4YJUA

The kinase domain of human spleen tyrosine (syk) in complex with gtc000249
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
262
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
total genus 91
structure length 262
sequence length 267
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjuA01
3H0YA 2JD5A 4ACHA 4FV5A 4ALWA 4MXAA 5ANEA 5AWMA 4GVJA 2XYNA 2IW9A 3EQRA 2FA2A 2IZRA 3FDNA 3UIXA 4YJVA 2O8YA 1I44A 1PF8A 3IONA 3RKBA 4EKKA 3BQCA 3C50A 4LL0A 3KY2A 1YQJA 3CD3A 1WBSA 3OTVA 3VQUA 4AOIA 2ZJWA 4Q2AA 4D5KA 2C5YA 3LFAA 4UYNA 4CT2A 4UWBA 4YLLA 5JH6A 3LLAA 3HMPA 5DI1A 2V7AA 2ZV7A 3ROCA 4CFXA 4YBKA 2DYLA 4EBWA 1NVRA 3RTPA 1CDKA 5GJFA 4LUEA 4FSWA 2WPAA 3MSSA 4FEXA 3OG7A 5CU0A 5J9YA 4HVHA 4E5WA 2Y4IB 3VBVA 3WBLA 3GU7A 4NH1A 2PE1A 1CM8A 1M7NA 3ZXTA 3MGYA 3VS4A 2R3MA 3QBNA 2P33A 3EB0A 3HP2A 4WOVA 4X3FC 5H8BA 5JRSA 4NM7A 5BVKA 3RP9A 4ZAUA 1NVSA 5GZ8A 4MXYA 4YZBA 3I6UA 2B4SB 3TUBA 2VV9A 5K3YA 5TF9A 2XK9A 3W2OA 5GHVA 4IFGA 1MP8A 3LXKA 4YJUA 3UC3A 4ZTLA 5A46A 1CMKE 4IACA 5CU3A 4BZOA 1SNUA 5HOAA 1SYKA 3DZOA 4OAVB 5M09A 1YI3A 3NVMB 4FC0A 5KBQA 2QKWB 4E6AA 2GS6A 2HAKA 5JKGA 5CZHA 3P7CA 5L6PA 3Q2JA 4C3PA 2F7ZE 1GZ8A 4NFNA 2J4ZA 1NT2A 3TDWA 3O96A 4S2ZA 2QG7A 4O1PA 2WQEA 4Y73A 4F0GA 3RVGA 4P4CA 4P7EA 5H2UA 4IMYA 2J0MB 3Q4CA 3OC1A 2Y8OA 4NIFA 4OR5A 4UALA 4BCMA 3BU3A 5A3XA 1DAYA 4V0GA 4XCUA 4EC8A 3ANQA 2BZHB 5FDPA 3IPHA 4EOLA 3CXWA 4TPTA 4HYUA 2YLFA 3ZSGA 2R3RA 4NU1A 5L2WA 5E4HA 5BMSA 1A48A 2OXYA 4CXAA 2OKRA 5DRBA 2OWBA 3CTJA 2YIYA 3BELA 5FP6A 4FV8A 1MRVA 4ANLA 2IZTA 4U41A 5A9UA 5LCKA 4JOAA 2OFUA 1PHKA 3EJ1A 3K5UA 3LCDA 2XMYA 4M0ZA 5AP4A 2O64A 4BWPA 4AFEA 4LQMA 3D5WA 4IAKA 5FLFA 3SGCA 3HRCA 1PMNA 3D9VA 5E8VA 4TYHA 2R3JA 3C0HA 3ZTXA 3ORLA 4FE2A 3ATSA 4WSYA 3ETAA 3REPA 3R1YA 4GRBA 4QMSA 1YVJA 4F1OA 1LEZA 5AR5A 1OUYA 3LFEA 2G1TA 2QU6A 4II5A 2IO6A 2PSQA 5CVFA 3IW4A 3NLBA 2RKUA 4NCTA 3MB6A 3PSDA 5IISA 1WVWA 2YCFA 3BU5A 3G2FA 3MA3A 4U42A 2OICA 2BPMA 1EH4A 4AA0A 3OFMA 2RFEA 3ORKA 3V51A 2FB8A 1KE5A 1RQQA 3EYHA 4DN5A 4ZZNA 3EQBA 4RX9A 3I0OA 4UMPA 3CTHA 3VHEA 3QC9A 2J0IA 3NW5A 4QP1A 5B2LA 4FIFA 3EQPA 2CNUA 1Q8UA 1KOAA 3Q60A 4KRDA 5KMNA 1BI7A 3AMAA 3R9RA 3OUKA 4ZTQA 4RFZA 5DE2A 3DCVA 5E1EA 4FKIA 4XOYA 4BI0A 3VUDA 5DG5A 4OGRA 3SHEA 5JQ5A 4IQ6A 3UC4A 2X39A 2J0KA 1UKHA 1TKIA 4BCIA 3QTRA 1OECA 4I5HA 4USFA 3GNIB 4FGRA 4FOBA 2A1AB 3RBWA 2CGVA 5CSVA 3VS5A 3Q32A 5CTPA 4PX6A 1ZMWA 4J97A 5C8MA 4XHKB 1DAWA 1PKDA 1YW2A 3NUNA 4FKVA 5D41A 2YJSA 4FSQA 3MY0A 4YP8A 5HCZA 5CY3A 2QOIA 4QTAA 3HV7A 1OVEA 4FTKA 3R9DA 2XCKA 2WTKB 3VJOA 4F9YA 4O27B 4X3FA 2AC3A 3W33A 4XG9A 3CCNA 2PZYA 5KHXA 4DBXA 4WNMA 4D9TA 5BPYA 5IQHA 3ERKA 4L52A 4BZDA 3E87A 4WNKA 1ZYLA 1XR1A 2WTVA 3BGZA 3V01A 3DPKA 2CKPA 4GS6A 4XEYA 1LR4A 2YDKA 3RMFA 4D5HA 3JR1A 3QKKA 4FIJA 4YJQA 2OXDA 3SOCA 2RG5A 5J7HA 4NL0A 3TNHA 2UVYA 4AS0A 1OIQA 2W06A 2YITA 3IS5A 4L67A 1RE8A 3BYUA 3UGCA 2BIKB 1E9HA 2WIPA 3QUPA 2XM8A 4BB4A 4C34A 5IQDA 3EIDA 3H9OA 2R64A 2JKKA 3COMA 4J98A 2OBJA 2YIXA 2FVDA 5L2IA 2JIIA 1FVTA 2A27A 2PL0A 3FZ1A 3LZBA 3EZRA 3V04A 3DFAA 4ZJVA 1CTPE 4PDPA 4C38A 5IH5A 3TZ9A 4PNKA 2QNJA 4CT1A 5F9EA 4LV8A 4YO4A 3NW6A 4BIDA 1ZYSA 1YI6A 3DKFA 2V7OA 4W4YA 5FDXA 3R7OA 4EZ7A 1ZYJA 3A7IA 5KMMA 4BF2A 2BIYA 3A8WA 5K0KA 1T46A 4ERKA 4WUNA 3AGLA 3FC2A 2WFYA 5C03A 2PYWA 3E62A 2AUHA 3FXXA 4W9WA 3DBFA 4GU6A 4L68A 4XOZA 4RVMA 4X0MA 3LPBA 4E73A 4PMPA 1M2PA 4GIHA 5HIBA 3F9NA 3LCTA 4RIYA 4XG3A 4TTHB 4BZNA 5DR9A 2QLQA 4PPCA 2Z7RA 1PXLA 1UWHA 4ACDA 4QRCA 4ZTMA 3DT1A 2Y6MA 4ASEA 5DGZA 3RCDA 3NUPA 1Q97A 2F2UA 4I22A 5ANJA 3UYSA 2QO9A 3WF6A 3TUDA 1BUHA 2WIHA 3IW5A 4PMTA 5AAGA 3ZO3A 4B0GA 1OBDA 4AN9A 5HNIX 2ZYBA 1B6CB 4BY9E 1PXIA 4TWCA 3ENMA 4CMOA 3NUXA 3R1QA 2X8EA 5L2SA 1YWNA 4D4VA 2VN9A 2GNIA 2QHMA 1E1XA 4FTAA 5EW3A 2XKCA 3DJ5A 3GQLA 5F1ZA 2GNLA 4MNFA 2OU7A 1WBVA 3C4CA 3NIZA 4MQ1A 4RVTA 5E8UA 2PVNA 4FX3A 4O83A 5K5XA 3EL7A 3GBZA 2XKDA 3G33A 4G9CA 2GU8A 2X9FA 3LCOA 4RT7A 5M51A 2Z2WA 2IJMA 3HAVA 4IFCA 4KS8A 3E93A 4J71A 4BI2A 1JPAA 2BZJA 5HBEA 2LGCA 2J2IB 5HIDA 3V5PA 1WCCA 3FLZA 4XLVA 2W5AA 2R3QA 3PUPA 1H1QA 4A9YA 4R78A 4LRKA 4CSVA 2OIQA 4R7IA 4IVCA 2X6EA 2EXCX 3OUNB 5AMNA 4HVSA 2ZV8A 3SD0A 1UNHA 3O23A 3BIZA 3H30A 4KKHA 3V6RA 1CKJA 3OXTA 5KZ0A 2X4ZA 1ZY5A 3S3IA 2JKOA 4PP7A 4JI9A 4DCEA 3Q4ZA 4L8MA 2C3IB 5IA0A 3CQEA 3QGWA 4EQMA 3FMHA 4ZSEA 4MD8E 3KMMA 3HL7A 1BMKA 2REIA 4FSNA 4ZP5A 5TO8A 4YLKA 3U9CA 1LPUA 4FODA 4C37A 3OROA 4ANMA 3IGOA 2YM5A 1OZ1A 3AMBA 3R1NA 4EOQA 3BV2A 3LQ3A 3F2NA 2R3KA 2UZVA 4E5BA 5D11A 3A60A 3UQCA 1AQ1A 1PXMA 5B2KA 1ZLTA 3ZRLA 4EH8A 5I9XA 2ZV9A 3ZC5A 1Y6AA 3CJGA 3NSZA 4D2SA 5CAUA 2ZDUA 4IZYA 3FYJX 4GSBA 4H3QA 1V0PA 4WBBB 2QKRA 4CVAA 3BEGA 3FXZA 3G9NA 4JR3A 2AYPA 3Q52A 4R7BA 3KVWA 2YWVA 4BYIA 1UWJA 3SG8A 4I92A 5IMXA 3QTIA 4KBAA 4ASDA 5EYCA 3TNPC 5LVMA 1H27A 1BL6A 4FIHA 4FTNA 5HEZA 4GW8A 3VRZA 2Z02A 2VRXA 4TYJA 3VUGA 4CTBA 3W2QA 2CN8A 4I4EA 2XNEA 3C0IA 1GOLA 3VUMA 4CFWA 4H1MA 2RG6A 3F3VA 3WIGA 4K8AA 3F61A 4F7NA 3D2IA 1OKYA 3P7BA 4I3ZA 3TI1A 1HCKA 4H36A 4EONA 4IX5A 3FI2A 3S95A 5JGAA 1URCA 4ASXA 4R3RA 