L6WL 2W5HA 2QQ7A 5DE2A 4C4HA 1UU7A 4X2GA 3IW7A 2RG5A 3SOCA 4ACMA 2JBPA 4S2ZA 3KF7A 4FKQA 2OIBA 2UZLA 2X6DA 1TKIA 4R6VA 2OXYA 3IW5A 4DG2E 4APPA 4GYGA 4XG9A 4I0TA 5LCJA 4FZFB 2A2AA 2ZDTA 1U54A 3E62A 4E5AX 3VS7A 3UVRA 4FICA 2ITXA 3DTWA 3MY5A 4LGDA 4M14A 4IVDA 3NEWA 4KD1A 4MKCA 1YRPA 3MDYA 1GJOA 3ORLA 4LFIA 2W1HA 4ZXTA 4KNBA 1FVTA 4FKIA 4RX7A 4IADA 3ACKA 1GZ8A 1ZARA 3EH9A 4HYIA 5EW3A 2V22A 4PL4A 4EC8A 3AT3A 2BDJA 4F0GA 5M06A 4IMYA 2J9MA 2GMXA 3Q9ZA 2WGJA 1XH5A 4O22A 1LP4A 1VEBA 3ZEWA 1MQ4A 1S9JA 3L9NA 3NUUA 4KWPA 5DOSA 3IW4A 3ZOSA 4F7SA 4PUZA 3FZTA 4EOJA 3AT2A 3WZKA 1KE7A 3GCSA 1G8AA 4O83A 3UIUA 4H3QA 5CNNA 4FTQA 1WVYA 4U45A 5CAVA 3EQDA 4ERWA 2HENA 5CEPA 3HP2A 5BVNA 5EOBA 2F7ZE 3LHJA 4KA3A 3R00A 4UV0A 4YZMA 4AZEA 4YU2A 5I9VA 5JMSA 3G2FA 3NAYA 3VBVA 4FBXA 4OTQA 4DTKA 4RFZA 4EC9A 2NPQA 3UBDA 5AV3A 3QD4A 4EKKA 1URCA 4R5YA 2VTSA 3UO5A 4FNZA 5A4CA 4FKRA 5C4KA 3JVSA 3LJ0A 3UE4A 2GQRA 2YDIA 3F3WA 5C4LA 3R9RA 5JFXA 3NZ0A 2QR8A 3NUNA 1FVRA 1OI9A 2GNLA 5EKOA 4CFFA 5TF9A 3N4VA 3QLFA 4KIPA 4RZWA 3VS3A 5CVHA 2IWIA 3MH3A 2O3PA 4XV2A 5EI6A 4DEAA 1YXTA 3WF7A 1BL7A 3I0OA 4JRNA 4AOTA 4L67A 1JKSA 4F6SA 4Z9LA 3QCYA 3SW7A 1WMKA 2WQMA 2VRXA 5JFVA 3DK6A 4EI4A 1UKIA 1H8FA 2XM8A 4QYFA 2X81A 4IZYA 3RINA 3ORXA 5HKMA 3A60A 2W1ZA 3KCKA 3A8WA 3TDVA 3MN3A 5CXZA 2YIQA 2G01A 4Q2AA 4BICA 5I3RA 2OIQA 1YWVA 5BX0A 5DRBA 2R7BA 1VYZA 5ANEA 5IA5A 2ESMA 2PPQA 3BWJA 4FSMA 4HPTE 3FMKA 4DTBA 4HYHA 3U55A 4JOAA 3GBZA 4PF4A 3AD5A 1U5QA 3OWPA 4QPAA 4F1OA 5HD4A 1CTPE 4HVSA 1H4LA 2HAKA 2XBAA 4PPCA 2C6MA 4HVHA 2GNIA 2I0YA 4V0GB 2J0LA 4BI2A 4V0GA 2W96B 2RL5A 2C30A 5I9UA
chains in the Genus database with same CATH superfamily
