4YJUA

The kinase domain of human spleen tyrosine (syk) in complex with gtc000249
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
262
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
total genus 91
structure length 262
sequence length 267
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjuA01
3QD4A 4FIFA 5CU3A 4A9RA 3UVPA 1J1CA 2UVXA 2QKRA 5JGBA 5AM7A 3Q53A 3FZTA 3KRJA 2CN8A 2NP8A 3IECA 4L42A 4WHZA 3I0QA 3I0OA 4C02A 3BPRA 4YO4A 2WIPA 3ANQA 3BHUA 3ZLXA 4BWXA 1ZOHA 1PKDA 3PSBA 4I93A 4W4VA 2A0CX 5I9UA 4YPSA 4BY9E 2YDIA 4TTHB 3QD0A 1XH9A 2YEXA 3G5DA 3C4FA 5HG7A 4CZTA 3IW6A 3KF4A 3R63A 4I0TA 5CU4A 3UIXA 3WZJA 3G9NA 4JQEA 4BDHA 4PDPA 4EEVA 4H1MA 2PVYA 3DNDA 4PMPA 2WPAA 1O9UA 5GJGA 1HOWA 3QRKA 2JDRA 4XUFA 1YHSA 3PRIA 2QOIA 4BCQA 3MPTA 4EOQA 2YN8A 5J9LA 3RK9A 4IVAA 4OT6A 3AGLA 3HV7A 3E7VA 3V5WA 4Z7HA 1PXMA 3TJCA 4RJ6A 4F0IA 3COMA 3UTOA 2SRCA 4X2KA 4EORA 4ZLOA 4C3PA 4QPSA 4QYYA 4NW5A 5HIEA 2WD1A 3GFWA 5FP6A 4RIWB 3OEZA 1Y8GA 2LAVA 2WTKC 1GZKA 2UW5A 2OZAB 3EN7A 3MIYA 1MRVA 3FXWA 3BV3A 3OY3A 3PXKA 4M67A 4C8BA 2YM5A 5FD2A 3BELA 3ULIA 4L01A 3QA8A 3R73A 5JT2A 4YZCA 4O7VA 5HBJA 5GNKA 4MNFA 4TNDA 3GU4A 4PDYA 4DFBA 3F6XA 5CZHA 2J2IB 2VO0A 5K3YA 4AX8A 4RX9A 4RX5A 4KSQA 2XNBA 3OHTA 3AXWA 1V0PA 2R3JA 5BVKA 4IANA 5ANJA 2BRBA 3KK9A 5L6WL 3FPQA 2RFNA 2PE2A 4D1XA 3LM5A 3PWDA 3W32A 3NUUA 5CF4A 3IG7A 3MTFA 3ATTA 4O0WA 3FHRA 2OXXA 3PSDA 3ORXA 4W8EA 3CGFA 3TZMA 4XV9A 2WQEA 3PYYA 1M2PA 3WZDA 4FL2A 2F7EE 3NIZA 3SXFA 5M56A 2QO2A 3DOGA 4L7FA 2XIYA 4M0ZA 3BZ3A 4FIJA 4BBMA 3KC3A 3LHJA 4RIYB 2YLFA 5FTOA 4D2WA 5CU0A 4FUYA 4XS2A 1XBCA 2NPQA 5HG9A 3I79A 5L6OA 3V51A 5AP6A 4JR3A 5IQFA 3ALNA 4XG2A 3FZSA 1J3HA 4IMYA 5HNGA 1YWVA 2ZM4A 3ZUVA 3DGKA 4C4EA 3POOA 4AAAA 1XBAA 2ZV8A 4BKZA 4O0TA 2C0TA 2YM4A 4X6RA 4RLKA 5AWMA 4E4LA 4F0FA 3F3WA 4H36A 4QP4A 4IAZA 2G1TA 3PJ2A 5DR9A 4ZSJA 2YAKA 1PMNA 2I0VA 1YQJA 2ONLA 2PSQA 1H1RA 3QCYA 4FTOA 4EWHA 4N57A 2I7QA 3IS5A 4E1ZA 1OPKA 3DU8A 4E73A 4BCIA 4FV5A 3OOGA 2UZVA 3ODYX 2BZIB 4QMOA 2YJSA 4YBJA 4PTGA 3SDJA 3SXRA 3VBVA 4DEHA 5KMMA 2PVNA 1KE8A 5LMAA 4NJ3A 5LXMA 2YIYA 5HBHA 4CKIA 1EH4A 2OBJA 2RFEA 4JAIA 5KHWA 4NCTC 5LVMA 4O7ZA 2OXYA 4D58A 4FVPA 1XH4A 3GOPA 4RBLA 3LXNA 4XHKB 3PPJA 5J1VA 2X9FA 5CY3A 3PA4A 2ZV7A 3FZRA 3EKNA 3QKMA 2W9FB 4Y5QA 5ETIA 3OG7A 3D15A 4FG9A 5L2IA 3F3UA 2E9OA 2XIXA 5AFVA 4NJDA 3NMUF 4MXZA 2FSMX 2HYYA 1LP4A 1U54A 5A3XA 4EYJA 1U4DA 3EN4A 3LCOA 3RCDA 4OW8A 3ZYAA 3FY2A 4ENXA 2XYNA 4GRBA 4U42A 3GCQA 1JSVA 1KWPA 5DPVA 3LMHA 2BFXA 2IZUA 3UDBA 3KXHA 5HU3A 5IA4A 2C5OA 5E9EA 2X6EA 3KFAA 2BIKB 4LL5A 4NCTA 1YI6A 4J52A 4D55A 4CLIA 2W5BA 3KCKA 4WG4A 3GOKA 4BCGA 2PZ5A 2WTVA 5L6PA 2G2FA 1M17A 3UC4A 5IF1A 3NNWA 3R7UA 4CFVA 3AC5A 5AR7A 2XBJA 4RRVA 3QRTA 1IG1A 1RE8A 2GDOA 3R04A 4NW6A 2RKUA 4IX5A 4ZTLA 4C62A 1QPJA 3DCVA 3EQGA 3OFMA 1LPUA 3SA0A 3JS2A 3BI6A 5TKDA 3SKCA 4IVDA 4HGLA 3ZDUA 2XBAA 3EOCA 2X9EA 1TQMA 2VTSA 1P5EA 1U54B 3CPCA 4YJVA 5EW8A 5BUJA 4FE2A 4F99A 1PYXA 3QHRA 4RWLA 5CSHA 5FXSA 2PL0A 5CU2A 1MQBA 2I40A 2RGPA 4CFNA 2YM3A 5D41A 5AA9A 1M52A 2HK5A 2C6MA 5CTPA 4RMZA 4HVHA 4FKSA 5GZ8A 4GIHA 3OVVA 2EUFB 4W8DA 2OJIA 4EK3A 5IH6A 4GFOA 5IMXA 2R3QA 3NPCA 1OB3A 4KRDA 4XV3A 3FL5A 4CTBA 4MKCA 2Y7JA 2R2PA 3NS9A 2XP2A 1TVOA 4M8TA 3W2PA 3A4OX 4JBPA 2P0CA 3FY0A 3KA0A 3P4KA 4M84A 4O2PA 4WA9A 2W1GA 5DR2A 4AOJA 2FGIA 5K0KA 3HRCA 4QOXA 2R3LA 2BZJA 4HNFA 3I60A 3ZFMA 3ZO1A 4MXXA 3PJ3A 2H6DA 4EK5A 2CHLA 4LMNA 3ORIA 3TEIA 2VO3A 2YLEA 3O17A 3PXYA 3TV7A 2ZMCA 2CCHA 4LMUA 3M42A 2CLQA 2EVAA 3ZSGA 1J91A 3A2CA 4O7NA 4L00A 2VTPA 3QZGA 4N70A 3HAMA 4EOLA 3CXWA 3QTUA 5AP7A 3VW8A 4KBKA 3HUCA 3RPOA 4GSBA 4X0MA 4BCOA 1I44A 3VBXA 2BIYA 1NA7A 3OROA 4N6ZA 3TWJA 4A4LA 4BBFA 3A8XA 4H05A 4GT3A 2Z7QA 2G15A 3KRLA 1UWJA 2XK7A 3H9FA 4IM2A 3FPMA 2PVRA 4WT6A 5CXZA 1ND4A 4HPUE 4EOJA 2GNGA 3VS0A 3FMEA 3MFTA 4XV1A 3U54A 1OPJA 1GY3A 1IR3A 4IB0A 3VNTA 5HD4A 4O7YA 4G3FA 2Z8CA 1Q8UA 2HZNA 4WNPA 3SV0A 2XF0A 5AR2A 3PY1A 2VWBA 3G15A 2PUIA 5GJFA 3DFCB 1XHAA 5FDXA 3ORTA 3PDTA 3HLLA 2X7FA 3EYGA 4MWIA 3VHEA 3A60A 3G0FA 3H10A 4KAOA 5IQHA 4HYIA 3Q3BA 5E91A 3QWKA 3UIBA 4FTMA 4TYJA 2IO6A 2QD9A 4GT5A 2W4OA 5HE3A 3DV3A 3R9DA 4GFGA 5J5SA 2JGZA 2QCSA 3AMBA 3PRFA 4AZSA 4AGWA 3LFFA 3Q5ZA 4FK3A 3BHTA 4K11A 4EK8A 4IWDA 2I0HA 1SNXA 3UGCA 4CMOA 1NW1A 3HGKA 3PTGA 5DG5A 2YM8A 1ZOGA 2B52A 1XR1A 3MA3A 1Y91A 3TNPC 3CSVA 3HUBA 4P90A 3UG1A 2GHMA 5M57A 1PW2A 3VBTA 4FSUA 2J51A 2QKWB 3NAXA 4R7BA 1OITA 3FZ1A 3MTLA 4FNXA 3LCSA 3C4CA 3ZMMA 3ET7A 2PY3A 2VTQA 2WMBA 4RIWA 4ZOGA 3QQGA 4U3ZA 3VF8A 3KGAA 3R8PA 4XLIA 4X6QC 5HTIA 4XYFA 2VWZA 2BRGA 1WCCA 3CCNA 4PL3A 2P2HA 3K3IA 1JSUA 1BMKA 2OGVA 2VAGA 1SYKA 5E1SA 5GIOE 3UMXA 1QPCA 2J0KA 2PZYA 3KCFA 3QX2A 2FUMA 1WBOA 3NYXA 5J8IA 1QMZA 2VD5A 5CVFA 4JDJA 4QTCA 4O7TA 2JIVA 2ITPA 3PVGA 4AGUA 1R1WA 3OC1A 4QYFA 1Q8YA 2GMXA 4PY1A 3BU6A 4RJ3A 2UZBA 3LQ5A 3O2MA 5ETFA 5C26A 3OT8A 4DTBA 3F88A 4AN9A 3ORNA 3LFCA 4GU6A 2XM8A 4FZFB 3MW1A 4IDTA 4ITHA 4BWKA 4IWQA 5CZIA 2R3OA 3NIEA 2VWVA 3W55A 3QUDA 2PWLA 4FSQA 4WUAA 4UMUA 4S34A 2ESMA 4U79A 4JRVA 3CQUA 5CT7A 