5M4UA 4NTSA 5GZ9A 1JKKA 4GT3A 4M14A 4YZCA 3CQUA 3R6XA 2F49A 3R22A 2B0QA 3ZDIA 5EK7A 4CZTA 4IAYA 3LMHA 3MVLA 3VAPA 3Q4TA 4UXQA 3H9FA 3UZTA 2OI4X 2Z60A 2H96A 5A4TA 3MFSA 3UG1A 4C4HA 3PRFA 4FK6A 3V5LA 2W4JA 3DQWA 3UBDA 4AGUA 4CMTA 4JLCA 5HLWA 3QXPA 3MIYA 3Q9ZA 1SVEA 4IVDA 3NAXA 1PXKA 3ANRA 4CEGA 5CU6A 3DXQA 4X6QC 4HGTA 4GJ2A 1OKZA 3UQGA 5FM3A 4WNPA 2CN5A 4XV1A 3KCKA 4C02A 1U4DA 5AP5A 5AUXA 2W7XA 4DH1A 3ZBFA 4JBVA 3CTQA 3DS6A 2JDVA 3RHXA 2WOUA 5LCJA 1CSNA 4BWXA 3VF8A 3K5VA 4MNEA 1YXSA 4WNOA 4RWIA 3PY3A 4ITIA 4OBQA 2XKFA 2FYSA 4IAAA 2W4OA 2Y7JA 3PXYA 4I5CA 3TG1A 1W83A 3B2TA 2J51A 5BUJA 3BYMA 4RX7A 4IX6A 2B9JA 5A4QA 5HGIA 4QP3A 2XJ0A 3GGFA 4O0TA 4UMUA 5IA2A 4N57A 4ZMEA 2ETMA 4EORA 5AFVA 3QA8A 4W4XA 3CD8A 4G31A 4O96A 2CCIA 1REJA 2EB2A 1WFCA 2F57A 3OEZA 2VTRA 4EH5A 5ITAA 2BFXA 3LE6A 1XH6A 2UZOA 3FZRA 1Y57A 3QCQA 4LFIA 4DEAA 4FT5A 2R3FA 5ETAA 1M2QA 4FI1A 5A4EA 3PXZA 4YTCA 3POZA 4U44A 4DGOA 3ZSHA 3MY1A 2XIRA 1YHSA 1KE8A 3EWHA 5KMIA 3FEGA 4O6EA 3JPVA 5DA3A 3RM7A 2WMRA 3L9LA 2OO8X 3TACA 4ZTHA 4G2FA 4LM5A 3QLFA 2ACXA 5EQYA 1S9IA 3QXOA 1H07A 3DU8A 4W4VA 5DR6A 5ANGA 1UU7A 3QZHA 2PVRA 4KBKA 2HXQA 3R2YA 4IWPA 4ONAA 5DR2A 5EFQA 1PKGA 4BBFA 2BRBA 2C69A 4FIIA 4B4LA 4DFZE 2R7IA 3ZRMA 4PF4A 3JY0A 5A14A 2VTPA 3LCSA 4OTPA 4TYGA 1J3HA 3O51A 5F94A 3FLSA 5CEMA 4LRJA 5H8GA 4XP2A 3VS2A 2ONLA 4CV8A 4QMVA 5JFVA 5EOBA 3GUBA 3L9NA 3U4WA 3UJGA 3TTJA 4QMTA 4JBQA 5CLPA 3WF5A 2GCDA 2R9SA 3O8TA 3U55A 4KUJA 3OW4A 1U54A 2WXVA 3ZLWA 2XZSA 3CEKA 5HE3A 3T9TA 5ACBC 3E8DA 4IX3A 3VS6A 4DLJA 5A4LA 5CAVA 1IASA 4EK3A 1YOJA 2XBAA 4JDKA 5IQFA 4TWOA 2VTLA 3MPAA 4AF3A 4EZ5A 3SC1A 2P0CA 4G1WA 1H00A 5EG3A 1FPUA 2WU6A 3QD0A 1SVGA 1UKIA 3C4WA 4ZLZA 3C4ZA 3HDNA 3RPVA 4MEDA 3FY2A 2GS7A 3G0EA 4AA4A 4C57A 1OI9A 5LVNA 2PMOX 2XRWA 2X2LA 3ACKA 2UZBA 3R2BA 2VTMA 2QO2A 2VWXA 3BHVA 3DTCA 3RAIA 4PL5A 2E9VA 4FTUA 3NYNA 5AJQA 4APPA 4BN1A 4E5AX 3KXZA 2V62A 4JVGA 4E93A 4NUSA 4G3CA 4M15A 3ZFMA 3PIXA 2VUWA 3KXNA 3PVWA 3FAAA 5CVGA 5E90A 1X8BA 3EYGA 1YI4A 4IHPA 4M97A 3H10A 4U97A 4EK8A 3D15A 1HCLA 2JEDA 3QRJA 4OTWA 4X2FA 3ORZA 4JQ7A 1ZOHA 3NX8A 1OM1A 4AOTA 1M52A 3PJCA 4JR7A 2R7BA 3VUKA 3QRUA 2PTKA 4GKIA 5HVYA 4EHEA 4I93A 1YOLA 3HMMA 4BDBA 4EOKA 2A19B 4QMYA 2QD9A 3PSBA 3R30A 4H1JA 4E6QA 2HENA 4Z7GA 2VX0A 3ACJA 4WT6A 2Y9QA 4P90A 2DUVA 4PRJA 3HMNA 5EI6A 4E6CA 4EOMA 4EK4A 2VTTA 4TZRA 4FEWA 3UVQA 4B6LA 2WTIA 4DLIA 3EN5A 4XH6A 4MVFA 5BVWA 3GC9A 2G2FA 1LP4A 3TIYA 4C3RA 2QOBA 2WEIA 5CVHA 3TZMA 3BCEA 3HA8A 4GJ3A 5C8NA 5CEKA 3C7QA 3OY3A 4XMOA 5EW8A 4V0GB 4C4FA 3FKLA 5EM8A 2HWOA 2HIWA 3R7VA 4DFNA 1UNLA 2E9OA 3UOKA 5KMKA 1PXNA 2O0UA 2I40A 3LHJA 2EB3A 3BWJA 3KF7A 4FIEA 4NM0A 3TCPA 2FO0A 2PZRA 5DMZA 3MYGA 1PYXA 3TNQB 3OY1A 2LAVA 4U0IA 1TQMA 2FSTX 3IG7A 2X7GA 4U6RA 3PVBA 5HO6A 3LOKA 4XG8A 3RPSA 3TKUA 2R5TA 3NUSA 4FL1A 2WO6A 5FXRA 1P14A 2RIOA 2R3PA 3EN9A 2XIZA 2OH0E 3RPOA 2WMXA 4YHJA 4ZSLA 4FG8A 1OIUA 5F95A 4L42A 4E4XA 4EOJA 5C26A 3NUUA 1PMUA 4OTRA 5ANKA 5J1VA 5EDRA 4GK4A 1Q4LA 2CHLA 3C4XA 4KIKA 2YDJA 3DY7A 4P5QA 1YXTA 1FMKA 3WF7A 4D58A 1XBAA 3F2AA 4JXFA 4RG0A 4JS8A 4O0WA 4FSUA 2GHGA 3CIKA 3LCKA 4X2NA 2UVXA 3R0TA 1NXKA 2ZM1A 4ANNA 1GIJA 3DXNA 2VGOA 5DHJA 3RCJA 3MH0A 3VHKA 3IW7A 5C27A 2I0VA 3QKLA 3FL4A 3RK7A 3NZ0A 1OBGA 3S2PA 1HOWA 4QMXA 4GT5A 1JSUA 4FTQA 1NW1A 2PVYA 2ZDTA 4PQNA 4RWKA 5B2MA 4MAOA 3CPCA 4F9WA 4KA3A 2UZWE 4LI5A 1Z9XA 2BDJA 2Z7LA 5EW9A 5J5TA 1UU3A 3ZZEA 3O17A 4MCVA 4OTQA 1Q8TA 1VYWA 2W99B 4MBIA 1M7QA 3ZLSA 4EOPA 4L00A 4F99A 4E7WA 5JRQA 3A4PA 5AUZA 3CY2A 5HKMA 1XJDA 4DEHA 5GINE 1H1PA 1JBPE 2YM3A 2C1AA 3QF9A 3QTZA 1WZYA 1KE9A 4KRCA 3FMMA 3BLHA 1JKLA 4ZIMA 3RZFA 1KOBA 4U8ZA 3T8OA 2GFCA 5D9HA 3Q6WA 4IWQA 3LMIA 5J8IA 5DYJA 5I4NA 4BTFA 3U9NA 3R00A 5AAEA 4BDEA 4MXXA 4EOOA 3CJFA 4ANOA 4GVAA 3AC5A 3Q5ZA 2NO3A 5JFSA 3AT4A 1O9UA 5JFWA 3P4KA 2CLQA 4O0XA 5BMMA 5TE0A 4IM3A 3C4EA 3KFAA 4O7ZA 3BLQA 3ENHA 4LYNA 2XM9A 1G8AA 3ZEWA 4JDIA 2W1FA 2Z8CA 4FSZA 4JIAA 3PJ3A 2R0UA 1G5SA 2QG5A 4JJRA 5JZNA 3QUEA 3FSKA 4HVIA 3M42A 2UZEA 3CLYA 3PY0A 4Q9ZA 4B9DA 4FYNA 1OB3A 5C01A 3HZTA 3V5QA 3ZH8A 4AW1A 4TY1A 2JC6A 4OTHA 4FMQA 4IM0A 2C4GA 2Y4PA 3GVUA 3G0FA 3MESA 5AV0A 4BDGA 2GHMA 4BCHA 3ZC6A 5AEPA 4AUAA 1PMEA 4GK2A 4DEDA 2ERKA 5DEWA 4D1ZA 2RSVA 2BKZA 3O8UA 3VNTA 3E88A 4LOOA 2SRCA 4YHFA 4D2RA 4O7NA 3MJ1A 3F66A 4M69A 5E7RA 5KMOA 4ZEGA 4BCQA 2CKQA 4XS2A 4XBRA 2C3JA 3L9PA 5HI2A 3NPCA 5IDNA 4CFUA 4FV7A 4BIBA 4N70A 3QQFA 2W4KA 3ULIA 2CKEA 2VX3A 4FK3A 5E92A 3I79A 4R3PA 1QPEA 3KXHA 5IEVA 5KKRB 2W9ZB 3JXWA 3FWQA 4ZY5A 3LJ2A 4FV2A 3I5NA 3R8ZA 2WQNA 4AT5A 2EUFB 3HUBA 4RLLA 3SDJA 5BVFA 4CKIA 2EWAA 4DEIA 5HVJA 1H1SA 4QPAA 4YJPA 4FT9A 4KSQA 4CYIA 2E9PA 3MFTA 4O7RA 4DFBA 2IVUA 1YDTE 3SKCA 3MVJA 4OLIA 3F7ZA 5KBRA 4PDOA 2ESMA 2DS1A 5JK3A 2RF9A 4FOCA 1F5QA 4O7YA 2XJ1A 4FG7A 4FTTA 1OL7A 3JVSA 2BRNA 1W0XC 4PTEA 1G3NA 4QP8A 4Z9LA 1Z5MA 2UZDA 3GB2A 3NAYA 4NKAA 4CQGA 5BUIA 3KRXA 2GDOA 1UA2A 3ZMMA 4NWMA 4TYHB 5HD7A 3DBDA 2W0JA 3MI9A 2X0GA 4AE9A 4AW5A 4ANBA 2PVLA 2CNVA 5KNJA 2VGPA 4PTCA 4L7FA 3ATTA 4ALVA 2W96B 5AP0A 4S34A 3WE4A 4AGCA 4F1TA 