5EI8A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
280
structure length
261
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGTVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 261
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ei8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ei8A01
3PE2A 1V1KA 4D9UA 3TG1A 1BKXA 1ZOHA 1W7HA 4EQMA 3ZTXA 5BYYA 2PULA 2XM9A 4LUDA 4E6QA 4UMUA 2OJGA 3C4XA 4MQ1A 4AA4A 4F7NA 3EJ1A 3UPZA 3RTPA 3TUCA 2X0GA 2QU5A 4USEA 3MA6A 3W10A 4QYEA 3C0GA 3LLTA 4DFYA 5CANA 2R3NA 2F2CB 3TXOA 2YM4A 2C4GA 3IW7A 4WIHA 5IA1A 4J95A 3FKOA 3FLYA 3D5WA 3LHJA 3PJCA 5H8GA 1WVWA 4AE6A 4PDOA 1Q8YA 5LVNA 1KE5A 2BZJA 4NWMA 3LFNA 5IQIA 4DBNA 1ZZ2A 4AN2A 2XNPA 3AC4A 4P2KA 5HKMA 4M8TA 5HLNA 2HW6A 3M1SA 3O7LD 4FICA 3TNQB 4DFXE 4WNMA 3MYGA 3QTIA 1UWJA 4R3CA 2YWPA 2PVLA 4W4WA 4RMZA 5AUYA 3VJNA 1ZY5A 3QFVA 4A9TA 1PKGA 4LYNA 5JMSA 1M2PA 3PXYA 4TYJA 3ZEWA 2C0OA 1J3HA 2VTSA 3D7TA 4YJVA 4GYIA 3W2PA 3QC9A 3DA6A 3AGLA 5IU2A 3NGAA 4KS7A 4YJUA 4PPCA 3ORZA 3FKLA 4GT4A 1YDTE 4KBKA 4X3FA 2YDJA 4YC6A 2OZAA 5JGAA 4W8DA 4FKRA 2PUPA 3DK3A 4L52A 3IOKA 3PFQA 5LMAA 1JWHA 4RVKA 4C4IA 4E26A 5JQ5A 5FBOA 4PMSA 1G8AA 4ACDA 5HLPA 2HY81 2V62A 3MPTA 4EH2A 4FA2A 2DS1A 2BZKB 3C0IA 1MP8A 4G1WA 1KV2A 3TACA 5CALA 2UW4A 4EUTA 4FKUA 5KO1A 2V22A 4UMTA 1PHKA 1WBOA 3SLSA 1P4OA 5JH6A 3EKNA 3QQFA 3V5QA 3DKFA 1WZYA 5E7RA 3KRWA 4GEOA 5IA3A 1PXLA 2YCRA 3GGFA 3RAHA 1P5EA 1PKDA 2XKCA 3QZHA 2YZLA 2YM5A 3JXWA 3QZGA 5LMBA 2UW3A 1RW8A 3FL5A 3NNWA 4BCQA 4ANSA 4AW1A 1OI9A 2IJMA 2IZRA 4M69B 3QLFA 4XX9A 3W2OA 3GI3A 3QKMA 3VUIA 1REJA 5HVYA 2ITXA 3TV6A 2JKMA 3UOLA 3EQHA 3DTWA 3N4TA 3UNJA 4EUUA 2UZUE 2JD5A 4OGRA 2PVJA 2WGJA 2WIPA 5DR6A 1P14A 1I44A 3E93A 2C6DA 3R1YA 4BDAA 4KIOA 4RQKA 3RI1A 5DI1A 4S33A 5A4TA 5F9EA 1OITA 3ZM9A 4FSWA 2Z7QA 5AV2A 5HNGA 3EFJA 2QONA 3BHUA 3SVVA 4FF8A 4JOAA 5IDNA 3LMHA 3PXQA 1WBNA 4FG8A 4O0WA 3FLSA 4QYHA 4YJTA 3Q2JA 2PYWA 4FE2A 3OWLA 2PPQA 4O0SA 2P33A 3UQFA 3OEFX 4R78A 1WBPA 3AD5A 1QPCA 4E4LA 4WNKA 5I3OA 2XBAA 3QTZA 2G01A 3JVRA 4XMOA 2BKZA 4ZEGA 3F82A 4I5CA 4AP7A 2YIYA 3DBFA 1ZYLA 3OP5A 4CMTA 3QQHA 3OCGA 4EOIA 3VBTA 2F7XE 4TN6A 3NEWA 3UIMA 1PMNA 2C6MA 2Y7JA 2C6IA 4QMLA 1H28A 4H1MA 3ZONA 5T3QA 4OT6A 1JSUA 5J8IA 5L6OA 3GCSA 4YTHA 3G15A 3OZ6A 1ZRZA 4HPUE 2VN9A 3JR1A 1FQ1B 4DH3A 3DXNA 4DEEA 3ANQA 5C8KA 2O5KA 3LFAA 1WMKA 4AWIA 3FMKA 2VO6A 1XH8A 4ZZMA 2BAKA 5AADA 3O71A 4F1TA 5A4EA 1OPLA 3IW6A 4OT5A 5ANIA 5HQ0A 4XP2A 5EHLA 1KSWA 4ZSEA 2F2UA 2J90A 1G3NA 1JSTA 2XH5A 3IGOA 3MW1A 4XV9A 4ALVA 2BIKB 3ANRA 4D2VA 4BI2A 2W1HA 4F6SA 3KQ7A 3T3VA 4UWCA 3R6XA 1GZ8A 3F3VA 3GENA 2J0KA 2WMWA 4FSRA 2PZPA 4I4FA 5D41A 3KB7A 3RMFA 4IWPA 3FZOA 3QUDA 3V6RA 4EH9A 2G1TA 4RX7A 3CLYA 4EHEA 4FSMA 3PIXA 4FT3A 4X3FB 5DOSA 2J0IA 3P7AA 4OBPA 2QR7A 5HHWA 3GP0A 3R8VA 3R7YA 3E8CA 1FMKA 3A4PA 3FLNC 4BCOA 4BDEA 3NAYA 2WMAA 4Q5EA 1DAWA 3FI3A 4ZSGA 4EH4A 5FEQA 2VAGA 5HD4A 4GT5A 4GMYA 3EQFA 4PY1A 3ATSA 5K3YA 5H8EA 3VF9A 3MPAA 3R1QA 4Y5QA 3OWJA 3DBEA 4YHJA 1FVRA 2JITA 3MS9A 1TQMA 3EYGA 2YERA 2O65A 4UYNA 2GFSA 3DK7A 2QNJA 1XWSA 1B38A 4U42A 5FGKA 3WF5A 2F4JA 1WBSA 4RIWB 5DGZA 1OPJA 2CNUA 2QD9A 5HU9A 4C3RA 4C61A 2X9FA 2XIYA 3QCSA 3OFMA 3GCQA 3OY3A 5JEBA 5DN3A 3Q9XA 3UDBA 2XUUA 4BY9E 3EN7A 1H08A 4ZK5A 4AGCA 2IPXA 4EOMA 4FZAB 1YKRA 3EZRA 5J9LA 3CC6A 3I6WA 4BCNA 3ID6C 3D5XA 3TKHA 5HGIA 4I6BA 3U6JA 1ZARA 4D1ZA 4L3PA 3FSKA 3ZBXA 5DPVA 1OZ1A 2VTNA 5I3RA 3MH2A 5E8WA 3FQSA 4L43A 4GJ3A 3NYOA 3JYAA 2RL5A 5FEDA 4DINA 2YM3A 4FKVA 4W4XA 4QP1A 3OVVA 5A46A 1NXKA 4I5MA 4QTAA 2XKDA 4M7IA 2XIXA 5IA5A 2XK3A 4RZWA 5HU3A 3MVHA 2I40A 4XV1A 1GIHA 2E9OA 3DDQA 5FQDC 2PE2A 3R8MA 2IO6A 3FYKX 4WA9A 3DNDA 3E8EA 4BL1A 2OICA 5K5NA 4ID7A 4DG3E 4DFLA 3RINA 3N9XA 4IWOA 4U7ZA 4R1VA 4X0MA 4CCBA 4WUAA 3VHKA 1PF8A 3W16A 3DOGA 1STCE 4BDCA 4FK3A 3LIJA 3LCSA 5CEQA 5AP1A 3A7GA 3RWPA 2I0HA 2ZMCA 4OTRA 3ZCLA 1GZKA 3WARA 1Q61A 2W99B 3UO5A 2W1CA 1JLUE 4Y85A 3HLLA 5CY3A 3Q4ZA 4ZJJA 5CZHA 2BALA 4EC8A 4BZNA 3AC1A 1BMKA 2XZSA 4JBOA 4V04A 3UC3A 2R64A 4F7LA 1JKKA 1REKA 2JGZA 3NSZA 4RWJA 3LFQA 2OF4A 5AR8A 4X21A 5KKRB 5KZIA 1BYGA 4FSTA 2PZYA 3ATTA 4FV6A 3NVMB 3RZBA 5CU4A 4EBWA 4EOKA 4CEGA 5I9ZA 4ZJVA 4GFOA 1OB3A 1W98A 2G2IA 3D14A 4NTTA 5AM7A 4BGHA 4A06A 1Q3WA 2CLXA 3MA3A 5HTCA 1RE8A 4FT5A 1U4DA 2W4OA 4J1RA 3F2NA 2JIUA 4NT4A 1FGKA 4JR7A 4O1OA 4Q9ZA 4OTWA 4EONA 2UVYA 4FV2A 4A4LA 4F0FA 1PMEA 2R3GA 2CLQA 3Q52A 2WTIA 4MF1A 3ZRKA 1FVVA 1R3CA 3F7ZA 2BZIB 4OW8A 5HG8A 2QOHA 1ZLTA 3U87A 5CAUA 4AZVA 3VW8A 5D11A 5LMKC 1RJBA 2FH9A 4D0XA 4OTIA 4FVPA 3VJOA 3PYYA 3VS5A 5E92A 1GIIA 5FTOA 3Q53A 3DPKA 5TO8A 4YTCA 5AUZA 2IW6A 2WFYA 3HEGA 3KMMA 4UV0A 5CF8A 2YABA 4DBXA 2B0QA 3F88A 5A3XA 4QTEA 5D1JA 4O83A 4GJ2A 1CM8A 1OL7A 4UZDA 5LVOA 2UZOA 2EVAA 3VUHA 3ZYAA 4GKIA 2IVTA 4PL4A 2B4SB 2W96B 3C51A 1PRYA 3R7VA 3H0YA 1KE6A 4RJ3A 1OKVA 4B9DA 4E3CA 5K5XA 4DG0E 1UV5A 4ZLZA 5M57A 3BHHA 3RBWA 2XB7A 1OMWA 5IH5A 4BDKA 2WU6A 3QU0A 3S95A 4TKSA 3TEIA 4ACHA 2R3OA 4DYMA 4E73A 4IB1A 5EM5A 2HXQA 4JDIA 3DNEA 5I5ZA 4O7ZA 2R2PA 2PVFA 3KF4A 3MTLA 3QWJA 4LRMA 4FSUA 3WZJA 