4YJUA

The kinase domain of human spleen tyrosine (syk) in complex with gtc000249
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
262
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of GSK143, a highly potent, selective and orally efficacious spleen tyrosine kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
total genus 91
structure length 262
sequence length 267
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yjuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yjuA01
5GNKA 3SX9A 5IA1A 3RHKA 1OL2A 2R64A 3LQ3A 2JDVA 4CRSA 4YJVA 2PVHA 5BUEA 4I6QA 4BCGA 2QOBA 3R1NA 1YW2A 2ETMA 3H10A 3EMGA 5AV0A 3NZ0A 4D2PA 5FEDA 3RAIA 2C0IA 4GFMA 4FV9A 3WZEA 5KMLA 2PZIA 3B8QA 4MTAA 4U45A 4CG8A 4NTSA 3DFAA 3UIBA 4QMLA 4OAUC 3MB7A 2OXDA 1OPKA 3LQ5A 3Q6UA 1WVXA 1ZYLA 2CMWA 1RW8A 3I79A 1TQMA 3DS6A 2ZM4A 4ITIA 3SC1A 2JEDA 5E8YA 2FUMA 5FLFA 4HW7A 5BYLA 1XBBA 1ZLTA 2CPKE 2VWXA 3QKKA 2OFUA 5AV4A 3KREA 4XX9A 5LQFA 2LGCA 3KQ7A 3D7ZA 3UNJA 2BAKA 4OW8A 5CEIA 3OVVA 1REKA 1JKLA 1KE6A 2A27A 4DBXA 2PZPA 4NFNA 3ANQA 4O82A 1YVJA 3R63A 4U9AA 1M14A 4WNOA 3WZJA 3AT4A 4QT1A 4O21A 4QMZA 1YOMA 2VD5A 3UOLA 2Z02A 3ORLA 5L6OA 2Y9QA 4NW6A 5AWMA 1O9UA 4LOPA 3H4JA 1F0QA 2X9EA 3I1AA 2ETKA 3F5GA 4MD7E 4BDCA 4NWMA 3D5UA 3Q52A 5CTPA 4ERKA 5FRIA 1JKTA 2R4BA 1Y8YA 3LQ8A 3MTLA 2XP2A 3NW6A 5BVEA 3VF9A 2VTSA 2NPQA 3QRJA 3GOPA 3DLZA 3HYHA 4FIIA 4CT1A 3UMWA 3ODZX 3AG9A 2QNJA 3KGAA 4QMVA 2NO3A 4ALWA 4BICA 3VBQA 2EXMA 3W33A 3MBLA 4TT7A 5DPVA 2XMYA 3TNWA 5CSPA 4F63A 5I9YA 4FE2A 4NYEA 4FZ6A 4GT4A 4GIHA 1KUTA 3FDNA 2FO0A 3VHKA 3NSZA 3OMVA 3QYWA 3C4CA 2P3GX 4F9BA 1MRYA 4BC6A 1UU9A 4M67A 3NVMB 1MRVA 4MBIA 4RG0A 2BVAA 1XR1A 1KOBA 3OHTA 5HORA 2UW0A 1SVGA 2BAQA 5AFVA 3DBEA 4A4OA 4UWBA 4DFLA 3FZPA 4LUEA 4I6HA 3QZIA 2QKRA 3L9LA 2E9VA 4D5KA 4NZWB 4M14A 2HY0A 4E4XA 1DS5A 2HZNA 5EOBA 3I4BA 2WD1A 3W18A 4O0TA 3ID6C 4W4WA 2WQNA 3CP9A 2YACA 5DE2A 1FVTA 3VC4A 2IVVA 4NM7A 4AZFA 3V3VA 4R1YA 3GCPA 2YJSA 3KN6A 3DA6A 5AR8A 3GU6A 3Q6WA 3RAHA 5ETAA 1NW1A 1IAHA 3MB6A 3UVQA 3SVVA 4U3YA 2B7AA 5J1VA 3H9FA 4XYFA 5KMJA 3NYOA 3ZFMA 1XH7A 5C8KA 1YRPA 3RAKA 4QTEA 4R7HA 4FMQA 4Y46A 1GIJA 4L68A 4FV5A 4GKHA 2R3QA 3EKKA 4J96A 2YM4A 1FVVA 2OLCA 4U8ZA 4X3FC 3U54A 2GNIA 2PTKA 3EFJA 4A06A 4CLIA 1ZYSA 4PDSA 4U40A 5IDPA 4M69A 3UBDA 4GCJA 3FE3A 1OIQA 2WEIA 2XKCA 3V8WA 4OT5A 1PXNA 4OTFA 2ITPA 5HO7A 3QQJA 4O0XA 4ZJJA 3B8RA 5I9VA 4FKPA 5D41A 5J7BA 3LJ1A 4H1MA 4YTHA 1VEBA 4DH5A 2JIVA 3P7CA 1Q62A 4BKZA 4CFUA 3NVKI 1JBPE 3OY1A 1PF8A 2WOTA 1U54B 4DLJA 4K0YA 1M7QA 1YHVA 3TN8A 5FM2A 4A7CA 4YZMA 2AC5A 3COIA 3LFBA 1P4FA 2PULA 1L3RE 2VWUA 4FK6A 4CCUA 3LCKA 3K5VA 3IW4A 3UP2A 4J8NA 4AZVA 4E1ZA 4FTMA 4EH4A 4O27B 5M53A 1XO2B 3IG7A 3VW8A 4F1MA 3BYMA 5CSXA 3D5VA 4Y95A 5L4QA 3QLGA 4DEDA 4DFUA 3C4WA 4RIOA 3LJ0A 1HCKA 4HGLA 2XK6A 4UXLA 4X3JA 4GEOA 5AUWA 4B8MA 5IEXA 4IB0A 2R7IA 3ZSGA 5D7VA 4O1PA 4IW0A 5HBHA 2RSVA 2BMCA 4A9TA 5H8BA 1YQJA 4M66A 3V8SA 4FSTA 2ITZA 1UA2A 3ZLYA 5E4HA 3QUPA 2R3IA 3I81A 3PYYA 4X6RA 3RNIA 3OXZA 3QA0A 4Z9LA 3TKHA 4N4SA 4P2KA 2EB2A 4QYEA 3AMBA 5HQ0A 5BYZA 4GH2A 3TJCA 2WXVA 4TPTA 3DNDA 3KN5A 4K6ZA 4BTMA 3Q32A 1BL7A 2PL0A 3GCSA 5LVNA 3VF8A 4PDPA 4HVSA 5DN3A 3S0OA 1U4DA 3POOA 4DFBA 4F65A 5E8ZA 3G15A 4QYYA 3TV4A 4UWYA 3FHRA 4K2RA 1Q8YA 1R0PA 3PZEA 4O7TA 3R8PA 5I3OA 3D83A 3NYNA 2QO2A 5AEPA 2PZRA 3CTQA 5DLSA 2HW7A 5IEVA 3EQIA 4LMNA 2OF2A 4GG7A 3C0GA 1H4LA 1ZXEA 3QZGA 4FTNA 3PSCA 4ZMFA 1Q99A 4D58A 3ZOSA 5A4QA 4GIIA 2DWBA 5CXHA 1GIIA 4XG9A 2VUWA 3HMMA 3A60A 3GT8A 4QYFA 4APCA 4BHNA 5IH5A 4UMUA 3K54A 3BPRA 4FL2A 1U5RA 2VTHA 3QQLA 3EQDA 4OUCA 4JQ8A 4KD1A 3BBTB 4DC2A 4GS6A 4YTIA 3MSSA 1ZMWA 3EQFA 4NIFA 5ANKA 3PXYA 4DGLC 2SRCA 3UO6A 2JIIA 4RJ3A 2H9VA 3EB0A 1MUOA 3AXWA 3BLHA 4QMPA 3QLFA 5FUTA 2VTIA 4BDEA 3PJ8A 4UEUA 2WO6A 4QMXA 2WIPA 3RZFA 2X6DA 3F3UA 4S30A 4HGEA 2W0JA 5AMNA 2QU6A 4EZ7A 1DM2A 2Z8CA 3BZ3A 1Q8WA 3HECA 3QL8A 2IWIA 2QOHA 2W99B 2WMWA 3C50A 3G51A 3QUDA 4LG4A 4QYGA 1WZYA 4FL1A 2ZDTA 4FKOA 4BL1A 2GTNA 1V1KA 4FIEA 4LI5A 3SG9A 2P55A 3Q5ZA 3PA3A 3ZHPC 1XH5A 2VNWA 5HO6A 3UZPA 2EVAA 2WMSA 5F95A 5JRSA 4L6QA 4GK4A 3EN7A 3SW4A 4D1XA 3PLSA 3CBLA 3HV3A 5EHLA 4BGHA 3MIAA 5HCZA 1Z5MA 2W1ZA 3VS0A 3KXGA 3FMEA 1P5EA 3MVLA 3PG3A 3T8OA 3HRBA 4NIFB 2Y6MA 4F64A 3ELJA 5JN2A 4B4LA 5A6OA 3R01A 4IC7A 3BYUA 3POZA 4W9XA 1U59A 3AOXA 4YLJA 3TM0A 3EIDA 4FZFB 4LV8A 2REIA 1OMWA 5K9IA 2W5HA 4FSUA 2GNJA 4YTCA 2GU8A 4DAWA 2QCSA 1Q3WA 4CTBA 3HUBA 1IG1A 2XNPA 3Q9XA 2DUVA 3EN4A 4G5PA 4AT4A 4D9UA 1JAMA 4L52A 2VAGA 4J97A 3FY0A 2W9ZB 4NKSA 3OUKA 5CENA 5AR4A 3ATTA 3SW7A 4TL0A 4MF0A 4PP9A 4Z16A 4A9RA 3LCOA 5ETCA 2QOOA 1OL1A 4L45A 2J0MB 4RLKA 4UY9A 2GDOA 4YHJA 2BHEA 4FVPA 4FKUA 4RVTA 4YC8A 3MFRA 3ORPA 4CMUA 4E6AA 1M2QA 2XKDA 4M7IA 3UZRA 3BI6A 4N6ZA 4F7NA 4X2FA 4YZNA 3DDQA 4B6LA 2GFSA 4ZJIA 3EQRA 4FEUA 2VV9A 5M4UA 2WTKC 2HELA 2V55A 3TZ8A 3CGFA 4JT3A 4LL0A 5IF1A 2C4GA 4O2ZA 4XCUA 3U8WA 4EUUA 4FTAA 3CSVA 4FUXA 4CFXA 2PVYA 3OOGA 5CU4A 4DF3A 2WMUA 4K1BA 4XG6A 4QTCA 2XZSA 4FR4A 2RF9A 1UKHA 3OTVA 4FV2A 4HPTE 1FQ1B 1JSUA 3DBFA 4C57A 2YM3A 4DEBA 4Y5QA 5C27A 1O6YA 