1XBAA 3FSKA 5HLPA 3G51A 4AW5A 2GNFA 4QMUA 5HE2A 5IA0A 4HNIA 5JEBA 1YXVA 4RZVA 3DZOA 5FG8A 2J50A 2R9SA 2W1EA 3T3VA 4DEDA 5HQ0A 2ZVAA 3P23A 3REPA 4CFNA 4F63A 4YJSA 5M53A 2ZV2A 2ONLC 2C3JA 2X9FA 4AE9A 3VUKA 3ZONA 2ITWA 4JQEA 4M69B 2GHGA 4M69A 2B52A 3DOGA 2XK7A 4S34A 4ZSAA 3K2LA 2EXCX 2P2IA 4O86A 1PXNA 2QOLA 2XA4A 3CEKA 3PJ1A 5A9UA 1URWA 5IMEA 2C4GA 2NP8A 3PUFC 1GOLA 1K2PA 3NUSA 3KMUA 4U3YA 4CQGA 1Z57A 3DNEA 2ETRA 4A9RA 4KUJA 1U46A 2OIDA 4LL0A 2C68A 2SRCA 3WZUA 1SNUA 5HTIA 5B2KA 5CF6A 2B0QA 3FZPA 3F5GA 5DPVA 4O7WA 4HYUA 3CP9A 3GC8A 3LQ3A 2XB7A 4PTCA 3IDPA 4YJUA 5T3QA 3QA8A 2QI8A 4LRKA 4RG0A 4AXEA 1ZLTA 4TRLA 4J1RA 3EZVA 2J5FA 1OUYA 2QR7A 2VX1A 2IO6A 2WTKC 3F2AA 3R04A 4YNEA 3TZ7A 4DDIA 4DITA 3IS5A 4ANLA 3V5PA 2Y6OA 1YWNA 3BV2A 3GQLA 2WOUA 3CPBA 3EQFA 1RJBA 1KE6A 3RGFA 3HMPA 5AADA 4I6LA 3S3IA 2OSCA 3AKKA 2RG6A 1ZXEA 1KV1A 3LM5A 3LCSA 5E8SA 3PLAE 1FPUA 3H3CA 3V04A 5HO6A 4BBMA 3LFNA 4YZDA 4BL1A 5E90A 3OCSA 4LV7A 4AXFA 4QMLA 4IX4A 4O7NA 4CZUA 3O8TA 3MESA 4XBUA 3LFCA 3JY9A 2Y9QA 4ALWA 4ZMEA 1DI8A 2J0JA 2B9HA 3FHIA 4XV3A 1IA9A 5EYMA 4Y95A 2QO7A 5FM2A 2BR1A 4C0TA 2JKOA 3B2TA 4ZJJA 5H8BA 4AW2A 2PMLX 4BHZA 3TJDA 2XRWA 5A4QA 5CF8A 2ITUA 3A62A 4BR3A 3VF8A 5A6OA 4MK0A 3ZC6A 1GIIA 3GT8A 3O5AA 4YPDA 5DGZA 3UOLA 1RDQE 2QNJA 4NFMA 3HA6A 4AN2A 4C35A 3CTJA 1JSTA 4WD5A 3V01A 3ULIA 3QKMA 1U4DA 3FY2A 5LMKA 4BGHA 4AFEA 2BZKB 2X9EA 5EFQA 3RZBA 2BRHA 3EJ1A 2RSVA 3Q32A 4FG9A 4IACA 4RWJA 2QKRA 2Y4IB 4FV6A 4O4EA 2OXXA 3K3JA 4FT9A 2QCSA 3IDBA 4ZS4A 1PMUA 5KE0A 5IA1A 2E2BA 5AV2A 2VTTA 4JRVA 3UDTA 1W8CA 2QHMA 5G6VA 4M13A 4XP3A 4CFWA 2PK9A 4QNAA 4OTRA 4DN5A 4RX8A 2BZHB 1DAYA 4XS2A 1KOBA 2UW6A 3ZSHA 1GZKA 2IN6A 3HKOA 4N70A 4YHFA 5BVEA 4BCKA 4FTTA 4OAUC 1M2PA 3HGKA 3BEAA 3V5TA 3THBA 3PJ2A 4J71A 3AD4A 4R3PA 4BCHA 3N4UA 2CN8A 3PSBA 2UW9A 2R0UA 3CR0A 3ACJA 1FOTA 4F78A 1SZMA 3AQVA 3BE2A 4GYIA 4FKLA 4IM2A 3CGFA 5F1ZA 2RKUA 3AXWA 5K0KA 4BYJA 3HL7A 1A06A 3Q9WA 2WQOA 3VBXA 4C4GA 2RF9A 5AJQA 4MD7E 4PDSA 3BWFA 4QMNA 2F49A 3TV7A 1Q8UA 3QD2B 4FTKA 4IZ7A 4MX9A 3W0SA 2Y4IC 3IOPA 1MRVA 4I0SA 5TKDA 5BVFA 3OFMA 1OL7A 2R3RA 4V04A 1TFFA 4PY1A 4CKRA 5CWZA 2OKRA 