1SVEA 4OTPA 3VWAA 5GINE 2QO7A 3ZBXA 4RPVA 5E8WA 2YZLA 2KULA 2J0MB 4JL9A 3TJDA 2W5HA 2OU7A 5ETAA 4RFYA 2KTYA 4OBQA 5IUGA 4EK6A 4H3BA 2C47A 3K2LA 5A46A 4NFMA 4C7TA 2B53A 4Y5HA 5J5TA 3NYVA 1OBGA 3A99A 2WZJA 3U6HA 2WFYA 3DJ7A 3OBGA 3FI3A 4O81A 3JVRA 1ERKA 1HCKA 3BU5A 4O0XA 1H28A 3DPKA 1Y57A 2XK8A 5G6VA 3V5JA 4I20A 4PPBA 4XOZA 2HAKA 4ZS4A 3UP7A 1YOLA 3KXXA 5B2MA 2C3LA 3QCQA 1Q61A 2DWBA 4TYEA 1KE7A 4RVTA 2VX1A 5BMMA 3SC1A 4F9YA 5M07A 3TNIA 3FV8A 2ZOQA 3HMMA 3OWLA 3O51A 1ZY5A 2UZTA 3Q4CA 3MFRA 1REKA 2BPMA 2NRUA 3OOMA 4FKRA 5LJJA 3C9WA 4JNWA 5IPJA 4ITIA 4PMSA 3DBFA 3ULZA 4FI1A 3C50A 3DJ6A 3F5GA 2QODA 1OUYA 3W2CA 2W4KA 3UNZA 1CKIA 2B55A 2DUVA 2ONLC 2UW6A 3OW3A 4L3JA 4LL0A 5L2SA 5AUVA 2VTAA 3Q96A 2G9XA 3E8CA 4QQ5A 3BCEA 3O8UA 5HCYA 4R3RA 3MV5A 3E63A 2AC5A 3LCTA 3FLYA 1PMVA 4X2FA 4LGDA 4TYHA 5EKOA 1P2AA 2IW9A 3PG1A 4I92A 4LG4A 3TKHA 4AFJA 5HE2A 5FDPA 3H4JA 4AA0A 4YP8A 5H9BA 2OI4X 4MBLA 3E8NA 1UNLA 2YCFA 3F2RA 4U81A 4I24A 4OGRA 3SRVA 3Q9WA 4L3LA 4YTCA 2BTSA 2WMAA 5C01A 4L43A 4G6LA 4BCPA 4F70A 5KBRA 4X3FC 3OF0A 4RIOA 2UW3A 3MA6A 3AD4A 4WBBB 2C69A 4BTFA 4LRKA 2WTDA 5TR6A 1XH6A 4G2FA 3QX4A 4I3ZA 3BHHA 5M09A 2WEVA 5KKRB 3QKLA 4D2SA 1IA9A 1MUOA 2WMQA 4XX9A 4FTCA 1FQ1B 4IDVA 4D28A 1SM2A 4FV1A 1U5RA 4BYJA 4CZUA 3BGZA 3VRZA 4GEOA 4RZVA 2F57A 5CNNA 4H1JA 4LUDA 4RC4A 4E93A 3MI9A 5HTBA 3QZHA 2C1AA 2VN9A 3UVRA 2CGVA 4BTKA 2R0IA 2EXMA 5DEYA 2GTNA 4FSZA 5DEWA 1U59A 3RI1A 4AT4A 3DK6A 3W2RA 4YTHA 2HW7A 5E8SA 4IJPA 5LVLA 4D9TA 1BYGA 5DRDA 4JDHA 1PYEA 5AM6A 5TOZA 3RHKA 5JQ5A 3SAYA 3EQDA 3JVSA 4CCBA 3FI2A 4BC6A 3C1XA 3RZFA 2NRYA 3PXZA 3LIJA 3WF5A 1YOJA 2Y4PA 4IM0A 4QMSA 4FYOA 3QLGA 1BL6A 4AA4A 5HO6A 3QTXA 3T8OA 5I9YA 3CJFA 1ZMWA 2WELA 4BR3A 4NK9A 5CAVA 4S31A 5DIAA 4TWCA 4ZTQA 5CLPA 4UV0A 2W96B 1FBNA 4AE9A 2QVSE 2C1BA 5GZAA 4BIEA 1JQHA 2AC3A 2HIWA 4DTKA 5JQ8A 4R77A 2R3PA 1YHVA 4FYNA 4JIKA 2ITNA 4UBAA 3QQFA 3N9XA 1G8AA 4FK6A 3DY7A 5KX8A 3DJ5A 5DH3A 2BDWA 4ONAA 2VTLA 4MK0A 4IAFA 2ITYA 4L44A 3MB6A 3QYWA 4RX8A 3WYYA 3LXPA 3PP1A 4YU2A 3PP0A 2QOFA 4DAWA 3MVHA 3F61A 3R2YA 2XK9A 4DG0E 5AMNA 5EYCA 3BGQA 3WF7A 3PXRA 4FV4A 5HNIX 4O7SA 4AACA 3FQSA 3R9HA 3EIDA 3CD8A 1CSNA 4JX7A 5M44A 4B4LA 1QL6A 4CKJA 5HORA 1JOWB 4TNBA 4BL1A 5HVKA 5EFQA 4CGAA 1PHKA 1W84A 4UX9A 4BBEA 3QF9A 2QLUA 3MVJA 4FTIA 4Z3VA 4EJNA 2B0QA 3MIAA 5GIPE 3FL4A 4IE9A 4KIPA 4DINA 4YBKA 4YNOA 5T68A 2JLDA 4U9AA 3QRJA 5HEZA 3KREA 3GQLA 1ZZLA 5AAEA 2C5NA 5K9IA 3VUKA 3UIUA 1IEPA 3PVBA 5CENA 4UB7A 4QMVA 4FNZA 2GQSA 5A4TA 1CTPE 2UVZA 4IX6A 4QMLA 2R3NA 4O0UA 4TZRA 4DYMA 4OT5A 3UZTA 4ALUA 5JFWA 1OM1A 1A48A 4AUAA 1NY3A 2J5EA 4CEGA 5CSXA 3A61A 3NUNA 4Y46A 3IO7A 3BKBA 2HENA 2XRUA 4YSMA 5A14A 3LFSA 5FEQA 3NVMB 5BVWA 3FE3A 4O38A 1Y6AA 5AA8A 4D5HA 4IX4A 5JEBA 3F5XA 4FKGA 5C8KA 2WU6A 4B0GA 4RJ7A 5DRBA 4FVQA 4TXCA 3QTIA 4C4GA 2WQNA 5AP2A 3QGYA 5IA5A 3A7IA 3FQHA 5ETCA 5IZFA 4A06A 5D9HA 2B9JA 4YHFA 1FVTA 4X3FB 3PVWA 5HG8A 3GB2A 3ENMA 3KXNA 4HCUA 5E1EA 4DLIA 4D4YA 1H8FA 4XMOA 4FV9A 4M69B 2C6TA 4K6ZA 4GVJA 3PY0A 5HLPA 3DFAA 1LEWA 4R3CA 3FWQA 4EQUA 3BQRA 3UVQA 5EW3A 5AIRA 4FG7A 2O65A 4RA4A 2F49A 3BWJA 1UU3A 4JI9A 4AWIA 4F6UA 3HMOA 3LLTA 4PTEA 4AOTA 3IPHA 4C59A 3VQUA 3W10A 3H9OA 3HMIA 4YJOA 4O82A 5EOBA 3QTRA 5AR3A 3O8TA 5IDNA 4KUJA 2BZHB 1H0WA 3JXWA 2OFUA 2QG5A 3HV6A 3HYHA 3G6HA 4TT7A 4ACMA 2GQGA 4AS0A 3HKOA 4HGEA 3DTWA 5FTQA 2C6IA 4J98A 3RP9A 3WF9A 2JKKA 2WHBA 3BBTB 3PIZA 3L8XA 4CMUA 3R8ZA 3W2QA 4YLLA 3BHVA 3NW6A 1UKIA 4I22A 2YIRA 3C0IA 4IIRA 4D2TA 3ROCA 5HU9A 3GBZA 4JT3A 1GJOA 1VYZA 3BLRA 4L46A 4XOYA 3F2AA 3HA8A 2EXCX 5D7VA 3TZ8A 2J9MA 5AP1A 5LCKA 5FM3A 4QP9A 1FMOE 2PK9A 3EFKA 4OLIA 2WB8A 2XK3A 4YJRA 5E8ZA 4YURA 1BUHA 1YXVA 2E9NA 4BWPA 4EBWA 4BGHA 3IOPA 3MJ2A 5FM2A 4IZ5A 3R1SA 4JQ7A 3CBLA 3PJ1A 1OKWA 3RALA 3GGFA 3NEWA 4F4PA 4BICA 5DWRA 3ORZA 4AGDA 2IVUA 3HEGA 5JGAA 3FMLA 4H39A 3WIGA 5KMKA 2DYLA 3LLAA 4ANBA 3QC9A 3P7BA 3CTQA 5F1ZA 4FTQA 5CT0A 2HZIA 5IEVA 4U97A 4FSNA 5KE0A 2HXLA 4MVFA 1UU9A 4D4SA 5F9EA 2GPHA 2GU8A 4PP9A 4N4SA 4ZZNA 2VWYA 4FKQA 3RK5A 5LVNA 4Y72A 4DTAA 3R7EA 3QWJA 3ZM4A 5AV0A 3UPXA 4O91A 3JY9A 3QLFA 5KBQA 1KV1A 1GOLA 5LOHA 4MEDA 3FMMA 2I0EA 4DEEA 5DHJA 1E1VA 2GS6A 3RAIA 4MQ1A 1ZY4A 2QONA 2W9ZB 4JDKA 3PFQA 3Q9ZA 3LVPA 4EBVA 5C4KA 4C38A 4EOKA 4YLKA 2GCDA 3GVUA 1SVHA 5FUTA 4FL1A 5CSVA 3MWUA 3CKXA 5BUEA 5EHYA 1H00A 4B99A 1KSWA 2OICA 4KA3A 2I0YA 4GYGA 4V0GB 3Q4TA 4FUXA 4ZS0A 5KZ0A 5I4NA 2VWXA 3ZLWA 5LWMA 3P5KA 4J53A 4WSQA 2ZDUA 3LFQA 5EYDA 4XBUA 5LMKC 5DT3A 4GFMA 2X4ZA 4QT1A 4E5AX 2P2IA 2OO8X 4JBOA 3NZ0A 3VRYA 3QQHA 4MCVA 2WMUA 3BU3A 3VS1A 3WYXA 4DH5A 1IAHA 3U6JA 3R9RA 1DAWA 2QOCA 1IRKA 3LCKA 4ASDA 2V7AA 4PPCA 4EOPA 2UZDA 3B8RA 2C68A 1TKIA 4U3YA 4ANLA 4AT5A 4DGGA 5L2QA 3OXZA 4GV1A 4FV6A 5IUIA 4RZWA 1BI8A 2W05A 5IEXA 4EC8A 2XVDA 2RFDA 4FZ7A 4F0GA 2B1PA 5ACBC 5H8EA 4YGAA 3KK8A 4ASXA 5CEMA 3LAUA 3G9LX 1O6LA 2VV9A 4RJ5A 4UYAA 4NUSA 4AE6A 5FXRA 4EOSA 1JAMA 3ANRA 5B7VA 3EWHA 3TUDA 5CF8A 4IAKA 4FT3A 2F4JA 2UZWE 4KIQA 4L9IA 5L4QA 2X39A 3O0GA 4FR4A 5LARA 3HP5A 3BYOA 3L9LA 4R7HA 2J0LA 4RGJA 3UYTA 5HZNA 4YC3A 