4O82A 4C0TA 4KKGA 4R5SA 2R3OA 3VS3A 3OOGA 4G5PA 4RZVA 3PYYA 1JSTA 3HGKA 2B1PA 2CDZA 4QQ5A 4YSMA 3A99A 4U43A 5CI7A 5E8YA 1NVQA 4DEEA 4CG8A 2UW4A 3NYOA 5M44A 1ZOEA 3LFCA 4R5YA 2BILB 3LM5A 1PY5A 3A8XA 3G5DA 4ZZMA 4AGDA 4C58A 2C30A 1T45A 3CC6A 3TEIA 3DKGA 5FBOA 3R02A 3QKMA 3OD6X 3FMDA 4CCUA 4BDJA 4IBMA 5HCXA 3QLGA 3G15A 3RK9A 2BZKB 3QALE 3EMGA 1LUFA 3TNWA 2OFVA 2P55A 4FKOA 5AA8A 3F6XA 1QPDA 5JEBA 2QO7A 3FSFA 2NNWB 3KMWA 5K9IA 3AQVA 5CZIA 5JSMA 3A7HA 4DGLC 4LV5A 1SNXA 1QPCA 4A7CA 1JKTA 3OP5A 4DGMA 2P2HA 1JVPP 4AP7A 4AZWA 1STCE 2HELA 2W1ZA 3FKNA 3PIYA 3PY1A 3Q6UA 3Q9YA 4AZEA 4IB3A 4GUEA 1W84A 4C61A 2QR7A 3PVUA 4PUZA 5L8KA 5CSHA 2X8DA 4F9BA 2OF2A 4RMZA 5FG8A 4C2WA 4HGEA 5EH0A 5ICPA 3OCSA 4PTGA 2WTDA 5HX8A 1Y8YA 3E63A 3IOKA 3QZIA 5CEOA 1IR3A 2XUUA 3VO3A 4EOIA 4MF1A 1ZARA 2GPHA 4PL4A 3I5ZA 3PPKA 3Q04A 4YR8A 3C13A 4FSRA 4KSPA 1GZNA 3UE4A 1PRYA 4HZSA 5BVEA 2ZV2A 4FZ7A 4HYSA 5M56A 2JIUA 4J96A 2VTAA 2W05A 4D9UA 1JKSA 3D7ZA 4ZK5A 2VTSA 4S33A 1DS5A 3BGPA 4MH7A 4RJ7A 4DFXE 2ZMDA 5HU9A 4GG5A 4JRVA 1J1CA 4MKCA 4E8AA 2WMQA 4F6SA 4GG7A 4M8TA 4ENXA 3NNUA 2A2AA 4UZHA 3QZGA 3P79A 5C8KA 3QTUA 3R9HA 4QMLA 4HGSA 4FUYA 4F4PA 1MRYA 2RFDA 1L8TA 1YHWA 3ZHPC 4L3PA 4M3QA 5CEQA 2VWYA 4O2ZA 5LVOA 4L3JA 3EQCA 5FEEA 4FL3A 2YM7A 5ANDA 3LM0A 4EYMA 2JFMA 4TT7A 5I3OA 3MN3A 4YZMA 4BWKA 4UMQA 1XH5A 3ALNA 4OUCA 2BCJA 4JIKA 3NW7A 3CBLA 4S32A 3O7LB 4ZY4A 4NT4A 1XH8A 2QLUA 3FJQE 2BHHA 2F9GA 4MWIA 3IECA 3TL8A 3FHIA 2JAMA 4MQ2A 3PG3A 4BCNA 3EN6A 2EVAA 5FM2A 2CLXA 5C4LA 5DOSA 3UYTA 5HICA 5GNKA 4A4OA 3QX4A 5H3QA 2QHNA 4HNIA 4DE4A 3L1SA 4UBAA 3WILA 5J9ZA 4M0YA 4CFMA 4FEUA 3UMXA 1YHVA 4CFFA 2Y6OA 1SVHA 4L01A 3ELJA 3UO5A 2YZAA 3COIA 3LQ8A 1PXPA 3NS9A 4TNBA 4V04A 4BTMA 3MW1A 1LEWA 2OK1A 4AW0A 3HMIA 4RIXB 4BCGA 3OZ6A 3SW4A 2VWVA 2VTNA 4RJ8A 2H34A 2XRUA 4UEUA 1YXVA 3R7EA 4HCVA 3THBA 3CGFA 2E2BA 4LMNA 4F63A 4QTEA 2R3GA 4G34A 4IDTA 2XNBA 5BNJA 2BR1A 3BHUA 4RJ5A 1IAHA 4FKRA 4JL9A 4ERWA 1K2PA 3QCSA 3QZFA 4D4RA 1MUOA 2VU3A 3C51A 2OJJA 4F0IA 3KN6A 4FIGA 5IA5A 3BE2A 1JSVA 3QTWA 4YJOA 2XNOA 5CF4A 4FV1A 3S0OA 2VWZA 1OL2A 1YDRE 3F3UA 4R1YA 4FVRA 1R78A 4FT7A 4QMPA 3TM0A 5D10A 2PU8A 2HZIA 4GIIA 3MPTA 3HV5A 3OWJA 3CQWA 4YZ9A 1YXXA 4O91A 2YIWA 4UN0C 1J7LA 4O86A 5LMAA 3KF4A 2YM8A 3EQFA 4FV3A 3DDPA 1H1RA 3VW6A 2JDTA 2XNPA 4Y72A 3R73A 4BC6A 2HOGA 3NEWA 4MD9E 4ZLOA 2UW3A 1OL6A 3K3JA 4N4SA 4QYEA 5HG8A 3R8VA 5IQIA 2YA9A 2VX1A 1KE6A 4M84A 3KRRA 3WE8A 1VJYA 4Q5HA 2ITTA 3V8WA 4IC8A 4K0YA 2G01A 2OJFE 4RVKA 4U79A 3SV0A 4YO6A 3VUTA 4F08A 2Z7QA 3SX9A 5JZJA 1REKA 4MXZA 4YTFA 4WBOA 2C6OA 4GH2A 4JRNA 4EH7A 3NNXA 3QGYA 5I3RA 3CPBA 2DWBA 2XA4A 4MTAA 3LFBA 4C4GA 1H0VA 2WOTA 2BMCA 5EI8A 1ZAOA 1ZRZA 2CCHA 4F7SA 1J7IA 5HE0A 3UQFA 3W1FA 4CG9A 3ORNA 4Z16A 3IQ7A 1J7UA 5G6VA 1U54B 2XEYA 3EN7A 2JFLA 3G9LX 4NKSA 4GYGA 4XG2A 4ARKA 5DPVA 3V3VA 3LXLA 2PUPA 5AP1A 4ZTRA 4F70A 2UZNA 1GAGA 2FSLX 3Q4UA 3JY9A 3DNEA 2QVSE 3Q53A 3VRYA 2B52A 2QOHA 3FQHA 2GFSA 3OW3A 4FT3A 1TQIA 1YRPA 4RJ6A 1OPJA 5HNGA 3ZLYA 4E1ZA 4R8QA 3GOPA 4HW7A 2QC6A 5GJDA 3WZJA 5CSPA 3QWJA 3I6WA 4YJRA 2QU5A 1OL1A 1H28A 1YWRA 4RQVA 3LQ5A 2QR8A 3ZRKA 3IDPA 4IAZA 3LJ0A 3PRIA 4CLIA 4FBXA 2CMWA 4B8MA 1VEBA 5T6KA 3ZO4A 4QQJA 3ZM9A 3WZEA 2F2CB 2OH4A 4QP4A 4I24A 2E9NA 2IVSA 3KXXA 3F7WA 4RIOA 4QMOA 4YNOA 1H25A 3VBQA 5HU3A 2B7AA 3LJ1A 2HYYA 2OSCA 3AMYA 3FHRA 2W1GA 2OG8A 2PHKA 2UW5A 3FQEA 3A7JA 4LGDA 4C4IA 3M1SA 3MB7A 2I6LA 4LGGA 4BBMA 4HOKA 2ITOA 3BBWA 3F3TA 4FSYA 4RX8A 4HPTE 3OOMA 4WRGA 4PDSA 3R01A 1P2AA 3LLTA 4G5JA 3TIZA 4U5JA 3HRFA 4A9UA 4BDCA 2YACA 3RM6A 3PE1A 4AU8A 2BROA 2PE0A 4U9AA 3JS2A 4D0WA 3ZUVA 4JDHA 1H24A 2HW6A 2WTKC 3KXMA 4BRXA 5IU2A 2C47A 4X3JA 3ORIA 2CSNA 3OWLA 1R0EA 4FKQA 4O7SA 5CF8A 3D7TB 4S30A 3TJCA 2QOQA 1WBTA 2BFYA 5DFPA 4NTTA 3W2PA 5CAQA 4AN3A 2PUIA 5EHYA 4C62A 4EJ7A 1FMOE 3D4QA 1K3AA 4DFLA 4UB7A 3TJDA 2BRHA 4JQ8A 4BTKA 5J7BA 5HVKA 3GCUA 3NUAA 4PDYA 2HZ0A 4FKSA 3VUIA 1JAMA 4D2TA 2W1HA 2VO0A 3QRIA 3EFKA 4BDAA 3FBVA 4IJPA 4EUTA 4IB0A 2BVAA 3QTSA 2QI8A 5IQGA 2QURA 4I23A 2XYUA 5LARA 3N51A 4MK0A 3ET7A 3ORXA 4CCBA 5AP6A 4MXOA 2UZUE 5AA9A 5IKWA 3D5VA 2Z7SA 5L8JA 4ALUA 4XLIA 4LL5A 4QMWA 4Q5EA 4QD6A 2PUUA 3VW8A 4BHZA 3TDVA 2PMNX 5JN2A 3QCXA 4IANA 5AUYA 2PVMA 1O6YA 5D1JA 4I0TA 4M12A 4YJSA 3RWQA 4LMUA 5EM5A 4ZS4A 3MPMA 3E8CA 5DN3A 3HA6A 1E1VA 4IZ5A 3W18A 5CXZA 5I9VA 2WAJA 3FY0A 3L8SA 4ZLYA 3DK7A 5ETFA 2CGWA 4RWLA 2I0HA 2VO7A 3UNZA 4YUQA 3ALOA 4O0YA 2WELA 5FXSA 4RA4A 4Y5HA 2HK5A 1YWVA 4UXLA 3WIKA 5CXHA 3E8EA 2A0CX 4W9XA 3P9JA 4HNFA 2GTMA 1BKXA 1H8FA 4ZXTA 4BIEA 2GS2A 3HECA 3OXZA 5GIOE 5JT2A 3EOCA 4AE6A 1YXUA 2IG7A 4W4WA 4A07A 3UIMA 3DB8A 2QONA 3A4OX 2PZPA 3W55A 3FMNA 1RW8A 3BE9A 2PMLX 2QOLA 4ZSGA 2BAKA 5DVRA 4E4LA 3R8PA 4KINA 5AM7A 3ITZA 3W10A 3U6IA 3BHTA 4WG4A 2X6DA 3W2RA 5A6NA 3NCZA 3PXQA 3NCGA 3DA6A 5CAOA 3UVPA 2OJGA 5ANIA 2O63A 3HV4A 4EH3A 4GUBA 3O7LD 3SXRA 3PFQA 3I4BA 3NMUF 2WMVA 4Z55A 5IQEA 3MH2A 3EKKA 4FTJA 5HE2A 3ZOSA 5B7VA 5JQ8A 3U4UA 3UOLA 3CY3A 4C36A 2OXXA 2W1EA 3A7GA 4IEBA 4QP7A 4Y83A 3WZKA 5JGDA 2YCRA 4WRSA 4YJNA 3R1SA 1Q24A 3V5TA 