2PMIA 4KBAA 1ZAOA 3UIMA 4DGMA 5HNIX 3R30A 4U7ZA 1JKSA 2YWVA 3LZBA 3WF6A 3QZFA 4JBPA 3C4FA 3O7LD 4OBPA 2W1CA 4W8DA 3G9NA 1Q8UA 3MVJA 3FAAA 4EK5A 3R9RA 4ZK5A 2W1GA 3P78A 4AOIA 4M12A 4BDBA 4IWQA 3RMFA 4CD0A 5EKNA 3FXWA 4BDFA 2ITTA 3FMHA 1SNUA 3JVSA 1JQHA 4FGRA 3U4WA 3CXWA 2B55A 4HYUA 5AV1A 4KAOA 4BYIA 2ITYA 3UOJA 5HCXA 4K33A 3KXNA 1YI6A 5ACBC 2ZV9A 4O22A 3PJ1A 2Z7SA 2YLFA 3BRBA 4F70A 3LMGA 3W8QA 3UG1A 4D5HA 1M7NA 5FXRA 3MVHA 3VUMA 4E7WA 5A14A 4CCBA 3IW5A 3MWUA 3KA0A 3NYVA 4UMQA 3V5PA 4BCIA 4QMQA 4O84A 4QTAA 4ZY5A 3AC1A 4TTHB 4A9YA 4NW5A 3DKFA 3VIDA 3P79A 3DK7A 5KNJA 4U44A 2JBOA 5C4LA 3O71A 4JBQA 1S9JA 2UV2A 4YJRA 5AP2A 3KMMA 4CV8A 4PP7A 4FNXA 5EW3A 2R3JA 2X8EA 3P5KA 4LGDA 1VZOA 4HCVA 4XUFA 3MS9A 3OF0A 3WZUA 4IXPA 4PPBA 4MKCA 2R2PA 3IDPA 1UNLA 1YXSA 2HZ0A 3WZKA 2ONLA 3HKOA 3IOKA 4M15A 3PZHA 3PY1A 2BZKB 4BTJA 5BYYA 4USEA 5AP3A 3RWPA 2PE0A 4ONAA 3H0ZA 3KU2A 4HVHA 5EDPA 2BPMA 2QVSE 2JFLA 4GRBA 4M0ZA 1YWVA 4O7ZA 3QTRA 3F7ZA 2P0CA 3DTWA 3NMUF 5IH4A 1AGWA 2IVSA 2OF4A 2VTJA 4EOJA 4D1SA 4GK2A 4O91A 4X2KA 5ETFA 4DCEA 5DMZA 3PXFA 4ZSEA 4WD5A 2X4FA 2WU7A 3O23A 4B99A 4D2VA 2GHLA 2WFYA 1UU8A 2IW8A 4IAKA 4JVGA 3JUHA 3QTZA 4OGRA 1BMKA 2BIYA 1WBVA 1WBSA 4HYIA 4F1OA 2WQEA 4NK9A 4ANLA 4R1VA 4MD9E 3FMDA 5IISA 2WMBA 5HOAA 2PVMA 4JBOA 3FZRA 1ZY4A 2YM8A 3PSBA 5CVHA 3FLQA 5E7RA 4XG8A 4EOLA 4HOKA 4IZAA 4D2WA 5DVRA 2XK9A 3PE2A 2RKUA 4Y5HA 5JK3A 3DKCA 2IG7A 2W1EA 3NRMA 3UQCA 4QQTA 2QONA 3OCTA 3SV0A 4AW1A 3D2IA 4CXAA 4O0YA 3OEZA 1O6LA 4OTPA 5A46A 3Q53A 3O50A 3ZEWA 2XNBA 4L46A 4RC4A 1XJDA 2VWIA 3PWDA 2V5QA 2GNLA 2OO8X 2XCKA 2QR7A 4YHFA 3HA8A 3NYXA 2Z60A 5KHXA 3UTOA 5LVMA 3DU8A 4E4MA 2PU8A 5EQEA 3AQVA 5I9ZA 4O7SA 4ZTLA 4IX5A 3K3IA 3CQEA 2O64A 3KFAA 4PTGA 5GJGA 2YISA 4BTKA 1GOLA 2WB8A 3FI2A 4X2JA 2HAKA 5GHVA 4EK8A 4NKAA 2B54A 4IWOA 3WILA 4BBEA 5BUIA 4R78A 2WTCA 3Q2JA 1H8FA 4XP0A 3QRUA 4KWPA 1UVRA 2BUJA 4E5AX 4EH6A 1JOWB 4C8BA 1H0VA 4I94A 2UVXA 4DFZE 3TDVA 4IM3A 3HNGA 4JRVA 4FX3A 5F20A 2XNGA 4FL3A 2ZMDA 5AA9A 4EH8A 3LFFA 2OIBA 2QHMA 2OJFE 4J7BA 4YJUA 3OWLA 2PSQA 5HIBA 3MGYA 5GINE 2VGPA 2JLDA 3Q2MA 2ZOQA 4EBVA 2UZLA 3MH3A 3D7TA 5IPJA 4D2RA 1QPCA 3DT1A 4EQUA 4J71A 2FSTX 3NNXA 4RPVA 1URWA 4ZAUA 2UZOA 5K3YA 4Z3VA 1FGIA 1YXUA 3KY2A 3PLAE 4KKHA 3RJCA 3DBQA 3LXPA 1KWPA 4YZCA 4CLJA 2VTPA 4TYHA 5CEPA 4AN3A 4EZ3A 3MESA 1IA9A 3OWKA 4IVAA 3LFEA 3QAME 5M4CA 3RNYA 5DNRA 2J7TA 2JKQA 3FZSA 3SD0A 4F99A 2PE2A 2F7EE 2Q83A 3F5PA 4I4FA 1V0OA 3TJDA 3EFKA 1GNGA 1M2RA 4NSTA 5AX3A 3CR0A 4C58A 1H08A 3SA0A 2IPXA 2XKFA 4I20A 2Z2WA 2XIYA 4JIAA 1K3AA 2WHBA 3DJ5A 3IW8A 4O86A 2XIZA 5JH6A 4K9YA 2OIQA 5J9LA 3G9LX 3QTQA 1YHWA 3FI8A 4WBOA 4FV7A 4L3PA 3QRKA 4AQCA 5CEKA 3PRIA 2R3HA 3W2RA 2QR8A 3GU8A 5CF4A 4KUJA 3OS3A 2WELA 4I3ZA 5AUVA 2R3MA 4ZZNA 2YIRA 2VU3A 4X2NA 1KE9A 3MA3A 3F6XA 4IAAA 4PL3A 5LCJA 1ZYJA 4ZTQA 1JWHA 3BYVA 1UWJA 3DTCA 4FSMA 4MCVA 5AUUA 5GZ9A 1CKPA 3DAJA 1RJBA 3LFQA 4O6LA 5TF9A 4R77A 3NUNA 3DQXA 3ALNA 3BWJA 5F4NA 5AR7A 4CT2A 4CZUA 5BUJA 2XNMA 4IWPA 4K18A 2GS6A 2J9MA 2OBJA 4U42A 3RPRA 5JGBA 5LOHA 2CKQA 4KIOA 3ZEPA 2H8HA 1V0PA 2HXLA 4KRDA 4O6EA 4TWCA 3TTIA 4MXYA 2PVJA 1HOWA 4AZEA 5LMKA 4ZS4A 1OIUA 2OZAA 4EOIA 3O8UA 4I23A 1IAJA 4DH1A 2CGWA 4RVKA 2QQ7A 4MH7A 1U46A 2OK1A 4QPMA 4AOTA 4L01A 2VNYA 4FZDB 4J1RA 4F08A 3KL8A 4V0GB 1UV5A 3PJ2A 1ZWSA 2J0LA 2UW9A 4TW9A 3EN6A 3R00A 4RIWB 1ZY5A 1CKIA 3UIXA 4AX8A 3TXOA 3E64A 3O8PA 3CJFA 3CIKA 4OT6A 2PMLX 1LUFA 4JIKA 1WCCA 5CVFA 4KNBA 3WE8A 3IO7A 4YSMA 2I7QA 5DYJA 4II5A 5CI6A 4KA3A 4ERWA 3BHYA 4IBMA 4CFWA 4PDOA 5I5ZA 3R6XA 4H39A 2OZOA 2CKOA 1BKXA 2JDRA 3DNEA 4YC3A 4F09A 3FC2A 2CNVA 1OECA 2Y7JA 4YLLA 5EHYA 1PKDA 3ODYX 5HZNA 3KCKA 3KEXA 4GW8A 5CSHA 3OW3A 3C7QA 3LLTA 3C1XA 2Z7LA 3HV4A 1QCFA 4WSYA 2OW3A 2X2MA 3R2YA 5KBQA 3F66A 3EHAA 5M08A 4IHPA 1R78A 1YI3A 4W8EA 2UZDA 4FNWA 3FMJA 4G3CA 4QP4A 3CY2A 4YZ9A 5CU2A 3SQQA 5L2TA 5L8JA 4FKJA 2EWAA 2VX0A 3VUTA 2WZJA 4OTGA 3VS1A 4NEUA 5D7AA 3ALOA 3DQWA 1L8TA 3GFEA 3OD6X 4EWQA 5K5NA 5M06A 4LRMA 1UNGA 1OZ1A 2E2BA 1MRUA 5JRQA 3OG7A 3OTUA 4L7SA 3VBTA 4WBBB 3ZDIA 2GPHA 5GZ8A 2JDTA 2V62A 2HZIA 2KULA 4L42A 1B39A 2ZV7A 4NH1A 4NM3A 1H00A 3A4OX 2UZWE 5FP5A 3R8UA 3ZUUA 4MYGA 5E1EA 2WNTA 2ITXA 4U0IA 4XMOA 4HGSA 3ZO4A 1OKVA 1Y91A 2I6LA 5EHOA 4AAAA 2A2AA 3SOCA 4C2VA 4E6CA 3HV6A 2QOIA 2RGPA 3I60A 3RINA 4LUDA 1SVEA 3FUPA 3EFLA 3HMPA 3TUBA 3AD6A 1PXKA 4Q9ZA 4J8MA 3KVWA 3GU4A 2PMOX 3VW6A 2FA2A 2XRWA 3MPTA 5IQCA 3SKCA 4MBJA 1SM2A 4R3CA 4TYHB 4ACDA 5KCVA 3PSDA 3RWQA 4DGOA 3PVUA 2VTRA 3EQCA 5HE2A 3S95A 3VS2A 4EYMA 4ORKA 3NWWA 2G2HA 2VWZA 3QA8A 4GYGA 3LVPA 5E92A 3KRXA 5CAPA 5HEZA 3ORMA 4H1JA 2PUUA 4ASDA 4J98A 4WKQA 2JAMA 4B7TA 2YCQA 2HYYA 5FTOA 3ZZEA 4MQ2A 1PXLA 4D0WA 3LOKA 2I0VA 3E8DA 4CFMA 4FICA 4FSWA 5T3QA 4W4YA 1PMNA 3DV3A 5I9WA 2GNGA 3RPOA 4D4SA 2R0UA 3Q9ZA 3VRYA 3TDWA 5HHWA 2UZUE 4XV9A 5M55A 4GV1A 4DFNA 2E9PA 3F5XA 5LWNA 3RBWA 4FC0A 4FTCA 3TT0A 4G6LA 3L8VA 2BAJA 5CLPA 3ZXZA 2UW4A 3R2BA 1ZYCA 2FB8A 2UW8A 4O0WA 5FXQA 3VBVA 3I0OA 4D9TA 2O8YA 2CCIA 4IB5A 4FYNA 3MV5A 3QUEA 4FT0A 5M51A 3GVUA 3A2CA 3C51A 2XK3A 4AP7A 5LJJA 4U6RA 4YJOA 2FH9A 3DXQA 