4QMXA 4NJ3A 5F95A 3RP9A 4C38A 3BEAA 3JY0A 3FLQA 5JK3A 1SVHA 1V0BA 3BGPA 4W4VA 4LL0A 1ZOGA 2QO7A 4ZZOA 4ZY4A 2CJMA 5D10A 3VNTA 4IX5A 3UTOA 4CZUA 3PVWA 3ZC5A 4NCTC 3B2TA 4JX7A 1KOBA 4RA4A 2JDSA 2WTJA 1LEWA 3BHYA 4YC3A 3PXFA 4YJPA 2P0CA 3LQ5A 5GZ8A 2I0YA 4KKGA 4D4RA 4QYGA 3V8WA 1QL6A 2BIYA 3BLQA 5DIAA 4R3PA 3W55A 4AUAA 4V0GA 3O23A 3VWAA 3KRJA 4ZXTA 3PLSA 2FO0A 5IDPA 3COIA 4MBLA 4WHZA 4JDHA 3VBVA 5IUIA 4Q9SA 4EYMA 1GOLA 4KABA 3HNGA 3HYHA 3NR9A 4MD9E 4D5KA 3OT3A 3LLAA 2XYNA 3VVHA 4F4PA 3DB6A 3QAME 4O91A 3AC5A 2J6MA 2R4BA 5DG5A 4X6RA 2QVSE 4Y73A 3RHKA 2QO2A 4FR4A 5CF4A 4YZ9A 3ZLYA 1HCLA 2GSFA 2RFNA 3CP9A 4O7LA 4QTDA 1S9IA 3V3VA 4O81A 4AT5A 3R9HA 4AA5A 5ANDA 4M67A 3ZBFA 2VTPA 2G9XA 1LP4A 4I20A 5J1VA 2W0JA 3ETAA 3LFDA 3HDMA 1SYKA 4F1MA 1OL1A 1YXUA 3HA6A 2HWOA 3BU5A 4IM2A 2XNEA 4PTGA 4YR8A 3NUAA 4EKKA 4AOIA 1ZAOA 3S00A 3FUPA 2ZDTA 3C0HA 5AIRA 3TIYA 4F09A 4D0WA 5BUJA 5IEXA 4DF3A 5CVGA 4IHPA 4B99A 5KX8A 3QF9A 3E88A 2ACXA 4TWOA 3E5AA 4TWPA 1UA2A 2EUFB 3KXNA 4FK6A 1UU9A 2XKFA 4YGAA 2GTMA 2R0IA 1J91A 2PVNA 1XH6A 5BVNA 3GQIA 3EOCA 4R1YA 2I6LA 3BYOA 5FDXA 1R0EA 2XM8A 1FPUA 5AR7A 5KE0A 4EH6A 4LM5A 4EWQA 3BGZA 4QT1A 2E9PA 5FP5A 5JGDA 1J7IA 3LXPA 4OAUC 1NVRA 4U43A 2J0LA 3QKKA 4E4XA 3DBCA 3ZFMA 5JRQA 5BX0A 2ZM3A 3F3ZA 2C3JA 2P3GX 3PA4A 1YXXA 3ZFXA 3TM0A 4IJ9A 3THBA 2ITOA 4RWIA 3V5PA 2HIWA 4F08A 5BPYA 4OAVB 3GFEA 2RFEA 3OUNB 1XQZA 4IACA 5DRDA 4IB3A 3ZSHA 4PDSA 4TYGA 4FV7A 4DT9A 2VTMA 2GQGA 4FOCA 5C8MA 4YU2A 2ZOQA 4RQVA 2IZUA 2YCFA 1TVOA 4QP4A 3F5PA 4EH8A 5AP4A 2HY0A 3FC1X 4RPVA 3FSFA 4IADA 5FWKK 2ZV2A 3QALE 1KE8A 3PVGA 4ZLOA 2B9FA 5AR2A 3DTCA 2QC6A 3PUPA 5KMIA 3EMGA 1H1PA 4GV1A 4EKLA 3F2RA 3R8ZA 4CZTA 4QQJA 1XO2B 3CPBA 3UP2A 1OKYA 3BV2A 4FL3A 4JR3A 1BI8A 3DFAA 3Q5IA 4RLKA 2OXDA 3DAJA 4KINA 3E3BX 2HWPA 2YFXA 5AEPA 1YVJA 4EJNA 4U8ZA 4F0GA 4V01A 3UVQA 2LAVA 4GU9A 4N6ZA 4J71A 4O22A 3U4UA 3IGGA 3PXRA 2W9ZB 5KUPA 3UNKA 3ET7A 3I5NA 3NS9A 3EQIA 3SRVB 5CU6A 2WTDA 4D2RA 4ARKA 4I1ZA 4F0IA 3QTXA 5AR3A 5K0KA 4BKYA 3HDNA 3VS3A 4TTHB 3WIGA 3LW0A 4G3GA 2JKQA 1XH5A 3AXWA 4R6VA 3GNIB 4QP3A 3RALA 4QMTA 1M2RA 4RRVA 1WVYA 4KS8A 4KSPA 4JIKA 5DA3A 1UNHA 5IISA 1O6YA 2C6EA 1MRYA 4NU1A 2XJ2A 2QCSA 5KMJA 1V0OA 2BAQA 3MY0A 1CDKA 4P5QA 4QTBA 4W9XA 2W1ZA 2NPQA 2WQMA 5CAPA 1ZYJA 3LFEA 4DTKA 1ZWSA 2OBJA 4ASXA 3ORKA 2JDTA 4DFZE 2BILB 3FQHA 4UXQA 4BBEA 3V6SA 2WMSA 2WD1A 2B9JA 4J7BA 3R71A 4Z9LA 4C4HA 3UODA 4GK3A 4DAWA 3A4OX 2WMUA 2YAKA 2IVVA 3GC9A 4FV1A 4RA5A 4FV3A 4MWIA 2IN6A 4ONAA 4XOZA 4XP0A 4YJQA 5FEEA 4ANNA 5J9ZA 1ND4A 3O50A 1J1BA 1GJOA 3MI9A 4LUEA 2GNJA 4NW5A 3JPVA 4ZS0A 3P78A 4N4SA 1PXPA 4KRCA 4MHAA 5C01A 3ENMA 1M7QA 2ONLC 4IJPA 4A4XA 2XRWA 5EDPA 4U41A 3ORIA 2PUIA 4E5WA 3EFWA 1OKWA 5KBRA 2P55A 1NT2A 3GU4A 4L45A 1A06A 3KK9A 1Y8GA 5TF9A 4CQEA 4C2VA 2UZTA 3UC4A 1K3AA 3LQ8A 4C4EA 5IA4A 3TT0A 3RAKA 4G9RA 4IE9A 2UZDA 1GZNA 3MB6A 4ZIMA 4AX8A 4XEYA 3SOCA 4YJOA 4ZMEA 5C9CA 3AD6A 3R28A 5A4LA 3PIYA 5IQCA 4EOLA 2W1IA 1H24A 2QHNA 2B9HA 4MWHA 4CGAA 1QMZA 2XCHA 4QMSA 5AUTA 2YAAA 4UWBA 5EHYA 5EM8A 3REPA 4EYJA 3UIBA 2OGVA 2W7XA 3FXWA 4QP2A 3FV8A 2PUUA 4FTJA 4DEAA 5KHXA 2G2FA 5DHJA 3DB8A 2QO9A 1APME 4XOYA 3PA3A 2B54A 4D4SA 3KREA 3A99A 1ZZLA 4B0GA 5CF5A 3K54A 1R1WA 1WVXA 3LKMA 1QCFA 4H1JA 5ETFA 3OCTA 3QD3A 4GG5A 5GNKA 1BX6A 4Z55A 4FTTA 4TL0A 5HO6A 4RVTA 5TT7A 3D4QA 3BELA 2LGCA 3UZTA 2UZBA 2HELA 4K6ZA 3CKXA 4YNOA 2XEZA 1XBCA 4FKQA 3GOPA 4HGTA 4NL0A 3TWJA 1ZMUA 3ZMMA 4GRBA 2XYUA 5IH4A 3UVRA 3RCDA 3DKGA 4N6YA 1OGUA 3HP2A 3OC1A 4EOSA 2BHHA 4TYIA 3HUCA 3MTFA 4XG2A 1XH4A 5AIKA 1VYWA 3QUPA 4B8LA 2IVUA 2J50A 1P2AA 2RSVA 4AZEA 3CY3A 4AG8A 3NLBA 4X3FC 2XIKA 1G8SA 3MH0A 2ITQA 4NIFB 2V0DA 4GK2A 4QMMA 5ICPA 4K1BA 3CS9A 4Z7GA 4NKAA 1A48A 4CG9A 5FM3A 4C4GA 3H30A 4IWDA 3BHVA 2YDIA 4P7EA 4CLIA 4MXYA 4NM5A 4QQTA 5ETIA 2O63A 4FSNA 1YDRE 4BR3A 3EIDA 1R39A 4F6WA 2UZLA 3R0TA 3H9FA 1SMHA 4O2PA 3F69A 3D9VA 4LOPA 4MYGA 3IOPA 3NX8A 2YIRA 3C4ZA 3KXMA 3IDBA 4AA0A 5D9HA 5FP6A 3CQEA 4I41A 2OF2A 4ZTSA 3FMDA 4YP8A 3HMOA 3CJFA 3S2PA 5AAFA 4FTMA 4PMMA 4UY9A 5EM7A 4A7CA 5E8ZA 3U8WA 4MAOA 2YISA 3UBDA 4EHZA 4CLJA 4MH7A 4ALWA 3JS2A 4I0SA 3P1AA 3EL7A 4JIAA 4BKJA 5I9VA 3R1SA 1Q4LA 3NYNA 4FV9A 4FTQA 1YQJA 2VTRA 4KBCA 2YM8A 3N4VA 4WG3A 4I0TA 3FMNA 4E6CA 2R3LA 3NW7A 4JX3A 5H9BA 5EQEA 3C13A 1OL2A 2VWUA 4C33A 5BVOA 2YCSA 1TQPA 2UW5A 4UWYA 4PP7A 3HZTA 3ZLXA 4FG7A 4RLLA 3VAPA 2CCIA 3C50A 3DJ6A 2QOLA 5HEZA 3Q4UA 1O6KA 1Y91A 3F6XA 1F5QA 3L8PA 3O96A 5DNRA 4MQ2A 5ANEA 3VBYA 2XKEA 4YSJA 4H36A 2VTLA 4HZRA 5ACKA 3HUBA 3PVBA 3ALOA 3PJ1A 2QR8A 2KTYA 4JG6A 3QCYA 3P79A 4NW6A 4RIYB 5EH0A 1WCCA 3HKOA 4K9YA 4YO6A 4BWKA 5FXRA 1YOLA 4NFNA 4XYFA 3NUNA 1IRKA 2CMWA 1H27A 5E1EA 3VUDA 3MIYA 3SA0A 3CXWA 4WRSA 5HE1A 1GNGA 1Z9XA 3SXFA 4GCJA 5F1ZA 3V8SA 2ITTA 3NAXA 3PSBA 5AP6A 3W2CA 3QTWA 5AMNA 4YLKA 1X8BA 3I1AA 3VO3A 4RJ8A 4BZDA 3ORTA 2UZVA 4O2ZA 4QQ5A 5H8BA 2BKKA 1BL7A 3Q9YA 3O8UA 5EHOA 2X7FA 2X1NA 5CNNA 5L2WA 4J96A 3EN9A 4APCA 2CKQA 2CN8A 3ZZEA 3LXNA 5L3AA 5KKRC 3FJQE 3QTUA 2WQNA 3QQKA 3CGOA 3RPOA 3NUSA 5J9YA 4AOJA 5LCJA 3DU8A 4WG4A 5IUHA 3SKCA 