4F7LA 5DGZA 2ITTA 1JPAA 5AAGA 4J95A 2O5KA 2Y9QA 2WQOA 4HOKA 5CF5A 3NGAA 3DQXA 3EZVA 4RFZA 2XNEA 3D83A 4WSYA 4YSJA 4UMRA 4JBVA 3MGYA 1RDQE 5L8JA 4FMQA 4NM7A 3ZFYA 1UU7A 3I7CA 2C5VA 3RPVA 4QMNA 3ZH8A 1H1PA 3DB6A 3FQEA 4G9RA 1WVXA 4W4XA 5EKNA 5C9CA 4CV9A 4W9XA 4JJRA 4BCNA 3DKFA 3EQRA 1DS5A 4JS8A 4FEXA 5IQGA 4I6BA 2JDVA 5CSWA 1YXTA 2EWAA 2X2KA 3O96A 4RWKA 3OMVA 4FNWA 4MD7E 4ZSLA 4Q9ZA 4KKHA 3OWPA 3LXKA 2CPKE 4QMWA 1OIQA 3L9NA 4O1OA 5AR5A 3F5UA 3L8VA 1Q4LA 4U6RA 2IW8A 5FEDA 5EOLA 4I5CA 2J90A 2BHEA 4CNHA 2WU7A 3ID6C 2Z7LA 4LYNA 4XP2A 2RFSA 2W0JA 2QG7A 3QHWA 4EUUA 4HZSA 3VQHA 4TWOA 4BFMA 2JBOA 4LOPA 4EZ3A 2C6OA 4K2RA 5D7AA 1UNHA 4RSSA 1URCA 2UW9A 3NUAA 4FZDB 3PPZA 2W1EA 4EQCA 3U9NA 5FWKK 5IG1A 5L3AA 4EUTA 3F82A 1E1XA 5EYKA 3G2FA 3QQLA 2F2CB 3IDPA 5CQWA 3FAAA 5DVRA 3RM6A 4P5QA 3QTSA 2HOGA 4UY9A 3QTQA 4A7CA 1H1WA 5IU2A 5KO1A 4BHNA 2AYPA 4EOMA 4MD8E 4YJNA 4TYIA 4XG6A 3T3VA 4CTCA 2GQRA 1REJA 3COIA 3FC2A 3QCXA 3ORKA 1OL6A 2XJ2A 4GKHA 5DR6A 4FSRA 3RCJA 5CAOA 4BTMA 2VTHA 4JOAA 3KF7A 4I23A 3DBQA 5EDPA 4TWNA 3UO5A 4OAVB 5JKGA 4HYHA 2EB2A 5HKMA 2OZOA 3KN5A 5KMNA 3HA6A 4O6LA 4P7EA 3ACJA 3ODZX 4J97A 4BDEA 1VR2A 3EH9A 5M53A 4GG5A 1ZYJA 5GJDA 2W1DA 5A54A 2WTIA 3R28A 5EDQA 4IXPA 2ITOA 2QQ7A 4YHTA 4EZ7A 4ZTRA 1F5QA 3P7AA 4FEWA 3LKMA 3FYKX 2CKQA 5H3QA 3E8EA 1OKZA 4C4JA 3Q4UA 3A7HA 5HGIA 1JVPP 2VWUA 4IACA 4ZXTA 4EHEA 2XIKA 4G17A 4EH6A 4R6VA 4AFEA 5CS6A 4HPTE 3CC6A 3F3ZA 4FSWA 1OL1A 2FSLX 4TYGA 5M55A 4C36A 3TM0A 5KUPA 1PXLA 4TRLA 4PP7A 4DC2A 4DITA 3DXNA 4QMPA 5BQ0A 4USFA 1SNUA 4PDSA 5AUTA 1AD5A 2BROA 3GC0A 1ZOEA 2UZOA 1YDRE 3LQ8A 2VO7A 5EK7A 3NNXA 4UMTA 4ZY6A 3FKOA 4BKYA 3H3CA 2F7XE 4FTUA 2X2MA 3UC3A 1RW8A 3ZEPA 2YDKA 4G6NA 3BYVA 1SVGA 4KNBA 3CY2A 2RSVA 3TCPA 1OVEA 4C34A 1WMKA 5J7BA 1T46A 4QP1A 3E87A 4AF3A 4E6AA 2ITUA 4GJ3A 1XWSA 4JX3A 1CM8A 4FKUA 5EHOA 4PUZA 3EQBA 3OT3A 5HE0A 5T3QA 3ZONA 2R3IA 4IWOA 1BKXA 4LI5A 3FI4A 4X2GA 5AAFA 4KWPA 3RTPA 4AN3A 4DH1A 3CJGA 2W1CA 4DT8A 3N51A 4FSTA 1H27A 3VBQA 3P0MA 4O1PA 4QP8A 2WTWA 1JSTA 4QQCA 5JRQA 1XO2B 2FA2A 4FV8A 4BYIA 4MX9A 1Z57A 4QD6A 3G6GA 4QP7A 4RVLA 1OL7A 4E4MA 3GCSA 2VRXA 3ZCLA 3UO6A 4FEVA 4AU8A 3ZC5A 4IJ9A 3PXQA 1O6YA 1V0BA 3ZO4A 3UZRA 3F5PA 5EM7A 4CFUA 4TPTA 3PA3A 2F7ZE 3AGMA 3FZOA 4F1MA 3WIKA 3L8SA 2FVDA 2BRHA 3LXLA 1PXNA 5H8BA 4D0XA 2C4GA 4MTAA 5IUHA 5IMEA 1KE9A 3OS3A 1M7NA 2XM9A 3HDNA 4QMYA 4JG8A 3W2SA 4K77A 4F08A 3QYZA 5HO8A 3UNJA 2BKZA 3V6RA 4GUEA 2FB8A 3GFEA 5AP4A 3LCDA 2Y6OA 2ZB1A 4IZYA 3VS2A 2ZM3A 3TNQB 3MN3A 3R83A 3PJ8A 4EK4A 3IK3A 1Z9XA 3R0TA 4X7QA 4IWPA 1CKPA 4O2ZA 4MXAA 4WRSA 5K5XA 4R7IA 2X7OA 3BWFA 4RVMA 4W4WA 4QNYA 4PWNA 5EI6A 3AC4A 4USDA 4P2KA 4L68A 4P4CA 3CE3A 3RJCA 3AMAA 2VZ6A 4LM5A 4QYEA 5E8XA 1FOTA 5JGDA 3N4UA 2XKFA 3MSSA 4NSTA 4YZ9A 2B7AA 4J96A 1A9UA 4MQ2A 3O7LB 4U7ZA 4QTBA 3SQQA 3QXPA 2QURA 5EQPA 4Q5HA 5FTGA 1OIYA 4PMTA 3D2IA 3HNGA 3BYMA 2QOLA 5ANKA 4ANQA 4YJTA 4EH5A 1IAJA 1G8SA 2QOOA 4RQVA 2R7BA 2X8IA 5HESA 4EOIA 5AP3A 4NIFB 3TN8A 1ZMUA 4NIFA 4DG3E 3PLAE 4N6YA 4O0RA 3PE2A 5FG8A 4APCA 2JAVA 3I7BA 1YHWA 5BYLA 3OCTA 4IZAA 5DT0A 3EMGA 3MB7A 3EB0A 4NFNA 2W1HA 2CCIA 3V5LA 3QQJA 1Q97A 2PZPA 4MF1A 4LV5A 3TKUA 4CG8A 2QC6A 5M51A 3I5ZA 2WIHA 4IAYA 4MXYA 4HVSA 2BHHA 4E4NA 3FKLA 2XNNA 4C4HA 4RA5A 4FT7A 1OGUA 2EXEA 2BFYA 2RL5A 2WOUA 1B6CB 3R02A 2PVFA 3LJ1A 2VNYA 5I5ZA 2A27A 2PVKA 3KEXA 1JBPE 4IC7A 5CAQA 1UA2A 4RWJA 5A4QA 5CSPA 3COKA 3MYGA 5KHXA 3QL8A 4WG3A 3F2NA 2O0UA 3FI8A 4DT9A 2X6DA 3HDMA 3R9NA 3OUNB 4L53A 3LPBA 1JKSA 5M4FA 1WZYA 2J6MA 3B2TA 3IW7A 4QYGA 2YJRA 2PE0A 4G31A 5BNJA 3MPMA 1M7QA 3LFNA 4OBPA 2PVHA 3HMPA 3SG8A 3VS6A 4UWBA 3DXQA 1W0XC 2XIZA 2YHVA 4R5YA 2ZM1A 4B6LA 3RMFA 2IZRA 4DEGA 3NW7A 3Q32A 4IW0A 3MH2A 4PV0A 1Q24A 3W16A 1WFCA 4UYNA 2JITA 4FKPA 4M14A 3D7ZA 4S32A 4H3QA 4E6QA 1FGKA 4ZK5A 3UOKA 4AXAA 4CLJA 3QU0A 4JR7A 2OKRA 2HZ4A 3CY3A 3PY3A 2GNFA 3VUMA 3C51A 1H1SA 1KE6A 5BVEA 4U43A 2WXVA 5HBEA 4BDIA 2XS0A 1OIUA 1Y6BA 4EHGA 1MQ4A 2JDOA 2WO6A 2O64A 4MHAA 1UU8A 4XG3A 3CIKA 5DFPA 3NYOA 4QMZA 3NW5A 3AC1A 4RX7A 1STCE 3E8DA 5A6NA 1ZLTA 3FSFA 3O71A 4CVAA 4IB3A 4J8MA 4QP2A 2OWBA 5HTCA 4YPDA 4L45A 1UNGA 2X81A 4FEUA 4IEBA 3RPRA 1LEZA 2VU3A 2C5XA 5IH5A 4DH8A 3NSZA 2P55A 1H08A 4EZ5A 4K9YA 1W8CA 2XK6A 3DQWA 3Q6UA 4QTEA 3GNIB 2CLXA 4MD9E 5TE0A 4ZSAA 2Y4IC 4I5HA 4QQJA 4FIIA 3HRBA 4U44A 4BZDA 1A06A 3BLQA 5FLFA 2CNVA 1TQIA 4ACGA 4DGMA 4FOCA 1JKKA 4FICA 3ZLYA 3ORPA 4FGBA 4C33A 3C4XA 4CFWA 3RAHA 2VGPA 3MY5A 2UUEA 3F7ZA 3P1AA 5I9ZA 1NXKA 1FMKA 3CQWA 4YJUA 4QMTA 5M4CA 4BDKA 5CASA 4XG4A 4RVKA 4FX3A 4BIBA 5HICA 2IWIA 5KMIA 4DFXE 2FO0A 5K5NA 3OCSA 4ALVA 2R64A 3QQUA 4ZLZA 2BVAA 3ZLSA 2VX0A 5L8KA 4BDJA 5HCXA 3BYSA 3PA5A 4QNAA 3W8LA 1J7LA 3M2WA 2I1MA 4RG0A 4BZNA 2VWWA 3D7TA 3Q2MA 4OBOA 4LV8A 3HRFA 3HL7A 3EL8A 1W82A 5ANGA 2BDFA 1M2QA 4BI1A 1H25A 3QD2B 4GW8A 4RFMA 3WZKA 2ITXA 3OY1A 4PX6A 4DGLC 4DFUA 4CYJA 4YC8A 4BDGA 1WAKA 4F1OA 3P9JA 2NO3A 5EHLA 3C0GA 3ZFXA 1Q8TA 4CV8A 1FGIA 1CKJA 3BE2A 5AUYA 2X7GA 5AUXA 4NM5A 4S30A 3PZHA 2P4IA 3FSKA 1PMEA 2YDJA 3QAME 2OSCA 2WTKB 3I6UA 2YERA 1GZNA 2OH0E 2UZEA 