5J5TA 2VTMA 1P4OA 4YURA 3A7FA 4UMPA 3UC3A 4YBJA 5JGAA 1H01A 1WBPA 3IDCA 4O1OA 5GIPE 1ATPE 4IAIA 4QP1A 4C4HA 2BIKB 5AP7A 3P0MA 3LM0A 5I4NA 3U6HA 2GNHA 3ENMA 2OICA 2XH5A 5IA4A 3LW0A 3IW6A 5TT7A 5KMKA 1APME 4TYEA 3R9NA 3GXLA 4FA2A 2C3LA 5IA2A 4DN5A 4UALA 2WMRA 4FTJA 1YDSE 2XM8A 2R3GA 4DG2E 3E7VA 4RVMA 2VN9A 4U5JA 4RLLA 5IQBA 3U87A 4NCTA 4XOYA 4LOQA 3NLBA 4WRGA 3Q4CA 5HG5A 3QQGA 4PUZA 3BCEA 3NDMA 2BCJA 3F3TA 3BBWA 3KB7A 3CEKA 3OZ6A 4O0VA 4RC3A 4Y8DA 5B2KA 4DEAA 2PPQA 4O7YA 2YCFA 3DB6A 1YXVA 2CCHA 3UMXA 2PZ5A 1FGKA 2WMTA 2Y8OA 4G34A 4UMTA 2X81A 5C8MA 4O81A 2HOGA 3HUCA 3MA6A 1ZOHA 3ZLXA 4DGGA 4USFA 4CMOA 2IN6A 3Q9YA 2UZBA 4JX3A 4CFNA 4IMYA 3AMAA 3UVPA 5FQDC 2Y0AA 4H3BA 2C0OA 4ANOA 1Y6AA 4S34A 3G0FA 4D2TA 4EHVA 4G17A 3L9NA 4F0FA 4MQ1A 2OIDA 3P08A 4MK0A 2EUFB 1J7LA 5DGZA 5AP6A 4ZIMA 3VNTA 5HX8A 5FP6A 4JAJA 3BHHA 4X2GA 4X0MA 5E8VA 5DH3A 4JRNA 5E8UA 5FD2A 4QTDA 4BIDA 5CAUA 4XV2A 1UU3A 5KKRB 2BRGA 3PDTA 1NVSA 2ZM3A 2RL5A 3EQHA 3R83A 4BCNA 4DCAA 3R22A 3I5ZA 4DH7A 3QX2A 1IR3A 2OXXA 3ORKA 4KBCA 4BZDA 5IA0A 3Q4TA 3A61A 4U41A 1Q8ZA 2G15A 3G6GA 2UZEA 4OLIA 4V04A 4NT4A 4IQ6A 5KMOA 3VVHA 5CI7A 4CGAA 3MH1A 2J90A 1H1SA 3OFMA 3QXPA 2IVUA 4EK4A 1PMUA 2O3PA 3V5WA 4RA4A 3UE4A 5KZIA 4X3FA 3ZZWA 3IECA 4C38A 5BNJA 2B0QA 4QRCA 4BI2A 2NRUA 4NL0A 3GCQA 1J91A 2DQ7X 5CZHA 3Q60A 2XYNA 4YZBA 3O96A 5HG7A 3VS3A 3HA6A 5I0BA 3FKNA 1PXMA 3LXLA 4P4CA 3G5DA 3UG2A 4ZP5A 4OAVB 2NNWB 1JVPP 2YDIA 2GS7A 4M13A 2XF0A 1FVRA 3AMYA 3GU5A 5GZAA 1FINA 5KMIA 4FV1A 4S32A 5HIEA 2ZMCA 3TG1A 4CFFA 1H26A 2PY3A 1F5QA 3ITZA 1X8BA 2A0CX 3OBJA 3TV6A 4EI4A 4RRVA 1QPDA 3TZ9A 1QPJA 3IGOA 5H8GA 4AN2A 4XG7A 5CAQA 4NFMA 5CEMA 1E1XA 2WTWA 4CVAA 5CYIA 5HX6A 3V6SA 4QP6A 3U9CA 4QP8A 2FYSA 3GGFA 4R8QA 3ORTA 1PY5A 3II5A 3TACA 3P7BA 4W9WA 5CU0A 1IASA 3BU6A 4IM2A 5G1XA 2JKOA 4XJ0A 4IFGA 3K5UA 4IIRA 4BDAA 4BFMA 3M11A 3C0IA 2XIRA 4FKIA 4FUYA 4BIBA 4DTAA 4FKVA 3FQEA 4GKIA 5E8XA 3ZTXA 1KOAA 4UYAA 2ETRA 4L3LA 2JKMA 4U81A 3RK9A 4FOBA 2CKEA 3QZHA 1OPJA 3KK8A 3QALE 3VUHA 3COMA 4C4EA 5EKOA 4QMYA 1BUHA 5H3QA 2J50A 4E8AA 3BHTA 3GQLA 4PX6A 2F4JA 3SXSA 5J7HA 2O2UA 1ZRZA 2J5EA 3GENA 5BVDA 2W1DA 4QPAA 1LPUA 4RQKA 4DA5A 1J1BA 2BROA 3CTJA 3PY0A 5AR5A 5KMMA 2W17A 3A62A 5EK7A 4BZNA 1ERKA 4R6VA 1STCE 1ZOEA 4FZAB 3LCSA 2BZIB 1M2PA 2YHVA 2XEZA 2QOLA 4KABA 2W06A 4RC2A 4AS0A 4ENXA 4IM0A 5H2UA 4Z7GA 4IJ9A 4CQGA 4RWJA 4BVUA 2R5TA 4YC6A 4XG3A 3VJNA 2X7OA 3EQBA 4EORA 2DS1A 2CN8A 5DEWA 3EQPA 4XP3A 5HNBA 3ORNA 4EOMA 5E9EA 4KIKA 1J7UA 4D55A 2F2UA 2G01A 1H1PA 4L00A 3BGQA 3U4UA 3V01A 4AA5A 4ENYA 4FTRA 4EQMA 3S4QA 3COHA 2X9FA 2BDFA 2G9XA 4HYHA 4E26A 5DEYA 2W96B 3BYSA 4U43A 3RK7A 5C1QB 2BRBA 1WVYA 4FKQA 2PE1A 2YIXA 1W83A 4P5QA 4RJ5A 5D1JA 4A4LA 4BWKA 4YZDA 1Q97A 4O0UA 3BQRA 2O65A 5J79A 4TRLA 4G2FA 4BCQA 5B7VA 1ZZ2A 3O0GA 1KE7A 4E4LA 4QO9A 4BBMA 2C3KA 5HE0A 3GC0A 4IX3A 5FDXA 4YPDA 4I5PA 3NUAA 3E87A 4WA9A 1BI7A 3G6HA 4QMNA 4QYHA 3S00A 1OM1A 5ANIA 4QD6A 3LAUA 3BWFA 4YPSA 3GFWA 4TKSA 4EYJA 2IVTA 4RX8A 1R1WA 5BVOA 4RWKA 3HGKA 3I7CA 3OROA 3A7GA 4MXXA 5IZFA 5KKRC 5EOLA 5EM7A 4QPSA 4IB1A 4BCPA 4B0GA 2I1MA 4ASXA 1OB3A 3FZ1A 3K2LA 3F3ZA 4GFOA 4JJRA 3TL8A 2JD5A 4RX7A 3QQKA 4FK3A 4E20A 2YEXA 5HE1A 3ZFXA 3R1QA 4EHGA 3R71A 3GBZA 3LFDA 1XH6A 3MIYA 4OR5A 4UB7A 4EBWA 4C3PA 4WRSA 1WMKA 2R3PA 3VHEA 5LVPA 4DH3A 3CCNA 3QX4A 4HZRA 4YP8A 1Q5KA 3UZTA 5CF8A 4QTBA 1S9IA 3O2MA 3PG1A 5M4IA 4YU2A 5F9EA 1J1CA 2W7XA 5DA3A 2HIWA 3N9XA 4FSNA 4RQVA 3R7EA 3TWJA 2BALA 2R3NA 5AP5A 2PWLA 4OTQA 3AGMA 4FEQA 4HZSA 3C4ZA 2J0KA 3SG8A 3BLRA 2X8IA 1KV1A 3SRVA 4KKEA 3HLLA 3UPXA 3QTUA 2ERZE 2PVLA 3F7WA 2YIWA 4MHAA 4NM5A 3ZYAA 3LFNA 2JGZA 4KIQA 4V01A 5K0KA 5K5XA 1OUYA 5AX9A 5GJDA 3L8XA 3ZH8A 2BFYA 1UKIA 3JY9A 2Y4IB 1AQ1A 4DEGA 2IW9A 3L9PA 4W4XA 2XS0A 5IQIA 5LWMA 4FVQA 4RJ7A 4RFZA 3ZRMA 4B9DA 3NNWA 4IEBA 4BGQA 3EYGA 5J95A 2YAAA 4F7LA 5AP4A 1H24A 4RBLA 2Q0BA 4FIJA 4FNYA 2OH4A 4JDHA 4U79A 4I6BA 3U51A 3TV7A 5JZNA 3VUIA 4DYMA 2HWOA 3CE3A 4GU9A 4LV5A 4Y85A 4JL9A 5ETIA 3C4XA 5EM6A 5LVLA 3ZSIA 3D4QA 1ND4A 4J53A 5JFSA 3JR1A 1Q24A 1YXXA 3R7VA 3OP5A 4DFXE 2XM9A 1Z57A 3OT8A 1H1WA 2V7OA 4PMSA 3AC2A 3S2PA 4Y73A 3ZXTA 3UPZA 3UYTA 4AA0A 2XBJA 3OC1A 3CJGA 3AC3A 5FXSA 4EHEA 1WBWA 3NPCA 3IDBA 4QMOA 3WIKA 4E3CA 5IQGA 2H6DA 5EQPA 5JT2A 4BWXA 2R9SA 3PIXA 1JKKA 3SDJA 5HVYA 4EHZA 4NU1A 4AWIA 1EH4A 4XRJA 1IA8A 4FODA 5G6VA 2W9FB 3D14A 5DHJA 2IO6A 4EH5A 3BELA 1W84A 3GCUA 1PKGA 4BRXA 3MPMA 4ACCA 2PHKA 1JLUE 4DLIA 5AADA 2OJJA 2F49A 2W4KA 4FYOA 2PMNX 4MBLA 4FTQA 3JPVA 3QTXA 4EH9A 3E92A 3HEGA 2B52A 4GU6A 4PMMA 4BCFA 5A9UA 1U5QA 4UBAA 5FWKK 2WPAA 2IJMA 4YGAA 3MVMA 3KXZA 3QCQA 4R3RA 3HP2A 2VTOA 5CWZA 4BI0A 3O8TA 2OG8A 4C61A 1OUKA 2RFNA 4XV1A 4AT3A 5D11A 4IAYA 3OWPA 5IH6A 1OIYA 3M2WA 4IFCA 3KMWA 4R3PA 4QOXA 3TEIA 3WYXA 2X4ZA 5HBJA 2V0DA 2OI4X 3DBCA 4I21A 4QP3A 2BKZA 2YJRA 4G3GA 4FT9A 5CX9A 4KSQA 4W4VA 1XH8A 4D28A 3QF9A 5JZJA 5I9UA 2PVKA 3BIZA 3TKUA 4OTRA 3A8XA 5CEOA 2HY81 1G8SA 3NAYA 4TYJA 3VBXA 4PTCA 4YSJA 2QOKA 5ANOA 3FHIA 4RSSA 5IA3A 4IANA 3ZC5A 4QNAA 3DCVA 2UW7A 4CTCA 4D4RA 4XHKB 1ZARA 5ANGA 3PA4A 5EM5A 3MDYA 3CC6A 