3GBZA 3IDCA 4K11A 4HVGA 3R63A 3MY1A 3U54A 3G6GA 3KF7A 3Q3BA 2ITZA 3VN9A 2R3JA 5GJDA 4EI4A 4FTRA 3OXIA 2BTRA 4KKHA 4OTDA 3W8QA 4BTJA 5DEYA 2RF9A 3UJGA 3I0QA 1H0WA 4XUFA 2IG7A 4C34A 5TE0A 1PXJA 2GCDA 4O0TA 3MY5A 5AM6A 3SC1A 3W32A 2XCKA 3C4FA 3FI4A 4L3LA 2XK6A 3FY2A 3T8OA 4CRLA 3N4UA 3HGKA 4D2SA 4O0RA 5HIEA 5TR6A 5AP7A 3NVKI 3EQCA 2FUMA 3KN5A 3GB2A 1K9AA 3BQCA 1JKLA 4TW9A 5DRBA 3VQUA 2FB8A 3RVGA 5GINE 1M17A 5A54A 5JFWA 2Q0BA 2XBJA 3VULA 3KVXA 2JC6A 5DR9A 5JT2A 4LGGA 2UV2A 3EQRA 2O3PA 4U97A 3G0EA 3OTVA 5A6NA 3MESA 3ZRMA 4EEVA 2R3IA 5BUEA 4R3RA 4YPDA 3AGMA 1WFCA 2DUVA 3KXHA 4GG7A 2BRHA 4I6FA 4II5A 5HG7A 1OBDA 4ORKA 3K2LA 3G2FA 3MBLA 3OWPA 1RQQA 1WBTA 4C8BA 4EORA 3UO4A 1YRPA 3LFCA 3G6HA 2PMNX 3T3UA 1W0XC 1UU7A 3DJ5A 4IAKA 4DITA 3OHTA 2VTAA 2VWBA 2OZOA 3RAIA 1JPAA 2R3MA 4RIOA 4BRXA 4I5PA 4QMOA 2UW7A 4DGNA 4IFGA 2JBOA 4HCUA 1KUTA 1NW1A 3PZEA 5AP3A 2Y4IC 3KU2A 2JIVA 2HZ0A 1R78A 3LAUA 5CAOA 5L2TA 3PWYA 2IVSA 4N70A 4FYOA 4YTIA 2YA9A 4HOKA 5LQFA 3D7TB 3IS5A 2WMQA 2X81A 3ORPA 3UP7A 4JL9A 2JEDA 3SGCA 2AC5A 4IVCA 1RDQE 1JVPP 2PVHA 4U81A 5FTQA 4QMYA 2CNQA 5KMOA 1J7LA 4FV5A 2H6DA 2OZAB 4YHTA 5E8YA 2B53A 5FTGA 5FD2A 1G5SA 3O51A 2EXEA 5EKNA 1VZOA 3EFLA 4OLIA 3KN6A 4ZSJA 4JG8A 4O96A 4DCAA 4HNIA 1YI4A 2F49A 5L2QA 1IAHA 2J4ZA 3Q04A 3DJ7A 3AG9A 1GIJA 4QPAA 2J0MB 1H1WA 2BRBA 4IFCA 2C47A 2YM6A 4GSBA 4BI1A 5E8XA 3E8DA 2B52A 4YMJA 3ZXTA 5HX8A 4IDVA 5ANGA 4LMNA 2JDVA 1MRUA 5BQ0A 3EL8A 3TNWA 3R2YA 4ZLYA 3RM7A 4P5ZA 3KULA 3KCKA 4NM3A 2FVDA 2GS7A 4U44A 3BWFA 4BCFA 1Y6BA 3ZO1A 4BIBA 3BEGA 3FZSA 3SG8A 3ZHPC 5HCYA 4BWXA 4CT1A 5LCKA 3UGCA 3ELJA 3UNZA 5IQGA 4J98A 3GOKA 3COKA 2O64A 4GYGA 3WIKA 3I7BA 1PY5A 5ETCA 4BBMA 4G2FA 4ASZA 2E9VA 3QGWA 5HBHA 4ACMA 5M09A 4KA3A 1F3MC 4FUXA 3CTQA 2HENA 2Z60A 4EOQA 3RNYA 2WELA 3F2AA 3R7GA 4M3QA 4S2ZA 4QMWA 5HCXA 3R9NA 3E64A 4JJRA 4O21A 3DBDA 1CMKE 4BWPA 2OJFE 2X4FA 4GU6A 2G2HA 2PVMA 2UVZA 4RJ5A 5BYLA 2JDRA 2QI8A 5KNJA 3TDWA 2HYYA 4UZHA 2WQBA 1YW2A 3MSSA 3P23A 5DWRA 5CEPA 4RSSA 1OIUA 4K18A 4O7SA 5EQYA 2C6KA 2QODA 4IC8A 5B2LA 1YI6A 3GC0A 3D7ZA 5BUIA 4B4LA 3SW4A 3TNPC 2JFMA 2XF0A 4W8EA 3VS4A 3ZZWA 4TWCA 2GHGA 2CCHA 3AMBA 3R8PA 3BU3A 3R1NA 4XV3A 4K77A 4DH1A 5I9XA 3BLHA 3KMWA 2XA4A 2B55A 2ZYBA 4YJRA 3CE3A 3GU6A 3BQRA 3OD6X 4FIHA 1OL6A 4HW7A 4FEVA 2VUWA 5CSXA 4DHFA 2R5TA 3BV3A 2C5XA 3AC2A 3LFBA 4GT3A 1ZOEA 4WBBB 2R9SA 3QA8A 3B8RA 1Q8WA 3C1XA 5JKGA 1KE9A 3FMEA 4ZY6A 2W05A 3SV0A 3FMMA 3WYYA 5BVEA 4EK6A 2VX3A 4QPMA 4LRJA 2NNWB 2BMCA 4MEDA 3AT2A 5AAGA 1QPDA 5L2SA 5HBEA 4F63A 4CXAA 4PMPA 5ITAA 4AFEA 3SQQA 4BKZA 2CPKE 2Y6MA 3GCPA 4BDDA 2VWWA 4FYNA 5T68A 1YDSE 4RG0A 4R7BA 4NEUA 3VIDA 2CGVA 3SG9A 3S1HA 4PV0A 5LVPA 4UMRA 4HPTE 3KK8A 5HO8A 4DG2E 3EN5A 3NNXA 2V55A 5C4LA 4XLVA 5AUWA 3IDPA 5BVWA 4DH5A 2CSNA 3NNUA 3MFRA 4FT0A 4NTSA 1YXTA 5B2KA 4ZJIA 4HVIA 2YLFA 3H3CA 3LCOA 3MVMA 3NW5A 2W5AA 1VR2A 2DWBA 2Y0AA 3KL8A 5A6OA 4FBXA 3EQBA 2XNGA 4NH1A 4BHNA 2W1DA 3BCEA 5CS6A 4I5HA 3TZMA 2YITA 1M2QA 4FTKA 1Q99A 5E8SA 3ZSIA 5CSPA 5C1QB 2HAKA 3NYVA 2W9FB 3NCZA 4MCVA 4M68A 4AZSA 4D5HA 4HVSA 4ZSAA 5AFVA 3R9DA 5HZNA 1SNUA 4CMUA 3UMWA 3JVSA 5M08A 2IW8A 2GHMA 4QYFA 5CTPA 3MJ2A 3Q4CA 1YXVA 1FINA 1WBVA 1XBBA 4PP9A 4CKJA 5IEVA 4MXCA 5A14A 4FGRA 3EHAA 5HO7A 4FEUA 2FSLX 2Z02A 3LVPA 2OKRA 2XK9A 1AGWA 5I4NA 3HV7A 3CTHA 3LJ1A 2ZV8A 4CCUA 2Y4IB 3PDTA 3ZSGA 2E9NA 3PLAE 1V0PA 2PUNA 4W4YA 1NY3A 2UVXA 4I4EA 4EOOA 4FKPA 4FKSA 2PE0A 4A9SA 4XRLA 1MQ4A 2ZJWA 2ESMA 4XNEA 5LVLA 2C5VA 3EFKA 1Y6AA 4MXOA 1Q8ZA 4Q5HA 1PMUA 3P0MA 4X2FA 4A4OA 4CYIA 4Y83A 5AUVA 2ZDUA 1OIYA 4IQ6A 3LPBA 5FDPA 4EJ7A 4CV9A 2PU8A 1UKHA 2C6LA 2H9VA 3EQDA 3Q32A 3KVWA 2FGIA 3O0GA 1CSNA 2ETRA 3BX5A 3ZXZA 4MXAA 3OT8A 4NJDA 3CKWA 5CVHA 3SOAA 3RZFA 3RPRA 3EKKA 3BGQA 5B7VA 3AT4A 1BUHA 2Y9QA 4EOPA 2X8EA 4JS8A 1OM1A 4U3ZA 3ACKA 4L8MA 2W1EA 2JAVA 4BTFA 3RPVA 3PG1A 3MV5A 4UMQA 2WQEA 4XG9A 3R8UA 4E1ZA 2PMIA 5EI6A 3NUXA 2W1GA 1CKIA 4CFNA 3ZDUA 2WTKB 3DAEA 1YWVA 4G16A 2OW3A 2ITUA 4O6LA 4FVQA 2YM7A 2PZIA 2QKRA 4Y46A 4D9TA 2IW9A 3ZLWA 4FODA 5AV1A 4D1SA 1H4LA 3CPCA 4H3BA 2GNLA 4J53A 4CFVA 4CKRA 3QTSA 4O0XA 4WSYA 4NYEA 3L9LA 3D0EA 2CGWA 4AS0A 3ZDIA 4C3FA 3IONA 4PQNA 3VUGA 3PRIA 2XK7A 4G6LA 4X2JA 4EC9A 2XNOA 5I9WA 4PTEA 5LARA 4PNIA 2QHMA 5AP5A 4TNBA 2F9GA 5HG5A 4A9RA 3IK3A 3BYSA 3UQGA 2RIOA 3DQXA 4HYHA 3GCUA 3VW6A 1UNLA 3LCKA 4ITJA 4IZAA 4UB7A 3TTJA 2WEVA 4TZRA 4LI5A 2XJ0A 1YHSA 2GDOA 2HOGA 4BN1A 3UYTA 1SNXA 4AZTA 2HXLA 3FHIA 3PP0A 4AGWA 4B7TA 4CRSA 2C5NA 3WF7A 2JFLA 2OFUA 3DY7A 4JT3A 1JBPE 5AV4A 2VWXA 3COMA 4FIEA 3A7HA 4USDA 3Q96A 3BI6A 4QNAA 3V51A 3L8XA 3BLRA 5IA0A 3I6UA 4IB5A 5DYJA 2YIXA 1YWRA 4IX6A 1HOWA 3MDYA 4PL3A 2OFVA 4JAJA 4Y8DA 4IM0A 4AW2A 3HAMA 4CNHA 3MN3A 3WBLA 1PXKA 1BL6A 2OK1A 2VWVA 3DZQA 2YLEA 3PIZA 2VTQA 2OIDA 4ZTQA 4JNWA 2J2IB 4F9CA 4UN0C 4EH5A 3FZ1A 4V05A 5DH3A 5M4UA 4BB4A 1FOTA 2PTKA 2HZNA 2HZ4A 3DFCB 1CTPE 4GVJA 4EK8A 4HVDA 4O86A 4IH8A 4I0RA 4UEUA 2OLCA 3L8VA 3RK7A 5JFVA 4AQCA 5IMEA 4D28A 3FAAA 4MKCA 3OS3A 4NZWB 5EM6A 4X3JA 4FZDB 3CTJA 3VRZA 1WBWA 3TKIA 3CBLA 4M66A 5C4KA 3E92A 3PG3A 5AV3A 