2V7AA 3DAEA 3BV3A 3MJ2A 4F4PA 3NUXA 5KMOA 1PYXA 5C8KA 3FAAA 4G3EA 4O0RA 3SLSA 5AIKA 2VTMA 4ENYA 3G33A 2O0UA 2ZV7A 4FZ7A 4E4MA 3S00A 2W17A 4FSWA 4KRCA 4AACA 4Q5EA 4BCIA 4BIEA 5A54A 5D11A 2VU3A 3HYHA 3LKMA 3WIGA 3PP1A 4ENXA 1ZYDA 4KBKA 3OY1A 4QP9A 3ZO3A 4O4FA 3BU5A 1OKZA 3BYSA 4F65A 4ZTLA 3EQHA 2PVYA 4S30A 4MUQA 2VO6A 4JX3A 3BHVA 4E5BA 3PE2A 4ASXA 4FIFA 4FJVA 4Y73A 4BB4A 2BRBA 3VW6A 4E20A 4C33A 3VS2A 2WEIA 4D4SA 3QCXA 4CV8A 3P08A 2PMOX 1YXUA 3QU0A 3P5JC 4C57A 4L45A 1OPKA 3AC4A 5GHVA 2JDOA 3C4EA 2X1NA 3TNIA 4YC8A 5TE0A 4EWQA 3TJCA 2I0VA 5IUIA 2C3LA 2PZ5A 4FF8A 2DWBA 3BGPA 3KXZA 3A2CA 4G6NA 4G9CA 3W10A 5AP3A 3D7TB 2H9VA 3V8SA 3IW6A 3L8PA 3D7TA 4MHAA 5LCKA 4AOJA 3VUMA 2GU8A 3BYVA 3VQHA 2R3OA 3F9NA 1R0EA 2UW7A 5E8XA 2UZEA 4YZBA 5ETAA 3GGFA 1H0WA 2J0MB 2PVNA 5DEYA 4BHNA 3I1AA 3AT4A 4IAKA 4B9DA 4H3PA 5IQFA 1E1XA 3HV7A 4IXPA 4EKLA 1PHKA 3OWKA 5FD2A 4EORA 2PMNX 5HX6A 2OLCA 4FEWA 2REIA 4ALUA 3VRZA 3ZYAA 2H6DA 3QQKA 4Z7GA 5AP0A 1QPCA 3OXIA 3CQWA 2W4KA 3MIAA 2FYSA 2R5TA 2P0CA 3EYGA 4TY1A 4ZTSA 4O38A 5L2IA 5LMKC 3F7ZA 2YWPA 4GK2A 2VGPA 2XK6A 3AC5A 3QWJA 4F7LA 4O96A 3FEGA 4F08A 2AC3A 5C27A 1JNKA 4D2PA 4UXLA 4YO4A 4ANQA 4YLKA 3QTIA 3UYSA 4CKJA 2R3HA 3OUNB 1MUOA 3C4CA 3NYXA 4OGRA 5EYDA 5KKRC 3MB6A 4YTFA 1Q8WA 2VTLA 3GCQA 4IAZA 5GJFA 4BGGA 4U8ZA 5KMKA 3IECA 4IHPA 3BHYA 3ZUTA 2HELA 1YHWA 4L01A 3E8CA 3F6XA 4M97A 4PQNA 2OJFE 3TEIA 1NT2A 2P55A 1XQZA 4H3BA 4DFBA 2JLDA 4OW8A 1DS5A 2IEWA 3EFLA 3NR9A 4AXCA 4YLLA 3TM0A 4U5JA 2H8HA 3NAXA 3FKOA 5CYIA 4I41A 3R83A 3ZDUA 4E6DA 4ASEA 4D4RA 3RM7A 1H1RA 2JDSA 5A4LA 1OBDA 1YXXA 4YJTA 2YN8A 3K54A 3V5JA 3ANRA 4I0RA 1APME 1GY3A 2QODA 3G9NA 2C6EA 1WCCA 1MQBA 2X0GA 4LL5A 4D0XA 4R78A 1CDKA 3CXWA 4GUEA 4E8AA 4OT5A 4LQMA 1JPAA 2VTNA 5B2LA 5L3AA 3OVVA 3QC4A 1FINA 3MY0A 3PY1A 3PA5A 3DT1A 4I21A 3TUDA 1IAJA 2O65A 2OGVA 1E9HA 1PXLA 2XVDA 1XMMA 3EQRA 3GC9A 5HIDA 2VWWA 2XARA 5CT0A 