3WI6A 3QFVA 4YGAA 5I0BA 4DF3A 4JG7A 4UWCA 2XP2A 2GNFA 3E3PA 1DM2A 3SXFA 4C4JA 4XNEA 4EJNA 1KE7A 5DEYA 3HKOA 3FMJA 1M17A 4IZ7A 4LG4A 2OLCA 5T68A 5KZIA 4CQEA 3WYXA 3HRBA 3LFFA 3MTLA 1Q61A 3FMLA 3PXKA 4G6NA 4HPUE 1FBNA 4QO9A 2YCSA 4E3CA 4C4EA 2JKMA 3ZCLA 4RA5A 3ZZWA 4W8EA 2VZ6A 2EU9A 4Z3VA 3I81A 1SZMA 5KE0A 3ZUUA 4HVDA 4NM3A 4FZFB 5I9UA 3ZONA 5K5NA 1IG1A 5HCYA 5KCVA 4AACA 3P5KA 2Y4IC 5L6WL 3D83A 3AC4A 4E26A 2HY81 2XCHA 2WB8A 3C5UA 5B0XA 1GZKA 3FL5A 4IWOA 5HD4A 1O6LA 5CNOA 5F20A 2XK6A 5M4CA 2XNNA 3F3WA 2X4FA 2ETRA 5E8TA 4QTDA 2UVZA 4YLJA 4ZSJA 3ID6C 4ORKA 3I0QA 1YOMA 3GU6A 3VS0A 2WMAA 4J53A 5FTQA 3ODZX 4FVPA 3SAYA 5FUTA 1BX6A 1JWHA 4YTHA 3UTOA 3LW0A 5BUEA 4Y46A 4ZS0A 5AR7A 1XKKA 5FD2A 2HZNA 3NWWA 4MWHA 2GMXA 2F4JA 3BYVA 3PWDA 4IVBA 4KD1A 5EM7A 4LRMA 4QP6A 5FQDC 4D2VA 2I0EA 2OZOA 2PZ5A 4BDHA 1OITA 3P86A 4NSTA 2CGUA 3FKOA 3JUHA 3AD4A 1ZMVA 1SMHA 2C6KA 2UW6A 3KRJA 4ANSA 5BX0A 4IZAA 1PW2A 3AC3A 3S4QA 3FLNC 4QQCA 2ITYA 4ITHA 3SXSA 3WOWA 5I9ZA 4FNYA 2FUMA 3DLSA 4HGLA 5AR2A 2VTIA 4Y8DA 1UVRA 5LMBA 3I7CA 3DAJA 4XUFA 3TTIA 3COHA 4H39A 3PJ8A 2JBPA 2WNTA 5DT4A 1V1KA 3FYKX 3G90X 5IQCA 3DZQA 3E3BX 4FTCA 4NEUA 1XH7A 4D28A 3UZRA 4CMUA 3LFSA 4BCFA 5AM6A 5IEYA 1G8SA 1IAJA 3FI4A 3Q5IA 2FGIA 4IB1A 5G1XA 4IAIA 3GP0A 4IE9A 1ZOGA 4GKHA 2W17A 3AT3A 2VO3A 4WG3A 4QMMA 2VNWA 5T3QA 3U87A 5L6OA 4L6QA 2H9VA 5TR6A 2IZUA 2JDOA 3OEFX 4YC3A 3EL8A 3SLSA 5K4IA 1ND4A 4O7WA 2PVJA 5HX6A 4FV4A 2IPXA 5AP7A 3MFRA 3UOJA 3ZO1A 5CSWA 5AV2A 3HAMA 5EYKA 2VTJA 2IZSA 5KX8A 5EDPA 3G6GA 5M08A 4IXPA 3MJ2A 3BI6A 2J0LA 1KSWA 3PXFA 4FUXA 4EQUA 3CSVA 5DWRA 4FL2A 3HV3A 5EQEA 1WVYA 2B9IA 3BPRA 3H0ZA 3FZSA 4MX9A 4AT4A 4FICA 4EZ3A 4TL0A 3PWYA 3NVKI 5TT7A 1OPKA 3TKIA 4WIHA 4WO5A 4PP9A 1DI8A 1Y6BA 3VIDA 2B54A 1ZMUA 4XX9A 5FEQA 2YHVA 3O2MA 4RJ3A 5DH3A 3HMOA 3LXNA 2ITZA 3WZUA 2G9XA 1PXJA 2OZAB 2V0DA 3QX2A 5KKRC 5KUPA 5AP3A 5M06A 3M2WA 4YHTA 3RHKA 2CNQA 4GFOA 4CFVA 3D94A 5M4IA 4IJ9A 2ZM4A 3Q2MA 4QT1A 5LWNA 4C3FA 3HDMA 4QQTA 2WMUA 4I6FA 3GCPA 1Q41A 2WGJA 4OTGA 4EI4A 4OW8A 1KWPA 2ERZE 5I9WA 2C5VA 5FBNC 3ZUTA 4LUDA 2GQSA 4NJDA 4BYJA 4DH3A 2EXEA 4NZWB 4MYGA 3R21A 1A9UA 3QA0A 5HHWA 2J90A 1OL5A 2WQMA 2XJ2A 3VBXA 3E7VA 2C6MA 2FH9A 4GFGA 4DG3E 3PIZA 5AV1A 4GMYA 1I09A 1H01A 3AXWA 4RC2A 4TXCA 3NYVA 2IVTA 2WU7A 4UWYA 3FV8A 5ETIA 4BDFA 2PULA 4FKWA 3W8QA 4FEVA 3R9OA 4FGBA 4QMNA 3OTUA 2XF0A 1H08A 4FKPA 4XG7A 3MS9A 4YJTA 5AAFA 3AGMA 4Y85A 1WBOA 3A61A 3C4FA 4O0UA 3SOAA 3F2RA 2CKOA 3W8LA 2UW7A 3CGOA 3RNYA 3TZ7A 2RGPA 3K3IA 4C35A 1KV2A 1AD5A 3POOA 4YPDA 5LMKA 2I0YA 3R7GA 4EC9A 2BAQA 4PPAA 3NRMA 2XKEA 4I94A 3GFWA 3IK3A 3KL8A 4U3YA 5IZFA 1ZZ2A 3FLYA 4K1BA 5TOZA 4BGHA 4OAUC 1V0BA 3DGKA 4G17A 5CI6A 2QODA 3CKXA 4M68A 4XV3A 2HZ4A 5BQ0A 4CD0A 3NIEA 4DT9A 2OW3A 5KMLA 3SVVA 3VUHA 3WZDA 4YC8A 5FP5A 1Q8YA 5L2TA 4K2RA 5CWZA 1XH4A 3R71A 3UP7A 1UV5A 4UV0A 3RWPA 4DAWA 3KULA 3LAUA 3VF9A 2X9EA 1QMZA 4EHZA 4RLKA 3T3UA 3R8LA 4X2GA 3COKA 4G9RA 3TXOA 4BDIA 4U3ZA 5JGBA 1OKWA 3C9WA 4U45A 3GC0A 1BI8A 3RINA 3UIUA 2XK3A 4AZTA 4X21A 5CEIA 5HBHA 1UU9A 3DTWA 2Q0NA 4M69B 4V01A 3UVRA 2C6TA 4BICA 1SM2A 2YN8A 3QYZA 3PG1A 3UIBA 3P08A 3S1HA 4TWPA 5IG1A 4R6VA 1H1WA 1U5RA 4QPSA 3A2CA 1B38A 3KVXA 5FGKA 4D2PA 4J8NA 2WQOA 4LOQA 3U8WA 3FMEA 3MBLA 4KIPA 4ZOGA 2KTYA 4NYEA 4RZWA 1IEPA 4X2KA 3VBTA 3O50A 5CENA 4JT3A 4BKZA 4NFMA 2H6DA 2NP8A 3SW7A 2C3LA 2GNHA 4AW2A 5FRIA 3TZ8A 5HG5A 5AR3A 3ZSIA 1A06A 2PVFA 3TWJA 3F5PA 4K18A 2HWPA 2BKKA 1R39A 2CGXA 1H0WA 3GEQA 3MIAA 5DT0A 3VJNA 2QOFA 5K0XA 3UNJA 5DBXA 5BVDA 2UW9A 4P5ZA 4MD7E 3DXPA 3KCFA 4L43A 3TNIA 4F1MA 4TYEA 4DGNA 4DGGA 2YDIA 4IDVA 2BAJA 2VTOA 2X2MA 1MQBA 4WKQA 4CKJA 5M4FA 4FZ6A 4AGWA 4IAFA 4AQCA 5M57A 1UNGA 4NW5A 3GXLA 2PMIA 2YM6A 3HUCA 3OWKA 3D7TA 3E8NA 4YTIA 3ZDUA 3DBCA 4NW6A 2X7OA 1FOTA 3ORTA 5E8SA 3B8RA 3TV6A 3ULZA 5ACKA 2YERA 3NR9A 2VTHA 3R7IA 3TN8A 4JDJA 3V8SA 4FA2A 1XWSA 4UMTA 4ITJA 4YPSA 4BGGA 4DFUA 4I41A 4Y5QA 5AUTA 2ITPA 2WMSA 4O22A 5EKNA 4G16A 3P78A 3H4JA 3E92A 5AADA 1R3CA 2ZB0A 4NJ3A 4AWIA 4L46A 4DHFA 4CZYB 2WHBA 3V5JA 4F0FA 4MBLA 5IH4A 4WD5A 4DINA 1J91A 3FI3A 2PWLA 2ETKA 2J9MA 1AGWA 1ZYCA 5IPJA 5CS6A 4MXCA 3RPRA 1Q5KA 3DOGA 3FMKA 4ACGA 2PK9A 1IRKA 4ZJIA 3WF8A 3BYSA 1VR2A 4X3FB 4BCOA 5J5SA 4FV0A 5HE1A 4EH6A 1ATPE 3GC8A 1WBNA 5KHWA 3C5IA 3WYYA 4BTJA 2V5QA 1Q8WA 4RQKA 5EDQA 3W32A 4IIRA 5JFXA 2R3LA 1APME 4XG6A 3AD5A 3R7UA 1GNGA 2XIXA 3G6HA 1P4OA 4XP0A 2J6MA 4A4XA 4F64A 3H9RA 5H9BA 2XK8A 3QQHA 3SA0A 1XH9A 2JAVA 3EH9A 3O71A 5AUUA 4C33A 5IA4A 4BHNA 2GNGA 3D14A 4FTRA 1OMWA 4XYFA 5A54A 4FZDB 4QTCA 5DIAA 3D5XA 5C4KA 4FF8A 2YIRA 5E9EA 4AXAA 3SRVA 2BTSA 3P23A 5E91A 5AV4A 3ZS5A 3QQUA 4AA5A 4DG2E 5LVPA 2W9FB 2W5HA 4PL3A 4L9IA 2ITXA 3DJ7A 2P2IA 3RNIA 4C2VA 4RPVA 2B9FA 1WBPA 3KN5A 4FNXA 2YM4A 4AAAA 4EL9A 3S00A 5FTGA 2O3PA 3QHWA 3QQGA 3DDQA 3OS3A 2CJMA 3PLSA 4FYOA 4Q9SA 3V5WA 4O21A 3QC4A 2PZIA 3BYOA 4DTBA 3KC3A 3GU4A 5IH6A 1ZXEA 5CU2A 5HESA 2UV2A 1MRUA 4E4MA 3IGGA 4PNIA 1UU8A 2YCQA 4FT0A 2P3GX 4G3GA 4R77A 4TRLA 3QD4A 4O1OA 4BL1A 4EYJA 3QTQA 4IADA 1OGUA 2DQ7X 3RALA 4O81A 3PSCA 2UW0A 3PA5A 5CANA 