3C4EA 3ERKA 2E2BA 3KXGA 3QHRA 1PYEA 3QXPA 4DFNA 3ZFYA 4RX8A 3E3PA 2PVRA 1L3RE 2RG5A 1Q5KA 4IB0A 4MF0A 5DLSA 2WMRA 5EG3A 2R3KA 4K8AA 1NA7A 4OUCA 5E8TA 3RWQA 4HCVA 3QD0A 1MUOA 4FSQA 5CQUA 5BVDA 4EK3A 2R3HA 2OO8X 4H3QA 2ERZE 2KULA 5CXHA 2VWIA 4IIRA 3VQHA 4BCHA 2X39A 5CU2A 5AX3A 5FLFA 3H0ZA 3UOKA 5CSWA 4BFMA 3QGYA 3OROA 3PWDA 4D2WA 4BYIA 4PDYA 2PVKA 4KD1A 3UOHA 1IAJA 4QP7A 3QQLA 4OTFA 1OECA 2Y4PA 3K3JA 4G31A 2BR1A 2JIIA 4LV8A 4QMUA 5D12A 4XV2A 1PJKA 4ZTNA 4Q2AA 3MIAA 5AWMA 4PF4A 4V0GB 4BHZA 4GIHA 4U80A 2GMXA 2VX0A 3OG7A 4X2KA 3HP5A 4HGEA 1M7NA 2UW9A 3W2RA 1MQBA 2UUEA 4ACGA 4FVRA 3TL8A 5DT0A 5AR5A 1FMOE 4TYHA 1B6CB 4KAOA 5LXMA 5ANOA 4NM7A 2H8HA 2VU3A 3TKUA 3HMPA 4MXZA 3EYHA 4QMVA 5L8JA 4YZNA 3OY1A 2X2LA 4FZFB 1IG1A 2ETKA 3QX4A 2ZV7A 5J1WA 3ACJA 2EB2A 2WMTA 3CY2A 1KWPA 3MFSA 4DGOA 4ANMA 5HOAA 4G3CA 4DLIA 3QXOA 4DGMA 3U55A 3ALNA 2GQRA 1IEPA 3SD0A 4ZOGA 4ALUA 4O7RA 4YTFA 3W2QA 3TUDA 3FLZA 4BCIA 4FTLA 3LE6A 4GL9A 5E1SA 3NW6A 3CEKA 4I23A 2FA2A 1LEZA 3FWQA 3HV5A 3QCQA 4Y72A 1E1XA 4FI1A 3K3IA 2EU9A 5GZAA 3MVJA 4XG8A 2OH4A 3OXZA 3O17A 5IH6A 3G5DA 1M52A 3S0OA 2X4ZA 3PP1A 4CSVA 3U51A 2B1PA 3UVPA 3K5UA 3VHEA 5G6VA 3FPQA 5AUXA 2NRUA 3OOGA 4CQGA 2WTWA 4Y95A 4L7SA 5K9IA 4DGGA 3R7UA 2WMBA 2C3KA 4UALA 4GFGA 1JQHA 4FNZA 4FSYA 4BC6A 4E6AA 1KV1A 3CGFA 3ZO3A 3DS6A 4HNFA 4KBAA 4O0UA 3ZH8A 3PJ8A 2WOTA 1ZYSA 4GFMA 4L01A 3S3IA 5CEKA 2QOQA 4IVBA 3I0OA 3IG7A 2XNBA 4QMNA 3I7CA 3GU8A 2EXMA 4RWLA 4L53A 5M55A 3RHXA 3AMYA 3BE2A 3D2IA 1YI3A 3PY3A 4HYSA 4R5YA 1BLXA 1O9UA 1E1VA 4CFWA 2ERKA 1PW2A 5HI2A 3I79A 5IQAA 1GZOA 4EK4A 4MD8E 2I1MA 3QRTA 2J51A 4D1XA 2QOKA 3L9MA 1F0QA 5HE3A 4KKEA 3OXTA 2V7AA 4MK0A 4L67A 1UNGA 3NWWA 4NM0A 5CZIA 3VUKA 2CN5A 4IMYA 2VNYA 3RK9A 3WOWA 4JBPA 4FZ7A 3F61A 2QKWB 4GW8A 3W18A 4EZ7A 3F5XA 4ZTLA 2C5OA 2ETMA 4ANBA 3S4QA 4QO9A 2QURA 1J1CA 2X6EA 3GU7A 4RJ7A 1XHAA 3TJDA 4B8MA 4WUNA 5EYCA 1H0VA 1H07A 4FKTA 3ROCA 2I0EA 5EI2A 2IZTA 3D5UA 1B39A 4FEQA 3CQUA 2W17A 3LFSA 3FC2A 4PMTA 4UMPA 3U6HA 5CT7A 5JSMA 3GU5A 1T45A 2BTSA 3C4WA 5IKWA 2F7EE 2GNIA 4M69A 2OJ9A 3QYZA 5IQFA 3IKAA 2PWLA 4FKWA 4CD0A 3NUYA 3R21A 2GQSA 3ENHA 1W83A 4IZ7A 2RG6A 4WOVA 4O84A 4F1OA 4NKSA 5CX9A 4BTMA 5KCVA 2UW8A 3NUUA 4PWNA 5KMKA 2X2MA 3ZC6A 2C6OA 3UG2A 5CU0A 2W4JA 4EOJA 2FSMX 3NIEA 4MXXA 4QQCA 3V5WA 4DTBA 4AFJA 4D2PA 2BRGA 2WPAA 4WNOA 3VS7A 4RZVA 3F7WA 1YOMA 4OBQA 5M56A 3G90X 3CD3A 3UYSA 2WB8A 3D83A 3GCVA 2XVDA 2JDOA 4G6OA 5BMSA 4NSTA 3KXXA 3R9OA 3O2MA 3MVLA 5L8LA 2ITNA 1ZXEA 4PL5A 3U9CA 4KIPA 2C30A 2BAJA 3CIKA 1NVSA 4WKQA 5CENA 1DAYA 1U5QA 2X6DA 3FQEA 4IAZA 3LQ3A 3QLGA 3PPJA 4MBIA 4R5SA 5BVFA 2W5HA 5IPJA 3TI1A 5JQ8A 2YHVA 3KY2A 4I6HA 4S32A 4L42A 3EQPA 2XK8A 4H58A 2X8IA 3DCVA 4BZOA 4EBVA 4ENYA 4IAAA 4RVMA 4JBQA 2VTHA 3KEXA 2NO3A 4BCJA 1O6LA 1U54A 4ZZNA 4TPTA 3RJCA 5L6PA 4DEHA 3UOJA 1H1SA 3TIZA 2V7OA 3LMGA 4B6LA 4JBVA 3JY9A 4N57A 2NRYA 4AF3A 4EZ5A 3HMMA 3R9RA 3LFFA 4UXLA 4XH6A 1W82A 3FMLA 4DE4A 4FKGA 4YO4A 2OWBA 4TRLA 1R0PA 4XBUA 4DTAA 2BPMA 3U4WA 5ANJA 3HECA 3PXKA 5HESA 5EW8A 3ZOSA 5CSHA 4F65A 4UX9A 2QOIA 1A9UA 2ZAZA 4FKOA 3VBQA 4AZFA 4F6UA 4KIKA 3EH9A 1UU8A 4YHFA 3OEZA 3C7QA 2ZVAA 3L8SA 4CT2A 3N51A 4IDTA 5DR2A 2OG8A 3P9JA 4EWHA 3RK5A 3MFTA 2J9MA 5C03A 4JI9A 5EOLA 1H25A 4TYEA 4JRNA 3M42A 4QNYA 1XJDA 3BHTA 3RCJA 4IWQA 3V5TA 2ZB0A 3NRMA 2Z8CA 4FG9A 4H39A 4IX3A 4KRDA 2YACA 5EDQA 4DEDA 3DDPA 3W2SA 4CFXA 1SVEA 4O82A 4AACA 4YJNA 3QTRA 5AJQA 4FIIA 4WG5A 2UW6A 4FC0A 3ORLA 5GJFA 5M07A 1T46A 4XRJA 2O2UA 4FV8A 5H2UA 5HE0A 1H1QA 3E62A 3FHRA 5AA9A 4RJ4A 4CTBA 3TNHA 2CDZA 1IR3A 1VJYA 3KKVA 4C02A 4GUEA 4H05A 3UIXA 4ENXA 3I5ZA 3P08A 2CNVA 3GUBA 4FEWA 4PNKA 5KMLA 3LMIA 4XCUA 5BMMA 2WEIA 4BCMA 3FBVA 1UVRA 2PL0A 3F3UA 2X9EA 3QZIA 4LL5A 3UO6A 4LGHA 5CAVA 3HV4A 4RIWA 4O6EA 4C57A 4AXAA 4TY1A 2OIBA 1AD5A 2VRXA 3GC8A 4ITHA 3Q5ZA 2BRMA 2F57A 4YNEA 5M44A 3L9PA 5M4CA 3G0FA 5EQPA 4N0SA 5TOZA 4AW5A 1OIQA 3HVCA 3Q9ZA 4IBMA 2YDKA 4L68A 4G5JA 4ZTRA 3U6IA 5CXZA 2HZIA 3U9NA 5GHVA 4MNEA 2WAJA 2V5QA 3P86A 3VBXA 1KE7A 5HTIA 3OUKA 3L1SA 2A1AB 2VTIA 3VC4A 4FGBA 4WRGA 3A2CA 2J7TA 3KRRA 1WAKA 1XH7A 3KGAA 4QMPA 5E90A 5D7AA 4E4MA 1U46A 2ITPA 3RPSA 4IZ5A 2ZB1A 5HG9A 4PPAA 4LGDA 4A07A 2RFSA 4FT9A 3V5LA 5HIBA 3QA0A 4FMQA 4CVAA 4LQMA 3KRXA 5C26A 4AN3A 4FTAA 3KMUA 3DZOA 2VGPA 4M97A 1ZMWA 2GPHA 4C3PA 4L7FA 5IEYA 3TZ7A 3V8TA 5EK7A 3A60A 3FMHA 5HBJA 4O0YA 4RFYA 4O7WA 5CF6A 1OKZA 3NDMA 3KC3A 1HCKA 4NFMA 4CFMA 2P2IA 4G3FA 1JKTA 3QD2B 4NUSA 3L9NA 4JG7A 1AQ1A 3AQVA 1JAMA 4IX4A 5JRSA 3A62A 4FIFA 2OJIA 2Z7RA 4IVAA 4LOQA 5F94A 3FI2A 3T9TA 4GKHA 1S9JA 1Z5MA 4L00A 2XK4A 2C68A 5LWNA 3EN4A 1U54B 2Y6OA 5AP2A 2C3IB 4ASEA 4C2WA 4U3YA 5EI8A 4J97A 2WZJA 4CTCA 4AT4A 4L46A 4H3PA 3DLSA 4O27B 4P90A 4G3DA 4HCTA 5CVFA 5J5SA 5M4FA 3R04A 4LV5A 2WKMA 1L8TA 1PMVA 5M51A 4FKIA 5AR4A 5C8NA 1K2PA 4YLLA 5GIPE 2VTOA 4YZDA 5FM2A 1XKKA 3LM0A 3P5KA 3BRBA 5T6KA 4E7WA 4EH3A 2BDJA 1VYZA 2ITWA 4BTKA 4RC2A 3POZA 4KIKB 4QPSA 5KHWA 2REIA 3IW5A 3ULIA 4XP3A 4I21A 4KWPA 4W9WA 5HNIX 2YJRA 4QTCA 3ZU7A 2XS0A 4G5PA 3WZUA 2R3FA 3NYXA 4S31A 1IA9A 1DI8A 4XJ0A 4IAFA 