5TO8A 4FKJA 4BY9E 3DBCA 3BHHA 4GL9A 1UV5A 3ELJA 1PXIA 3F7WA 3SQQA 1OL2A 4RVLA 3WF6A 2JAVA 4UXQA 4MEDA 4ZTHA 4FV3A 3U6JA 5I5ZA 1Y8GA 3E3PA 1PKDA 2IVUA 2UW8A 4AXAA 4D1XA 3QQJA 3DPKA 3C50A 3C9WA 4DEBA 3M11A 3BELA 4N6YA 4C4IA 2CSNA 3KRJA 3DK7A 5CSHA 5F4NA 3ZFMA 3FPMA 1V1KA 3F5UA 2KULA 2WMBA 4HJOA 4D9TA 3TZMA 1AGWA 3DGKA 4S32A 4G3GA 5BYLA 3ZC5A 4CCBA 5J9LA 4EH6A 3FLZA 3HZTA 3UOKA 5HG9A 3PFQA 4CMTA 4EOPA 2EU9A 1SVHA 2YLFA 3AMBA 2PVFA 4KABA 1R0PA 2IJMA 4FTAA 3RKBA 5K5NA 1SMHA 3S0OA 5HNBA 3PPZA 5HBJA 3OBJA 1TQMA 2PUNA 1VR2A 5DT0A 5EK7A 1ZYJA 2QO2A 3R7UA 4I24A 3TKHA 2OH0E 3QTWA 5CZIA 4AZTA 4DE4A 5HO8A 3FI4A 4FA2A 5DRDA 4KKGA 2B54A 4WNMA 4YJNA 3V5LA 5M4UA 3BBTB 5IQAA 3P1AA 4IJ9A 3QCQA 2X0OA 3QKKA 3R0TA 2W0JA 4X2NA 4BDFA 2X8DA 3FQHA 3MB7A 4UMQA 5I4NA 2QOFA 2JITA 5CU3A 1W0XC 1Q3WA 4L9IA 2ETKA 2EB3A 4MD8E 3WIKA 5J5SA 3LFAA 4HGSA 1MRYA 3D5VA 3RMFA 3R8VA 4V01A 4ZEGA 4FTUA 4ORKA 1H25A 2Y4PA 3SXRA 3Q6UA 5J5TA 1PW2A 3JYAA 2BFYA 3SXSA 4UYAA 3W0OA 5FXSA 3V8WA 4E3CA 2VWBA 2ITYA 1KSWA 1IR3A 2I40A 3NIEA 3Q2MA 2OICA 4BWKA 3RCDA 2KTYA 3EYHA 4BZOA 3E7VA 4S33A 3RTPA 5IZFA 5J1WA 4XH6A 4FKTA 4G5PA 4BFMA 1DAWA 2WD1A 3ITZA 3PVGA 2XIYA 5EW9A 4GK4A 3LFEA 4YSMA 2QOKA 3GP0A 2QOQA 4QTBA 2QONA 4E5WA 3QXPA 4K2RA 3LE6A 3PYYA 4RWLA 3NYOA 4O82A 1PY5A 4HYSA 5DEWA 5L2QA 2JKQA 3ZXTA 3VS6A 3CKWA 5I9YA 1BI8A 4AZWA 1YDSE 4ZSLA 4D0WA 4O84A 2UVXA 2XIZA 4IVCA 2V7OA 2W5BA 3H9FA 4KS8A 4M15A 4NM0A 2WTCA 3AOXA 4GMYA 3Q9XA 4MBLA 4ANSA 4JG6A 1Q3DA 3PXZA 3A7JA 5K5XA 4O4BB 3F3UA 3ORKA 4I6QA 4BWPA 4JBVA 2R3FA 3C51A 4I4EA 4CG9A 1LR4A 4ZSGA 4PPAA 3BCEA 4FNXA 3LFBA 5J9ZA 2W05A 3MY1A 4JNWA 4PDPA 1OGYA 4D4VA 1Z5MA 4EH5A 4G1WA 2G1TA 3HUBA 4DC2A 3O51A 3A7HA 4G6OA 5IEVA 1FVVA 2EVAA 2WQBA 3WE4A 1UNGA 5DHJA 1VZOA 4E93A 4MF0A 2JIVA 1FMKA 1QPDA 3GNIB 4RJ6A 5C8NA 2W4OA 2ZMDA 4AT5A 3DJ7A 5HEZA 3R7OA 4DGOA 4Y72A 3DBEA 2PE0A 2F9GA 4YHTA 4FOBA 5HCZA 4C3FA 3NUYA 