5ANOA 2VO6A 3LVPA 4IB5A 3R7YA 4RC4A 3UPXA 4GK3A 4EH9A 4NM5A 4OTFA 4CYJA 3EFJA 4D1XA 3LMGA 5AP2A 2O2UA 4IW0A 3NUYA 1B39A 1JLUE 4ID7A 3ZLXA 4ZTSA 5CSXA 3R8MA 2X81A 5LWMA 3QWKA 3L8VA 3ZEPA 4EH4A 2R3HA 3AC1A 3MV5A 1QCFA 2IWIA 3SQQA 2C1BA 2GTNA 3DLZA 4F9CA 4BKJA 5E8XA 2YABA 4BGQA 1H26A 5CF6A 5CYIA 3F3ZA 4FR4A 5L2QA 4H05A 2PUNA 2ZOQA 4CNHA 2Y0AA 1ZWSA 4F6UA 3UNKA 1W8CA 4OTDA 3DJ6A 3N4TA 2ITNA 3F69A 4FZAB 3PP1A 4FKTA 2G2IA 4DT8A 5IQBA 1JQHA 3IW6A 4DYMA 2V22A 2WKMA 4I6HA 3JVRA 4K6ZA 1RDQE 4RFYA 3KKVA 2RFNA 5IUIA 4EH2A 3NNWA 4EWHA 3DFCB 3EQHA 2JITA 5HO8A 4RGJA 3LFDA 3TUCA 2BRMA 3RAWA 3BV3A 2VWUA 2R3IA 3ZO2A 1BLXA 5HLPA 3W16A 5CU4A 4A4LA 5EHOA 3FLQA 1H4LA 2I7QA 4A9SA 4ACCA 3ZFXA 2WMWA 1NA7A 5JMSA 4B8LA 4NCTC 4XRLA 4PWNA 3KXGA 3H3CA 3PPJA 3DAEA 4OT6A 4GL9A 4I0RA 1CKPA 3W2SA 3GQIA 4FKGA 2Q83A 4KIKB 1PMVA 3KULB 4JBOA 2O5KA 1W98A 2IW8A 2OGVA 3PPZA 2H8HA 1GIIA 2QOOA 3AOXA 3II5A 4FTLA 2WD1A 3Q96A 2QQ7A 4AFJA 3QYWA 4O7TA 4OBOA 4RWJA 5ETCA 2F7XE 3IDBA 4PMMA 2WTWA 2XB7A 4ZJJA 2GQRA 3ZM4A 4L45A 4EHGA 4OTIA 2OIBA 4NK9A 1U59A 5GJGA 2QOKA 4QP2A 3PP0A 3QL8A 3N9XA 1YKRA 1ZY4A 4QYYA 3L9MA 4KKEA 5AX9A 1ERKA 4PPBA 5J95A 4O84A 4BDDA 4RJ4A 4APCA 4DFYA 5J9LA 3OCGA 3KRLA 1GJOA 4M67A 2C6LA 1OPLA 3GCSA 4DTKA 4FVQA 1WVXA 3B8QA 3I7BA 3LIJA 3MA6A 3VBWA 4EQCA 3NDMA 5AUWA 3W2CA 4AZSA 2ITVA 2J50A 4G3EA 5CAPA 5C9CA 2XEZA 3PTGA 4QMUA 4W8DA 4R3CA 1PXOA 2F7EE 3OT3A 5DRDA 3UDBA 1OIRA 3ROYA 1BL7A 4ENYA 3GU5A 4YMJA 4CRLA 4HZRA 4D4YA 4J52A 3PJ1A 4L3LA 4F9AA 4M13A 3FZOA 3OT8A 5AR4A 1VZOA 1JOWB 1IA8A 4GCJA 4K11A 2XBJA 3HP5A 2OZAA 4CV9A 5AR8A 2BRGA 3R63A 3DB6A 4H3PA 2O65A 1Q62A 3DKOA 4IC7A 4K33A 1U46A 2GSFA 3EKNA 2C5OA 3OVVA 3UG2A 4BCKA 3MTFA 5GIPE 3FQSA 3OBJA 4GYIA 2HXLA 4QYFA 4O0VA 4Z7HA 2XNGA 4IWDA 3UPZA 1U5QA 2W1DA 5HG7A 5GZAA 4XJ0A 4RX5A 3TV4A 2G15A 3ORPA 4ZY6A 3KMUA 4C8BA 2JLDA 4QPMA 3UO6A 5EQPA 3R8UA 5CASA 3V8TA 2HCKA 3UMWA 3R83A 3VBYA 4R7HA 1XBBA 2JBOA 3D2KA 3VWAA 1QL6A 2ZVAA 1NY3A 3BLRA 3QHRA 3QQLA 4U80A 5IF1A 3E7OA 4JQEA 2ZAZA 3RAKA 4QYHA 3BQRA 5FXQA 5C1QB 4KWPA 4QMZA 2VD5A 2I1MA 5FTOA 3MVHA 3DK6A 1RJBA 1M2RA 1XO2B 1FVRA 4H3BA 3PA3A 4O2PA 3L8PA 4MBJA 3UOHA 3VN9A 1PJKA 2IVVA 2YISA 4HJOA 1OIYA 2XVDA 2XK7A 4QP9A 3O8PA 4DH7A 3U6JA 4CLJA 3FI8A 1ZZLA 4AN2A 4AG8A 5LMKC 3CR0A 2C6IA 1J1BA 4M66A 3GFEA 4WA9A 3RAHA 5A6OA 3U51A 4QNYA 3VVHA 2NRUA 4C59A 4KIQA 3C1XA 4KS7A 4I4FA 2NPQA 3KEXA 4BVUA 3QAME 4ZSAA 3AD6A 4FNWA 5L8LA 1IA9A 5D7VA 3F5UA 4EUUA 3TKHA 4J1RA 4G6OA 4RFMA 3BKBA 3PZHA 3QQKA 4O6LA 3GOKA 2XK4A 4L44A 2C0IA 2QOCA 3SRVB 4EK6A 3AG9A 2JIVA 2BUJA 5CEPA 3PZEA 1TVOA 3ORMA 4JX7A 3TV7A 5H8EA 2E9UA 4GEOA 2X2KA 3KK9A 5M07A 5HIEA 5CNNA 4EK5A 3GCVA 4CTCA 3JYAA 5IUGA 1FVVA 1URWA 4Y95A 4U7ZA 1W7HA 3BEAA 4B7TA 2YAAA 2UZLA 5EYDA 5LOHA 3EFWA 4FV6A 4QOXA 4F6WA 3U54A 2PPQA 3RK5A 1TQPA 4BI1A 4O7LA 4OBPA 4E4NA 4DA5A 1BYGA 1WMKA 3NYXA 5DT3A 4BCPA 4TKSA 4USEA 2C0TA 3UODA 4N0SA 2HW7A 4AX8A 4LOPA 2YWPA 5BVNA 2KULA 3KU2A 1QPJA 2VWWA 5FWKK 3AT2A 3BX5A 5IEXA 2Q0BA 3QTXA 5DLSA 1L3RE 2WMBA 4CFNA 3EHAA 4JBPA 3CKWA 3L8XA 4I21A 4DCAA 1O6KA 2ZM3A 5EM6A 4DITA 2C3KA 2BDWA 3BHYA 3V6SA 4RSSA 1XQZA 5D7AA 3T9IA 3GI3A 3MDYA 3LFQA 4D2WA 4EKLA 4G3FA 5LQFA 4YU2A 1KUTA 3EFLA 3ZBXA 4E20A 4FKLA 2UW8A 3RGFA 3K2LA 2B9HA 2V55A 4FKJA 5HBJA 3N4UA 3HYHA 3UZPA 4RIWA 3FE3A 4B99A 5LJJA 5HTBA 2IW6A 3CS9A 3F82A 3BWFA 2JKQA 4JNWA 4MNEB 4QNAA 4H58A 3HLLA 3PVGA 3F88A 1F3MC 3FPQA 3R04A 3FPMA 1GIHA 4IH8A 2UUEA 4BBEA 5CQUA 2P4IA 3Q9WA 4HCTA 4I20A 3MVMA 3RPYA 4A9RA 3CP9A 4AT3A 4GFMA 2W5BA 4K9YA 2JDRA 2BDFA 2WMTA 4UY9A 4DH5A 4UX9A 3UP2A 3LXPA 1DI9A 3IDCA 3QQJA 4OT5A 3VQHA 3GCQA 5CQWA 3RZBA 3PE2A 4V05A 4F65A 1S9JA 5E1SA 2J5FA 2C6EA 1KV1A 4QYGA 2OJ9A 5E8WA 5KO1A 3IKAA 2GQGA 3BGQA 3IOPA 2YFXA 3DBEA 4F7JA 5I9YA 3MY5A 1W82A 3UO4A 2NRYA 3E5AA 2YEXA 5L3AA 4UYAA 1Z57A 3DK3A 4JAJA 3RJCA 5AIRA 3HVCA 3BRBA 5BYYA 3DNDA 4TYIA 4EWQA 3DQXA 2VAGA 2J7TA 3KK8A 4L7SA 4A06A 3CE3A 4I6BA 3ZU7A 3FXWA 2A4LA 3KB7A 3OF0A 1Q8ZA 2C5XA 1PYEA 4A9TA 4XV9A 2OIDA 2GHLA 3KRWA 4KABA 4LGHA 2FSMX 4IX4A 2WTJA 5HTIA 5CF5A 4XP3A 1Q3DA 1CKIA 5KMJA 5IQAA 4RRVA 1Y8GA 2IN6A 3HV6A 2R2PA 4YC6A 1K9AA 4FTMA 5AX3A 3HNGA 1GY3A 3QRKA 4O38A 5K4JA 4ASZA 1FGIA 1FQ1B 2VNYA 1P4FA 3E64A 3A62A 3G51A 3LFNA 4FSMA 4PY1A 5LVLA 4BKYA 4XRJA 5TKDA 3HX4A 1XHAA 4ZTNA 5EKOA 5BVOA 2VWIA 3FZPA 4EBVA 3PJ2A 4NIFB 3Q9XA 2R0IA 2C6DA 3OWPA 4QMQA 2WEVA 3GT8A 4HYIA 4WUAA 4UZDA 4FG9A 3OCBA 4D55A 5HLNA 4JG8A 5HTCA 3PLAE 1OKVA 3C0GA 2VWBA 5HNBA 3I1AA 2G2HA 4MF0A 5IA3A 4IVAA 5AV3A 4HVGA 4YURA 4FKUA 4R1VA 4ANQA 1Y91A 4YZDA 3R9NA 4BDKA 4D4SA 2CPKE 5BYLA 3F5GA 3EQDA 4O0SA 4DBNA 4CGAA 3ODYX 4XV2A 4AZVA 1WBWA 1MQ4A 2C68A 4KAOA 3EN4A 4RBLA 5FEDA 2ZB1A 4ZZOA 3PDTA 2XIKA 2JGZA 2QCSA 2BTRA 4CZUA 4FSTA 4DH8A 2RL5A 2HY0A 3QCYA 2C0OA 4DEBA 3OHTA 2B53A 3KREA 4IM2A 3D0EA 3VC4A 3PA4A 3F5XA 4G3DA 3DBQA 3NNVA 3OCTA 5BYZA 2OJIA 4YBJA 3BBTB 3OMVA 3ZXZA 2X8IA 4WHZA 4L53A 5DNRA 2XS0A 2ZMCA 4U40A 4RIWB 3O0GA 4U81A 3ZYAA 4RVLA 4S31A 1FINA 2R3NA 4GV1A 5IA1A 4I6QA 4X7QA 3FLWA 4F09A 4TN6A 3D5UA 5EOLA 3GC7A 4AOJA 3QRTA 