3LFEA 3O50A 4OTGA 3EQHA 4RJ4A 5CYIA 5AP0A 4BI0A 3A62A 3HZTA 2IZTA 3OW4A 4APPA 4DF3A 4C37A 3TUBA 2Z2WA 2BCJA 3II5A 2WOTA 1P14A 3TNHA 4OAUC 1FPUA 3GP0A 4IM3A 3DAJA 3LFDA 3RKBA 4J7BA 4NH1A 5ANOA 4FIHA 3DDQA 4AZEA 1ZWSA 5HIDA 4YZBA 4J1RA 4KIKB 4E5BA 3CQEA 4UXLA 4BDAA 1G3NA 4ZZOA 2J0JA 3TDVA 4JAJA 5IQBA 4NWMA 4A9TA 3DKGA 4DH3A 4MXOA 4O7WA 5I3OA 5JFXA 1Y8YA 3UP2A 4R78A 4L7SA 4A4XA 4LOQA 3TI1A 4E7WA 3GENA 3TXOA 4K18A 3DNEA 5GHVA 3B2WA 5D12A 4GG7A 2G2IA 2X8EA 2CSNA 4KS7A 3V04A 2O2UA 1URWA 2OFVA 2Z60A 2QI8A 4GL9A 1YDTE 3TNWA 3PLSA 3OP5A 2ITQA 2YAAA 2ZV2A 2XYUA 3TACA 2YIWA 1QPEA 1YOMA 2OF4A 4HNIA 1XJDA 4D2PA 2XA4A 3OEFX 3IW8A 2GTMA 1X8BA 1H0VA 4FT5A 4TY1A 2A2AA 3ALOA 4M3QA 4YJPA 2H8HA 2PYWA 3LQ3A 3HV4A 4E4XA 4O96A 4AW0A 3DA6A 3LOKA 4II5A 3R01A 2XKEA 4F7JA 4HCTA 2YM6A 4PMMA 3V3VA 4EC9A 1XQZA 2OH4A 5AR4A 4F9AA 2Q0NA 4EJ7A 3A7FA 4XEYA 3FMJA 4W9WA 3QRUA 2ETKA 4G3CA 4NYEA 5DYJA 2W1IA 1U46A 3D9VA 5ACKA 1P4FA 1W98A 2HWPA 2C0IA 4B8MA 3CR0A 1XH5A 2OIBA 1F3MC 4I0SA 4ZTMA 5M4UA 1OKVA 2W06A 2PVLA 1O6KA 3EKKA 3COHA 3WARA 3ROYA 4EH4A 3UOHA 3ERKA 2Z02A 3BYUA 5EW9A 3U6IA 2JAMA 2ZYBA 2WTCA 2Z7RA 4ANMA 2P3GX 5AR8A 4TYHB 1WVYA 2OG8A 4Q2AA 3DT1A 3IDBA 5I9XA 4ZP5A 3RWPA 3AG9A 3RVGA 3DS6A 3E92A 1Q8WA 3KVWA 2JEDA 4PNIA 5BUIA 3CPBA 2EB3A 4IHPA 4KB8A 4DEDA 3VJOA 4U5JA 2PVJA 4JDIA 4ZTNA 3REPA 3VAPA 4CSVA 4WKQA 1OMWA 1VJYA 1OECA 3RK7A 2WNTA 5EQEA 4EOOA 3R00A 4F9WA 3D4QA 3T9IA 2ACXA 3GXLA 4QPAA 4AW2A 4C2VA 4I4FA 1FVRA 3LJ0A 3UBDA 4QP3A 3F7WA 3W8QA 4KIKA 4TW9A 2HY0A 3U87A 3LM0A 4X2NA 5KCVA 5IQIA 4IAAA 3GC8A 3U51A 2BRMA 3TTIA 2YCQA 1VYWA 3R2BA 3CTJA 4KKEA 3UQGA 3L9MA 3TV6A 1OPLA 1E9HA 3ZRLA 4BTJA 4E8AA 2C6DA 4IQ6A 2C6LA 4UZDA 1LR4A 3PIYA 3T3UA 3HECA 2CGXA 3EQIA 5LVOA 4M97A 4BF2A 1AQ1A 1AGWA 5JMSA 2VGOA 4EKKA 2B4SB 4FTKA 4W4YA 5HLNA 4QMUA 3NCGA 4IX3A 3RNIA 2FH9A 4Y8DA 5IA3A 3M1SA 3R30A 4EHZA 4DEBA 4D4RA 3SG9A 3GU8A 4XNEA 3HMNA 3UOLA 5CVHA 5IEYA 5BVFA 2WMTA 5IA2A 2GFCA 4FZAB 3VN9A 4FA2A 5J7HA 2IPXA 2PVMA 4EH9A 4Z16A 5EM8A 4F7NA 3D7TB 1G5SA 4HVDA 2PUPA 5EM5A 2OLCA 4WNMA 3KN6A 4U8ZA 2V55A 3KXZA 3UJGA 2OIDA 4Y73A 3GU7A 3HVCA 3S1HA 3OXTA 3BRBA 4MH7A 5LMBA 3GC7A 5AV1A 3DAEA 3W2OA 5CEPA 3KY2A 1JLUE 4D1SA 5EYMA 1DM2A 3C4EA 2J0IA 3OBJA 5E8TA 3AC2A 3FLQA 4ACDA 1JNKA 3AQVA 4DFLA 5C27A 4I6FA 5LQFA 4GIIA 4J99A 3DBCA 4M13A 2AUHA 4ZY5A 2ETRA 1KOBA 2CGUA 2B9HA 5DI1A 4WNOA 2IVTA 3BBWA 3DBDA 3ZXZA 4HVGA 3EQFA 3L8PA 5HG5A 2QLQA 4BCJA 3NUSA 3I4BA 3ZU7A 4C4IA 3FHIA 4HYSA 4R3PA 4R8QA 4EWQA 4ID7A 5JFVA 3MDYA 5A9UA 2PULA 5CQUA 4FTRA 4RIXB 5AUZA 3C7QA 4FTAA 4BKJA 3GCPA 2C3IB 5DOSA 3W1FA 1H4LA 5JZNA 3DTCA 3WZUA 4JQ8A 3QGWA 3RNYA 4E20A 3DK3A 5AV3A 2BR1A 3ACKA 3F69A 4C57A 4K0YA 3FJQE 4CRLA 5J95A 1H24A 2ZV9A 1UVRA 4BGQA 3NDMA 4EHVA 2Y8OA 5A4EA 1V0OA 4E6DA 4BN1A 3TUCA 4XV2A 3FBVA 3PJCA 4AN2A 2YISA 2VTRA 3V5TA 5JSMA 5HHWA 5CAUA 3EFJA 3NWWA 3OD6X 4JVGA 4ANSA 3UYSA 2CKEA 3NLBA 4JRNA 2PUNA 4HYUA 3AD6A 1SMHA 3M11A 4J8NA 3TZ9A 3ZUUA 2OK1A 1K3AA 5AX3A 3TZ7A 5JK3A 3GC9A 5A4LA 3R1QA 4XBRA 3R8MA 5B2LA 3Q4ZA 4DBNA 3QUPA 4PDOA 3EQCA 2P33A 4O7RA 2UW4A 2YCRA 4E5WA 3IGGA 3OTVA 5L2TA 3CKWA 3KRXA 4ZSGA 4ZLYA 3LJ2A 3D14A 4DCAA 4RT7A 4AT3A 1WBNA 2QR8A 2XB7A 4AW5A 2OJGA 2WAJA 4GH2A 4C58A 5ANIA 4F09A 2VNWA 2XNGA 2PMNX 4I41A 4MYGA 4QO9A 2YM7A 1VEBA 3NX8A 3NUPA 1K2PA 3O8PA 3I5NA 4OTDA 1B39A 2O3PA 1ZYLA 3VULA 2NNWB 3S2PA 1PF8A 2B9FA 2Q0BA 2F9GA 4MWHA 4XRLA 2ETMA 3UG2A 3UOJA 4DEIA 5J79A 2CKPA 4JIAA 2R3GA 3ZOSA 4WRGA 3Q5IA 2W1FA 1GIJA 3KKVA 4YO6A 2C6KA 1OBDA 4HVIA 3A8WA 3QKKA 3UODA 2H9VA 4KBCA 3IOKA 2A4LA 2B9IA 3NRMA 2E9VA 2W1ZA 3A7JA 4FSYA 3O7LD 4AP7A 5FP5A 2WTJA 3H9RA 2WMRA 4YC6A 5EG3A 2BAKA 4ACHA 1GZ8A 1JKLA 3H30A 1YXUA 4KSPA 2YABA 3GI3A 3PSCA 4OTIA 4TKSA 4M12A 1R39A 3VS4A 3WF6A 5DE2A 4A9YA 3EZRA 5C8MA 4FKWA 3QTWA 4F6SA 3FYJX 3SOCA 5CF6A 5LMKA 3CP9A 2YWPA 3E7OA 3AT3A 2W99B 4FIGA 2XNOA 2JKMA 2H34A 2RG6A 4C0TA 3QUEA 2VTNA 5K4JA 2QNJA 4H58A 4OTHA 4DCEA 4K33A 3AT2A 1PKGA 2C3KA 4RJ8A 4O0VA 2LGCA 2ZMDA 5K0XA 4ACCA 2VWIA 4O7LA 4Q5EA 4QYHA 5CNOA 4OTQA 4TL0A 3U4UA 3DLSA 2VTTA 3N4TA 4FTLA 3ZM9A 3UE4A 4FTJA 4BB4A 3EN6A 4ITJA 4KINA 4NEUA 3WF8A 1YDSE 5HCZA 4IBMA 1H1QA 2F2UA 1ZYCA 3E93A 5JFSA 4GKIA 3CTHA 4PPAA 5HIBA 3L1SA 4FGRA 3MBLA 3OCGA 3HAVA 2J50A 5CWZA 3TDWA 1I09A 5FEEA 5HLWA 5CEQA 2CJMA 3NR9A 4RC2A 4DA5A 1WBPA 4BCKA 5IQEA 4NM0A 1B38A 3SLSA 3W18A 4XP0A 5D10A 3RINA 5BVNA 1APME 3UZPA 4BDCA 3DB8A 2CNQA 3UNKA 4UALA 3UQCA 3ZEWA 5JN2A 1J7UA 5K4IA 5IA0A 4YZMA 5EM6A 4CFXA 1L8TA 4DN5A 3TT0A 1WBVA 5HX8A 4KRCA 3P78A 4R5SA 4DHFA 3Q2JA 2A19B 3PIXA 4EONA 4LGGA 3UPZA 5AUUA 3ZTXA 2Y6MA 4YZNA 2HZ0A 2PTKA 5CX9A 1QPDA 4C35A 3JY0A 3OUKA 4LGHA 4UXQA 2VO6A 4FL3A 4EKLA 2GNHA 3OTUA 3I1AA 4OR5A 4XP3A 3SD0A 3UO4A 5AADA 3EN9A 3MY0A 5LCJA 5G1XA 4JLCA 2BZKB 4ARKA 2QU5A 4I0RA 4YLJA 1Q41A 2GFSA 5BYZA 4D5KA 4QTDA 1QCFA 5KKRC 4M0YA 3P23A 4CZYB 2UW8A 2JC6A 2XUUA 3GQIA 3WOWA 2J5FA 1PXKA 4U0IA 3DKOA 4UEUA 3U55A 3NUYA 4WOVA 5ANDA 3TL8A 5B0XA 4M15A 2W7XA 3LE6A 4GU9A 4B7TA 3TG1A 3LMGA 2W5AA 4EI4A 2GSFA 1WBSA 2HCKA 4ALWA 3UQFA 3VW6A 2PE1A 3IKAA 3E62A 