4I6HA 3QQUA 3EQCA 1YHSA 5CEQA 3CLYA 2OJIA 4WRSA 5JGAA 2ITPA 3DBQA 2H96A 1Y91A 3ZS5A 4BDEA 3TTJA 4FSZA 3C5UA 4I23A 3Q6WA 2QOHA 4O0WA 5ANIA 3NNVA 2WMUA 3DB8A 2QURA 4DGLC 4HNFA 2C5OA 4JIAA 4ZAUA 3FQSA 3MFUA 2PHKA 2VTJA 4ZP5A 5E91A 1TVOA 5TT7A 5AUZA 2VWUA 3A7FA 1PXPA 4TYEA 3FV8A 2HYYA 3COKA 3EWHA 4M3QA 3P7AA 4EWHA 1OECA 3LQ5A 1XH6A 2IVTA 4BVUA 2XNEA 5IDPA 2FSMX 3ZFYA 2OZOA 4P7EA 3OTVA 2GHMA 4ZIMA 5HD7A 3RHKA 4TT7A 4LUDA 2YM5A 4E6QA 4ZTMA 1AD5A 4DT8A 1CMKE 2CHLA 3BPRA 4EOSA 4K11A 4LMNA 3MI9A 4AG8A 4KSPA 4C59A 5J7BA 1Q24A 5BMSA 3L9LA 1XH8A 3HV5A 1KE9A 4NH1A 4IWQA 3L8XA 4L3JA 5CAUA 4M8TA 2V5QA 3LFDA 4FGRA 1I09A 2BILB 3AGLA 2YACA 3ZM9A 2X6EA 3I81A 3LCDA 5IUGA 5AP5A 3KRRA 3LZBA 3QYZA 2C1AA 3Q5ZA 4L46A 3R7YA 4RVKA 3CC6A 4FSNA 1G3NA 4Y85A 1P4FA 4YC3A 2VV9A 2WMXA 3VBWA 3CKXA 5AMNA 3DLSA 3U51A 3MA3A 4IAYA 4LGHA 4YZ9A 4QMYA 4DGNA 4GJ3A 3W0RA 1OKYA 3QRIA 1O6YA 3Q5IA 4KAOA 5GIOE 2NRYA 3FKLA 1P5EA 4Z7HA 2FH9A 3R9HA 3O17A 4FL3A 4EJNA 3HMMA 3ZH8A 4DCAA 5KZIA 2X0QA 1OPJA 1OPLA 4F9CA 3MV5A 1JSUA 3K5VA 3MH2A 2BTRA 2R2PA 4U3ZA 3E8DA 2WMWA 5TOZA 2C3KA 4ITJA 3DB6A 4BCNA 4BN1A 5BNJA 2BFXA 2YM3A 5CLPA 4EH7A 3DKFA 3SVVA 3SW4A 3PXKA 1ERKA 3Q4TA 2WTIA 1UNLA 2UZNA 3PXQA 4NM7A 4ACHA 3ML1A 3RWPA 1V0OA 4OBOA 3NNWA 3P5KA 4QP3A 2CMWA 3OF0A 4APCA 4DG3E 3UNJA 2Y6MA 3FC2A 3CY2A 3MYGA 5HG5A 5IQBA 4EH8A 3D0EA 3W2QA 2J6MA 2JFMA 2ZB1A 3GENA 4IVAA 3QZGA 4B4LA 4PP7A 1FQ1B 3PA4A 5CEMA 3E92A 1U54B 4F9WA 5AR7A 4PWNA 2Z2WA 2G2IA 4K18A 3HAMA 4F70A 2EXEA 4WNKA 3DAKA 4RBLA 3WF8A 2ZJWA 5DR2A 4MXOA 4GVAA 3QZFA 3E63A 4QPMA 2BAJA 4O0VA 4J95A 1H07A 1OITA 4I93A 4DAWA 2CDZA 2XKCA 3PZHA 2PE1A 2UUEA 4O7SA 5D9HA 2A27A 5JZNA 3LAUA 5DIAA 3RNYA 2GFSA 3QXOA 2V0DA 1SM2A 2PSQA 3QTXA 4GKHA 4RFYA 3BKBA 4IB0A 4NKSA 3R02A 3GCVA 5JFSA 2YFXA 4FTLA 3WE8A 4BBFA 2Z7QA 4EOOA 3F2RA 1YKRA 4MH7A 5FQDC 4GJ2A 3F61A 5EHYA 4C37A 3UDSA 5D10A 5IQEA 5GIPE 2YA9A 3CTHA 4G3CA 