4I5CA 3DB8A 3R7OA 3U55A 4AZTA 3QU0A 4TWOA 2E9NA 3EYHA 4ZTMA 2X7FA 4AXAA 4FKGA 3IKAA 4I24A 5FEEA 4GJ3A 3RM7A 3RPSA 4YJSA 4M3QA 5DRDA 2CLQA 1W0XC 4DE4A 2OFVA 1UNHA 3OUNB 2W5AA 3SXRA 2G1TA 5FM3A 2J6MA 1YOJA 4I0TA 4L8MA 2C5VA 5DT3A 2C69A 2AUHA 3ZLSA 4WOVA 3HZTA 4CNHA 4E5BA 3BEGA 1OPLA 2QOFA 5HVKA 2GTMA 2XRUA 3NCGA 4FKRA 3RM6A 4BF2A 3HAMA 3ZM4A 1LP4A 2XK7A 5J9ZA 4G16A 2QODA 2C6MA 1R0EA 2XB7A 4I93A 3LKMA 1JSTA 3G90X 1FMKA 5DRBA 5EFQA 3V8TA 5ICPA 4QMMA 4PF4A 2UVZA 4JX7A 3HMNA 3ZRLA 4IX6A 4M97A 5HTBA 2RG5A 4FTOA 2C6OA 5CAOA 5DT0A 4RIYB 4ARKA 2EB3A 3ZBXA 4N0SA 2GMXA 4V05A 4BWPA 2ACXA 2CDZA 3LM5A 2YA9A 3VUDA 3ORXA 3OXIA 4H58A 4TYIA 4U80A 4GG5A 4GVJA 5JMSA 5D10A 3CQUA 3QWKA 4NM0A 3U6IA 4I5MA 5M07A 3QD3A 4Y83A 3L8SA 2BILB 3DK6A 2AYPA 3D5XA 3QQHA 4O96A 4R5YA 4OTIA 4XG2A 3TZ7A 4LL5A 3UJGA 4S31A 4BGGA 3R02A 3MY0A 5M57A 4IAZA 4ALVA 3UQGA 4FT7A 3HDMA 4YTFA 3T3VA 4KKGA 1WBOA 4P5ZA 4QMTA 1ZYDA 2HWPA 4EKLA 4RWIA 4K11A 4EOKA 5C03A 3DAEA 5D12A 4EH7A 4GUEA 4YNOA 4QQ5A 4AF3A 2HK5A 4AOJA 2VO7A 4PNKA 4XV3A 5AAEA 4I0SA 4FEWA 4BHZA 5EI2A 3FQHA 3DY7A 3GC9A 2FSMX 3A99A 3GEQA 3PTGA 3UP7A 5HESA 1H28A 3KC3A 5AM7A 4GK3A 2R3OA 3LHJA 2YM6A 3FEGA 3HV7A 5TR6A 3BHVA 4BDKA 3WIGA 4TYGA 3PIZA 3RK5A 3QHRA 4YMJA 3QCXA 2P4IA 3NUPA 2C1BA 3KRWA 5IEYA 3QGWA 5CF5A 4C62A 1TKIA 3QFVA 3ZLWA 1OGUA 1QPEA 1OKYA 4QQCA 3TUCA 2PYWA 3NR9A 1PHKA 1H07A 5DFPA 3E62A 5I9XA 3CGOA 4JAIA 4RWLA 4JR7A 3WF8A 3NAXA 1WBNA 4MXCA 3FSKA 4C35A 3FC1X 4GSBA 4TXCA 4AA4A 3GNIB 3NW7A 3OWJA 4HCUA 5J87A 5LXMA 4YUQA 4EZ5A 3FZTA 3LXKA 5HU3A 4ACGA 4AT5A 2WMVA 3F82A 3D5WA 3QCSA 4IAFA 4ACMA 3LFCA 3QRTA 3PXKA 3G33A 3BU5A 3MW1A 2GFCA 4YO6A 1AD5A 4EK3A 3ULZA 1BYGA 2UVYA 4RIWA 4I41A 3KVXA 2ZV8A 3DZQA 5HLPA 3TKIA 2HZ4A 3KXXA 1DI8A 3ORIA 4FG7A 4FV0A 3SAYA 5AAFA 4BCKA 2C6TA 3R1SA 4ASEA 3E7OA 3H30A 4AGUA 4X21A 2JDSA 3F2AA 2XVDA 5DBXA 5HG9A 1TQPA 2J2IB 3R73A 4EC8A 4DTKA 4FIGA 1A48A 4I5HA 4N70A 1GZOA 2RIOA 2C68A 3V5TA 4DG3E 4UN0C 4R5SA 3L9MA 5TOZA 3G2FA 4ZTNA 5CF6A 4L44A 4EJ7A 2WMQA 5IQAA 4IB3A 5LMKC 3WF5A 2XJ1A 1OVEA 3QQFA 2JDOA 2Z7QA 2JITA 4I4EA 3QD0A 4M69B 3JXWA 5LVOA 2VTAA 3FYJX 3R04A 3E3BX 2OSCA 4D2SA 5C26A 3THBA 5FDPA 4FVRA 4EH2A 4ZOGA 5CNOA 1J7IA 3PPKA 3FMMA 4RFMA 5ANEA 5HLWA 5HLNA 2VTNA 3QQUA 3F2NA 4AZWA 3MPAA 3UOHA 4FTKA 3UGCA 5EW9A 4EC9A 4F9YA 3FLWA 4UMRA 5AUTA 5HIDA 4MXZA 5IQEA 5L2SA 3NNUA 5M09A 5CSWA 4RVLA 5LMAA 2OXYA 1LEZA 4C02A 4HPUE 4HNIA 5A4EA 3LJ2A 1Q4LA 2B1PA 3U9NA 1SVHA 3PIYA 3BE2A 2LAVA 3VBYA 4FI1A 4S2ZA 3ZU7A 5C8NA 3WARA 3BLQA 2PZYA 5HG8A 2R7BA 3R21A 4EH3A 3VQUA 3KRJA 2WTIA 4MNEA 2XBAA 1J3HA 3EH9A 4C4FA 4L7FA 3QRIA 4RGJA 2ZAZA 5T68A 3R8VA 3SHEA 2XK4A 4XBRA 3VS7A 3MY1A 1ZZLA 2P2IA 1XHAA 1GZ8A 3Q96A 4MEDA 2HXQA 2YWPA 4WG5A 2XNOA 3IGGA 3MJ2A 4GFGA 2PUIA 4KB8A 2C47A 2QG5A 3UYSA 3P1AA 5CASA 4C7TA 2YZAA 5H8EA 2YDKA 3GQIA 4D1ZA 2JAVA 1Z9XA 3DK3A 4FSZA 1V0BA 2BRHA 4IADA 4I0RA 3BV3A 3AT3A 3EJ1A 4PL4A 2VO6A 4AGCA 4EEVA 2IZUA 4G9RA 3TNPC 4ZSGA 2C6KA 2VTTA 3WZDA 5A4TA 4NTTA 4PWNA 5B2MA 3PXQA 4ZSLA 4EJNA 2YCSA 3Q9WA 5TE0A 4ITHA 5EG3A 3RAWA 4FKWA 1RE8A 3ZUVA 5K0XA 3FLNC 5A4LA 3QKMA 3W55A 4PV0A 4ZLZA 4FEVA 2F7ZE 4CKRA 3GP0A 3RHXA 4A9SA 1W8CA 5DR2A 5EYCA 4KS8A 4F4PA 1TVOA 3ZO1A 3ROYA 5C4KA 3HX4A 3BU3A 3GCVA 3TNQB 3ZDUA 1YDTE 1NT2A 5HD7A 5GIOE 2ESMA 2R3KA 3L1SA 4YHTA 3E8EA 4ANNA 4A9UA 4BB4A 3COKA 4IH8A 5A54A 4IVBA 3D9VA 4FTLA 3AD4A 4D0XA 3SXFA 4YO4A 1PYXA 4KRCA 4O7RA 4F0IA 2ZDUA 3NIZA 3T9TA 4ZJVA 3W2OA 1XBCA 1Y57A 5AJQA 4PDYA 4FT3A 4DEEA 5FGKA 5AUXA 4FGBA 3BE9A 2XJ0A 1PXJA 1REJA 1PMVA 4G3EA 5EDQA 3QYZA 2F9GA 2YLEA 4AW2A 4E73A 3FLSA 3FPMA 4C3FA 2BRMA 3FYKX 4IVCA 2CLXA 4C33A 3NS9A 3LCDA 4YNEA 2EXEA 1H0WA 1NVQA 3JVRA 3F3VA 3KMUA 2B9FA 1BI8A 4LGHA 1OBGA 4N6YA 3FQSA 2BDWA 4N57A 4AGDA 4AU8A 1T46A 1NXKA 2UUEA 1YOLA 2YERA 3ZRKA 3NUSA 4BIEA 1E9HA 1GZNA 2CJMA 4JI9A 5HTCA 3ATSA 3C5UA 4F7JA 1M52A 2UW6A 3UO5A 4AFJA 2QU5A 3MFSA 4DHFA 4BTFA 5CALA 3TUDA 4EK6A 4GMYA 3QGYA 3W16A 1CM8A 3OT3A 2IW6A 4IJPA 2XJ2A 3FLYA 2CGUA 2EU9A 4LQMA 4EOOA 1CSNA 2GS2A 3DBDA 5FEQA 2UZTA 3UO4A 4UZHA 5K4JA 4FSYA 4F9AA 4FV6A 2VX3A 1Y8GA 4JBVA 3VBWA 3DOGA 4O7VA 3GB2A 3EN9A 4OTWA 3KK9A 4Q2AA 3C9WA 1I44A 4NCTC 4WUNA 4O7NA 1GJOA 1MP8A 4QMUA 1GIHA 4AFEA 4BCJA 2H96A 1H1QA 4BR3A 4O2PA 3QWJA 4Q5EA 3HAVA 3PUPA 2YDJA 5HNGA 1YI4A 1IEPA 4HVIA 1PRYA 2B9HA 4IX4A 4MAOA 2HCKA 4DTBA 5JFXA 2C30A 1OIRA 2G2FA 2RFEA 2E9OA 2ERKA 3A4PA 5FBOA 3MTFA 3RALA 3VWAA 3GI3A 3QD2B 4JS8A 3F88A 5HCYA 2J4ZA 1KE5A 2WU6A 1VYZA 2B9IA 2C6EA 5HVJA 4E93A 5AA8A 2BZJA 1Q61A 1GY3A 4XP2A 3V51A 2QC6A 4FG8A 4O0RA 5EQYA 3E63A 3L8PA 4AE6A 2R3RA 2ZV2A 3ERKA 3PJCA 4BDDA 4LYNA 5CZIA 1Y6BA 3LMIA 5A3XA 3V6RA 2CN5A 4DEHA 5DI1A 5FBNC 5CT7A 2R3FA 4RIXB 5BVKA 3ZUTA 1W82A 3MH0A 4GL9A 3TNHA 4CYIA 4FF8A 4RT7A 3MFTA 2QG7A 4DITA 1PXIA 4ZY6A 3EL7A 5IUHA 1CDKA 2X2KA 4H36A 5AUYA 5EW8A 4ANMA 4GT5A 1XKKA 4L43A 3VN9A 1OI9A 3P23A 4O7LA 1T45A 3EZVA 3FWQA 4RMZA 3EOCA 2BTRA 4IDVA 5L2QA 5M4FA 5CSVA 5EI6A 4R7BA 4ANSA 4LOOA 2HW6A 1BLXA 2QOCA 5HTIA 4MWIA 2E9UA 4H3PA 4XNEA 4DGNA 4F6WA 4M68A 4TN6A 4YR8A 3OOMA 3DFCB 2XNEA 3QD4A 4FV8A 3P7AA 