3P86A 1ZMVA 4QMXA 3TIZA 4GVAA 4XH6A 4I5MA 5JZJA 5H8GA 1NVQA 4RWIA 1VZOA 2X1NA 4FBXA 4RIYA 5CXHA 4F64A 3R8UA 3HV3A 3FEGA 3VF9A 3MJ1A 4MXCA 3R8VA 2QO9A 5IQCA 2PMIA 2C30A 4ZMFA 2QOQA 5CALA 3GEQA 4RC3A 3E88A 5DMZA 1MP8A 4B9DA 4ZZMA 4CQGA 3BE9A 4H3PA 4HGSA 4N0SA 4EH3A 1T45A 2C5YA 4NZWB 3PWYA 4XG8A 4E26A 3BX5A 3FZPA 2V62A 3K5UA 1BX6A 2UVYA 4D2VA 4JXFA 3V8WA 2IG7A 2JDTA 3QBNA 5KMLA 4OUCA 4HZRA 5E92A 1JWHA 1NVRA 4UMQA 5BYYA 5TT7A 2RF9A 3RWQA 3WE4A 4G5JA 4BIDA 5KMOA 3QD3A 3MESA 3PZEA 3Q9XA 3SXSA 2WMXA 3FLNC 4CMTA 3V01A 4OTWA 5AJQA 1R78A 5AUWA 4I21A 3KRWA 3MH0A 4UN0C 2GNLA 3L9PA 3ZRKA 3CLYA 3ORMA 1GNGA 3LZBA 3TV4A 2PMLX 2W4JA 2HY81 2G01A 2FSOX 3LFBA 2ZAZA 3FMHA 3KULA 3V6SA 5JH6A 3QFVA 3PG3A 4ANNA 4O84A 3BGPA 1DI9A 4QMQA 5I9VA 4CT2A 1KV2A 5D11A 4I1ZA 5L8LA 3BEGA 3GCVA 3NAYA 4A4OA 3QXOA 3NNVA 5DN3A 4BI2A 2R0UA 1YW2A 3R7OA 4XRJA 5CEKA 2PMOX 3S00A 1PXIA 3ZO2A 4QTAA 4USEA 3GU5A 2CDZA 2RIOA 5C4LA 1YI3A 4RQKA 3Q9YA 1Q3WA 1PRYA 4Z7GA 3KULB 3R7IA 3TTJA 2XJ1A 3F3VA 1YI4A 3D5XA 3RPYA 3PVUA 5E90A 1NVSA 4EH8A 3HV5A 4LRMA 2FYSA 3VS5A 5HQ0A 3SW7A 3D5UA 3IONA 3C0HA 3KRRA 3R22A 3DXPA 2XJ0A 4ZJIA 4YMJA 2ZJWA 2OJJA 4TN6A 2VX3A 4GJ2A 2C0OA 1Q99A 3F9NA 4ASZA 4EYMA 3DBEA 1ATPE 2VTJA 4LQMA 4ERKA 4E6CA 1R0PA 4XG7A 4QPMA 2PUUA 4MF0A 4BCHA 4PRJA 1Q8ZA 3C13A 4DFZE 2V7OA 3RAWA 3ZBFA 1MRUA 2V22A 4G3DA 1ZXEA 4CT1A 5CAPA 4NKSA 5BMSA 2X4FA 5ITAA 5F95A 3OWJA 2VUWA 2GS7A 1M2RA 2UW0A 3FMNA 4GMYA 5IQDA 4BDBA 5BVOA 2IJMA 4FIEA 5DBXA 5EI2A 5CANA 3S0OA 1DI8A 2JD5A 3K5VA 2B54A 2IZSA 4CQEA 2GHGA 1PJKA 4FF8A 4I5PA 2OW3A 5HD7A 4Z9LA 3RGFA 4IC8A 3VUIA 3ATSA 1Q5KA 3QRIA 4O86A 2XCHA 2H96A 4NKAA 3PE1A 4M66A 2QR7A 4J71A 4FKVA 5IKWA 5I0BA 4YHJA 5CEOA 3KVXA 4ANOA 4CD0A 4O0YA 2OXDA 4L67A 4NTSA 4FSMA 3UIMA 3ENHA 3MVLA 2YACA 4L6QA 5FBOA 4IVBA 3U9CA 3A4PA 4FC0A 3DK7A 3GU6A 1FINA 3KMWA 4PNKA 3LMIA 5IQAA 1Q3DA 1WVWA 3LW0A 4XLVA 4GUBA 3HP2A 4BCFA 4DLJA 1ZRZA 4ORKA 5D1JA 3FXZA 4QMMA 1MRYA 1OL2A 1KOAA 3P7CA 1R0EA 4RLLA 2V5QA 2OIQA 3R71A 4U80A 2UZUE 5AP5A 4M68A 3VUDA 3ZUTA 1J7IA 3AC8A 3MVMA 4DBXA 2HELA 5M06A 4GS6A 4V01A 4ZTHA 5LWNA 5FGKA 2ITWA 1ZYDA 4S2ZA 3ZDIA 2IN6A 4IB5A 2BRNA 3RAKA 2XMYA 5TF9A 5E8VA 3FC1X 3SW4A 3NCZA 4YUQA 5B2KA 2CMWA 2VTMA 3P79A 5CI6A 1YXXA 5DA3A 5ANEA 2FSTX 3S95A 4C4FA 2WMVA 3JR1A 4ZJJA 4WIHA 3IDCA 3JUHA 3SGCA 2CN5A 4I6QA 4GT4A 3ZSHA 1WBWA 3RZBA 4F63A 5HX6A 3ZZEA 3EHAA 3D2KA 4MNEA 4BZOA 5A4CA 4O22A 3V8TA 3R7GA 2YCSA 2OF2A 2XK4A 4EH2A 3EJ1A 5BVDA 1YVJA 2PU8A 1H26A 2ITZA 4IVCA 5J9YA 2BAJA 1Q62A 3I81A 4AA5A 5EH0A 4F9CA 2OJFE 4KIOA 4E3CA 1TQPA 3AT4A 2IVVA 3ELJA 3PXFA 4YZDA 4GK2A 4V0GA 4BDDA 5JRSA 4O27B 1R3CA 2O63A 4QQTA 1YWRA 1GZOA 4TWPA 3G0EA 4FT9A 4KS8A 2VTOA 4OTFA 2QOHA 1P4OA 5J9ZA 4XCUA 4A9SA 4CXAA 2WGJA 2YIQA 3TIYA 3CEKA 3VHKA 2E2BA 3ZC6A 3PPKA 3EFWA 4CFMA 3E3BX 1IASA 2WMWA 3EYHA 4O0SA 1GAGA 4YJSA 3I6WA 4WO5A 2HWOA 2YWVA 3EQPA 4HCVA 1BL7A 3S3IA 4PTCA 4YTFA 4P5ZA 3ZSIA 4MBJA 3QZIA 3R1YA 4YJQA 3IW5A 3KU2A 4NTTA 1IA8A 1OZ1A 1BLXA 5IISA 3C5IA 5H2UA 4F9BA 3ZZWA 2XEYA 5EI8A 3D0EA 3VUHA 3RBWA 2QHMA 2XZSA 4NT4A 5HOAA 5FRIA 3THBA 4CCUA 3DKCA 4AOIA 1W83A 4L52A 4NU1A 5CEIA 4AZTA 1OL5A 4UWCA 1BI7A 2REIA 4F7SA 3GCUA 5L2WA 4ZAUA 5BX0A 1XBBA 2R9SA 3OWKA 2IVSA 3AD5A 2QU6A 3QCSA 4IADA 4IB1A 4K1BA 4R1YA 5F4NA 3W33A 4V04A 4ZMEA 5M08A 3MY1A 4G9CA 1DAYA 1UKHA 2IW6A 2XNPA 3FLZA 4FT0A 2JFMA 4AQCA 4HGTA 4XJ0A 5IA1A 2JBPA 3Q52A 1CMKE 3MH3A 5BPYA 4GCJA 4AGCA 3MH1A 4AZFA 2PPQA 1PXOA 1W7HA 3G90X 3KMUA 5DT4A 4AW1A 4PL4A 4ZJVA 1PMUA 2O8YA 2WKMA 3GT8A 4FZ6A 2ZVAA 3VUGA 1ZZ2A 5I9WA 3H0ZA 1H01A 4Y95A 3GUBA 4CYIA 4B8LA 1FVVA 3QZFA 5HVYA 3F3TA 4IFCA 2GNJA 2R3HA 1F0QA 3CS9A 4Y83A 5HE1A 2J7TA 3DZQA 5EDRA 3FMKA 4DH7A 5IDPA 4FKOA 2BDJA 3POZA 4FKTA 3P08A 5AIKA 2ERKA 3D5VA 4G3EA 4ENYA 4CKRA 4FOBA 2UZNA 2X8DA 1XH7A 4DGOA 4KBAA 4M69A 4Y85A 3VBWA 3K3JA 2ZDTA 3Q60A 3VO3A 3R21A 3ZO3A 3LFAA 4X3FA 3V5QA 1PXJA 3BQCA 3TKIA 4U40A 1L3RE 4DFYA 3DDPA 4DG2E 1K9AA 5M4IA 4AG8A 3SVVA 3Q04A 4K8AA 4RIXA 4F6WA 3E5AA 3D5WA 2C3JA 3PUPA 2GHLA 3QA0A 4IFGA 3QC4A 4ZEGA 1LUFA 3DAKA 2QOKA 3OXIA 4MAOA 5CVGA 4YTIA 4FEQA 5GZ9A 1GIIA 4HW7A 4DEAA 3AC3A 3R7VA 2V0DA 5HVJA 2R5TA 3BIZA 3VIDA 3MS9A 2Q83A 4GYIA 5AX9A 4C2WA 5KNJA 5IH4A 5HO7A 4D0WA 4L3PA 3FLSA 3FLWA 4IH8A 5J1WA 2JIUA 2WQBA 4FV0A 1J1BA 3A7GA 4JBQA 4HJOA 2R3MA 2E9PA 4FTNA 5TO8A 3ETAA 2CNUA 1M14A 4ZTSA 4X21A 4FKIA 4MBIA 2BILB 3BV2A 1HCLA 2J4ZA 3K54A 1UWHA 5ICPA 3CGOA 1OKYA 1ZYSA 2X0GA 3FMDA 1GIHA 3RHXA 3R6XA 2R3RA 4D9UA 3DZOA 3SOAA 4CG9A 4GK3A 2R3FA 4PL5A 4G16A 4G5PA 1H07A 5J87A 1JKTA 1XKKA 4BGGA 3CD3A 3WZEA 4ZIMA 3S4QA 4A9UA 2CGWA 3C4WA 3VUTA 4DE4A 4V05A 4D2RA 3F66A 3WILA 4YR8A 5E4HA 4FNYA 1CDKA 2BAQA 2QOBA 4O21A 4WNKA 1S9JA 3IQ7A 4FV2A 5C03A 3ZHPC 4QRCA 2R7IA 2YFXA 3H0YA 1UV5A 3MFSA 4C3FA 3FDNA 5T6KA 2JDSA 4F1TA 3Q6WA 2GNIA 4R1VA 5AV2A 3RPSA 1ZARA 3VVHA 4OTRA 4FV7A 3U4WA 1OUKA 4BVUA 4EH7A 4BHZA 4WD5A 3OZ6A 2C6EA 3HX4A 4KKGA 4ERWA 1YXSA 4JG7A 2HXQA 3NVKI 3EL7A 1RJBA 3SX9A 4FG8A 2G2HA 4FODA 3JYAA 3FXXA 2HW6A 5AEPA 4KABA 4DFNA 1NT2A 2Z7SA 1SZMA 2ZB0A 4D4VA 4G3GA 3ZXTA 