4RJ7A 1K9AA 2XBJA 2PUUA 5CVGA 4USFA 2C6LA 4EK4A 4DH3A 3AC8A 5EDRA 2A4LA 4KIQA 4QTEA 3DFCB 2QVSE 2YCFA 4AZVA 4C2WA 4WSYA 3IGGA 4IBMA 4IZAA 2OF2A 2YAKA 1R39A 2C5YA 2XZSA 3LXNA 5KHWA 4ZSJA 3DV3A 2ACXA 4RA4A 3T9TA 1CSNA 3PY0A 3AKJA 2W9FB 3R21A 4Y83A 4OBPA 4O1PA 4EOLA 2GTMA 2O2UA 2ITNA 4B6LA 2NRUA 4DLJA 1R3CA 4AGUA 4X2JA 3RAIA 4O7TA 2WNTA 3ZBFA 1U59A 2PTKA 1OB3A 3EFKA 3PP0A 3QTSA 4IW0A 4JR7A 4D1SA 3GU8A 3ORZA 1W84A 3G0FA 4YUQA 4FKSA 4D28A 4PMPA 2JEDA 3NSZA 1IRKA 1OGUA 1OL5A 2ZOQA 4QNYA 4FZDB 3RWQA 4K1BA 4FTMA 4KKHA 2X2LA 3QALE 2ONLA 3UMXA 1ZYCA 2XJ0A 3BU6A 4B8LA 2XKEA 3VS1A 4JBOA 3EL8A 3VUTA 5KMIA 4I5MA 3OP5A 3C4FA 3PRIA 5HBEA 5J9YA 1JAMA 2BZIB 3K5UA 4DEIA 3FLQA 3ZHPC 3ZEPA 3CPCA 1GZNA 3UZTA 3QHWA 4DINA 2R3PA 3BHTA 3BZ3A 3PG3A 4R3RA 5CQUA 1RQQA 3ZO4A 3UTOA 2CJMA 3SDJA 3MS9A 3LCTA 4OT6A 5J87A 4M68A 5E8UA 3VJOA 3NIZA 4HOKA 5AAEA 4KRDA 3HLLA 3MGYA 4AAAA 5LQFA 2CKQA 2CKOA 4IDTA 3H10A 3KN6A 4FT7A 4O6EA 2XNGA 3PXYA 4JQ7A 4RVTA 4NIFB 4WKQA 4XV1A 5HBHA 4NIFA 5HVYA 4H05A 4F7NA 2QO9A 3U9NA 3VUDA 4EOMA 4C58A 5KUPA 3QX2A 3L1SA 2ITVA 2WTKB 3W8QA 3MPTA 5DG5A 3F82A 3MH1A 3BQCA 5FBNC 1PRYA 1I44A 1VJYA 1GIJA 2UW5A 1WZYA 5LVMA 3NRMA 3LJ2A 3FZSA 4ZTRA 4DHZA 4I94A 4BZDA 4F0FA 2FVDA 1EH4A 5H8EA 2PZYA 3FZRA 4FV7A 3NGAA 1H26A 4IFGA 3KL8A 5FUTA 5IG1A 3ET7A 5IISA 3SG9A 3U4WA 3OEFX 4FC0A 4K9YA 2VO0A 2IPXA 2UW4A 1HCKA 5C9CA 1W98A 3PDTA 2R3IA 3OT3A 5JK3A 4RT7A 5T68A 4G2FA 3OXZA 3D5WA 3HMIA 3OUKA 3RBWA 4WNOA 1YI6A 4E1ZA 5KCVA 2HY81 4K0YA 1L3RE 5JQ5A 2IVVA 4C61A 4PP9A 5FTGA 2PVRA 4DEHA 2E9PA 3OBGA 5GINE 2GNHA 3RPOA 1XMLA 3OOGA 4EYMA 3UOJA 3QD3A 4RIYB 4O2ZA 4RIYA 2VWYA 3UDZA 3UNZA 4JJRA 4JMQA 3ZLWA 2YM8A 2FB8A 4DH5A 1Y57A 5EDPA 5K0XA 4F6UA 4GT3A 3KB7A 5K4JA 2IZRA 3U4UA 2ERZE 2OK1A 3PJ8A 4UALA 3KRLA 3F5XA 2EXMA 3RAHA 5HICA 5CU4A 3R30A 1SNXA 2XNPA 2QU5A 5DN3A 3U9CA 3KREA 3DXQA 5AA9A 1M14A 2XS0A 4RIXA 2VZ6A 4FYNA 4RIOA 3GVUA 