5EFQA 5LWMA 3M2WA 4YLJA 1PYXA 2XNMA 3ZUUA 4MX9A 4F7JA 2CKEA 3EZVA 1DM2A 3BIZA 1FVTA 1DS5A 4F64A 2BHEA 2AUHA 3M11A 2WTKC 3VUTA 5DBXA 2OI4X 3DAKA 3PPZA 5A4CA 4FIJA 1OBGA 2WNTA 4WT6A 4QMQA 2R3QA 2X7GA 1XR1A 2QQ7A 5CNOA 3Q4TA 5L4QA 3IO7A 5JGBA 4A9UA 4GVAA 5HICA 1IASA 3MFUA 3W8LA 5L8KA 4RT7A 3H9RA 4EK5A 1Q41A 2EWAA 3WI6A 2C0TA 2YIWA 4M15A 4XG7A 2JLDA 1P4FA 3UZPA 3TNIA 5EYKA 1Y8YA 2C1AA 4L3JA 1URWA 2C0IA 4YSMA 5JFSA 3LCTA 4XG3A 1OIRA 4JVGA 1FBNA 4GK4A 4KIQA 2WU7A 1OL5A 1Q3DA 4ZTHA 5FXQA 5BVKA 3WF8A 3QD4A 2CKPA 2I0VA 5CQWA 1SM2A 5KZ0A 4KUJA 4MNEB 3VUMA 4E8AA 5EYMA 3DXPA 4DH8A 3HRBA 2XIRA 4M12A 1H00A 4C4JA 4K0YA 5EOBA 5A4QA 2WOUA 5I0BA 4X7QA 3ROYA 2GNGA 5IQDA 2QOBA 4DCEA 2VO7A 4XLIA 4I22A 4JDKA 3BYUA 3OW4A 3QZFA 4YC8A 2C69A 5JZJA 5BNJA 2VD5A 5F20A 4U6RA 3W1FA 1QPJA 2XMYA 3PXZA 1DI9A 4BIDA 5J7BA 5IZFA 4TXCA 2OH0E 4G9CA 3WF9A 4YUQA 3MH1A 3HV6A 4E5AX 4Z16A 2QOOA 5AUUA 4FZ6A 5I9YA 4DC2A 4J8MA 1ERKA 3OWKA 2W1FA 4BCPA 3C4CA 2VTJA 5IQEA 1SZMA 4OTPA 4WNPA 4O7NA 1PXNA 3FZTA 3ZRLA 3A8XA 4IW0A 4M84A 3R83A 2B9IA 3R7OA 4QP9A 4OTGA 1Q8UA 4TNDA 4ANOA 4APPA 3QQUA 2W4KA 3MB7A 4JXFA 4C58A 2NP8A 3QBNA 5ACBC 4ASDA 2O0UA 1LR4A 4HYUA 3ZUTA 2VGOA 2YJSA 3OOMA 3EN6A 3F3TA 3BZ3A 2XNNA 1ZY4A 4Z3VA 2OXYA 4BDFA 3HAVA 3H9OA 4C36A 2PSQA 2ZM1A 4O7TA 4PPBA 4RIXA 3A7FA 4KB8A 3DKOA 2E9UA 5EYDA 2PVYA 4J52A 2BCJA 4UBAA 3I60A 2R7BA 3SX9A 3I81A 1ATPE 4JQEA 3C9WA 5CAQA 4FEXA 1SVGA 3PRFA 4FTNA 4BBFA 1ZMVA 2UZEA 4FX3A 4DEGA 2GU8A 2YCQA 3QCXA 3AOXA 3RKBA 4GH2A 4AOTA 4YZMA 3R8LA 4L44A 4ZS4A 2IZSA 4LRKA 1Y57A 3SXSA 3R22A 2YN8A 3QTQA 1YXSA 3NCGA 1GY3A 3Q60A 4QP6A 3FMJA 5LJJA 3TDVA 4HJOA 3LJ2A 3FKNA 3ITZA 3QWKA 2YZAA 3BE9A 4IANA 4ZSLA 3BYVA 3QRUA 4IEBA 4E6DA 5K4IA 4KSQA 3O7LB 3V01A 2PZRA 3IECA 3PTGA 4CYJA 4C62A 2EXCX 2RGPA 2W06A 1GAGA 3E7VA 3KRLA 2UZNA 5ETAA 3FI8A 2HW7A 1PXOA 2OSCA 5DFPA 5HVKA 5LOHA 3SW7A 5B2MA 1YHVA 3WZEA 3P4KA 3NIZA 3BWJA 4TWNA 3HRCA 4X2GA 2BZHB 3TJCA 2YIQA 4PUZA 4FTOA 4E93A 3OW3A 3KULB 2WMVA 2BRNA 2GNFA 5HNBA 3KXZA 4IXPA 2A2AA 3FL4A 3LOKA 5ANKA 3RPYA 4DLJA 2BVAA 3PE1A 3HV3A 5CEMA 4DEBA 2CKOA 4BIEA 2VWYA 3PA5A 3BKBA 5CT0A 1H1RA 1U59A 2VTTA 5J7HA 4M14A 3CD8A 3BPRA 4R7IA 2QG5A 3CR0A 3QRIA 3HRFA 3ODYX 3TV4A 4G6NA 4CV8A 3CJGA 4O0VA 4C59A 1JKSA 4FSZA 1Q62A 2AC3A 2JBPA 4XG4A 3T9IA 5JZNA 5E8UA 3LZBA 2I7QA 2OIQA 5CWZA 5HX6A 4IZYA 2VWZA 3TV7A 1UU3A 5FRIA 4BDBA 3PY0A 4G17A 3A61A 4NK9A 3O8TA 4FNYA 3ZM4A 5HTBA 4BF2A 2XEYA 3DQWA 2DQ7X 3Q6WA 5E9EA 2Y8OA 4ZMFA 3PSDA 4OTHA 4HGSA 3QYWA 5HD7A 4EHVA 5KMMA 3BYMA 3O8PA 5AAEA 4JQ7A 1H26A 2A19B 3IPHA 3HMNA 4LOOA 4CMOA 5EW9A 2C6TA 4YBKA 1U5RA 4U9AA 4RWKA 3SAYA 3QX2A 4RC3A 4O1PA 3SRVA 1W84A 5GIOE 5A9UA 2H34A 5LMKA 2YEXA 3OCSA 3V04A 4I93A 5DT4A 3WE8A 5LVMA 4R77A 4USFA 1JOWB 3G9NA 3QQJA 4F9WA 4F9YA 1UWHA 1IA8A 4C0TA 4FL2A 3PZHA 2CGUA 3Q2MA 4P4CA 2VNWA 3K5VA 4FOBA 3HX4A 3VBWA 4DEIA 4FT7A 1FGIA 3E87A 3NZ0A 3OBJA 2PMLX 4JQ8A 4EQCA 4HGLA 5AP0A 2C3LA 2X8DA 3SDJA 4DT8A 4DN5A 3RGFA 3G51A 4J99A 5BYZA 4QD6A 4R7HA 1TQIA 4F9BA 3LM5A 4U40A 2VO0A 3KA0A 2P2HA 3FDNA 1BI7A 4FL1A 3WZKA 2QOCA 3IW8A 5IMXA 3ZUVA 3BBWA 2WMXA 2C5YA 3GT8A 5G1XA 3DKCA 2WIHA 2JKKA 2PE1A 3P7BA 4RIXB 2J0JA 4XBRA 4FNWA 4IM3A 1LPUA 5F4NA 5K4JA 5IQBA 4WBOA 2UW0A 5CSVA 5HCZA 2CGXA 2G15A 2R3PA 1M14A 4O38A 3TZ8A 4AZWA 3UZRA 4S30A 3F66A 3FZPA 4DFUA 4RBLA 5DMZA 3RM6A 3DBQA 2DYLA 4PRJA 2ITYA 4ZY5A 5EW3A 4CFFA 4I6QA 4PDPA 3AD4A 2GS2A 2ZV9A 4NCTA 4RFMA 5EDRA 2RKUA 3E8NA 4U45A 3GVUA 4I94A 4AAAA 5HIDA 1H01A 2R3RA 3UPXA 2HK5A 2A27A 3B2WA 5CYIA 2A0CX 2VZ6A 2R7IA 4CZYB 2VO3A 4F7SA 4FUYA 4AGUA 5GZ9A 4GIIA 2ZM4A 5D7VA 3WYXA 4QYYA 3MGYA 4ITIA 5M53A 4CFUA 4EH7A 4LMUA 4O7YA 1H8FA 2O8YA 2BROA 5CI6A 3UIUA 3D2KA 4QP8A 3ZS5A 1LUFA 2IWIA 4R8QA 3UG1A 5KMNA 4TT7A 3PVUA 4PX6A 3A8WA 3A7JA 4AW0A 1OUYA 4F99A 4FKJA 3R73A 3CSVA 2OJJA 3EB0A 4EL9A 5TKDA 2WTCA 5IG1A 3ZEPA 1OUKA 3Q9WA 3QC4A 4UYAA 3F5UA 4FTUA 3FYJX 3QL8A 4BVUA 2HCKA 2VV9A 3FPMA 3OBGA 4BDHA 5M06A 5B0XA 4D4YA 1QPEA 3MPMA 3UE4A 1JNKA 2X2KA 3D94A 3MJ1A 4C35A 2PZ5A 3C5IA 3PJ2A 4YZBA 3SHEA 3TN8A 4ACCA 4BICA 3PPKA 4MTAA 2JAMA 5I9UA 4CKIA 3KFAA 5L6WL 1W8CA 4G3EA 2J5FA 3F9NA 3ZO2A 2H96A 4D55A 4ERWA 4YBJA 2PY3A 3DT1A 3H10A 1CKJA 5GJGA 3RNIA 5CEOA 4DFBA 3POOA 4DA5A 3R02A 3DXQA 4MVFA 2WHBA 2EB3A 2J5EA 3F5GA 4LG4A 3TUBA 4FV0A 2ZMDA 4QRCA 3MWUA 4GS6A 1CKPA 3AC3A 4JAIA 3GFWA 5DVRA 3P7CA 3TCPA 5E4HA 2JKOA 2Q0NA 5J5TA 3F3WA 3GXLA 3IQ7A 3QKLA 4OBOA 2W5BA 5DT3A 4MNFA 2WXVA 3G33A 4AGDA 1XH9A 2GHLA 3FXZA 4S34A 2BFXA 4IAIA 2OU7A 1E9HA 4NIFA 3D5VA 4BCKA 4KNBA 2GNHA 3DGKA 3UQCA 3KCFA 2Q83A 3ORNA 1YWNA 2VX1A 2BUJA 4RFZA 3QRJA 5L2IA 4AU8A 3R30A 4D2TA 3BBTB 3ORXA 4FV4A 4FNXA 4RX9A 4ERKA 4DH7A 2QOFA 3NPCA 1PXIA 3R2BA 4HYIA 3AC8A 3LXKA 5DE2A 1EH4A 5CASA 3VS6A 5CLPA 4C4FA 5IQHA 4X6QC 4AT3A 4IAYA 3HA8A 4FIGA 4BDIA 4AE9A 3LCDA 4L9IA 5FUTA 4M0YA 4A9YA 2ITVA 4DGLC 4BGGA 3R01A 3EWHA 3TTIA 2C1BA 3VS2A 4U5JA 4QOXA 4RGJA 3PSCA 2PK9A 2Z7SA 2Z2WA 4U79A 4EZ3A 3CCNA 3DV3A 1I09A 3ZO4A 5HLWA 2PHKA 5HVJA 3WF6A 5J87A 2QLQA 5FG8A 1NVQA 2FSTX 3FXXA 4L6QA 4YPSA 4ANQA 1J7UA 2YWVA 3I4BA 