2VTIA 2BKKA 2UV2A 1YWNA 3D94A 3NUXA 4FKLA 2WMSA 4GK4A 4AZVA 2BUJA 4G6OA 1WBTA 2YITA 3BLHA 5E8UA 1XH8A 4WBOA 5FQDC 3T9TA 4X2JA 3ZRMA 3N4VA 5E7RA 2Y4IB 1KE5A 3QTZA 4IAIA 1KUTA 4QP6A 3V5PA 4FVRA 4WG5A 2XKCA 5KZIA 5F94A 3VJNA 4M7IA 5F20A 4X3JA 3G51A 3VS7A 2GS2A 5LVPA 2Y0AA 4PQNA 4IZ7A 3WE8A 3V8SA 2ITVA 5CI7A 2QHNA 2BTRA 2XH5A 3IGOA 5FBNC 2DQ7X 2BMCA 2CKOA 4BDFA 3C4ZA 4UZHA 4EL9A 4EQMA 5AV4A 4ASEA 3FKNA 4I4EA 2UZLA 3VS3A 5I3RA 1V1KA 2JFLA 2PZIA 4MNEB 3UMWA 1OI9A 1Z5MA 2W17A 2XNMA 2PZRA 3C5UA 2I6LA 1YRPA 4A07A 2A1AB 2ERZE 2PHKA 3WI6A 4WUNA 4D1ZA 3R7YA 1ZAOA 5DNRA 4Z55A 1YKRA 4BCMA 3KL8A 3R8LA 5EQYA 4BRXA 1PY5A 3ZS5A 4ZY4A 4L8MA 3SRVB 4KD1A 4ZSEA 3U8WA 5CU6A 4AZWA 2UW7A 4C3RA 4CFFA 4U41A 3OCBA 4O83A 2OJ9A 4FTTA 3RM7A 4UMPA 3MPAA 2R4BA 2E9UA 3KXMA 3R1NA 3ORLA 4YNEA 4CRSA 2WQMA 4LFIA 1PXPA 2EU9A 4I6HA 2XIRA 3FUPA 5HI2A 3KMMA 2JIIA 4UWYA 1U5QA 3EN5A 3KB7A 4XG9A 3E64A 3NYNA 3MFUA 4FKJA 3VC4A 2RG5A 3BEAA 4U45A 5FXQA 2XCKA 3AMYA 3O23A 3ITZA 4S33A 1OIRA 3R9OA 5C8NA 5KMJA 3G33A 2X2LA 4FV3A 2DS1A 4G34A 5HNBA 3E3PA 4PF4A 3EFLA 3KQ7A 2XKDA 4LRJA 4F65A 5E8YA 2BALA 4NM3A 4DGNA 1S9IA 3BHYA 3AOXA 3VBYA 3WBLA 5DLSA 4I94A 4G1WA 3SHEA 2YZAA 3JPVA 2WEIA 4C61A 4NL0A 4LOOA 2XEZA 2OZAA 4LUEA 2YA9A 3B8QA 5A6OA 3DLZA 2YIXA 3QQKA 2JKQA 2R3KA 1RQQA 3KXGA 2JKOA 3QALE 3IW4A 2XRWA 3NNUA 4Q9SA 4JG6A 4O6EA 5C1QB
chains in the Genus database with same CATH superfamily
3QD4A 4FIFA 5CU3A 4A9RA 3UVPA 1J1CA 2UVXA 2QKRA 5JGBA 5AM7A 3Q53A 3FZTA 3KRJA 2CN8A 2NP8A 3IECA 4L42A 4WHZA 3I0QA 3I0OA 4AXDA 4C02A 3BPRA 4YO4A 2WIPA 3ANQA 3BHUA 3ZLXA 4BWXA 1ZOHA 1PKDA 3PSBA 4I93A 4W4VA 2A0CX 5I9UA 4YPSA 4BY9E 2YDIA 4TTHB 3QD0A 1XH9A 2YEXA 3G5DA 3C4FA 5HG7A 4CZTA 3IW6A 3KF4A 3R63A 4I0TA 5CU4A 3UIXA 3WZJA 3G9NA 4JQEA 4BDHA 4PDPA 4EEVA 4H1MA 2PVYA 3DNDA 4PMPA 2WPAA 1O9UA 5GJGA 1HOWA 3QRKA 2JDRA 4XUFA 1YHSA 3PRIA 2QOIA 4BCQA 3MPTA 1ST0A 4EOQA 2YN8A 5J9LA 3RK9A 4IVAA 4OT6A 3AGLA 3HV7A 3E7VA 3V5WA 4Z7HA 1PXMA 3TJCA 4RJ6A 4F0IA 3COMA 3UTOA 2SRCA 4X2KA 4EORA 4ZLOA 4C3PA 4QPSA 4QYYA 4NW5A 5HIEA 2WD1A 3GFWA 5FP6A 4RIWB 3OEZA 1Y8GA 2LAVA 2WTKC 1GZKA 2UW5A 2OZAB 3EN7A 3MIYA 1MRVA 3FXWA 3BV3A 3OY3A 3PXKA 4M67A 4C8BA 1G8JA 2YM5A 5FD2A 3BELA 3ULIA 4L01A 3QA8A 3R73A 5JT2A 4YZCA 4O7VA 5HBJA 5GNKA 4MNFA 4TNDA 3GU4A 4PDYA 4DFBA 3F6XA 5CZHA 2J2IB 2VO0A 5K3YA 4AX8A 4RX9A 4RX5A 4KSQA 2XNBA 3OHTA 3AXWA 1V0PA 2R3JA 5BVKA 4IANA 5ANJA 2BRBA 3KK9A 5L6WL 3FPQA 2RFNA 2PE2A 4D1XA 3LM5A 3PWDA 3W32A 3NUUA 5CF4A 3IG7A 3MTFA 3ATTA 4O0WA 3FHRA 2OXXA 3PSDA 3ORXA 4W8EA 3CGFA 3TZMA 4XV9A 2WQEA 3PYYA 1M2PA 3WZDA 4FL2A 2F7EE 3NIZA 3SXFA 5M56A 2QO2A 3DOGA 4L7FA 2XIYA 4M0ZA 3BZ3A 4FIJA 4BBMA 3KC3A 3LHJA 4RIYB 2YLFA 5FTOA 4D2WA 5CU0A 4FUYA 4XS2A 1XBCA 2NPQA 5HG9A 3I79A 5L6OA 3V51A 5AP6A 4JR3A 5IQFA 3ALNA 4XG2A 3W0RA 3FZSA 1J3HA 4IMYA 5HNGA 1YWVA 2ZM4A 3ZUVA 3DGKA 4C4EA 3POOA 4AAAA 1XBAA 2ZV8A 4BKZA 4O0TA 2C0TA 2YM4A 4X6RA 4RLKA 5AWMA 4E4LA 4F0FA 3F3WA 4H36A 4QP4A 3NFFB 4IAZA 2G1TA 3PJ2A 5DR9A 4ZSJA 2YAKA 1PMNA 2I0VA 1YQJA 2ONLA 2PSQA 1H1RA 3QCYA 4FTOA 4EWHA 4N57A 2I7QA 3IS5A 4E1ZA 1OPKA 3DU8A 4E73A 4BCIA 4FV5A 3OOGA 1W2FA 2UZVA 3ODYX 2BZIB 4QMOA 2YJSA 4YBJA 4PTGA 3SDJA 3SXRA 3VBVA 4DEHA 5KMMA 2PVNA 1KE8A 5LMAA 4NJ3A 5LXMA 2YIYA 5HBHA 4CKIA 1EH4A 2OBJA 2RFEA 4JAIA 5KHWA 4NCTC 5LVMA 4O7ZA 2OXYA 4D58A 4FVPA 1XH4A 3GOPA 4RBLA 3LXNA 4XHKB 4AXEA 3PPJA 5J1VA 2X9FA 5CY3A 3PA4A 2ZV7A 3FZRA 3TMOA 3EKNA 3QKMA 2W9FB 4Y5QA 5ETIA 3OG7A 3D15A 4FG9A 5L2IA 2E9OA 3F3UA 2XIXA 5AFVA 4NJDA 3NMUF 4MXZA 2FSMX 2HYYA 1LP4A 1U54A 5A3XA 4EYJA 1U4DA 3EN4A 3LCOA 3RCDA 4OW8A 3ZYAA 3FY2A 4ENXA 3W0OA 2XYNA 4GRBA 4U42A 3GCQA 1JSVA 1KWPA 5DPVA 3LMHA 2BFXA 2IZUA 3UDBA 3KXHA 4F78A 5HU3A 5IA4A 2C5OA 5E9EA 3W0QA 2X6EA 3KFAA 2BIKB 4LL5A 4NCTA 1YI6A 4J52A 4D55A 4CLIA 2W5BA 3KCKA 4WG4A 3GOKA 4BCGA 2PZ5A 2WTVA 5L6PA 2G2FA 1M17A 3UC4A 5IF1A 3NNWA 3R7UA 4CFVA 3AC5A 5AR7A 2XBJA 4RRVA 3QRTA 1IG1A 1RE8A 2GDOA 3R04A 4NW6A 2RKUA 4IX5A 4ZTLA 4C62A 1QPJA 3DCVA 3EQGA 3OFMA 1LPUA 3SA0A 3JS2A 3BI6A 5TKDA 3SKCA 4IVDA 4HGLA 3ZDUA 2XBAA 3EOCA 2X9EA 1TQMA 2VTSA 1P5EA 1U54B 3CPCA 4YJVA 5EW8A 5BUJA 4FE2A 4F99A 1PYXA 3QHRA 4RWLA 5CSHA 5FXSA 2PL0A 5CU2A 1MQBA 2I40A 2RGPA 4CFNA 2YM3A 5D41A 5AA9A 1M52A 2HK5A 2C6MA 5CTPA 4RMZA 4HVHA 4FKSA 5GZ8A 4GIHA 3OVVA 2EUFB 4W8DA 2OJIA 4EK3A 5IH6A 4GFOA 5IMXA 2R3QA 3NPCA 1OB3A 4KRDA 4XV3A 3FL5A 4CTBA 4MKCA 2Y7JA 2R2PA 3NS9A 2XP2A 1TVOA 4M8TA 3W2PA 3A4OX 4JBPA 2P0CA 3FY0A 3KA0A 3P4KA 4M84A 4O2PA 4WA9A 2W1GA 5DR2A 4AOJA 2FGIA 5K0KA 3HRCA 4QOXA 4O4CA 2R3LA 2BZJA 4HNFA 4FJVA 3I60A 3ZFMA 3ZO1A 4MXXA 3PJ3A 2H6DA 4EK5A 2CHLA 4LMNA 3ORIA 3TEIA 2VO3A 2YLEA 3O17A 3PXYA 3TV7A 2ZMCA 2CCHA 4LMUA 3M42A 2CLQA 2EVAA 3ZSGA 1J91A 3A2CA 4O7NA 4L00A 2VTPA 3QZGA 4N70A 3HAMA 4EOLA 3CXWA 3QTUA 5AP7A 3VW8A 4KBKA 3HUCA 3RPOA 4GSBA 4X0MA 4BCOA 1I44A 3VBXA 2BIYA 1NA7A 3OROA 4N6ZA 3TWJA 4A4LA 4BBFA 3A8XA 4H05A 4GT3A 2Z7QA 2G15A 3KRLA 1UWJA 2XK7A 3H9FA 4IM2A 3FPMA 2PVRA 4WT6A 5CXZA 1ND4A 4HPUE 4EOJA 2GNGA 3VS0A 3FMEA 3MFTA 4XV1A 3U54A 1OPJA 1GY3A 1IR3A 4IB0A 