1PMNA 3R8UA 4L68A 2CNVA 5BUIA 4A7CA 5C03A 3F3ZA 4FV1A 3OZ6A 2XMYA 4YGAA 4IM3A 4QQCA 3IKAA 1YWRA 5L8KA 2BKKA 3MPMA 4XP2A 1WBVA 4A4LA 4AGDA 3RVGA 2RGPA 4BDKA 4BCMA 5E9EA 1J1CA 4NJ3A 1W82A 2E9OA 2PZRA 5BPYA 4A9SA 5E8VA 4G3DA 4QT1A 5JZJA 2PUPA 5KZ0A 4FSQA 3LM0A 3M2WA 4FX3A 4DFLA 4YURA 4Y5HA 2BRGA 5J1VA 4EZ3A 3DY7A 1XR1A 4IZ5A 4YTCA 5FTOA 4BTKA 4UYNA 4PX6A 4A06A 2R4BA 3HRFA 1UWJA 3PVWA 3VNTA 4BDAA 3TMOA 4CFMA 3IDCA 2Z7LA 3PE1A 4AU8A 4FV0A 3HP5A 2YJSA 2OWBA 4QMPA 4DF3A 2XK8A 4KBCA 3HAVA 2OW3A 2W06A 2G15A 1JSVA 3PSCA 3FL4A 3O50A 4FTNA 2Z7RA 4MXZA 4QQJA 4ALVA 3ENHA 4AQKA 3PZEA 4CD0A 3KMWA 4FI1A 4IB5A 3QRTA 4G5JA 4HGEA 1H28A 3DJ6A 4NEUA 5CALA 3TNHA 1JKKA 2QU6A 4IAFA 3ORNA 4J53A 4LOQA 5CZHA 5CEIA 4L7FA 3FLYA 3SGCA 5HZNA 4RMZA 2CGWA 5BVWA 4ASDA 1IAHA 3KC3A 4RC3A 1YHVA 3ETAA 4BCPA 3KVXA 4MQ1A 2ZV8A 2PVHA 2RFNA 4IE9A 5HU9A 5AP1A 5ACBC 4YTIA 5IA2A 4CV9A 3QX4A 4DTAA 3NMUF 5DT3A 2O64A 1UNHA 4HGTA 3OW3A 4O21A 2BTSA 3HVCA 5DNRA 4BRXA 2JAMA 2OZAB 2OZAA 3RJCA 2XUUA 5HIBA 4Q5HA 5K4IA 3KK8A 3RCJA 3H30A 4EL9A 3QKLA 3VS0A 2JFLA 1G5SA 2C0TA 4GEOA 4MXCA 5AR4A 4UMRA 4W4VA 1HOWA 1R1WA 3MIYA 4LV5A 4LOOA 4EK5A 5ANKA 4L7SA 4ARKA 3VO3A 4ANNA 4F1MA 2W1FA 1Z9XA 3Q4ZA 4RRVA 2XH5A 4A4OA 4FSYA 1V0BA 2XK4A 4JVGA 3BIZA 4BIDA 2Z7SA 3N9XA 4YPSA 2X2MA 4W9XA 2VX0A 3P78A 1NA7A 2HK5A 3PG1A 3OMVA 4JX7A 3VBQA 5LARA 4D2RA 3LMIA 3U6IA 4Y46A 4CRSA 2XK9A 4M67A 4FT5A 2JDVA 2PY3A 5DYJA 5IH4A 3TKUA 4CFUA 4A9UA 4FYOA 5HTBA 2C1BA 1IEPA 3ZMMA 3C1XA 4RJ5A 4G17A 4I6FA 1KE8A 3EIDA 4MWIA 3DLZA 4EHZA 5D7VA 1Q99A 1YOJA 2JKKA 2YJRA 3KU2A 4GVJA 4F7JA 4I5PA 4JR3A 5B2MA 5EQEA 2PYWA 3QTRA 5FTQA 5GJDA 1WVWA 3G6GA 5EKNA 4H1MA 4YMJA 3BLRA 1ZZ2A 4QMVA 5KBQA 1CKPA 3POOA 4XRJA 3D15A 1Q41A 5JH6A 3FXXA 4I5CA 4MNFA 1STCE 3H0ZA 5GNKA 5JRSA 3BHUA 5KMNA 2OJJA 5CEKA 4FKPA 2YLEA 2XP2A 5DFPA 5GZ9A 3UYTA 4C7TA 2XF0A 4D2SA 2OJGA 5BUJA 5KKRB 4O7ZA 4AFJA 2XANA 4AT3A 2CNQA 