3VS1A 4UMRA 4GT4A 2EXMA 5IDPA 5CALA 2PVKA 2WZJA 2YJRA 4WG5A 4O7VA 3Q3BA 1P5EA 5EYMA 3P0MA 3NGAA 2ITWA 4CRSA 3DKCA 1Q3WA 4J99A 4D1SA 2BZIB 3MWUA 2JDSA 2WTCA 5E8ZA 4RIXA 5CT7A 2BALA 3PXRA 4BR3A 4QTBA 4EHVA 4N6YA 4FTOA 2AC5A 4G6LA 3ZFYA 5A4CA 3FUPA 4I5MA 4MHAA 3P1AA 5J1WA 2C5NA 3QU0A 5HQ0A 1F0QA 5L4QA 2GNJA 4YZNA 2J0JA 4I1ZA 4J95A 4TW9A 3IO7A 1R1WA 3OXIA 4DTAA 4J7BA 3BZ3A 5AUVA 4AZFA 2XNMA 3QUDA 4DC2A 2PE2A 4HCUA 4EOSA 3I60A 3KQ7A 1ZYDA 4XBUA 1V0OA 1OUKA 4ACMA 2X1NA 1M14A 2BHEA 2FSOX 1XBCA 2ITQA 2RFSA 3AC8A 4GU9A 4KBCA 5EI2A 4DG0E 2XH5A 5J79A 4KB8A 5J87A 2ITUA 3R28A 4O0RA 4E6DA 2R4BA 3P7AA 1FGKA 1YDSE 2WQBA 4FV9A 4TWNA 5AIKA 5CT0A 5CX9A 4YSJA 4M7IA 5HG9A 3AC2A 4YNEA 3MFUA 3QD2B 3WARA 5HORA 3GU8A 3EQIA 3VULA 4WSQA 4RC3A 5D12A 4JAIA 4FEQA 3SG9A 3IW8A 2YAKA 4XG4A 5EHLA 3DV3A 3FC1X 4D0XA 1Q99A 3M11A 5M53A 2B55A 2PY3A 4P2KA 3U6HA 2OF4A 4C7TA 1R0PA 2W1IA 4JG6A 1VYZA 4JX3A 3DAKA 3MH1A 2YZLA 2J5EA 3K54A 5F4NA 3A7FA 4FNZA 5IMEA 3FZTA 3QD3A 4BCJA 4FTIA 4EEVA 5M55A 3BHHA 2X7FA 4TNDA 3HEGA 3RI1A 4F7LA 3N4VA 3GENA 3KA0A 3B2WA 3T3VA 5IUHA 4ZMFA 3EZVA 3KGAA 2YIQA 4X6RA 5HZNA 2PVHA 2XIYA 5I5ZA 4I0SA 3VS7A 3OBGA 4USDA 5HO7A 2W1CA 3EQGA 4KNBA 1WAKA 2ONLC 4KIOA 3WF9A 4DEGA 3BU6A 5LXMA 4I5PA 3MH3A 4CKRA 4N6ZA 4PV0A 4J8MA 1GZOA 4PMSA 4HYHA 4X2JA 2VTQA 1JNKA 3LKMA 4K77A 3TT0A 4BFMA 4RIYB 2YLEA 2UZTA
chains in the Genus database with same CATH superfamily
3H0YA 2JD5A 4ACHA 4FV5A 4ALWA 4MXAA 5ANEA 5AWMA 4GVJA 2XYNA 2IW9A 3EQRA 2FA2A 2IZRA 3FDNA 3UIXA 4YJVA 2O8YA 1I44A 1PF8A 3IONA 3RKBA 4EKKA 3BQCA 3C50A 4LL0A 3KY2A 1YQJA 3CD3A 1WBSA 3OTVA 3VQUA 4AOIA 2ZJWA 4Q2AA 4D5KA 2C5YA 3LFAA 4UYNA 4CT2A 4UWBA 4YLLA 5JH6A 3LLAA 3HMPA 5DI1A 2V7AA 2ZV7A 3ROCA 4CFXA 4YBKA 2DYLA 4EBWA 1NVRA 3RTPA 1CDKA 5GJFA 4LUEA 4FSWA 2WPAA 3MSSA 4FEXA 3OG7A 5CU0A 5J9YA 4HVHA 4E5WA 2Y4IB 3VBVA 3WBLA 3GU7A 4NH1A 2PE1A 1CM8A 1M7NA 3ZXTA 3MGYA 3VS4A 2R3MA 3QBNA 2P33A 3EB0A 3HP2A 4WOVA 4X3FC 5H8BA 5JRSA 4NM7A 5BVKA 3RP9A 4ZAUA 1NVSA 5GZ8A 4MXYA 4YZBA 3I6UA 2B4SB 3TUBA 2VV9A 5K3YA 5TF9A 2XK9A 3W2OA 5GHVA 4IFGA 1MP8A 3LXKA 4YJUA 3UC3A 4ZTLA 5A46A 1CMKE 4IACA 5CU3A 4BZOA 2XARA 1SNUA 5HOAA 1SYKA 3DZOA 4OAVB 5M09A 1YI3A 3NVMB 4FC0A 2AQXA 5KBQA 2QKWB 4E6AA 2GS6A 2HAKA 5JKGA 5CZHA 3P7CA 5L6PA 3Q2JA 4C3PA 2F7ZE 1GZ8A 4NFNA 2J4ZA 1NT2A 3TDWA 3O96A 4S2ZA 2QG7A 4O1PA 2WQEA 4Y73A 4F0GA 3RVGA 3AKKA 4P4CA 4P7EA 5H2UA 4IMYA 2J0MB 3Q4CA 3OC1A 2Y8OA 4NIFA 4OR5A 4UALA 4BCMA 3BU3A 5A3XA 1DAYA 4V0GA 4XCUA 4EC8A 3ANQA 2BZHB 5FDPA 3IPHA 4EOLA 3CXWA 4TPTA 4HYUA 2YLFA 3ZSGA 2R3RA 4NU1A 5L2WA 5E4HA 5BMSA 1A48A 2OXYA 4CXAA 2OKRA 5DRBA 2OWBA 3CTJA 2YIYA 3BELA 5FP6A 4FV8A 1MRVA 4ANLA 2IZTA 4U41A 5A9UA 5LCKA 4JOAA 2OFUA 1PHKA 4O4BB 3EJ1A 3K5UA 3LCDA 2XMYA 4M0ZA 5AP4A 2O64A 4BWPA 4AFEA 4LQMA 3D5WA 4IAKA 5FLFA 3SGCA 3HRCA 1PMNA 3D9VA 5E8VA 4TYHA 2R3JA 3C0HA 3ZTXA 3ORLA 4FE2A 3ATSA 4WSYA 3ETAA 3REPA 3R1YA 4GRBA 4QMSA 1YVJA 4F1OA 1LEZA 5AR5A 1OUYA 3LFEA 2G1TA 2QU6A 4II5A 2IO6A 2PSQA 5CVFA 3IW4A 3NLBA 2RKUA 4NCTA 3MB6A 3PSDA 5IISA 1WVWA 2YCFA 3BU5A 3G2FA 3MA3A 4U42A 2OICA 2BPMA 1EH4A 4AA0A 3OFMA 2RFEA 3ORKA 3V51A 2FB8A 1KE5A 1RQQA 3EYHA 4DN5A 4ZZNA 3AKJA 3EQBA 4FJVA 4RX9A 3I0OA 4UMPA 3CTHA 3VHEA 3QC9A 2J0IA 3NW5A 4QP1A 5B2LA 4QEBA 4FIFA 3EQPA 2CNUA 1Q8UA 1KOAA 3Q60A 4KRDA 5KMNA 1BI7A 3AMAA 3R9RA 3OUKA 4ZTQA 4RFZA 5DE2A 3DCVA 5E1EA 4FKIA 4XOYA 4BI0A 3VUDA 5DG5A 4OGRA 3SHEA 5JQ5A 4IQ6A 3UC4A 2X39A 2J0KA 1UKHA 1TKIA 4BCIA 3QTRA 1OECA 4I5HA 4USFA 3GNIB 4FGRA 4FOBA 2A1AB 3RBWA 2CGVA 5CSVA 3VS5A 3Q32A 5CTPA 4PX6A 1ZMWA 4J97A 5C8MA 4XHKB 1DAWA 1PKDA 1YW2A 3NUNA 4FKVA 5D41A 2YJSA 4FSQA 3MY0A 4YP8A 5HCZA 5CY3A 2QOIA 4QTAA 3HV7A 1OVEA 4FTKA 3R9DA 2XCKA 2WTKB 3VJOA 4F9YA 4O27B 4X3FA 2AC3A 3W33A 4XG9A 3CCNA 2PZYA 5KHXA 4DBXA 4WNMA 4D9TA 5BPYA 5IQHA 3ERKA 4L52A 4BZDA 3E87A 4WNKA 1ZYLA 1XR1A 2WTVA 3BGZA 3V01A 3DPKA 2CKPA 4GS6A 4XEYA 1LR4A 2YDKA 3RMFA 4D5HA 3JR1A 3QKKA 4F78A 4FIJA 4YJQA 2OXDA 3SOCA 2RG5A 5J7HA 4NL0A 3TNHA 2UVYA 4AS0A 1OIQA 2W06A 2YITA 3IS5A 4L67A 4QDEA 1RE8A 3BYUA 3UGCA 2BIKB 1E9HA 2WIPA 3QUPA 2XM8A 4BB4A 4C34A 5IQDA 3EIDA 3H9OA 2R64A 2JKKA 3COMA 4J98A 2OBJA 2YIXA 2FVDA 5L2IA 2JIIA 1FVTA 2A27A 2PL0A 3FZ1A 3LZBA 3EZRA 3V04A 3DFAA 4ZJVA 1CTPE 4PDPA 4C38A 5IH5A 3TZ9A 4PNKA 2QNJA 4LDTA 3W0NA 4CT1A 5F9EA 4LV8A 4YO4A 3NW6A 4BIDA 1ZYSA 1YI6A 3DKFA 2V7OA 4W4YA 5FDXA 3R7OA 4EZ7A 1ZYJA 3A7IA 5KMMA 4BF2A 2BIYA 3A8WA 5K0KA 1T46A 4ERKA 4WUNA 3AGLA 3FC2A 2WFYA 5C03A 2PYWA 3E62A 2AUHA 3FXXA 4W9WA 3DBFA 4GU6A 4L68A 4XOZA 4RVMA 4X0MA 3LPBA 4E73A 4PMPA 1M2PA 4GIHA 5HIBA 3F9NA 3LCTA 4RIYA 4XG3A 4TTHB 4BZNA 5DR9A 2QLQA 4PPCA 2Z7RA 1PXLA 1UWHA 4ACDA 4QRCA 4ZTMA 3DT1A 2Y6MA 4ASEA 5DGZA 3RCDA 3NUPA 1Q97A 2F2UA 4I22A 5ANJA 3UYSA 2QO9A 3WF6A 3TUDA 1BUHA 2WIHA 3IW5A 4PMTA 5AAGA 3ZO3A 4B0GA 1OBDA 4AN9A 5HNIX 2ZYBA 1B6CB 4BY9E 1PXIA 4TWCA 3ENMA 4CMOA 3NUXA 3R1QA 2X8EA 5L2SA 1YWNA 4D4VA 2VN9A 2GNIA 2QHMA 1E1XA 4FTAA 5EW3A 2XKCA 3DJ5A 3GQLA 5F1ZA 2GNLA 4MNFA 2OU7A 1WBVA 3C4CA 3NIZA 4MQ1A 4RVTA 5E8UA 2PVNA 4FX3A 4O83A 5K5XA 3EL7A 