2Z7LA 3R7EA 5E91A 1YOJA 5CU3A 1YHWA 3VS0A 3HMIA 2R0UA 4ZAUA 4MBJA 1JSVA 4E4NA 2XP2A 2FYSA 4JDJA 4K33A 5J95A 4WSQA 5J79A 3OMVA 2FSOX 4Y5HA 4PTCA 4F9AA 5IF1A 2XRUA 2P4IA 3FY0A 4QMZA 4XG6A 4C7TA 4D58A 4IC7A 4CG8A 4J8NA 4EHGA 1OVEA 5E8VA 4D4VA 4I3ZA 1ZYCA 1URCA 4X2NA 3GEQA 4BYJA 3GC7A 3B8QA 1ZYDA 2AYPA 3PY1A 2GS6A 3G9LX 4AN9A 4RIYA 5JFXA 4Z7HA 5FXSA 3WILA 3HL7A 4JRVA 4RC4A 5DEWA 2BDWA 4ZP5A 3FLWA 2A4LA 2QG7A 1KOAA 1Q24A 2WTVA 3DLZA 3RAWA 2B7AA 4F70A 3FE3A 3D15A 3C5UA 5AA8A 1Q8TA 1Z57A 4E5BA 3DK6A 3II5A 3Q6UA 3R7IA 2OXXA 2QU6A 4FTCA 5CI7A 4K2RA 3JUHA 4RJ6A 4HVHA 1Q97A 1VEBA 3NNVA 3QHWA 3ODZX 3E7OA 3EQGA 3FZRA 4MD7E 4BDGA 5IUGA 4GUBA 5M4IA 1TKIA 3BU6A 2RFDA 2GTNA 4EQUA 4YURA 3VF8A 3AMAA 4I24A 4M0ZA 3TZ9A 4RVLA 5C27A 2BDFA 3ZLSA 3WE4A 5K0XA 4WD5A 4M13A 4IVDA 4XHKB 4YJSA 3UMXA 3QQGA 1XBAA 3E63A 3CQWA 4XS2A 3ORMA 1UKIA 4WO5A 2F7ZE 3A7IA 3IW4A 4YZCA 5CEIA 4ZTMA 3FEGA 5JN2A 4O7VA 5HORA 3W33A 4HZSA 4OTQA 4RX5A 2ONLA 3VS1A 3NUPA 3COHA 4I92A 4OR5A 4BDJA 3WZDA 3NMUF 3LXLA 3LJ0A 2QLUA 5AX9A 3QRKA 5AV0A 4BCGA 5IA2A 2XJ1A 4JLCA 4LFIA 2WO6A 3SXRA 2SRCA 1PXMA 4E20A 1OPKA 3OTUA 3VRYA 4FKLA 4TYHB 5H3QA 3ULZA 5EKOA 4C37A 3QUEA 4U0IA 3GQLA 5HE2A 5KBQA 3MH3A 4BGQA 2WQOA 3AT3A 5FBNC 3OF0A 2GFCA 3PJ3A 3H4JA 1MRVA 2X7OA 2BFYA 4G34A 2PMOX 2XIZA 4FTIA 4BI0A 2UZWE 3R00A 4ANLA 3V5JA 3OCBA 2CHLA
chains in the Genus database with same CATH superfamily
3PE2A 1V1KA 4D9UA 3TG1A 1BKXA 1ZOHA 1W7HA 4EQMA 3ZTXA 5BYYA 2PULA 2XM9A 4LUDA 4E6QA 4UMUA 2OJGA 3C4XA 4MQ1A 4AA4A 4F7NA 3EJ1A 3UPZA 3RTPA 3TUCA 2X0GA 2QU5A 4USEA 3MA6A 3W10A 4QYEA 3C0GA 3LLTA 4DFYA 5CANA 2R3NA 3P5JC 2F2CB 3TXOA 2YM4A 2C4GA 3IW7A 4WIHA 5IA1A 4J95A 3FKOA 3FLYA 3D5WA 3LHJA 3PJCA 5H8GA 1WVWA 4AE6A 4PDOA 1Q8YA 5LVNA 1KE5A 2BZJA 4NWMA 3LFNA 4AXFA 5IQIA 4DBNA 1ZZ2A 4AN2A 2XNPA 3AC4A 4P2KA 5HKMA 4M8TA 5HLNA 2HW6A 3M1SA 3O7LD 4FICA 3TNQB 4DFXE 4WNMA 3MYGA 3QTIA 1UWJA 4R3CA 2YWPA 2PVLA 4W4WA 4RMZA 5AUYA 3VJNA 1ZY5A 3QFVA 4A9TA 1PKGA 4LYNA 5JMSA 1M2PA 3PXYA 4TYJA 3ZEWA 2C0OA 4FRFA 1J3HA 2VTSA 3D7TA 4YJVA 4GYIA 3W2PA 3QC9A 3DA6A 3AGLA 5IU2A 3NGAA 4KS7A 4YJUA 4PPCA 3ORZA 3FKLA 4GT4A 1YDTE 4KBKA 4X3FA 2YDJA 4YC6A 2OZAA 5JGAA 4W8DA 4FKRA 2PUPA 3DK3A 4L52A 3IOKA 3PFQA 5LMAA 1JWHA 4RVKA 4C4IA 4E26A 5JQ5A 5FBOA 4PMSA 1G8AA 4ACDA 5HLPA 2HY81 2V62A 3MPTA 4EH2A 4FA2A 2DS1A 2BZKB 3C0IA 1MP8A 4G1WA 1KV2A 3TACA 5CALA 2UW4A 4EUTA 4DDIA 4FKUA 5KO1A 2V22A 4UMTA 1PHKA 1WBOA 3SLSA 1P4OA 5JH6A 3EKNA 3QQFA 3V5QA 3DKFA 1WZYA 5E7RA 3KRWA 4GEOA 5IA3A 1PXLA 2YCRA 3GGFA 3RAHA 1P5EA 1PKDA 2XKCA 3QZHA 2YZLA 2YM5A 3JXWA 3QZGA 5LMBA 4AXCA 2UW3A 1RW8A 3FL5A 1G8KA 3NNWA 4BCQA 4ANSA 4AW1A 5BV3A 1OI9A 2IJMA 2IZRA 4M69B 3QLFA 4XX9A 3W2OA 3GI3A 3QKMA 3VUIA 1REJA 5HVYA 2ITXA 3TV6A 2JKMA 3UOLA 3EQHA 3DTWA 3N4TA 3UNJA 4EUUA 2UZUE 2JD5A 4OGRA 2PVJA 2WGJA 2WIPA 5DR6A 1P14A 1I44A 3E93A 2C6DA 3R1YA 4BDAA 4KIOA 4RQKA 3RI1A 5DI1A 4S33A 5A4TA 5F9EA 1OITA 3ZM9A 4FSWA 2Z7QA 5AV2A 5HNGA 3EFJA 2QONA 3BHUA 3SVVA 4FF8A 4JOAA 5IDNA 3LMHA 3PXQA 1WBNA 4FG8A 4O0WA 3FLSA 4QYHA 4YJTA 3Q2JA 2PYWA 4FE2A 3OWLA 2PPQA 4O0SA 2P33A 3UQFA 3OEFX 4R78A 1WBPA 3AD5A 1QPCA 4E4LA 4WNKA 5I3OA 2XBAA 3QTZA 2G01A 3JVRA 4XMOA 2BKZA 4ZEGA 3F82A 4I5CA 4AP7A 2YIYA 3DBFA 1ZYLA 3OP5A 4CMTA 3QQHA 3OCGA 4EOIA 4BJJA 3VBTA 2F7XE 4TN6A 3NEWA 3UIMA 1PMNA 2C6MA 2Y7JA 2C6IA 4QMLA 1H28A 4H1MA 3ZONA 5T3QA 4OT6A 1JSUA 5J8IA 5L6OA 3GCSA 4YTHA 3G15A 3OZ6A 1ZRZA 4DHIB 4HPUE 3W0MA 2VN9A 3JR1A 1FQ1B 4DH3A 3DXNA 4DEEA 3ANQA 5C8KA 2O5KA 3LFAA 1WMKA 4AWIA 3FMKA 2VO6A 1XH8A 4ZZMA 2BAKA 5AADA 3O71A 4F1TA 5A4EA 1OPLA 3IW6A 4OT5A 5ANIA 5HQ0A 4XP2A 5EHLA 1KSWA 4ZSEA 2F2UA 2J90A 1G3NA 1JSTA 2XH5A 3IGOA 3MW1A 4XV9A 4ALVA 2BIKB 3ANRA 4D2VA 4BI2A 2W1HA 4F6SA 3KQ7A 3T3VA 4UWCA 3R6XA 1GZ8A 3F3VA 3GENA 2J0KA 2WMWA 4FSRA 2PZPA 4I4FA 5D41A 3KB7A 3RMFA 3W0RA 4IWPA 3FZOA 3QUDA 3V6RA 4EH9A 2G1TA 4RX7A 3CLYA 4EHEA 4FSMA 3PIXA 4FT3A 4X3FB 5DOSA 2J0IA 3P7AA 4OBPA 2QR7A 5HHWA 3GP0A 4DDGA 3R8VA 3R7YA 3E8CA 1FMKA 3A4PA 3FLNC 4BCOA 4BDEA 3NAYA 2WMAA 4Q5EA 1DAWA 3FI3A 4ZSGA 4EH4A 5FEQA 2VAGA 5HD4A 4GT5A 4GMYA 3EQFA 4PY1A 3ATSA 5K3YA 5H8EA 3VF9A 3MPAA 3R1QA 4Y5QA 3OWJA 3DBEA 4YHJA 1FVRA 2JITA 3MS9A 1TQMA 3EYGA 2YERA 2O65A 4UYNA 2GFSA 3DK7A 2QNJA 1XWSA 1B38A 4U42A 5FGKA 3WF5A 2F4JA 1WBSA 4RIWB 5DGZA 1OPJA 2CNUA 2QD9A 5HU9A 4C3RA 4C61A 2X9FA 2XIYA 3QCSA 3OFMA 3GCQA 3AKJA 3OY3A 5JEBA 5DN3A 3Q9XA 3UDBA 2XUUA 4BY9E 3EN7A 1H08A 4ZK5A 4AGCA 2IPXA 4EOMA 4FZAB 1YKRA 3EZRA 5J9LA 3CC6A 3I6WA 4BCNA 3ID6C 3D5XA 3KIOC 3TKHA 5HGIA 4I6BA 3U6JA 1ZARA 4D1ZA 4L3PA 3FSKA 3ZBXA 5DPVA 1OZ1A 2VTNA 5I3RA 3MH2A 5E8WA 3FQSA 4L43A 4GJ3A 3NYOA 3JYAA 3VONA 2RL5A 5FEDA 4DINA 2YM3A 4FKVA 4W4XA 4QP1A 3OVVA 5A46A 1NXKA 4I5MA 4QTAA 2XKDA 4M7IA 2XIXA 5IA5A 1TFFA 2XK3A 4RZWA 5HU3A 3MVHA 2I40A 4XV1A 1GIHA 2E9OA 3DDQA 5FQDC 2PE2A 3R8MA 2IO6A 3FYKX 4WA9A 3DNDA 3E8EA 4BL1A 2OICA 5K5NA 4ID7A 4DG3E 4DFLA 3RINA 3N9XA 4IWOA 4U7ZA 4R1VA 4X0MA 4CCBA 4WUAA 3VHKA 1PF8A 3W16A 3DOGA 1STCE 4BDCA 3O5AA 4FK3A 3LIJA 3LCSA 4O4DA 5CEQA 5AP1A 4BJJB 3A7GA 3RWPA 2I0HA 2ZMCA 