3VNTA 5HD4A 4O7YA 4G3FA 2Z8CA 1Q8UA 2HZNA 4WNPA 3SV0A 2XF0A 5AR2A 3PY1A 2VWBA 3G15A 2PUIA 5GJFA 3DFCB 1XHAA 5FDXA 3ORTA 3PDTA 3HLLA 2X7FA 3EYGA 4MWIA 3VHEA 3A60A 3G0FA 3H10A 4KAOA 5IQHA 4HYIA 3Q3BA 5E91A 3QWKA 3UIBA 4FTMA 4TYJA 2IO6A 2QD9A 4GT5A 2W4OA 5HE3A 3DV3A 3R9DA 4GFGA 5J5SA 2JGZA 2QCSA 3AMBA 3PRFA 4AZSA 4AGWA 3LFFA 3Q5ZA 4FK3A 3BHTA 4K11A 4EK8A 4IWDA 2I0HA 1SNXA 3UGCA 4CMOA 1NW1A 3HGKA 3PTGA 5DG5A 2YM8A 1ZOGA 2B52A 1XR1A 3MA3A 1Y91A 3TNPC 3CSVA 3HUBA 4P90A 3UG1A 2GHMA 5M57A 1PW2A 3VBTA 4FSUA 2J51A 2QKWB 3NAXA 4R7BA 1OITA 3FZ1A 3MTLA 4FNXA 3LCSA 3C4CA 3ZMMA 3ET7A 2PY3A 2VTQA 2WMBA 4RIWA 4ZOGA 3QQGA 4U3ZA 3VF8A 3KGAA 3R8PA 4XLIA 4X6QC 5HTIA 4XYFA 2VWZA 2BRGA 4FRFA 1WCCA 3UDTA 3CCNA 3TYKA 4PL3A 2P2HA 3K3IA 1JSUA 1BMKA 2OGVA 2VAGA 1SYKA 5E1SA 5GIOE 3UMXA 1QPCA 2J0KA 2PZYA 3KCFA 3QX2A 2FUMA 1WBOA 3NYXA 5J8IA 1QMZA 2VD5A 5CVFA 4JDJA 4QTCA 4O7TA 2JIVA 2ITPA 3PVGA 4AGUA 1R1WA 3OC1A 4QYFA 1Q8YA 2GMXA 4PY1A 3BU6A 4RJ3A 2UZBA 3LQ5A 3O2MA 5ETFA 5C26A 3OT8A 4DTBA 3F88A 4AN9A 3ORNA 3LFCA 4GU6A 2XM8A 4FZFB 3MW1A 4IDTA 4ITHA 4BWKA 4IWQA 5CZIA 2R3OA 3NIEA 2VWVA 3W55A 3QUDA 2PWLA 4FSQA 4WUAA 4UMUA 4S34A 2ESMA 4U79A 4JRVA 3CQUA 5CT7A 1SVEA 4OTPA 3VWAA 5GINE 2QO7A 3ZBXA 4RPVA 5E8WA 2YZLA 2KULA 2J0MB 4JL9A 3TJDA 2W5HA 2OU7A 5ETAA 4RFYA 2KTYA 4OBQA 5IUGA 4EK6A 4H3BA 2C47A 3K2LA 5A46A 4NFMA 4C7TA 2B53A 4Y5HA 5J5TA 3NYVA 1OBGA 3A99A 2WZJA 3U6HA 2WFYA 3DJ7A 3OBGA 3FI3A 4O81A 3JVRA 1ERKA 1HCKA 3BU5A 4O0XA 1H28A 3DPKA 1Y57A 2XK8A 5G6VA 3V5JA 4I20A 4PPBA 4XOZA 2HAKA 4ZS4A 3UP7A 1YOLA 3KXXA 5B2MA 2C3LA 3QCQA 1Q61A 2DWBA 4TYEA 1KE7A 4RVTA 2VX1A 5BMMA 3SC1A 4F9YA 5M07A 3TNIA 3FV8A 2ZOQA 3HMMA 3OWLA 3O51A 1ZY5A 2UZTA 3Q4CA 3MFRA 1REKA 2BPMA 2NRUA 3OOMA 4FKRA 5LJJA 3C9WA 4JNWA 5IPJA 4ITIA 4PMSA 3DBFA 3ULZA 4FI1A 3C50A 3DJ6A 3F5GA 3W0SA 2QODA 1OUYA 3W2CA 2W4KA 3UNZA 1CKIA 2B55A 2DUVA 2ONLC 2UW6A 3OW3A 4L3JA 4LL0A 5L2SA 5AUVA 2VTAA 3Q96A 2G9XA 3E8CA 4QQ5A 3BCEA 3O8UA 5HCYA 4R3RA 3MV5A 3E63A 2AC5A 3LCTA 3FLYA 1PMVA 4X2FA 4LGDA 4TYHA 5EKOA 1P2AA 2IW9A 3PG1A 4I92A 4LG4A 3TKHA 4AFJA 5HE2A 5FDPA 3H4JA 4AA0A 4YP8A 5H9BA 2OI4X 4MBLA 3E8NA 3O5AA 1UNLA 2YCFA 3F2RA 4U81A 4I24A 4OGRA 3SRVA 3Q9WA 4L3LA 4YTCA 2BTSA 5BV3A 2WMAA 5C01A 4L43A 4G6LA 4BCPA 4F70A 5KBRA 4X3FC 3OF0A 4RIOA 2UW3A 3MA6A 3AD4A 4WBBB 2C69A 4BTFA 4LRKA 2WTDA 4DHJA 5TR6A 1XH6A 4G2FA 3QX4A 4I3ZA 3BHHA 5M09A 2WEVA 5KKRB 3QKLA 4D2SA 1IA9A 1MUOA 2WMQA 4XX9A 4FTCA 1FQ1B 4IDVA 4D28A 1SM2A 4FV1A 1U5RA 4BYJA 4CZUA 3BGZA 3VRZA 4GEOA 4RZVA 2F57A 5CNNA 4H1JA 4LUDA 4RC4A 4E93A 3MI9A 5HTBA 3QZHA 2C1AA 2VN9A 3UVRA 2CGVA 4BTKA 2R0IA 2EXMA 5DEYA 2GTNA 4FSZA 5DEWA 1U59A 3RI1A 4AT4A 3DK6A 3W2RA 4YTHA 2HW7A 5E8SA 4IJPA 5LVLA 4D9TA 1BYGA 5DRDA 4JDHA 1PYEA 5AM6A 5TOZA 3RHKA 5JQ5A 3SAYA 3EQDA 3JVSA 4CCBA 3FI2A 4BC6A 3C1XA 3RZFA 2NRYA 3PXZA 3LIJA 3WF5A 1YOJA 2Y4PA 4IM0A 4QMSA 4FYOA 3QLGA 1BL6A 4AA4A 5HO6A 3QTXA 3T8OA 5I9YA 3CJFA 1ZMWA 2WELA 4BR3A 4NK9A 5CAVA 4S31A 5DIAA 1W2DA 4TWCA 4ZTQA 5CLPA 4UV0A 2W96B 1FBNA 4AE9A 2QVSE 2C1BA 5GZAA 4BIEA 1JQHA 2AC3A 2HIWA 4DTKA 5JQ8A 4R77A 2R3PA 1YHVA 4FYNA 4JIKA 2ITNA 4O4FA 4UBAA 3QQFA 4AAYA 3N9XA 1G8AA 4FK6A 3DY7A 5KX8A 3DJ5A 5DH3A 2BDWA 4ONAA 2VTLA 4MK0A 4IAFA 2ITYA 4L44A 3MB6A 3QYWA 4RX8A 3WYYA 3LXPA 3PP1A 4YU2A 3PP0A 2QOFA 4DAWA 3MVHA 3F61A 3R2YA 2XK9A 4DG0E 5AMNA 5EYCA 3BGQA 3WF7A 3PXRA 4FV4A 5HNIX 4O7SA 4AACA 3FQSA 3R9HA 3EIDA 3CD8A 1CSNA 4JX7A 5M44A 4B4LA 1QL6A 4CKJA 5HORA 1JOWB 4TNBA 4BL1A 5HVKA 5EFQA 4CGAA 1PHKA 4DDGA 1W84A 4UX9A 4BBEA 3QF9A 2QLUA 3MVJA 4FTIA 4Z3VA 4EJNA 2B0QA 3MIAA 5GIPE 3FL4A 4IE9A 4KIPA 4DINA 4YBKA 4YNOA 5T68A 2JLDA 4U9AA 3QRJA 5HEZA 3KREA 3GQLA 3AKLA 1ZZLA 5AAEA 2XALA 2C5NA 5K9IA 3VUKA 3UIUA 1IEPA 3PVBA 5CENA 4UB7A 4QMVA 4FNZA 2GQSA 5A4TA 1CTPE 2UVZA 4IX6A 4QMLA 2R3NA 4O0UA 4TZRA 4DYMA 4OT5A 3W0PA 3UZTA 4ALUA 5JFWA 1OM1A 1A48A 4AUAA 1NY3A 2J5EA 4CEGA 5CSXA 3A61A 3NUNA 4Y46A 3IO7A 3BKBA 2HENA 2XRUA 4YSMA 5A14A 3LFSA 5FEQA 3NVMB 5BVWA 3FE3A 4O38A 1Y6AA 5AA8A 4D5HA 4IX4A 5JEBA 3F5XA 4FKGA 5C8KA 2WU6A 4B0GA 4RJ7A 5DRBA 4FVQA 4TXCA 3QTIA 4C4GA 2WQNA 5AP2A 3QGYA 5IA5A 3A7IA 3FQHA 5ETCA 5IZFA 4A06A 5D9HA 2B9JA 4YHFA 1FVTA 4X3FB 3PVWA 5HG8A 3GB2A 3ENMA 3KXNA 4HCUA 5E1EA 4DLIA 4D4YA 1H8FA 4XMOA 4FV9A 4M69B 2C6TA 4K6ZA 4GVJA 3PY0A 5HLPA 3DFAA 1LEWA 4R3CA 3FWQA 4EQUA 3BQRA 3UVQA 5EW3A 5AIRA 4FG7A 2O65A 4RA4A 2F49A 4O4BB 3BWJA 1UU3A 4JI9A 4AWIA 4F6UA 3HMOA 3LLTA 4PTEA 4AOTA 3IPHA 4C59A 3VQUA 3W10A 3H9OA 3HMIA 4YJOA 4O82A 5EOBA 3QTRA 5AR3A 3O8TA 5IDNA 4KUJA 2BZHB 1H0WA 3JXWA 2OFUA 2QG5A 3HV6A 3HYHA 3G6HA 4TT7A 4ACMA 2GQGA 4AS0A 3HKOA 4HGEA 3DTWA 5FTQA 2C6IA 4J98A 3RP9A 3WF9A 2JKKA 2WHBA 3BBTB 3PIZA 3L8XA 4CMUA 3R8ZA 3W2QA 4YLLA 3BHVA 3NW6A 1UKIA 4I22A 2YIRA 3C0IA 4IIRA 4D2TA 3ROCA 5HU9A 3GBZA 4JT3A 1GJOA 1VYZA 3BLRA 4L46A 4XOYA 3F2AA 3HA8A 2EXCX 5D7VA 3TZ8A 2J9MA 5AP1A 5LCKA 5FM3A 4QP9A 1FMOE 2PK9A 3EFKA 4OLIA 2WB8A 2XK3A 4YJRA 5E8ZA 4YURA 1BUHA 1YXVA 2E9NA 4BWPA 4EBWA 4BGHA 3IOPA 3MJ2A 5FM2A 4IZ5A 3R1SA 4JQ7A 3CBLA 3PJ1A 1OKWA 3RALA 3GGFA 3NEWA 