3GBZA 2XKDA 3G33A 4G9CA 2GU8A 2X9FA 3LCOA 4RT7A 5M51A 2Z2WA 2IJMA 3HAVA 4IFCA 4KS8A 3E93A 4J71A 4BI2A 1JPAA 2BZJA 5HBEA 2LGCA 2J2IB 5HIDA 3V5PA 1WCCA 3FLZA 4XLVA 2W5AA 2R3QA 3PUPA 1H1QA 4A9YA 4R78A 4LRKA 4CSVA 2OIQA 4R7IA 4IVCA 2X6EA 3KIOC 2EXCX 3OUNB 5AMNA 4HVSA 2ZV8A 3SD0A 1UNHA 3O23A 3BIZA 3H30A 4KKHA 3V6RA 1CKJA 3OXTA 5KZ0A 2X4ZA 1ZY5A 3S3IA 2JKOA 4PP7A 4JI9A 4DCEA 3Q4ZA 4L8MA 2C3IB 5IA0A 3CQEA 3QGWA 4EQMA 3FMHA 4ZSEA 4MD8E 3KMMA 3HL7A 1BMKA 2REIA 4FSNA 4ZP5A 5TO8A 4YLKA 3U9CA 1LPUA 4FODA 4C37A 3OROA 4ANMA 3IGOA 2YM5A 1OZ1A 3AMBA 3R1NA 4EOQA 3BV2A 3LQ3A 3F2NA 2R3KA 2UZVA 4E5BA 5D11A 3AKLA 3A60A 3UQCA 1AQ1A 1PXMA 5B2KA 1ZLTA 3ZRLA 4EH8A 5I9XA 2ZV9A 3ZC5A 1Y6AA 3CJGA 3NSZA 4D2SA 5CAUA 2ZDUA 4IZYA 3FYJX 4GSBA 4H3QA 1V0PA 4WBBB 2QKRA 4DDGA 4CVAA 3BEGA 3FXZA 3G9NA 4JR3A 2AYPA 3Q52A 4R7BA 3KVWA 2YWVA 4BYIA 1UWJA 3SG8A 4I92A 5IMXA 3QTIA 4KBAA 4ASDA 5EYCA 3TNPC 5LVMA 1H27A 1BL6A 4FIHA 4FTNA 5HEZA 4GW8A 3VRZA 2Z02A 2VRXA 4TYJA 3VUGA 4CTBA 3W2QA 2CN8A 4I4EA 2XNEA 3C0IA 1GOLA 3VUMA 4CFWA 4H1MA 2RG6A 3F3VA 3WIGA 4K8AA 3F61A 4F7NA 3D2IA 1OKYA 3P7BA 4I3ZA 3TI1A 1HCKA 4H36A 4EONA 4IX5A 3FI2A 3S95A 5JGAA 1URCA 4ASXA 4R3RA 5M4UA 4NTSA 5GZ9A 1JKKA 4GT3A 4M14A 4YZCA 3CQUA 3R6XA 2F49A 3R22A 2B0QA 3ZDIA 5EK7A 4CZTA 4IAYA 3LMHA 3MVLA 3VAPA 3Q4TA 4UXQA 3H9FA 3UZTA 2OI4X 2Z60A 2H96A 5A4TA 3MFSA 3UG1A 4C4HA 3PRFA 4FK6A 3V5LA 2W4JA 3DQWA 3UBDA 4AGUA 4CMTA 4JLCA 5HLWA 3QXPA 3MIYA 3Q9ZA 1SVEA 4IVDA 3NAXA 1PXKA 3ANRA 4CEGA 5CU6A 3DXQA 4X6QC 4HGTA 4GJ2A 1OKZA 3UQGA 5FM3A 4WNPA 2CN5A 4XV1A 3KCKA 4C02A 1U4DA 5AP5A 5AUXA 2W7XA 4DH1A 3ZBFA 4JBVA 3CTQA 3DS6A 2JDVA 3RHXA 2WOUA 5LCJA 1CSNA 4BWXA 3VF8A 3K5VA 4MNEA 1YXSA 4WNOA 4RWIA 3PY3A 4ITIA 4OBQA 2XKFA 2FYSA 4IAAA 2W4OA 2Y7JA 3PXYA 4I5CA 3TG1A 1W83A 3B2TA 2J51A 5BUJA 3BYMA 4RX7A 4IX6A 2B9JA 5A4QA 5HGIA 4QP3A 2XJ0A 3GGFA 4O0TA 4O4DA 4UMUA 5IA2A 4N57A 2ETMA 4EORA 5AFVA 3QA8A 4W4XA 3CD8A 4G31A 4O96A 2CCIA 1REJA 2EB2A 1WFCA 2F57A 3OEZA 2VTRA 4EH5A 5ITAA 2BFXA 4DHZA 3LE6A 1XH6A 4QDVA 2UZOA 3FZRA 1Y57A 3QCQA 4LFIA 4DEAA 4FT5A 2R3FA 5ETAA 1M2QA 4FI1A 5A4EA 3PXZA 4YTCA 3POZA 4U44A 4DGOA 3ZSHA 3MY1A 2XIRA 1YHSA 1KE8A 3EWHA 5KMIA 3FEGA 4O6EA 3JPVA 5DA3A 3RM7A 2WMRA 3L9LA 2OO8X 3TACA 4ZTHA 4G2FA 4LM5A 3QLFA 2ACXA 5EQYA 1S9IA 3QXOA 1H07A 3DU8A 4W4VA 5DR6A 5ANGA 1UU7A 3QZHA 2PVRA 4KBKA 2HXQA 3R2YA 4IWPA 4ONAA 5DR2A 5EFQA 1PKGA 4BBFA 2BRBA 2C69A 2X0PA 4FIIA 4B4LA 4DFZE 2R7IA 3ZRMA 4PF4A 3JY0A 5A14A 2VTPA 3LCSA 3BL9A 4OTPA 4TYGA 1J3HA 3O51A 5F94A 3FLSA 5CEMA 4LRJA 5H8GA 4XP2A 3VS2A 2ONLA 4CV8A 4QMVA 5JFVA 5EOBA 3GUBA 3L9NA 3U4WA 3UJGA 3TTJA 4QMTA 4JBQA 5CLPA 3WF5A 2GCDA 2R9SA 3O8TA 3U55A 4KUJA 3OW4A 1U54A 2WXVA 3ZLWA 2XZSA 3CEKA 5HE3A 3T9TA 5ACBC 3E8DA 4IX3A 3VS6A 4DLJA 5A4LA 5CAVA 1IASA 4EK3A 1YOJA 2XBAA 4JDKA 3VONA 5IQFA 4TWOA 2VTLA 3MPAA 4AF3A 4EZ5A 3SC1A 2P0CA 4G1WA 1H00A 5EG3A 1FPUA 2WU6A 3QD0A 1ST0A 1SVGA 1UKIA 3C4WA 4ZLZA 3C4ZA 3HDNA 3RPVA 4MEDA 3FY2A 2GS7A 3G0EA 4AA4A 4C57A 1OI9A 5LVNA 2PMOX 2XRWA 2X2LA 3ACKA 2UZBA 3R2BA 2VTMA 2QO2A 2VWXA 3BHVA 3DTCA 3RAIA 4PL5A 2E9VA 4FTUA 3NYNA 5AJQA 4APPA 4BN1A 4E5AX 3KXZA 2V62A 4JVGA 4E93A 4NUSA 4G3CA 4M15A 3ZFMA 3PIXA 2VUWA 3KXNA 3PVWA 3FAAA 5CVGA 5E90A 1X8BA 3EYGA 1YI4A 4IHPA 4M97A 3H10A 4U97A 4EK8A 3D15A 1HCLA 2JEDA 3QRJA 4OTWA 4X2FA 3ORZA 4JQ7A 1ZOHA 3NX8A 1OM1A 4AOTA 1M52A 3PJCA 4JR7A 2R7BA 3VUKA 3QRUA 2PTKA 4GKIA 5HVYA 4EHEA 4AQKA 4I93A 1YOLA 3HMMA 4BDBA 4EOKA 2A19B 4QMYA 2QD9A 3PSBA 3R30A 4H1JA 4E6QA 2HENA 4Z7GA 2VX0A 3ACJA 4WT6A 2Y9QA 4P90A 2DUVA 4PRJA 3HMNA 5EI6A 4E6CA 4EOMA 4EK4A 2VTTA 4TZRA 4FEWA 3UVQA 4B6LA 2WTIA 4DLIA 3EN5A 4XH6A 4MVFA 5BVWA 3GC9A 2G2FA 1LP4A 3TIYA 4C3RA 2QOBA 2AEGA 2WEIA 5CVHA 3TZMA 3BCEA 3HA8A 4GJ3A 5C8NA 5CEKA 3BL7A 3C7QA 3OY3A 4AAYA 4XMOA 5EW8A 4V0GB 4C4FA 3FKLA 5EM8A 2HWOA 2HIWA 3R7VA 4DFNA 1UNLA 2E9OA 3UOKA 5KMKA 1PXNA 2O0UA 2I40A 3LHJA 2EB3A 3BWJA 3KF7A 4FIEA 4NM0A 3TCPA 2FO0A 2PZRA 5DMZA 3MYGA 1PYXA 3TNQB 3OY1A 2LAVA 4U0IA 1TQMA 2FSTX 3IG7A 2X7GA 4U6RA 3PVBA 2IEWA 3LOKA 5HO6A 4XG8A 3RPSA 3TKUA 2R5TA 3NUSA 4FL1A 2WO6A 5FXRA 1P14A 2RIOA 2R3PA 3EN9A 2XIZA 2OH0E 3RPOA 2WMXA 4YHJA 4ZSLA 4FG8A 1OIUA 5F95A 4L42A 4E4XA 4EOJA 5C26A 3NUUA 1PMUA 4OTRA 5ANKA 5J1VA 5EDRA 4GK4A 1Q4LA 2CHLA 3C4XA 4KIKA 2YDJA 3DY7A 4P5QA 1YXTA 1FMKA 3WF7A 4D58A 1XBAA 3F2AA 4JXFA 4RG0A 4JS8A 4O0WA 4FSUA 2GHGA 3CIKA 3LCKA 4X2NA 2UVXA 3R0TA 1NXKA 2ZM1A 3TMOA 4ANNA 1GIJA 3DXNA 2VGOA 5DHJA 3RCJA 3MH0A 3VHKA 3IW7A 5C27A 2I0VA 3QKLA 3FL4A 3RK7A 3NZ0A 1OBGA 3S2PA 1HOWA 4QMXA 4GT5A 1JSUA 4FTQA 1NW1A 2PVYA 2ZDTA 4PQNA 4RWKA 5B2MA 4MAOA 3CPCA 4F9WA 4KA3A 2UZWE 4LI5A 1Z9XA 2BDJA 2Z7LA 5EW9A 5J5TA 1UU3A 3ZZEA 3O17A 4MCVA 4OTQA 1Q8TA 1VYWA 2W99B 4MBIA 1M7QA 3ZLSA 4EOPA 4L00A 4F99A 4E7WA 4I6LA 5JRQA 3A4PA 5AUZA 3CY2A 5HKMA 1XJDA 4DEHA 5GINE 1H1PA 1JBPE 2YM3A 2C1AA 3QF9A 3QTZA 1WZYA 1KE9A 4KRCA 3FMMA 3BLHA 1JKLA 4ZIMA 3RZFA 1KOBA 4U8ZA 3T8OA 2GFCA 5D9HA 3Q6WA 4IWQA 3LMIA 5J8IA 5DYJA 5I4NA 4BTFA 3U9NA 3R00A 5AAEA 4BDEA 4MXXA 4EOOA 3CJFA 4ANOA 4GVAA 3AC5A 3Q5ZA 2NO3A 