4OTRA 3ZCLA 1GZKA 3WARA 1Q61A 2W99B 3UO5A 2W1CA 1JLUE 4Y85A 3HLLA 5CY3A 3Q4ZA 4ZJJA 5CZHA 2BALA 4EC8A 4BZNA 3AC1A 1BMKA 2XZSA 4JBOA 4V04A 3UC3A 2R64A 4F7LA 1JKKA 1REKA 2JGZA 3NSZA 4RWJA 3LFQA 2OF4A 5AR8A 4X21A 5KKRB 5KZIA 1BYGA 4FSTA 2PZYA 3ATTA 4FV6A 3NVMB 3RZBA 5CU4A 4EBWA 4EOKA 4CEGA 5I9ZA 4ZJVA 4GFOA 1OB3A 1W98A 2G2IA 3D14A 4NTTA 5AM7A 4BGHA 4A06A 1Q3WA 2CLXA 3MA3A 5HTCA 1RE8A 4FT5A 1U4DA 2W4OA 4J1RA 3F2NA 2JIUA 4NT4A 1FGKA 4JR7A 4O1OA 4Q9ZA 4OTWA 4EONA 2UVYA 4FV2A 4A4LA 4F0FA 1PMEA 2R3GA 2CLQA 3Q52A 2WTIA 4MF1A 3ZRKA 1FVVA 1R3CA 3F7ZA 2BZIB 4OW8A 5HG8A 2QOHA 1ZLTA 3U87A 5CAUA 4AZVA 3VW8A 5D11A 5LMKC 3AKLA 1RJBA 2FH9A 4D0XA 4OTIA 4FVPA 3VJOA 3PYYA 3VS5A 5E92A 1GIIA 5FTOA 3Q53A 3DPKA 5TO8A 4YTCA 5AUZA 2IW6A 2WFYA 3HEGA 3KMMA 4UV0A 5CF8A 2YABA 4DBXA 2B0QA 3F88A 5A3XA 4QTEA 5D1JA 4O83A 4GJ2A 1CM8A 1OL7A 4UZDA 5LVOA 2UZOA 2EVAA 3VUHA 3ZYAA 4GKIA 2IVTA 4PL4A 2B4SB 2W96B 3C51A 1PRYA 3R7VA 3H0YA 1KE6A 4RJ3A 1OKVA 4B9DA 4E3CA 5K5XA 4DG0E 1UV5A 4ZLZA 5M57A 3BHHA 3RBWA 2XB7A 1OMWA 5IH5A 4BDKA 2WU6A 3QU0A 3S95A 4TKSA 3TEIA 4ACHA 2R3OA 4DYMA 4E73A 4IB1A 5EM5A 2HXQA 4JDIA 3DNEA 5I5ZA 4O7ZA 2R2PA 2PVFA 3KF4A 3MTLA 3QWJA 4LRMA 4FSUA 3WZJA 4QMXA 4NJ3A 5F95A 3RP9A 4C38A 3BEAA 3JY0A 3FLQA 5JK3A 1SVHA 1V0BA 3BGPA 4W4VA 4LL0A 1ZOGA 2QO7A 4ZZOA 4ZY4A 2CJMA 5D10A 3VNTA 4QEBA 4IX5A 3UTOA 4CZUA 3PVWA 3ZC5A 4NCTC 3B2TA 4JX7A 1KOBA 4RA4A 2JDSA 2WTJA 1LEWA 3BHYA 4YC3A 3PXFA 4YJPA 2P0CA 2X0PA 3LQ5A 5GZ8A 2I0YA 4KKGA 4D4RA 4QYGA 3V8WA 1QL6A 2BIYA 3BLQA 5DIAA 4R3PA 3W55A 4AUAA 4V0GA 3W0OA 3O23A 3VWAA 3KRJA 4ZXTA 3PLSA 2FO0A 5IDPA 3COIA 4MBLA 4WHZA 4JDHA 3VBVA 5IUIA 4Q9SA 4EYMA 1GOLA 4KABA 3HNGA 3HYHA 3NR9A 4MD9E 4D5KA 3OT3A 3LLAA 2XYNA 3VVHA 4F4PA 3DB6A 3QAME 4O91A 3AC5A 2J6MA 2R4BA 5DG5A 4X6RA 2QVSE 4Y73A 3RHKA 2QO2A 4FR4A 5CF4A 4YZ9A 3ZLYA 1HCLA 2GSFA 2RFNA 3CP9A 4O7LA 4QTDA 1S9IA 3V3VA 4O81A 4AT5A 3R9HA 4AA5A 5ANDA 4M67A 3ZBFA 2VTPA 2G9XA 1LP4A 4I20A 5J1VA 2W0JA 3ETAA 3LFDA 4ZTNA 3HDMA 1SYKA 4F1MA 1OL1A 1YXUA 3HA6A 2HWOA 3BU5A 4IM2A 2XNEA 4PTGA 4YR8A 3NUAA 4EKKA 4AOIA 1ZAOA 3S00A 3FUPA 2ZDTA 3C0HA 5AIRA 3TIYA 4F09A 4D0WA 5BUJA 5IEXA 4DF3A 5CVGA 4IHPA 4B99A 5KX8A 3QF9A 3E88A 2ACXA 4TWOA 3E5AA 4TWPA 1UA2A 2EUFB 3KXNA 4FK6A 1UU9A 2XKFA 4YGAA 2GTMA 2R0IA 1J91A 2PVNA 1XH6A 5BVNA 3GQIA 3EOCA 4R1YA 3BLAA 2I6LA 3BYOA 5FDXA 1R0EA 2XM8A 1FPUA 5AR7A 5KE0A 4EH6A 4LM5A 4EWQA 3BGZA 4QT1A 2E9PA 5FP5A 5JGDA 1J7IA 3LXPA 4OAUC 1NVRA 4U43A 2J0LA 3QKKA 4E4XA 3DBCA 3ZFMA 5JRQA 5BX0A 2ZM3A 3F3ZA 2C3JA 2P3GX 3PA4A 1YXXA 3ZFXA 3TM0A 4IJ9A 3THBA 2ITOA 4RWIA 3V5PA 2HIWA 4F08A 5BPYA 4OAVB 3GFEA 2RFEA 3OUNB 1XQZA 4IACA 5DRDA 4IB3A 3ZSHA 4PDSA 4TYGA 4FV7A 4DT9A 2VTMA 2GQGA 4FOCA 5C8MA 4YU2A 2ZOQA 4RQVA 2IZUA 2YCFA 1TVOA 4QP4A 3F5PA 4EH8A 5AP4A 2HY0A 3FC1X 4RPVA 3FSFA 4IADA 5FWKK 2ZV2A 3QALE 1KE8A 3PVGA 4ZLOA 2B9FA 5AR2A 3DTCA 2QC6A 3PUPA 5KMIA 3EMGA 1H1PA 4GV1A 4EKLA 3F2RA 3R8ZA 4CZTA 4AAYA 4QQJA 1XO2B 3CPBA 3UP2A 1OKYA 3BV2A 4FL3A 4JR3A 1BI8A 3DFAA 3Q5IA 4RLKA 2OXDA 3DAJA 4KINA 3E3BX 2HWPA 2YFXA 5AEPA 1YVJA 4EJNA 4U8ZA 4F0GA 4V01A 3UVQA 2LAVA 4GU9A 4N6ZA 4J71A 4O22A 3U4UA 3IGGA 3PXRA 2W9ZB 5KUPA 3UNKA 3ET7A 3I5NA 3NS9A 3EQIA 3SRVB 5CU6A 2WTDA 4D2RA 4ARKA 4I1ZA 4F0IA 3QTXA 5AR3A 5K0KA 4BKYA 3HDNA 3VS3A 4TTHB 3WIGA 3LW0A 4G3GA 2JKQA 1XH5A 3AXWA 4R6VA 3GNIB 4QP3A 3RALA 4QMTA 1M2RA 4RRVA 1WVYA 4KS8A 3TYKA 4KSPA 4JIKA 5DA3A 1UNHA 5IISA 1O6YA 2C6EA 1MRYA 4NU1A 2XJ2A 2QCSA 1W2DA 1V0OA 2BAQA 3MY0A 5KMJA 1CDKA 4P5QA 4QTBA 4W9XA 2W1ZA 3ML1A 2NPQA 2WQMA 5CAPA 1ZYJA 3LFEA 4DTKA 1ZWSA 2OBJA 4ASXA 3ORKA 2JDTA 4DFZE 2BILB 3FQHA 4UXQA 4BBEA 3V6SA 2WMSA 2WD1A 2B9JA 4J7BA 3R71A 4Z9LA 4C4HA 3UODA 4GK3A 4DAWA 3A4OX 2WMUA 2YAKA 2IVVA 3GC9A 4FV1A 4RA5A 4FV3A 4MWIA 2IN6A 4ONAA 4XOZA 4XP0A 4YJQA 5FEEA 4ANNA 5J9ZA 1ND4A 3O50A 1J1BA 1GJOA 3MI9A 4LUEA 2GNJA 4NW5A 3JPVA 4ZS0A 3P78A 4N4SA 1PXPA 4KRCA 4MHAA 5C01A 3ENMA 1M7QA 2ONLC 4IJPA 4A4XA 2XRWA 5EDPA 4U41A 3ORIA 2PUIA 4E5WA 3EFWA 1OKWA 5KBRA 2P55A 3TMOA 1NT2A 3GU4A 4L45A 1A06A 3KK9A 1Y8GA 5TF9A 4CQEA 4C2VA 2UZTA 3UC4A 1K3AA 3LQ8A 4C4EA 5IA4A 3TT0A 3RAKA 4G9RA 4IE9A 1W2FA 2UZDA 1GZNA 3MB6A 4ZIMA 4AX8A 4XEYA 3SOCA 4YJOA 4ZMEA 5C9CA 3AD6A 3R28A 5A4LA 3PIYA 5IQCA 4EOLA 2W1IA 1H24A 2QHNA 2B9HA 4MWHA 4CGAA 1QMZA 2XCHA 4QMSA 5AUTA 2YAAA 4UWBA 5EHYA 5EM8A 3REPA 4EYJA 3UIBA 2OGVA 2W7XA 3FXWA 4QP2A 3FV8A 2PUUA 4FTJA 4DEAA 5KHXA 2G2FA 5DHJA 3DB8A 2QO9A 1APME 4XOYA 3PA3A 2B54A 4D4SA 3KREA 3A99A 1ZZLA 4B0GA 5CF5A 3K54A 1R1WA 1WVXA 3LKMA 1QCFA 4H1JA 5ETFA 3OCTA 3QD3A 4GG5A 5GNKA 1BX6A 4Z55A 4FTTA 4TL0A 3W0PA 5HO6A 4RVTA 5TT7A 3D4QA 3BELA 2LGCA 3UZTA 2UZBA 2HELA 4K6ZA 3CKXA 4YNOA 2XEZA 1XBCA 4FKQA 3GOPA 4HGTA 4NL0A 3TWJA 1ZMUA 3ZMMA 4GRBA 2XYUA 5IH4A 3UVRA 3RCDA 3DKGA 4N6YA 1OGUA 3HP2A 3OC1A 4EOSA 2BHHA 4TYIA 3HUCA 3MTFA 4XG2A 1XH4A 5AIKA 1VYWA 3QUPA 4B8LA 2IVUA 2J50A 1P2AA 2RSVA 4AZEA 3CY3A 4AG8A 3NLBA 4X3FC 2XIKA 1G8SA 3MH0A 2ITQA 4NIFB 2V0DA 4GK2A 4QMMA 5ICPA 4K1BA 3CS9A 4Z7GA 4NKAA 1A48A 4CG9A 5FM3A 4C4GA 3H30A 4IWDA 3BHVA 2YDIA 4P7EA 4CLIA 1G8JA 