4F4PA 4BICA 5DWRA 3ORZA 4AGDA 2IVUA 3HEGA 5JGAA 3FMLA 4H39A 3WIGA 5KMKA 2DYLA 3LLAA 4ANBA 3QC9A 3P7BA 3CTQA 5F1ZA 4FTQA 5CT0A 2HZIA 5IEVA 4U97A 4FSNA 5KE0A 2HXLA 4MVFA 1UU9A 4D4SA 5F9EA 2GPHA 2GU8A 4PP9A 4N4SA 4ZZNA 2VWYA 4FKQA 3RK5A 5LVNA 4Y72A 4DTAA 3R7EA 3QWJA 3ZM4A 5AV0A 3UPXA 4O91A 3JY9A 3QLFA 5KBQA 1KV1A 1GOLA 5LOHA 4MEDA 3FMMA 2I0EA 4DEEA 5DHJA 1E1VA 2GS6A 3RAIA 4MQ1A 1ZY4A 2QONA 2W9ZB 4JDKA 3PFQA 3Q9ZA 3LVPA 4EBVA 5C4KA 4C38A 4EOKA 4YLKA 2GCDA 3GVUA 1SVHA 5FUTA 4FL1A 5CSVA 3MWUA 3CKXA 5BUEA 5EHYA 1H00A 4B99A 1KSWA 2OICA 4KA3A 2I0YA 4GYGA 4V0GB 3Q4TA 4FUXA 4ZS0A 5KZ0A 5I4NA 2VWXA 3ZLWA 5LWMA 3P5KA 4J53A 4WSQA 4QEBA 2ZDUA 3LFQA 5EYDA 4XBUA 5LMKC 5DT3A 4GFMA 2X4ZA 4QT1A 3AKKA 4E5AX 2P2IA 2OO8X 4JBOA 3NZ0A 3VRYA 3QQHA 4MCVA 2WMUA 3BU3A 3VS1A 3WYXA 4DH5A 1IAHA 3U6JA 3R9RA 1DAWA 2QOCA 1IRKA 3LCKA 4ASDA 2V7AA 4PPCA 4EOPA 2UZDA 3B8RA 2C68A 1TKIA 4U3YA 4ANLA 4AT5A 4DGGA 5L2QA 3OXZA 4GV1A 4FV6A 5IUIA 4RZWA 1BI8A 2W05A 5IEXA 4EC8A 2XVDA 2RFDA 4FZ7A 4F0GA 2B1PA 5ACBC 5H8EA 4BJJB 4YGAA 3KK8A 4ASXA 5CEMA 3LAUA 3G9LX 1O6LA 2VV9A 4RJ5A 4UYAA 4NUSA 4AE6A 5FXRA 4EOSA 1JAMA 3ANRA 5B7VA 3EWHA 3TUDA 5CF8A 4IAKA 4FT3A 2F4JA 2UZWE 4KIQA 4L9IA 5L4QA 2X39A 3O0GA 4FR4A 5LARA 3HP5A 3BYOA 3L9LA 4R7HA 2J0LA 4RGJA 3UYTA 5HZNA 4YC3A 4F7LA 5DGZA 2ITTA 1JPAA 5AAGA 4J95A 2O5KA 2Y9QA 2WQOA 4HOKA 5CF5A 3NGAA 3DQXA 3EZVA 4RFZA 2XNEA 3D83A 4WSYA 4YSJA 4UMRA 4JBVA 3MGYA 1RDQE 5L8JA 4FMQA 4NM7A 3ZFYA 1UU7A 3I7CA 2C5VA 3RPVA 4QMNA 3ZH8A 1H1PA 3DB6A 3FQEA 4G9RA 1WVXA 4W4XA 5EKNA 5C9CA 4CV9A 4W9XA 4JJRA 4BCNA 3DKFA 3EQRA 1DS5A 4JS8A 4FEXA 5IQGA 4I6BA 2JDVA 5CSWA 1YXTA 2EWAA 2X2KA 3O96A 4RWKA 3OMVA 4FNWA 4MD7E 4ZSLA 4Q9ZA 4KKHA 3OWPA 3LXKA 2CPKE 4QMWA 1OIQA 3L9NA 4O1OA 5AR5A 2A98A 3F5UA 3L8VA 1Q4LA 4U6RA 2IW8A 5FEDA 5EOLA 4I5CA 2J90A 2BHEA 4CNHA 2WU7A 3ID6C 2Z7LA 4LYNA 4XP2A 2RFSA 2W0JA 2QG7A 3QHWA 4EUUA 4HZSA 3VQHA 4TWOA 4BFMA 2JBOA 4LOPA 4EZ3A 1XMMA 2C6OA 4K2RA 5D7AA 1UNHA 4RSSA 1URCA 2UW9A 3NUAA 4FZDB 3PPZA 2W1EA 4EQCA 3U9NA 5FWKK 5IG1A 5L3AA 4EUTA 3F82A 1E1XA 5EYKA 3G2FA 3QQLA 2F2CB 3IDPA 5CQWA 3FAAA 5DVRA 3RM6A 4P5QA 3QTSA 2HOGA 4UY9A 3QTQA 4A7CA 1H1WA 5IU2A 5KO1A 4BHNA 2AYPA 4EOMA 4MD8E 4YJNA 4TYIA 4XG6A 3T3VA 4CTCA 1G8KA 1REJA 3COIA 2GQRA 3FC2A 3W0NA 3QCXA 3ORKA 1OL6A 2XJ2A 4GKHA 5DR6A 4FSRA 3RCJA 5CAOA 4BTMA 2VTHA 4JOAA 3KF7A 4I23A 3DBQA 5EDPA 4TWNA 3UO5A 4OAVB 5JKGA 2XAOA 4HYHA 2EB2A 5HKMA 2OZOA 3KN5A 5KMNA 3HA6A 4O6LA 4P7EA 3ACJA 3ODZX 4J97A 4BDEA 1VR2A 3EH9A 5M53A 4GG5A 1ZYJA 5GJDA 2W1DA 5A54A 2WTIA 3R28A 5EDQA 4IXPA 2ITOA 2QQ7A 4YHTA 4EZ7A 4ZTRA 1F5QA 3P7AA 4FEWA 3LKMA 3FYKX 2CKQA 5H3QA 3E8EA 1OKZA 4C4JA 3Q4UA 3A7HA 5HGIA 1JVPP 2VWUA 4IACA 4ZXTA 4EHEA 2XIKA 4G17A 4EH6A 4R6VA 4AFEA 5CS6A 4HPTE 3CC6A 3F3ZA 4FSWA 1OL1A 2FSLX 4TYGA 5M55A 4C36A 3TM0A 5KUPA 1PXLA 4TRLA 4PP7A 4DC2A 4DITA 3DXNA 4QMPA 5BQ0A 4USFA 1SNUA 4PDSA 5AUTA 1AD5A 2BROA 3GC0A 1ZOEA 2UZOA 4O4EA 1YDRE 3LQ8A 2VO7A 5EK7A 3NNXA 4UMTA 4ZY6A 3FKOA 4BKYA 3H3CA 3NFGB 2F7XE 4FTUA 2X2MA 3UC3A 1RW8A 3ZEPA 2YDKA 4G6NA 3BYVA 1SVGA 3BL9A 4KNBA 3CY2A 2RSVA 3TCPA 1OVEA 4C34A 1WMKA 5J7BA 1T46A 4QP1A 3E87A 4AF3A 4E6AA 2ITUA 4GJ3A 1XWSA 4JX3A 1CM8A 4FKUA 5EHOA 4PUZA 3EQBA 3OT3A 5HE0A 5T3QA 3ZONA 2R3IA 4IWOA 1BKXA 4LI5A 3FI4A 4X2GA 5AAFA 4KWPA 3RTPA 4AN3A 4DH1A 3CJGA 2W1CA 4DT8A 3N51A 4FSTA 1H27A 3VBQA 3P0MA 4O1PA 4QP8A 2WTWA 1JSTA 4QQCA 5JRQA 1XO2B 2FA2A 4FV8A 4BYIA 4MX9A 1Z57A 4QD6A 3G6GA 4QP7A 4RVLA 1OL7A 4E4MA 3GCSA 2VRXA 3ZCLA 3UO6A 4FEVA 4AU8A 2X0PA 3ZC5A 4IJ9A 3PXQA 1O6YA 1V0BA 3ZO4A 3UZRA 3F5PA 5EM7A 4CFUA 4TPTA 3PA3A 2F7ZE 3AGMA 3FZOA 4F1MA 3WIKA 3L8SA 2FVDA 2BRHA 3LXLA 1PXNA 5H8BA 4D0XA 2C4GA 4MTAA 5IUHA 5IMEA 1KE9A 3OS3A 1M7NA 2XM9A 3HDNA 4QMYA 1ST4A 4JG8A 4BJJA 3W2SA 4K77A 4F08A 3QYZA 5HO8A 3UNJA 2BKZA 3V6RA 4GUEA 2FB8A 3GFEA 5AP4A 3LCDA 2Y6OA 2ZB1A 4IZYA 3VS2A 2ZM3A 3TNQB 3MN3A 3R83A 3PJ8A 4EK4A 3IK3A 1Z9XA 3R0TA 4X7QA 4IWPA 1CKPA 4O2ZA 4MXAA 4WRSA 5K5XA 4R7IA 2X7OA 3BWFA 4RVMA 4W4WA 4QNYA 4PWNA 5EI6A 3AC4A 4USDA 4P2KA 4L68A 4P4CA 3CE3A 3RJCA 3AMAA 2VZ6A 4LM5A 4QYEA 5E8XA 1FOTA 5JGDA 3N4UA 2XKFA 3MSSA 4NSTA 4YZ9A 2B7AA 4J96A 1A9UA 4MQ2A 3O7LB 4U7ZA 4QTBA 3SQQA 3QXPA 2QURA 5EQPA 4Q5HA 5FTGA 1OIYA 4PMTA 3D2IA 3HNGA 3BYMA 2QOLA 5ANKA 4ANQA 4YJTA 4EH5A 1IAJA 1G8SA 2QOOA 4RQVA 2R7BA 2X8IA 5HESA 4EOIA 5AP3A 4NIFB 3TN8A 1ZMUA 4NIFA 4DG3E 3PLAE 4N6YA 4O0RA 3PE2A 5FG8A 4APCA 2JAVA 3I7BA 1YHWA 5BYLA 3OCTA 4IZAA 5DT0A 3EMGA 4DHIB 3MB7A 3EB0A 4NFNA 2W1HA 2CCIA 3V5LA 3QQJA 1Q97A 2PZPA 4MF1A 4LV5A 3TKUA 4CG8A 2QC6A 5M51A 3I5ZA 2WIHA 4IAYA 4MXYA 4HVSA 2BHHA 4E4NA 3FKLA 2XNNA 4C4HA 4RA5A 4FT7A 1OGUA 2EXEA 2BFYA 2RL5A 2WOUA 1B6CB 3R02A 2PVFA 3LJ1A 2VNYA 5I5ZA 2A27A 2PVKA 3KEXA 1JBPE 4IC7A 5CAQA 1UA2A 4RWJA 5A4QA 5CSPA 3COKA 3MYGA 5KHXA 3QL8A 4WG3A 3F2NA 2O0UA 3FI8A 4DT9A 2X6DA 3HDMA 3R9NA 3OUNB 4L53A 3LPBA 1JKSA 5M4FA 1WZYA 2J6MA 2CNUA 3B2TA 3IW7A 4QYGA 2YJRA 2PE0A 4G31A 5BNJA 3MPMA 1M7QA 3LFNA 4OBPA 2PVHA 3HMPA 3SG8A 3VS6A 4UWBA 3DXQA 1W0XC 2XIZA 2YHVA 4R5YA 2ZM1A 4B6LA 3RMFA 2IZRA 4DEGA 3NW7A