5JFSA 3AT4A 1O9UA 5JFWA 3P4KA 2CLQA 4O0XA 5BMMA 5TE0A 1TZDA 4IM3A 3C4EA 3KFAA 4O7ZA 3BLQA 3ENHA 4LYNA 2XM9A 1G8AA 3ZEWA 4JDIA 2W1FA 2Z8CA 4FSZA 4JIAA 3PJ3A 2R0UA 1G5SA 2QG5A 4JJRA 5JZNA 3QUEA 3FSKA 4HVIA 3M42A 2UZEA 3CLYA 3PY0A 4Q9ZA 4B9DA 4FYNA 1OB3A 5C01A 3HZTA 3V5QA 3ZH8A 4AW1A 4TY1A 2JC6A 4OTHA 4FMQA 4IM0A 2C4GA 2X0QA 2Y4PA 3GVUA 3G0FA 3MESA 5AV0A 4BDGA 2GHMA 4BCHA 3ZC6A 5AEPA 4AUAA 1PMEA 4GK2A 4DEDA 2ERKA 5DEWA 4D1ZA 2RSVA 2BKZA 3O8UA 3VNTA 3E88A 4LOOA 2SRCA 4YHFA 4D2RA 4O7NA 3MJ1A 3F66A 4M69A 5E7RA 5KMOA 4ZEGA 4BCQA 2CKQA 4XS2A 4XBRA 2C3JA 3L9PA 5HI2A 3NPCA 5IDNA 4CFUA 4FV7A 4BIBA 4N70A 3QQFA 2W4KA 3ULIA 2CKEA 2VX3A 4FK3A 5E92A 3I79A 4R3PA 1QPEA 3KXHA 5IEVA 5KKRB 2W9ZB 3JXWA 3FWQA 4ZY5A 3LJ2A 4FV2A 3I5NA 3R8ZA 2WQNA 4AT5A 2EUFB 3HUBA 4RLLA 3SDJA 5BVFA 4CKIA 2EWAA 4DEIA 5HVJA 3W0QA 1H1SA 5BV3A 4QPAA 4YJPA 4FT9A 4KSQA 4CYIA 2E9PA 3MFTA 4O7RA 4DFBA 2IVUA 1YDTE 3SKCA 3MVJA 4OLIA 3F7ZA 5KBRA 4PDOA 2ESMA 2DS1A 5JK3A 2RF9A 4FOCA 1F5QA 4O7YA 2XJ1A 4FG7A 4FTTA 1OL7A 3JVSA 2BRNA 1W0XC 4PTEA 1G3NA 4QP8A 4Z9LA 1Z5MA 2UZDA 3GB2A 3NAYA 4NKAA 4CQGA 5BUIA 3KRXA 2GDOA 1UA2A 3ZMMA 4NWMA 4TYHB 5HD7A 3DBDA 2W0JA 3MI9A 2X0GA 4AE9A 4AW5A 4ANBA 2PVLA 2CNVA 5KNJA 2VGPA 4PTCA 4L7FA 3ATTA 4ALVA 2W96B 5AP0A 4S34A 3WE4A 4AGCA 4F1TA 4O82A 4C0TA 4KKGA 4R5SA 2R3OA 3VS3A 3OOGA 4G5PA 4RZVA 3PYYA 1JSTA 3HGKA 2B1PA 2CDZA 4QQ5A 4YSMA 3A99A 4U43A 5CI7A 5E8YA 1NVQA 4DEEA 4CG8A 2UW4A 3NYOA 5M44A 1ZOEA 3LFCA 4R5YA 3PFYA 2BILB 3LM5A 1PY5A 3A8XA 3G5DA 4ZZMA 4AGDA 4C58A 2C30A 1T45A 3CC6A 3TEIA 3DKGA 5FBOA 3R02A 3QKMA 3OD6X 3FMDA 4CCUA 4BDJA 4IBMA 5HCXA 3QLGA 3G15A 3RK9A 2BZKB 3QALE 3EMGA 1LUFA 3TNWA 2OFVA 2P55A 4FKOA 5AA8A 3P5JC 3F6XA 1QPDA 5JEBA 2QO7A 3FSFA 2NNWB 3KMWA 5K9IA 3AQVA 5CZIA 5JSMA 3A7HA 4DGLC 4LV5A 1SNXA 1QPCA 4A7CA 1JKTA 3OP5A 4DGMA 2P2HA 1JVPP 3UDTA 4AP7A 4AZWA 1STCE 2HELA 2W1ZA 3FKNA 3PIYA 3PY1A 3Q6UA 3Q9YA 4AZEA 4IB3A 4GUEA 1W84A 4C61A 2QR7A 3PVUA 4PUZA 5L8KA 5CSHA 2X8DA 4F9BA 2OF2A 4RMZA 5FG8A 4C2WA 4HGEA 5EH0A 5ICPA 3OCSA 4PTGA 2WTDA 5HX8A 1Y8YA 3E63A 3IOKA 3QZIA 5CEOA 1XMMA 1IR3A 2XUUA 3VO3A 4EOIA 4MF1A 1ZARA 2GPHA 3TYKA 4PL4A 3I5ZA 3PPKA 3Q04A 4YR8A 3C13A 4FSRA 4KSPA 1GZNA 3UE4A 1PRYA 4HZSA 5BVEA 2ZV2A 4FZ7A 4HYSA 5M56A 2JIUA 4J96A 2VTAA 2W05A 4D9UA 1JKSA 3D7ZA 4ZK5A 2VTSA 4S33A 1DS5A 3BGPA 4MH7A 4RJ7A 4DFXE 2ZMDA 5HU9A 4GG5A 4JRVA 1J1CA 4MKCA 4E8AA 2WMQA 4F6SA 4GG7A 4M8TA 4ENXA 1W2CA 2A2AA 3NNUA 4UZHA 3QZGA 3P79A 5C8KA 2NYAA 3QTUA 3R9HA 4QMLA 4HGSA 4FUYA 4F4PA 1MRYA 2RFDA 1L8TA 1YHWA 3ZHPC 4L3PA 4M3QA 1G8JA 5CEQA 2VWYA 4O2ZA 5LVOA 4L3JA 3EQCA 5FEEA 4FL3A 2YM7A 5ANDA 3LM0A 4EYMA 2JFMA 4TT7A 1ST4A 5I3OA 3MN3A 4YZMA 4BWKA 4UMQA 1XH5A 3ALNA 4OUCA 2BCJA 4JIKA 4DDIA 3NW7A 3CBLA 4S32A 3O7LB 4ZY4A 4NT4A 1XH8A 2QLUA 3FJQE 2BHHA 2F9GA 4MWIA 3IECA 3TL8A 3FHIA 2JAMA 4MQ2A 3PG3A 4BCNA 3EN6A 2EVAA 5FM2A 2CLXA 5C4LA 5DOSA 3UYTA 5HICA 5GNKA 4A4OA 3QX4A 5H3QA 2QHNA 4HNIA 4DE4A 3L1SA 4UBAA 3WILA 5J9ZA 4M0YA 4CFMA 4FEUA 3UMXA 1YHVA 4CFFA 2Y6OA 2XAOA 1SVHA 4L01A 3ELJA 4O4CA 3UO5A 2YZAA 3COIA 3LQ8A 1PXPA 3NS9A 4TNBA 4V04A 4BTMA 3MW1A 1LEWA 2OK1A 4AW0A 3HMIA 4RIXB 4BCGA 3OZ6A 3SW4A 2VWVA 2VTNA 4RJ8A 2H34A 2XRUA 4UEUA 1YXVA 1VLRA 3R7EA 4HCVA 3THBA 3PUFC 3CGFA 2E2BA 4LMNA 4F63A 4QTEA 2R3GA 4G34A 4IDTA 2XNBA 5BNJA 2BR1A 3BHUA 4RJ5A 1IAHA 4FKRA 4JL9A 4ERWA 4BJJA 1K2PA 3QCSA 3QZFA 4D4RA 1MUOA 2VU3A 3C51A 2OJJA 4F0IA 3KN6A 4FIGA 5IA5A 3BE2A 1JSVA 3QTWA 4YJOA 2XNOA 5CF4A 4FV1A 3S0OA 2VWZA 1OL2A 1YDRE 3F3UA 4R1YA 4FVRA 1R78A 4FT7A 4QMPA 3TM0A 5D10A 2IF8A 2PU8A 2HZIA 4GIIA 3MPTA 3HV5A 3OWJA 3CQWA 4YZ9A 1YXXA 4O91A 2YIWA 4UN0C 1J7LA 4O86A 5LMAA 1OGYA 3KF4A 2YM8A 3EQFA 4FV3A 3DDPA 4AXDA 1H1RA 3VW6A 2JDTA 2XNPA 4Y72A 3R73A 4BC6A 2HOGA 3NEWA 4MD9E 4ZLOA 2UW3A 1OL6A 3K3JA 4N4SA 4QYEA 5HG8A 3R8VA 5IQIA 2YA9A 2VX1A 1KE6A 4M84A 3KRRA 3WE8A 1VJYA 4Q5HA 2ITTA 3V8WA 4IC8A 4K0YA 2G01A 2OJFE 4RVKA 4U79A 3SV0A 4YO6A 3VUTA 4F08A 2Z7QA 3SX9A 5JZJA 1REKA 4MXZA 4YTFA 4WBOA 2C6OA 4GH2A 4JRNA 4EH7A 3NNXA 3QGYA 5I3RA 3CPBA 2DWBA 2XA4A 4MTAA 3LFBA 4C4GA 1H0VA 2WOTA 2BMCA 5EI8A 1ZAOA 1ZRZA 2CCHA 4F7SA 1J7IA 4JMQA 5HE0A 3UQFA 3W1FA 4CG9A 3ORNA 4Z16A 3IQ7A 1J7UA 5G6VA 1U54B 2XEYA 3EN7A 2JFLA 3G9LX 4NKSA 4GYGA 4XG2A 4ARKA 5DPVA 3V3VA 3LXLA 2PUPA 5AP1A 4ZTRA 4F70A 2UZNA 1GAGA 2FSLX 3Q4UA 3JY9A 3DNEA 2QVSE 3Q53A 3VRYA 2B52A 2QOHA 3FQHA 2GFSA 3OW3A 4FT3A 1TQIA 1YRPA 4RJ6A 1OPJA 5HNGA 3ZLYA 4E1ZA 4R8QA 3GOPA 4HW7A 2QC6A 5GJDA 3WZJA 5CSPA 3QWJA 3I6WA 4YJRA 2QU5A 1OL1A 1H28A 1YWRA 4RQVA 3LQ5A 2QR8A 3ZRKA 3IDPA 4IAZA 3LJ0A 3PRIA 4CLIA 4FBXA 2CMWA 4B8MA 1VEBA 5T6KA 3ZO4A 4QQJA 3ZM9A 3WZEA 2F2CB 2OH4A 4QP4A 4I24A 2E9NA 2IVSA 3KXXA 3F7WA 4RIOA 4QMOA 4YNOA 1H25A 3VBQA 5HU3A 2B7AA 3LJ1A 2HYYA 2OSCA 3AMYA 3FHRA 2W1GA 2OG8A 2PHKA 2UW5A 3FQEA 3A7JA 4LGDA 4C4IA 3M1SA 3MB7A 2I6LA 4LGGA 4BBMA 4HOKA 2ITOA 3BBWA 3F3TA 4FSYA 4RX8A 4HPTE 3OOMA 4WRGA 4PDSA 3R01A 1P2AA 3LLTA 4G5JA 3TIZA 4U5JA 3HRFA 4A9UA 4BDCA 2YACA 3RM6A 3PE1A 4AU8A 2BROA 2PE0A 4U9AA 3JS2A 4D0WA 3ZUVA 4JDHA 1H24A 2HW6A 2WTKC 3KXMA 4BRXA