4RJ4A 5D9HA 2I0YA 2VO3A 4G6NA 3PVGA 5AV3A 4KSPA 4ZTRA 4EOPA 4FTTA 5AM6A 4ZS0A 3KF7A 3UNZA 3E88A 1JPAA 3ETAA 4OTHA 1OL6A 4GYIA 2BFXA 4RX9A 4WUAA 3IOPA 4IZYA 4RX5A 2WMXA 3DKOA 3PJ3A 3R7UA 1OKWA 4X7QA 2YAKA 2VX1A 3BKBA 3EZRA 2XIXA 1WBTA 4PTEA 2IZTA 3UIUA 3UODA 2CNUA 1NY3A 3S3IA 4YJTA 5TKDA 4BCHA 3BGPA 3D7TB 2OJIA 3Q4ZA 4YJQA 3ACJA 3Q4UA 4MXOA 1XH4A 3WOWA 2FSLX 1VYWA 4E5WA 4HVGA 4KS7A 3FI4A 4Q5HA 5IKWA 4GJ2A 5FTQA 2ZB1A 2BR1A 3RCJA 3QC4A 4X6QC 5EH0A 4H3QA 4HNFA 4M84A 2OZAB 2X8DA 5AIRA 5E91A 5EM8A 4DBNA 2V22A 4DEIA 5CANA 4AW0A 5L3AA 3SOAA 3BYOA 3DAKA 4QNYA 4HCTA 4C37A 4CKJA 3UNKA 3ZO2A 2GNFA 3PE1A 5JQ8A 4FTIA 5AV2A 4IC8A 4QP9A 2PK9A 2OKRA 4WNMA 3IS5A 1W98A 3OXTA 2WEVA 3KCFA 4I22A 4ASZA 1SYKA 1XQZA 3C0HA 4RA5A 2O5KA 3LPBA 4JDIA 2FGIA 3TI1A 2F7XE 3E5AA 3ENHA 4H05A 2C3JA 4Y72A 2BKKA 4Q9SA 1TQIA 4RJ6A 2C5XA 3FMNA 3PPZA 4P7EA 3NUYA 3QBNA 3P9JA 3NIEA 2CSNA 4MXAA 3E8NA 5DOSA 3ZFYA 2QOQA 3OW4A 4TZRA 3N4VA 4PPAA 3BEAA 2J5FA 4AE9A 3F61A 5DR6A 1MQBA 3RGFA 5CQWA 2XNNA 5EYDA 2W4OA 3NCZA 3H9RA 5IA5A 1PXOA 4FT5A 3O17A 3VRZA 4C4IA 3CY3A 5ITAA 1DI9A 3EQGA 3A7HA 3QXOA 4U3ZA 4JDJA 1B38A 1A9UA 5BMMA 2Z7RA 4WHZA 3NNVA 1XWSA 3I5NA 5BPYA 3I6WA 4K77A 3WI6A 1WFCA 4F6SA 4FKLA 3WF7A 4K8AA 4XEYA 2OU7A 3LMHA 5IQDA 1Q8TA 3FL5A 2I0EA 4BYJA 4ZXTA 4ZTSA 4I1ZA 3Q3BA 3AC8A 4BCMA 4FOCA 2PVNA 4LM5A 3QTWA 3HVCA 5BVWA 3RP9A 1ZMVA 5L8LA 2X1NA 4TNBA 4PQNA 5J1WA 1OBDA 4BY9E 5DWRA 1PYEA 2WTDA 3LLAA 2EXCX 4CFVA 3MY5A 4RIYA 3Q04A 4FV3A 3DLSA 1FMOE 3GU7A 3ZSHA 2FSOX 4TY1A 4KINA 2WQOA 5KE0A 4F1TA 3W10A 3C13A 2BRNA 4BKJA 4DG0E 3DXNA 3KRRA 4PRJA 4BKYA 5I3RA 3JY0A 5JFVA 2GHMA 2XA4A 3MYGA 3NW5A 2X7GA 2I0HA 1GAGA 2BDJA 3SRVB 1KSWA 4MX9A 5C01A 2JFMA 4ZLYA 2ZYBA 5CU3A 2KTYA 1RDQE 4NUSA 4CZYB 1UWHA 3VULA 3ZCLA 4RZWA 2GQSA 5CY3A 4C34A 4M0YA 5JQ5A 4X3FB 3PRFA 3R7IA 3VUGA 3CLYA 2QLQA 3F3WA 4PNIA 3A8WA 4CG9A 4S33A 4QMSA 3FPQA 4ZMEA 4C36A 3NX8A 4PL5A 3QTSA 4YLKA 3CQWA 3DPKA 5L6WL 3UVRA 3VUKA 3ZBFA 4BBFA 3FXXA 4EUTA 2PVRA 4BCOA 4HJOA 5CAVA 2CHLA 3E3PA 3TCPA 5JKGA 5AR3A 4USDA 3VJOA 1PW2A 2X2LA 2VZ6A 5KO1A 2YM5A 3PVWA 5LMBA 4IE9A 5AR2A 2VWWA 4OBOA 1U54A 4FKTA 1CMKE 5AP0A 3Q5IA 4FKSA 3ZONA 4ZY4A 5JFWA 3OCSA 2PUNA 3W2CA 4IZ5A 3CKWA 4ITJA 4TWNA 3W2SA 4WG3A 2VWBA 4ACHA 2F57A 2ZJWA 3JS2A 1PXPA 3C5IA 3R9DA 2W4JA 5L2IA 4FSRA 3PY3A 3REPA 4F7SA 5CXZA 4F9WA 2ITOA 4C0TA 2CKPA 3N4UA 1JNKA 2WKMA 4I92A 3HV5A 4XH6A 2RFSA 4JQEA 4L9IA 5JSMA 3LFAA 2UW5A 5E1SA 3W2PA 4F6UA 5A4CA 4PY1A 4AW5A 5FG8A 2C3IB 2UZVA 4OBQA 2PVFA 5IMXA 2UW3A 3BGZA 3HMOA 3MJ1A 4ZLOA 3I0QA 2ONLC 4QP7A 4L67A 2CNQA 3TIZA 5HKMA 3ROCA 5F1ZA 4LRJA 4CMTA 5IQFA 4JLCA 4MF1A 4EKKA 2C5OA 4Z55A 5J9YA 3KRLA 1UU7A 2HENA 4AG8A 3UC4A 3NUXA 1YDRE 3OCGA 4XOZA 2W1IA 4ANBA 4J95A 4Z7HA 3R28A 2J0IA 1E1VA 2QO7A 5GJFA 1R39A 4C2WA 4EL9A 1P14A 4UYNA 3UOKA 3HRFA 1YWNA 3EN5A 2YN8A 3FI3A 4C4JA 1PMEA 1SNXA 2OH0E 2ZM1A 5HE3A 4AN9A 3W1FA 3HP5A 4L53A 5JEBA 4G9CA 5H9BA 4O38A 1P2AA 1IRKA 2C0TA 3O51A 4G6OA 4RFYA 4G5JA 1R3CA 2C5YA 4I6FA 4XLVA 2ITWA 2PUPA 2W1FA 4ZZOA 4R7IA 4XS2A 4FV4A 5HI2A 2XKEA 3IW7A 1ZMUA 2VTQA 1JSVA 2YABA 1Q3DA 3IPHA 4WNPA 3CD3A 4APPA 2A4LA 2CGXA 2VTLA 3H0YA 3HRCA 3FKLA 4JQ7A 3QHWA 4KIKB 2YM7A 5HBEA 3EWHA 3A7IA 4WNKA 4G3DA 1K9AA 4IDTA 4WO5A 3RTPA 3CS9A 2RFDA 4C4GA 5DR9A 3FXZA 1SZMA 3NGAA 5KMNA 3OCBA 4JOAA 5CT0A 3CTHA 5HU9A 4WT6A 2A1AB 3DDPA 5ANDA 4HVDA 4LGGA 3M1SA 2H34A 3LIJA 2WOUA 3VQHA 2NRYA 3IQ7A 4WIHA 3QTIA 2G2IA 4AUAA 2JC6A 5EDRA 3BV2A 4AZSA 2FVDA 3KF4A 3WF9A 3T9IA 3QCYA 4G3FA 4GT3A 3R0TA 3PWYA 4FSQA 3O7LB 5HO8A 2O0UA 5DIAA 4HGTA 5F94A 1LEWA 1Q41A 4IVDA 4O7WA 4JDKA 2O63A 4B8LA 1VR2A 5DT4A 4EWHA 4MWHA 3R8LA 4L3JA 2W05A 4MNEB 4QMWA 5BVFA 2I40A 3I6UA 4GVAA 4BDGA 4D4VA 1PJKA 3DJ7A 4JG8A 4ZSJA 1G5SA 1M17A 1NA7A 3ET7A 4IZ7A 1BL6A 1FPUA 1K2PA 2VO0A 4UZDA 2ITUA 2XK8A 5EYKA 3R9OA 3H3CA 4UV0A 4CQEA 2JBPA 4E4NA 5KX8A 2X6EA 1FOTA 1KE8A 3V5JA 3ZC6A 5J5SA 2DYLA 2YCRA 5IQHA 2B9JA 3IK3A 4G1WA 4WG4A 3CD8A 4MVFA 4QP2A 3FMKA 4JXFA 2GCDA 3UDBA 2QKWB 4PPCA 5C9CA 1URCA 5M56A 5B0XA 2XUUA 2R3LA 3RI1A 3DKGA 4FTUA 1KV2A 3PXZA 4E6DA 3D94A 5AAGA 3P4KA 2C6DA 4MD8E 4EOSA 5E8WA 4E6QA 3AGLA 2XYUA 3PP1A 3DZOA 3A7JA 4DH8A 3IONA 1W7HA 2OJGA 3MFUA 4EONA 3HMIA 4J52A 4MNFA 1MQ4A 3MN3A 5DG5A 5L6PA 2BHHA 5ACKA 5T6KA 5FTGA 5BMSA 3D2KA 4RIXA 3BX5A 5TO8A 2P33A 2QHNA 2J51A 5KUPA 1WVWA 2Y4IC 4A4XA 2P2HA 2WQBA 3W8LA 5CS6A 5IDNA 3OY3A 1XH9A 3FY2A 4XRLA 2X0GA 2RG6A 5AUZA 2WTVA 3ULIA 3HDNA 5E90A 5J8IA 4CSVA 5A6NA 1H1RA 1QL6A 3MI9A 5E8TA 1BX6A 4QQJA 5AP1A 3FLZA 2QO9A 2VWYA 4NJDA 5ANJA 4FIFA 5KBRA 3E93A 4O83A 4LMUA 5KZ0A 3SLSA 2QI8A 2OGVA 2WTJA 3LE6A 3NUUA 4BI1A 5CU6A 1LR4A 5K4IA 1NVRA 4LFIA 4EQCA 2QLUA 4IACA 2X39A 3UQFA 4F0GA 1OL7A 2A19B 3B2WA 3K3JA 1ZOGA 3GC8A 4YJNA 4EOQA 3PP0A 2BTSA 4RZVA 2ITVA 3N51A 3ZO3A 3FKOA 1CKJA 5CNNA 1OKZA 2Y4PA 4ZEGA 3PA5A 3R8ZA 4FZ7A 5CVGA 4FNZA 2B4SB 4JG6A 2CGVA 3CPBA 4D4YA 5HD4A 3ORZA 5BX0A 3F5UA 5IMEA 4OTDA 2F2CB 3WE4A 4BDIA 1H25A 2YFXA 3FL4A 3R9HA 2V7AA 3ANRA 4RJ8A 3V5LA 3D0EA 3ZM9A 4J99A 1YXTA 3ZMMA 5KHWA 3H9OA 2JIUA 4XG4A 5IG1A 2WIHA 5IU2A 1A06A 2WQMA 3B2TA 3GC7A 3KXHA 