4MXYA 4NM5A 4QQTA 5ETIA 2O63A 4FSNA 1YDRE 4BR3A 3EIDA 1R39A 4F6WA 2UZLA 3R0TA 3H9FA 1SMHA 4O2PA 3F69A 3D9VA 4LOPA 4MYGA 3IOPA 3NX8A 2YIRA 3C4ZA 3KXMA 3IDBA 4AA0A 5D9HA 5FP6A 3CQEA 4I41A 2OF2A 4ZTSA 3FMDA 4YP8A 3HMOA 3CJFA 3S2PA 5AAFA 4FTMA 4PMMA 4UY9A 5EM7A 4A7CA 5E8ZA 3U8WA 4MAOA 2YISA 3UBDA 4EHZA 4CLJA 4MH7A 4ALWA 3JS2A 4I0SA 3P1AA 3EL7A 4JIAA 4BKJA 5I9VA 3R1SA 1Q4LA 3NYNA 4FV9A 4FTQA 2XALA 1YQJA 2VTRA 4KBCA 2YM8A 3N4VA 4WG3A 4I0TA 3FMNA 4E6CA 2R3LA 3NW7A 4JX3A 5H9BA 5EQEA 3C13A 1OL2A 2VWUA 4C33A 5BVOA 2YCSA 1TQPA 2UW5A 4UWYA 4PP7A 3HZTA 3ZLXA 4FG7A 4RLLA 3VAPA 2CCIA 3C50A 3DJ6A 2QOLA 5HEZA 3Q4UA 1O6KA 1Y91A 3F6XA 1F5QA 3L8PA 3O96A 5DNRA 4MQ2A 5ANEA 3VBYA 2XKEA 4YSJA 4H36A 2VTLA 4HZRA 5ACKA 3HUBA 3PVBA 3ALOA 3PJ1A 2QR8A 2KTYA 4JG6A 3QCYA 3P79A 4NW6A 4RIYB 5EH0A 1WCCA 3HKOA 4K9YA 4YO6A 4BWKA 5FXRA 1YOLA 4NFNA 4XYFA 3NUNA 1IRKA 2CMWA 1H27A 5E1EA 3VUDA 3MIYA 3SA0A 5D12A 3CXWA 4WRSA 5HE1A 1GNGA 1Z9XA 3SXFA 4GCJA 5F1ZA 3V8SA 2ITTA 3NAXA 3PSBA 5AP6A 3W2CA 3QTWA 5AMNA 4YLKA 1X8BA 3I1AA 3VO3A 4RJ8A 4BZDA 3ORTA 2UZVA 4O2ZA 4QQ5A 5H8BA 2BKKA 1BL7A 3Q9YA 3O8UA 5EHOA 2X7FA 2X1NA 5CNNA 5L2WA 4J96A 3EN9A 4APCA 2CKQA 2CN8A 3ZZEA 3LXNA 5L3AA 5KKRC 3FJQE 3QTUA 2WQNA 3QQKA 3CGOA 3RPOA 3NUSA 3PUFC 5J9YA 4AOJA 5LCJA 3DU8A 4WG4A 5IUHA 3SKCA 1OGYA 3GBZA 3IDCA 4K11A 4HVGA 3R63A 3MY1A 3U54A 3G6GA 3KF7A 3Q3BA 2ITZA 3VN9A 2R3JA 5GJDA 4EI4A 4FTRA 3OXIA 2BTRA 4KKHA 4OTDA 3W8QA 4BTJA 5DEYA 2RF9A 3UJGA 3I0QA 1H0WA 4XUFA 2IG7A 4C34A 5TE0A 1PXJA 2GCDA 4O0TA 3MY5A 5AM6A 3SC1A 3W32A 3PFYA 2XCKA 3C4FA 3FI4A 4L3LA 2XK6A 3FY2A 3T8OA 4CRLA 3N4UA 3HGKA 4D2SA 4O0RA 5HIEA 5TR6A 5AP7A 3NVKI 3EQCA 2FUMA 3KN5A 3GB2A 1K9AA 3BQCA 1JKLA 4TW9A 5DRBA 3VQUA 2FB8A 3RVGA 5GINE 1M17A 5A54A 5JFWA 2Q0BA 2XBJA 3VULA 3KVXA 2JC6A 5DR9A 5JT2A 4LGGA 2UV2A 3EQRA 2O3PA 4U97A 3G0EA 3OTVA 5A6NA 3MESA 3ZRMA 4EEVA 2R3IA 5BUEA 4R3RA 4YPDA 3AGMA 1WFCA 2DUVA 3KXHA 4GG7A 2BRHA 4I6FA 4II5A 5HG7A 1OBDA 4ORKA 3K2LA 3G2FA 3MBLA 3OWPA 1RQQA 1WBTA 4C8BA 4EORA 3UO4A 1YRPA 3LFCA 3G6HA 2PMNX 3T3UA 1W0XC 1UU7A 3DJ5A 4IAKA 4DITA 3OHTA 2VTAA 2VWBA 3W0NA 2OZOA 3RAIA 1JPAA 2R3MA 4RIOA 4BRXA 4I5PA 4QMOA 2UW7A 4DGNA 4IFGA 2JBOA 4HCUA 1KUTA 1NW1A 3PZEA 5AP3A 2Y4IC 3KU2A 2JIVA 2HZ0A 1R78A 3LAUA 5CAOA 5L2TA 3PWYA 2IVSA 4N70A 4FYOA 4YTIA 2YA9A 4HOKA 5LQFA 3D7TB 3IS5A 2WMQA 2X81A 3ORPA 3UP7A 4JL9A 2JEDA 3SGCA 2AC5A 2A98A 1RDQE 4IVCA 1JVPP 2PVHA 4U81A 5FTQA 4QMYA 2CNQA 5KMOA 1J7LA 4FV5A 2H6DA 2OZAB 4YHTA 5E8YA 2B53A 5FTGA 5FD2A 1G5SA 3O51A 2EXEA 5EKNA 1VZOA 3EFLA 4OLIA 3KN6A 4ZSJA 4JG8A 4O96A 4DCAA 4HNIA 1YI4A 2F49A 5L2QA 1IAHA 2J4ZA 3Q04A 3DJ7A 3AG9A 1GIJA 4QPAA 2J0MB 1H1WA 2BRBA 4IFCA 2C47A 2YM6A 4GSBA 4BI1A 5E8XA 3E8DA 2B52A 4YMJA 3ZXTA 5HX8A 4IDVA 5ANGA 4LMNA 2JDVA 1MRUA 5BQ0A 3EL8A 3TNWA 3R2YA 4ZLYA 3RM7A 4P5ZA 3KULA 3KCKA 4NM3A 2FVDA 2GS7A 4U44A 3BWFA 3NFFB 4BCFA 1Y6BA 3ZO1A 4BIBA 3BEGA 3FZSA 3SG8A 3ZHPC 5HCYA 4BWXA 4CT1A 5LCKA 3UGCA 3ELJA 3UNZA 5IQGA 4J98A 3GOKA 3COKA 2O64A 4GYGA 3WIKA 3I7BA 1PY5A 5ETCA 4BBMA 4G2FA 4ASZA 2E9VA 3QGWA 5HBHA 4ACMA 5M09A 4KA3A 1F3MC 4FUXA 3CTQA 2HENA 2Z60A 4EOQA 3RNYA 2WELA 3F2AA 3R7GA 4M3QA 4S2ZA 4QMWA 5HCXA 3R9NA 3E64A 4JJRA 4O21A 3DBDA 1CMKE 4BWPA 2OJFE 2X4FA 4GU6A 2G2HA 2PVMA 2UVZA 4RJ5A 5BYLA 2JDRA 4DHZA 2QI8A 5KNJA 2XARA 2HYYA 3TDWA 4UZHA 2WQBA 1YW2A 3MSSA 3UDSA 3P23A 5DWRA 5CEPA 4RSSA 1OIUA 4K18A 4O7SA 5EQYA 2C6KA 2QODA 4IC8A 5B2LA 1YI6A 3GC0A 3D7ZA 5BUIA 4B4LA 3SW4A 3TNPC 2JFMA 2XF0A 4W8EA 3VS4A 3ZZWA 4TWCA 2GHGA 2CCHA 3AMBA 3R8PA 3BU3A 3R1NA 4XV3A 4K77A 4DH1A 5I9XA 3BLHA 3KMWA 2XA4A 2B55A 2ZYBA 4YJRA 3CE3A 3GU6A 3BQRA 3OD6X 4FIHA 1OL6A 4HW7A 4FEVA 2VUWA 5CSXA 4DHFA 2R5TA 3BV3A 2C5XA 3AC2A 3LFBA 4GT3A 1ZOEA 4WBBB 2R9SA 3QA8A 3B8RA 1Q8WA 3C1XA 5JKGA 1KE9A 3FMEA 4ZY6A 2W05A 3SV0A 3FMMA 3WYYA 5BVEA 4EK6A 2VX3A 4QPMA 4LRJA 2NNWB 2BMCA 4MEDA 3AT2A 5AAGA 1QPDA 5L2SA 5HBEA 4F63A 4CXAA 4PMPA 5ITAA 4AFEA 3SQQA 4BKZA 2CPKE 2Y6MA 3GCPA 4BDDA 2VWWA 4FYNA 5T68A 1YDSE 4RG0A 4R7BA 4NEUA 3VIDA 2CGVA 3SG9A 3S1HA 4PV0A 5LVPA 4UMRA 4HPTE 3KK8A 5HO8A 3AKKA 4DG2E 3EN5A 3NNXA 2V55A 5C4LA 4XLVA 5AUWA 3IDPA 5BVWA 4DH5A 2CSNA 3NNUA 3MFRA 4FT0A 4NTSA 1YXTA 5B2KA 4ZJIA 4HVIA 2YLFA 3H3CA 3LCOA 3MVMA 3NW5A 2W5AA 1VR2A 2DWBA 2Y0AA 3KL8A 5A6OA 4FBXA 3EQBA 2XNGA 4NH1A 4BHNA 2W1DA 3BCEA 5CS6A 4I5HA 3TZMA 2YITA 1M2QA 4FTKA 1Q99A 5E8SA 3ZSIA 5CSPA 5C1QB 2HAKA 3NYVA 2W9FB 3NCZA 4MCVA 4M68A 4AZSA 4D5HA 4HVSA 4ZSAA 5AFVA 3R9DA 5HZNA 1SNUA 4CMUA 2X0OA 3UMWA 3JVSA 5M08A 2IW8A 2GHMA 4QYFA 5CTPA 3MJ2A 3Q4CA 1YXVA 1ST0A 1FINA 1WBVA 1XBBA 4PP9A 4CKJA 5IEVA 4MXCA 5A14A 4FGRA 3EHAA 5HO7A 4FEUA 2FSLX 2Z02A 3LVPA 2OKRA 2XK9A 1AGWA 5I4NA 3HV7A 3CTHA 3LJ1A 2ZV8A 4CCUA 2Y4IB 3PDTA 3ZSGA 2E9NA 3PLAE 1V0PA 2PUNA 4W4YA 1NY3A 2UVXA 4I4EA 4EOOA 4FKPA 4FKSA 2PE0A 4A9SA 4XRLA 1MQ4A 2ZJWA 2ESMA 4XNEA 5LVLA 2C5VA 3EFKA 1Y6AA 4MXOA 1Q8ZA 4Q5HA 1PMUA 3P0MA 4X2FA 4A4OA 4CYIA 4Y83A 5AUVA 2ZDUA 1OIYA 4IQ6A 3LPBA 5FDPA 4EJ7A 4CV9A 2PU8A 1UKHA 2C6LA 2H9VA 3EQDA 3Q32A 3KVWA 2FGIA 3O0GA 1CSNA 2ETRA 3BX5A 3ZXZA 4MXAA 3OT8A