2CN5A 4FL1A 2YDJA 3R7IA 5KO1A 1J7LA 4RWIA 1ND4A 3W0QA 4UWCA 3S2PA 4W8EA 4EEVA 2J90A 4C8BA 1WFCA 4EZ5A 4I3ZA 1Q8YA 4JXFA 1F5QA 4JT3A 1XO2B 4P90A 1REKA 4YNOA 2UW3A 3BL9A 2ITOA 4CVAA 4NM3A 3FMNA 3KQ7A 5L6PA 2UZTA 2WO6A 1OIUA 4QMZA 3V5WA 2CLQA 2JDTA 2X7OA 3QL8A 5HE0A 5M4FA 4L3PA 2RFDA 4XG8A 1M7NA 5E8ZA 5AUVA 4H39A 4AXDA 1ZRZA 5H8GA 3ANQA 2HXLA 2G9XA 5HLWA 2EWAA 4FG8A 3TZ8A 4TWPA 3FWQA 4RIWB 2OXDA 2VO3A 4RIWA 5CS6A 5AEPA 4BDGA 3JY0A 2VWIA 1Q8ZA 4UZDA 4MQ2A 4OLIA 4W9WA 1KOAA 4QP2A 1PMVA 4G3FA 2IZUA 3FSFA 4X0MA 1F0QA 3KXGA 4BZNA 4YBJA 4DFXE 2XIKA 4LRMA 1YOLA 4XBRA 5KBRA 3UQGA 2PWLA 3BLQA 2GTNA 4U97A 4DA5A 3NPCA 1GIHA 2WMTA 3NW7A 4CFVA 2I6LA 1MP8A 1BI7A 3UDBA 5FBOA 4XRLA 3SC1A 3TACA 3WBLA 3TG1A 1FGIA 3CD3A 2PMIA 3JPVA 4BC6A 4C3RA 4DCEA 1UA2A 3GC7A 4BI1A 3CJGA 5H2UA 4BYIA 4U9AA 3FBVA 2C5VA 3KF4A 3KRXA 3MFSA 5BMMA 3W32A 3R2BA 4DFNA 2YEXA 3GU4A 3ENMA 5EYKA 3LLAA 5E8YA 4C4JA 2HW7A 3O7LD 4AZFA 2Y8OA 3DJ5A 1YVJA 2IW6A 1JKTA 1PKGA 4GUBA 2B7AA 4FSTA 5TR6A 2XIRA 3C4XA 1UWHA 5EHLA 2WEVA 3EFWA 4W4YA 4WSQA 3UQCA 5E1SA 4Z55A 2X39A 4JBPA 2YCQA 3I60A 3QRUA 4O4CA 3E5AA 3FMJA 4TXCA 4FV5A 4IANA 5J95A 1H08A 4J96A 4FT3A 4IFCA 3NDMA 3ZUUA 4E4NA 1CKJA 4WT6A 2A98A 5BVOA 2AEGA 2HCKA 2GHLA 3COHA 5F9EA 2UVZA 4ASZA 4L3LA 3P7BA 4K33A 3OWJA 4R5SA 4D2TA 2FUMA 2IG7A 4L8MA 4EQMA 1WBNA 2C3IB 2QG7A 4TZRA 5IEYA 1SVGA 3RK7A 4HVIA 2PULA 3D7ZA 4PTGA 1M2QA 1Q5KA 4XYFA 1HCLA 3VBTA 5D7AA 4ZLZA 2PU8A 4EK6A 4KSQA 4R7HA 2P2HA 5CEOA 2XJ1A 3BLHA 2FGIA 4GIHA 4KIKB 4TYIA 4R1VA 4MXYA 5EG3A 4KIKA 3PRFA 3LJ1A 2AUHA 4LOPA 4E4LA 1J3HA 4PMTA 2GNGA 1R78A 4EK3A 2HWPA 4BDDA 5DMZA 1M52A 2UW0A 4QMWA 4QMTA 3COIA 2AYPA 3SXFA 5L6OA 2C69A 4E7WA 3H0YA 3UPZA 2C6KA 3VQUA 5F94A 2CGVA 4ZTQA 5CSWA 4DEGA 1VLRA 3ZSIA 3BGZA 5HNGA 4JS8A 3FPQA 4L44A 1NVRA 3Q4UA 4RSSA 4IJPA 3EB0A 3KK9A 4WG4A 3LOKA 4BDJA 3AKLA 4CT1A 4P2KA 2WU7A 2J0IA 2J7TA 4IM0A 4M84A 4FTCA 3TT0A 3F2N