2VWVA 3JYAA 3R7GA 4FG9A 4CV9A 3VS5A 4ID7A 5HGIA 4WSQA 3DXPA 3FJQE 4G31A 1VJYA 1YWRA 2YIQA 2WMAA 4ZZMA 1I09A 1OL5A 3P86A 4BZOA 2ITQA 3GUBA 3RVGA 5JGDA 2Q0NA 4ZSAA 3G0EA 3WYYA 3R1YA 2WGJA 4CRLA 3W2QA 4CKIA 3TTJA 3AC4A 2VRXA 2VGOA 3PXRA 2XIKA 4NJ3A 3T3UA 3F9NA 3W32A 3U6JA 3C4EA 3TZMA 3RZBA 4UWCA 3ACKA 3KULA 5CEQA 4DFYA 4PMPA 3I7BA 3VAPA 3PVBA 5AIKA 3EFWA 5HICA 4PMTA 3DJ6A 3PPJA 2B53A 3AC5A 4LRKA 4DT9A 2GHGA 4UXQA 3F69A 3RPVA 4CZTA 4FBXA 2NP8A 3M42A 3WBLA 3SGCA 5M44A 4UX9A 4XBUA 3AT2A 3QC9A 5EI8A 5CQUA 5EYMA 4FEXA 2ZB0A 3VO3A 2QURA 4M8TA 2AC3A 2GQGA 4U97A 3ZS5A 5LARA 3CPCA 3KKVA 4JNWA 5IUIA 4V0GA 2IZSA 4YJPA 2Y6OA 3GOKA 3FZOA 2J0JA 1F3MC 1XBAA 2GQRA 4C59A 2WAJA 3LXNA 2OWBA 4P90A 3HL7A 4IWDA 4AACA 5L8KA 3FMLA 3FV8A 2GSFA 3KXMA 4DINA 2W1HA 5IUGA 2UZNA 3EKNA 3NEWA 3KULB 2ITNA 1DAYA 1SMHA 1RQQA 4TWPA 1FBNA 1B6CB 1GZKA 4ANQA 5LCKA 4C3RA 4BN1A 2YIYA 2C5NA 3N4TA 3OEFX 2ZVAA 4ALUA 5BQ0A 5E8SA 2XCHA 2QD9A 3FBVA 3QKLA 4FIHA 2BZHB 2IZRA 4HYSA 4KBKA 3PFQA 3LFSA 1HCLA 1DAWA 2XEYA 4GUBA 3VS6A 3R8MA 3TNIA 3DGKA 4JG7A 4BDJA 1QMZA 3FSFA 1O6KA 4BDHA 4F9CA 5B2LA 4DT8A 5L2WA 4YBKA 2WTKB 4CYJA 4TNDA 3V5QA 3EL8A 1G3NA 3BQCA 1WAKA 4O0SA 3D15A 4A07A 2YITA 2R0IA 3VS4A 1CTPE 3E8CA 3MH2A 3OBGA 2C6LA 1H27A 3AD5A 2C1AA 4JR3A 2YZLA 1OITA 3LCTA 4XLIA 2JKKA 3TIYA 1G8AA 3F2RA 1YHSA 4AGWA 2W5BA 4ZTHA 3BHUA 3RKBA 3CKXA 4KIPA 3R7YA 3RPYA 3RCDA 3V04A 5BVNA 4CEGA 3S1HA 1YKRA 2OJ9A 2C6IA
chains in the Genus database with same CATH superfamily
5GNKA 3SX9A 5IA1A 3RHKA 4AQKA 1OL2A 2R64A 3LQ3A 2JDVA 4CRSA 4YJVA 2PVHA 5BUEA 4I6QA 4BCGA 2QOBA 3R1NA 1YW2A 2ETMA 3H10A 3EMGA 5AV0A 3NZ0A 4D2PA 5FEDA 3RAIA 2C0IA 4GFMA 4FV9A 3WZEA 5KMLA 2PZIA 3B8QA 4MTAA 4U45A 4CG8A 4NTSA 3DFAA 3UIBA 4QMLA 4OAUC 3MB7A 2OXDA 1OPKA 3LQ5A 3Q6UA 1WVXA 1ZYLA 2CMWA 1RW8A 3I79A 1TQMA 3DS6A 2ZM4A 4ITIA 3SC1A 2JEDA 5E8YA 2FUMA 5FLFA 4HW7A 5BYLA 1XBBA 1ZLTA 2CPKE 2VWXA 3QKKA 2OFUA 5AV4A 3KREA 4XX9A 5LQFA 2LGCA 3KQ7A 3D7ZA 3UNJA 2BAKA 4OW8A 5CEIA 3OVVA 1REKA 1JKLA 1KE6A 2A27A 4DBXA 2PZPA 4NFNA 3ANQA 4BJJB 4O82A 1YVJA 3R63A 4U9AA 1M14A 4WNOA 3WZJA 3AT4A 4QT1A 4O21A 4QMZA 1YOMA 2VD5A 3UOLA 2Z02A 3ORLA 5L6OA 2Y9QA 4NW6A 5AWMA 1O9UA 4LOPA 3H4JA 1F0QA 2X9EA 3I1AA 2ETKA 3F5GA 4MD7E 4BDCA 4NWMA 3D5UA 3Q52A 5CTPA 4ERKA 5FRIA 1JKTA 2R4BA 1Y8YA 3LQ8A 3MTLA 2XP2A 3NW6A 5BVEA 3VF9A 2VTSA 2NPQA 3QRJA 3GOPA 3DLZA 3HYHA 4FIIA 4CT1A 3UMWA 3ODZX 3AG9A 2QNJA 3KGAA 4QMVA 2NO3A 4ALWA 4BICA 3VBQA 2EXMA 3W33A 3MBLA 4TT7A 5DPVA 2XMYA 3TNWA 5CSPA 4F63A 5I9YA 4FE2A 4NYEA 4FZ6A 4GT4A 4GIHA 1KUTA 3FDNA 2FO0A 3VHKA 3NSZA 3OMVA 3QYWA 3C4CA 2P3GX 4F9BA 1MRYA 4BC6A 1UU9A 4M67A 3NVMB 1MRVA 4MBIA 4RG0A 2BVAA 1XR1A 1KOBA 3OHTA 5HORA 2UW0A 1SVGA 2BAQA 5AFVA 3DBEA 4A4OA 4UWBA 4DFLA 3FZPA 4LUEA 4I6HA 3QZIA 2QKRA 3L9LA 2E9VA 4D5KA 1ST4A 4NZWB 4M14A 2HY0A 4E4XA 1DS5A 2HZNA 5EOBA 3I4BA 2WD1A 3W18A 4O0TA 3ID6C 4W4WA 3W0MA 2WQNA 3CP9A 2YACA 5DE2A 1FVTA 3VC4A 2IVVA 4NM7A 4AZFA 3V3VA 4R1YA 2X0PA 2YJSA 3GCPA 3KN6A 3DA6A 5AR8A 3GU6A 3Q6WA 3RAHA 5ETAA 1NW1A 1IAHA 3MB6A 3UVQA 3SVVA 4U3YA 2B7AA 5J1VA 3H9FA 4XYFA 5KMJA 3NYOA 3ZFMA 1XH7A 5C8KA 1YRPA 3RAKA 4QTEA 4R7HA 4FMQA 4Y46A 1GIJA 4L68A 4FV5A 4GKHA 2R3QA 3EKKA 4J96A 2YM4A 1FVVA 2OLCA 4DHIB 4U8ZA 4X3FC 3U54A 2GNIA 2PTKA 3EFJA 4A06A 4CLIA 1ZYSA 4PDSA 4U40A 5IDPA 4M69A 3UBDA 4GCJA 3FE3A 1OIQA 2WEIA 2XKCA 3V8WA 4OT5A 1PXNA 4OTFA 2ITPA 5HO7A 3QQJA 4O0XA 4ZJJA 3B8RA 5I9VA 4FKPA 5D41A 5J7BA 3LJ1A 4H1MA 4YTHA 1VEBA 4DH5A 2JIVA 3P7CA 1Q62A 4BKZA 4CFUA 3NVKI 1JBPE 3OY1A 1PF8A 2WOTA 1U54B 4DLJA 4K0YA 2X0OA 4AAYA 1M7QA 1YHVA 3TN8A 5FM2A 4A7CA 4YZMA 2AC5A 3COIA 3LFBA 1P4FA 2PULA 4DDGA 1L3RE 2VWUA 4FK6A 4CCUA 3LCKA 3K5VA 3IW4A 3UP2A 4J8NA 4AZVA 4E1ZA 4FTMA 4EH4A 4O27B 5M53A 1XO2B 3IG7A 3VW8A 4F1MA 3BYMA 5CSXA 3D5VA 4Y95A 5L4QA 3QLGA 4DEDA 4DFUA 3C4WA 4RIOA 3LJ0A 1HCKA 4HGLA 2XK6A 4UXLA 4X3JA 4GEOA 5AUWA 4B8MA 5IEXA 4IB0A 3W0RA 2R7IA 4MUQA 3ZSGA 5D7VA 4O1PA 4IW0A 5HBHA 2RSVA 1G8JA 2BMCA 4A9TA 5H8BA 1YQJA 4M66A 3V8SA 4FSTA 2ITZA 1UA2A 3ZLYA 5E4HA 3QUPA 2R3IA 3I81A 3PYYA 4X6RA 3RNIA 3OXZA 3QA0A 4Z9LA 3TKHA 4N4SA 4P2KA 2EB2A 4QYEA 3AMBA 5HQ0A 5BYZA 4GH2A 3TJCA 2WXVA 4TPTA 3DNDA 3KN5A 4K6ZA 4BTMA 3Q32A 1BL7A 2PL0A 3GCSA 5LVNA 3VF8A 4PDPA 4HVSA 5DN3A 3S0OA 1U4DA 3POOA 4DFBA 4F65A 5E8ZA 3G15A 4QYYA 3TV4A 4UWYA 3FHRA 4K2RA 1Q8YA 1R0PA 3PZEA 4O7TA 3R8PA 5I3OA 3D83A 3NYNA 2QO2A 5AEPA 2PZRA 3CTQA 5DLSA 2AQXA 2HW7A 5IEVA 3EQIA 4LMNA 2OF2A 4GG7A 3C0GA 1H4LA 1ZXEA 3QZGA 4FTNA 3PSCA 4ZMFA 1Q99A 4D58A 3ZOSA 5A4QA 4GIIA 2DWBA 5CXHA 1GIIA 4XG9A 2VUWA 3HMMA 3A60A 3GT8A 4QYFA 4APCA 4BHNA 5IH5A 4UMUA 3K54A 3BPRA 4FL2A 1U5RA 2VTHA 3QQLA 3EQDA 4OUCA 4JQ8A 4KD1A 3BBTB 4DC2A 4GS6A 4YTIA 3MSSA 1ZMWA 3EQFA 4NIFA 5ANKA 3PXYA 4DGLC 2SRCA 3UO6A 2JIIA 4RJ3A 2H9VA 3EB0A 1MUOA 3AXWA 3BLHA 4QMPA 3QLFA 5FUTA 3UDSA 2VTIA 4BDEA 3PJ8A 4UEUA 2WO6A 4QMXA 2WIPA 3RZFA 2X6DA 3F3UA 4S30A 4HGEA 3KIOC 2W0JA 5AMNA 2QU6A 4EZ7A 1DM2A 2Z8CA 3BZ3A 1Q8WA 3HECA 3QL8A 2IWIA 2QOHA 2W99B 2WMWA 3C50A 3G51A 3QUDA 4LG4A 4QYGA 1WZYA 4FL1A 2ZDTA 4FKOA 4BL1A 2GTNA 1V1KA 4FIEA 4LI5A 3AKJA 3SG9A 2P55A 3Q5ZA 3PA3A 3ZHPC 1XH5A 2VNWA 5HO6A 3UZPA 2EVAA 2WMSA 5F95A 5JRSA 4L6QA 4GK4A 3EN7A 3SW4A 4D1XA 3PLSA 3CBLA 3HV3A 5EHLA 4BGHA 3MIAA 5HCZA 1Z5MA 2W1ZA 3VS0A 3KXGA 3FMEA 1P5EA 3MVLA 3PG3A 3T8OA 3HRBA 4NIFB 2Y6MA 4F64A 3ELJA 5JN2A 4B4LA 5A6OA 3R01A 4IC7A 3BYUA 3POZA 4W9XA 1U59A 3AOXA 4YLJA 3TM0A 3EIDA 4FZFB 4LV8A 2REIA 1OMWA 5K9IA 2W5HA 4FSUA 2GNJA 4YTCA 2GU8A 1TZDA 4DAWA 2QCSA 1Q3WA 4CTBA 3HUBA 1IG1A 2XNPA 3Q9XA 2DUVA 3EN4A 4G5PA 4AT4A 4D9UA 1JAMA 4L52A 2VAGA 4J97A 3FY0A 2W9ZB 4NKSA 3OUKA 5CENA 5AR4A 3ATTA 3SW7A 4TL0A 4MF0A 4PP9A 4Z16A 4A9RA 3LCOA 3W0QA 5ETCA 2QOOA 1OL1A 4L45A 2J0MB 4RLKA 4UY9A 2GDOA 4YHJA 4O4BB 2BHEA 4FVPA 4FKUA 4RVTA 4YC8A 3MFRA 3ORPA 4CMUA 4E6AA 1M2QA 2XKDA 4M7IA 3UZRA 3BI6A 4N6ZA 4F7NA 4X2FA 4YZNA 3DDQA 4B6LA 2GFSA 4ZJIA 3EQRA 4FEUA 2VV9A 5M4UA 2WTKC 2HELA 2XALA 2V55A 3TZ8A 3CGFA 4JT3A 4LL0A 5IF1A 2C4GA 4O2ZA 4XCUA 3U8WA 4EUUA 4FTAA 3CSVA 4FUXA 4CFXA 2PVYA 3OOGA 5CU4A 4DF3A 2WMUA 4K1BA 4XG6A 4QTCA 2XZSA 4FR4A 2RF9A 1UKHA 3OTVA 4FV2A 4HPTE 1FQ1B 1JSUA 3DBFA 4C57A 2YM3A 4DEBA 4Y5QA 5C27A 1O6YA 2PMIA 4KBAA 1ZAOA 3UIMA 4DGMA 1G8KA 5HNIX 3R30A 4U7ZA 1JKSA 2YWVA 3LZBA 3WF6A 3QZFA 4JBPA 3C4FA 3O7LD 4OBPA 2W1CA 4W8DA 3G9NA 1Q8UA 3W0SA 3MVJA 3FAAA 4EK5A 3R9RA 4ZK5A 5BV3A 2W1GA 3P78A 4AOIA 4M12A 4BDBA 3W0PA 4IWQA 3RMFA 4CD0A 5EKNA 3FXWA 4BDFA 2ITTA 3FMHA 1SNUA 3JVSA 1JQHA 4FGRA 3U4WA 3CXWA 2B55A 4HYUA 5AV1A 4KAOA 4BYIA 2ITYA 3UOJA 5HCXA 4K33A 3KXNA 1YI6A 5ACBC 2ZV9A 4O22A 3PJ1A 2Z7SA 2YLFA 3BRBA 4F70A 3LMGA 3W8QA 3UG1A 4D5HA 1M7NA 5FXRA 3MVHA 3VUMA 4E7WA 3P5JC 5A14A 4CCBA 3IW5A 3MWUA 3KA0A 3NYVA 4UMQA 3V5PA 4BCIA 4QMQA 4O84A 4QTAA 4ZY5A 3AC1A 4TTHB 4A9YA 4NW5A 3DKFA 3VIDA 2AEGA 3P79A 3DK7A 5KNJA 4U44A 2JBOA 5C4LA 3O71A 4JBQA 1S9JA 2UV2A 4YJRA 5AP2A 3KMMA 4CV8A 4PP7A 4FNXA 5EW3A 2R3JA 2X8EA 3P5KA 4LGDA 1VZOA 4HCVA 4XUFA 3MS9A 3OF0A 3WZUA 4IXPA 4PPBA 4MKCA 2R2PA 3IDPA 1UNLA 1YXSA 2HZ0A 3WZKA 2ONLA 3HKOA 3IOKA 4M15A 3PZHA 3PY1A 2BZKB 4BTJA 5BYYA 4USEA 5AP3A 3RWPA 2PE0A 4ONAA 3H0ZA 3KU2A 4HVHA 5EDPA 2BPMA 2QVSE 2JFLA 4GRBA 4M0ZA 1YWVA 3PFYA 4O7ZA 3QTRA 3F7ZA 2P0CA 3DTWA 3NMUF 5IH4A 1AGWA 2IVSA 2OF4A 2VTJA 4EOJA 4D1SA 4GK2A 4O91A 4X2KA 5ETFA 4DCEA 5DMZA 3PXFA 4ZSEA 4WD5A 2X4FA 2WU7A 3O23A 4B99A 4D2VA 2GHLA 2WFYA 1UU8A 2IW8A 4IAKA 4JVGA 3JUHA 3QTZA 4OGRA 1BMKA 2BIYA 1WBVA 1WBSA 4HYIA 4F1OA 2WQEA 4NK9A 4ANLA 4R1VA 4MD9E 3FMDA 5IISA 3ML1A 2WMBA 5HOAA 2PVMA 4JBOA 3FZRA 1ZY4A 2YM8A 3PSBA 5CVHA 3FLQA 5E7RA 4XG8A 4EOLA 4HOKA 4IZAA 4D2WA 5DVRA 2XK9A 3PE2A 2RKUA 4Y5HA 5JK3A 3DKCA 2IG7A 2W1EA 3NRMA 3UQCA 4FRFA 2QONA 4QQTA 3OCTA 3SV0A 4AW1A 3D2IA 4CXAA 4O0YA 3OEZA 1O6LA 4OTPA 5A46A 3Q53A 3O50A 3ZEWA 2XNBA 4L46A 4RC4A 1XJDA 2VWIA 3PWDA 2V5QA 2GNLA 2OO8X 2XCKA 2QR7A 4YHFA 3HA8A 3NYXA 2Z60A 5KHXA 3UTOA 5LVMA 3DU8A 4E4MA 2PU8A 5EQEA 3AQVA 5I9ZA 4O7SA 4ZTLA 4IX5A 3K3IA 3CQEA 2O64A 3KFAA 4PTGA 5GJGA 2YISA 4BTKA 1GOLA 2WB8A 3FI2A 4X2JA 2HAKA 5GHVA 4EK8A 4NKAA 2B54A 4IWOA 3WILA 4BBEA 5BUIA 4R78A 2WTCA 3Q2JA 1H8FA 4XP0A 3QRUA 4KWPA 1UVRA 2BUJA 4E5AX 4EH6A 1JOWB 4C8BA 1H0VA 4I94A 2UVXA 4DFZE 3TDVA 4IM3A 3HNGA 4JRVA 4FX3A 5F20A 2XNGA 4FL3A 2ZMDA 5AA9A 4EH8A 3LFFA 2OIBA 2QHMA 1W2CA 2OJFE 4J7BA 4YJUA 3OWLA 2PSQA 5HIBA 3MGYA 5GINE 2VGPA 2JLDA 3Q2MA 2ZOQA 4EBVA 2UZLA 3MH3A 3D7TA 5IPJA 4D2RA 1QPCA 3DT1A 4EQUA 4J71A 2FSTX 3NNXA 4RPVA 1URWA 4ZAUA 2UZOA 5K3YA 4Z3VA 1FGIA 1YXUA 3KY2A 3PLAE 4KKHA 3RJCA 3DBQA 3LXPA 1KWPA 4YZCA 4CLJA 2VTPA 4TYHA 5CEPA 4AN3A 4EZ3A 3MESA 1IA9A 3OWKA 4IVAA 3LFEA 3QAME 5M4CA 3RNYA 5DNRA 2J7TA 2JKQA 3FZSA 3SD0A 4F99A 2PE2A 2F7EE 2Q83A 3F5PA 4I4FA 1V0OA 3TJDA 3EFKA 1GNGA 1M2RA 4NSTA 5AX3A 3CR0A 4C58A 1H08A 3SA0A 2IPXA 2XKFA 4I20A 2Z2WA 2XIYA 4JIAA 1K3AA 2WHBA 3DJ5A 3IW8A 4O86A 2XIZA 5JH6A 4K9YA 2OIQA 5J9LA 3G9LX 3QTQA 1YHWA 3FI8A 4WBOA 4FV7A 4L3PA 3QRKA 4AQCA 5CEKA 3PRIA 2R3HA 3W2RA 2QR8A 3GU8A 5CF4A 4KUJA 3OS3A 2WELA 4I3ZA 5AUVA 2R3MA 4ZZNA 2YIRA 2VU3A 4X2NA 1KE9A 3MA3A 3F6XA 4IAAA 4PL3A 5LCJA 1ZYJA 4ZTQA 1JWHA 3BYVA 1UWJA 3DTCA 4FSMA 4MCVA 5AUUA 5GZ9A 1CKPA 3DAJA 1RJBA 3LFQA 4O6LA 5TF9A 4R77A 3NUNA 3DQXA 3ALNA 3BWJA 5F4NA 5AR7A 4CT2A 4CZUA 5BUJA 2XNMA 4IWPA 4K18A 2GS6A 2J9MA 2OBJA 4U42A 3RPRA 5JGBA 5LOHA 2CKQA 4KIOA 3ZEPA 2H8HA 1V0PA 2HXLA 4KRDA 4O6EA 4TWCA 3TTIA 4MXYA 2PVJA 1HOWA 4AZEA 5LMKA 4ZS4A 1OIUA 2OZAA 4EOIA 3O8UA 4I23A 1IAJA 4DH1A 2CGWA 4RVKA 2QQ7A 4MH7A 1U46A 2OK1A 4QPMA 4LV7A 4QDVA 4AOTA 4L01A 2VNYA 4FZDB 4J1RA 4F08A 3KL8A 4V0GB 1UV5A 3PJ2A 1ZWSA 2J0LA 2UW9A 4TW9A 3EN6A 3R00A 4RIWB 1ZY5A 1CKIA 3UIXA 4AX8A 3TXOA 3E64A 3O8PA 3CJFA 3CIKA 4OT6A 2PMLX 1LUFA 4JIKA 1WCCA 5CVFA 4KNBA 3WE8A 3IO7A 4YSMA 2I7QA 5DYJA 4II5A 5CI6A 4KA3A 4ERWA 3BHYA 4IBMA 4CFWA 4PDOA 5I5ZA 3R6XA 4H39A 2OZOA 2CKOA 1BKXA 2JDRA 3DNEA 4YC3A 4F09A 3FC2A 2CNVA 1OECA 2Y7JA 4YLLA 5EHYA 1PKDA 3ODYX 5HZNA 3KCKA 3KEXA 4GW8A 5CSHA 3OW3A 3C7QA 3LLTA 3C1XA 2Z7LA 3HV4A 1QCFA 4WSYA 2OW3A 2X2MA 3R2YA 5KBQA 3F66A 3EHAA 5M08A 4IHPA 1R78A 1YI3A 4W8EA 2UZDA 4FNWA 3FMJA 4G3CA 4QP4A 3CY2A 4YZ9A 5CU2A 3SQQA 5L2TA 5L8JA 4FKJA 2EWAA 2VX0A 3VUTA 2WZJA 4OTGA 3VS1A 4NEUA 5D7AA 3ALOA 3DQWA 1L8TA 3GFEA 3OD6X 4EWQA 5K5NA 5M06A 4LRMA 1UNGA 1OZ1A 2E2BA 1MRUA 5JRQA 3OG7A 3OTUA 4L7SA 3VBTA 4WBBB 3ZDIA 2GPHA 5GZ8A 2JDTA 2V62A 2HZIA 2KULA 4L42A 1B39A 2ZV7A 4NH1A 4NM3A 1H00A 3A4OX 2UZWE 5FP5A 3R8UA 3ZUUA 4MYGA 5E1EA 2WNTA 2ITXA 4U0IA 4QDEA 4XMOA 4HGSA 3ZO4A 1OKVA 1Y91A 2I6LA 5EHOA 4AAAA 2A2AA 3SOCA 4C2VA 4E6CA 3HV6A 2QOIA 2RGPA 1TFFA 3I60A 3RINA 4LUDA 1SVEA 3FUPA 3EFLA 3HMPA 3TUBA 3AD6A 1PXKA 4Q9ZA 4J8MA 3KVWA 3GU4A 2PMOX 3VW6A 2FA2A 2XRWA 3MPTA 5IQCA 3SKCA 4MBJA 1SM2A 4R3CA 4TYHB 4ACDA 5KCVA 3PSDA 3RWQA 4DGOA 3PVUA 2VTRA 3EQCA 5HE2A 3S95A 3VS2A 4EYMA 4ORKA 3NWWA 2G2HA 2VWZA 3QA8A 4GYGA 3LVPA 5E92A 3KRXA 5CAPA 5HEZA 3ORMA 4H1JA 2PUUA 4ASDA 4J98A 4WKQA 2JAMA 4B7TA 2YCQA 2HYYA 5FTOA 3ZZEA 4MQ2A 1PXLA 4D0WA 3LOKA 2I0VA 3E8DA 4CFMA 4FICA 4FSWA 5T3QA 4W4YA 1PMNA 3DV3A 5I9WA 2GNGA 3RPOA 4D4SA 2R0UA 3Q9ZA 3VRYA 3TDWA 5HHWA 2UZUE 4XV9A 5M55A 4GV1A 4DFNA 1W2DA 2E9PA 3F5XA 5LWNA 3RBWA 4FC0A 4FTCA 3TT0A 4FJVA 4G6LA 3L8VA 2BAJA 5CLPA 3ZXZA 2UW4A 3R2BA 1ZYCA 2FB8A 2UW8A 4O0WA 5FXQA 3VBVA 3I0OA 4D9TA 2O8YA 2CCIA 4IB5A 4FYNA 3MV5A 3QUEA 4FT0A 5M51A 3GVUA 3A2CA 3C51A 2XK3A 4AP7A 5LJJA 4U6RA 4YJOA 2FH9A 3DXQA 5J5TA 2VTMA 1P4OA 4YURA 3A7FA 4UMPA 3UC3A 4YBJA 5JGAA 1H01A 1WBPA 3IDCA 4O1OA 5GIPE 1ATPE 4IAIA 4QP1A 4C4HA 2BIKB 5AP7A 3P0MA 3LM0A 5I4NA 3U6HA 2GNHA 3ENMA 2OICA 2XH5A 5IA4A 3LW0A 3IW6A 5TT7A 5KMKA 3AKLA 1APME 4TYEA 3R9NA 3GXLA 4FA2A 2C3LA 5IA2A 4DN5A 4UALA 2WMRA 4FTJA 1YDSE 2XM8A 2R3GA 4DG2E 3E7VA 4RVMA 2VN9A 4U5JA 4RLLA 5IQBA 3U87A 4NCTA 4XOYA 4LOQA 2ZFYA 3NLBA 4WRGA 3Q4CA 5HG5A 3QQGA 4PUZA 3BCEA 3NDMA 2BCJA 3F3TA 3BBWA 3KB7A 3CEKA 3OZ6A 4O0VA 4RC3A 4Y8DA 5B2KA 4DEAA 2PPQA 4O7YA 2YCFA 3DB6A 1YXVA 2CCHA 3UMXA 2PZ5A 1FGKA 2WMTA 2Y8OA 4G34A 4UMTA 2X81A 5C8MA 4O81A 2HOGA 3HUCA 3MA6A 1ZOHA 3ZLXA 4DGGA 4USFA 4CMOA 2IN6A 3Q9YA 2UZBA 4JX3A 4CFNA 4IMYA 3AMAA 3UVPA 5FQDC 2Y0AA 4H3BA 2C0OA 4ANOA 1Y6AA 4S34A 3G0FA 4D2TA 4EHVA 4G17A 3L9NA 4F0FA 4MQ1A 2OIDA 3P08A 4MK0A 2EUFB 1J7LA 5DGZA 5AP6A 4ZIMA 3VNTA 5HX8A 5FP6A 4JAJA 3BHHA 4X2GA 4X0MA 5E8VA 5DH3A 4JRNA 5E8UA 5FD2A 4QTDA 4BIDA 5CAUA 4XV2A 1UU3A 5KKRB 2BRGA 3PDTA 1NVSA 2ZM3A 2RL5A 3EQHA 3R83A 4BCNA 4DCAA 3R22A 3I5ZA 4DH7A 3QX2A 1IR3A 2OXXA 3ORKA 4KBCA 4BZDA 5IA0A 3Q4TA 3A61A 4U41A 1Q8ZA 2G15A 3G6GA 2UZEA 4OLIA 4V04A 4NT4A 4IQ6A 5KMOA 3VVHA 5CI7A 4CGAA 3MH1A 2J90A 1H1SA 3OFMA 3O5AA 3QXPA 2IVUA 4EK4A 1PMUA 2O3PA 3V5WA 4RA4A 3UE4A 5KZIA 4X3FA 3ZZWA 3IECA 4C38A 5BNJA 2B0QA 4QRCA 4BI2A 2NRUA 4NL0A 3GCQA 1J91A 2DQ7X 5CZHA 3Q60A 2XYNA 4YZBA 3O96A 5HG7A 3VS3A 1OGYA 3HA6A 5I0BA 3FKNA 1PXMA 3LXLA 4P4CA 3G5DA 3UG2A 4ZP5A 4OAVB 2NNWB 1JVPP 2YDIA 2GS7A 4M13A 2XF0A 1FVRA 3AMYA 3GU5A 5GZAA 1FINA 5KMIA 4FV1A 4S32A 5HIEA 2ZMCA 3TG1A 4CFFA 1H26A 2PY3A 1F5QA 3ITZA 1X8BA 2A0CX 3OBJA 3TV6A 4EI4A 4RRVA 1XMMA 1QPDA 3TZ9A 1QPJA 3IGOA 5H8GA 3AKKA 4AN2A 4XG7A 5CAQA 4NFMA 5CEMA 1E1XA 2WTWA 4CVAA 5CYIA 5HX6A 3V6SA 4QP6A 3U9CA 4QP8A 2FYSA 3GGFA 4R8QA 3ORTA 1PY5A 3II5A 3TACA 3P7BA 4W9WA 5CU0A 1IASA 3BU6A 4IM2A 5G1XA 2JKOA 4XJ0A 2XARA 4IFGA 3K5UA 4IIRA 4BDAA 4BFMA 3M11A 3C0IA 2XIRA 4FKIA 4FUYA 4BIBA 4DTAA 4FKVA 3FQEA 4GKIA 5E8XA 3ZTXA 1KOAA 4UYAA 2ETRA 4L3LA 2JKMA 4U81A 3RK9A 4FOBA 2CKEA 3QZHA 1OPJA 3KK8A 3QALE 3VUHA 3COMA 4C4EA 5EKOA 4QMYA 1BUHA 4BJJA 5H3QA 2J50A 4E8AA 3BHTA 3GQLA 4PX6A 2F4JA 3SXSA 5J7HA 2O2UA 1ZRZA 2J5EA 3GENA 5BVDA 2W1DA 4QPAA 1LPUA 4RQKA 4DA5A 1J1BA 2BROA 3CTJA 3PY0A 5AR5A 5KMMA 2W17A 3A62A 5EK7A 4BZNA 1ERKA 4R6VA 1STCE 1ZOEA 4FZAB 3LCSA 2BZIB 1M2PA 2YHVA 2XEZA 2QOLA 4KABA 2W06A 4RC2A 4AS0A 4ENXA 4IM0A 5H2UA 4Z7GA 4IJ9A 4CQGA 4RWJA 4BVUA 2R5TA 2NYAA 4YC6A 4XG3A 3VJNA 2X7OA 3EQBA 4EORA 2DS1A 2CN8A 5DEWA 3EQPA 4XP3A 3W0NA 5HNBA 3ORNA 4EOMA 5E9EA 4KIKA 1J7UA 4D55A 2F2UA 2G01A 1H1PA 4L00A 3BGQA 3U4UA 3V01A 4AA5A 4ENYA 4FTRA 4EQMA 3S4QA 3COHA 2X9FA 2BDFA 2G9XA 4HYHA 4E26A 5DEYA 2W96B 3BYSA 4U43A 3RK7A 5C1QB 2BRBA 1WVYA 4FKQA 2PE1A 2YIXA 1W83A 4P5QA 4RJ5A 5D1JA 4A4LA 4BWKA 4YZDA 1Q97A 4O0UA 3BQRA 2O65A 5J79A 4TRLA 4G2FA 4BCQA 5B7VA 1ZZ2A 3O0GA 1KE7A 4E4LA 4QO9A 4BBMA 2C3KA 5HE0A 3GC0A 4IX3A 5FDXA 4YPDA 4I5PA 3NUAA 3E87A 4WA9A 1BI7A 3G6HA 4QMNA 4QYHA 3S00A 1OM1A 5ANIA 4QD6A 3LAUA 3BWFA 4YPSA 3GFWA 4TKSA 4EYJA 2IVTA 2IF8A 4RX8A 1R1WA 5BVOA 4RWKA 3HGKA 3I7CA 3OROA 3A7GA 4MXXA 5IZFA 5KKRC 5EOLA 5EM7A 4QPSA 4IB1A 4BCPA 4B0GA 2I1MA 4ASXA 1OB3A 3FZ1A 3K2LA 3F3ZA 4GFOA 4JJRA 3TL8A 2JD5A 4RX7A 3QQKA 4FK3A 2A98A 4E20A 2YEXA 5HE1A 3ZFXA 3R1QA 4EHGA 3R71A 3GBZA 3LFDA 1XH6A 3MIYA 2IEWA 4OR5A 4UB7A 4EBWA 4C3PA 4WRSA 1WMKA 2R3PA 3VHEA 5LVPA 4DH3A 3CCNA 3QX4A 4HZRA 4YP8A 1Q5KA 3UZTA 5CF8A 4QTBA 1S9IA 3O2MA 3PG1A 5M4IA 4YU2A 5F9EA 1J1CA 2W7XA 5DA3A 2HIWA 3N9XA 4FSNA 4RQVA 3R7EA 3TWJA 2BALA 2R3NA 5AP5A 2PWLA 3TMOA 4OTQA 3AGMA 4FEQA 4HZSA 3C4ZA 2J0KA 3SG8A 3BLRA 2X8IA 1KV1A 3SRVA 4KKEA 3HLLA 3UPXA 3QTUA 2ERZE 2PVLA 3F7WA 2YIWA 4MHAA 4NM5A 3ZYAA 3LFNA 2JGZA 4KIQA 4V01A 5K0KA 5K5XA 1OUYA 4JMQA 5AX9A 5GJDA 3L8XA 3ZH8A 2BFYA 1UKIA 3JY9A 2Y4IB 1AQ1A 4DEGA 2IW9A 3L9PA 4W4XA 2XS0A 5IQIA 5LWMA 4FVQA 4RJ7A 4RFZA