5EI8A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
280
structure length
261
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGTVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 261
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ei8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ei8A01
3F69A 1REKA 1ZARA 4WSQA 1GZ8A 2ETKA 4O83A 3Q53A 1GZNA 3PA4A 4IDVA 4YTIA 4G9CA 4FIGA 4FIJA 4FTNA 1ND4A 3QD4A 1P14A 2R9SA 3N51A 5EYDA 2VTNA 5FTOA 5KBRA 3LFAA 3QUPA 3FMJA 4Y95A 3Q4ZA 4JDHA 3FDNA 3TZ7A 4O7SA 3HVCA 4Z16A 5CAPA 2BKZA 3MFSA 5HNIX 3LZBA 2PMIA 3FXXA 5D12A 3SG9A 2VTQA 4BKYA 2PVKA 4J95A 5CI7A 4NTTA 4Z55A 4YLKA 3OW3A 5DH3A 5C03A 5E92A 5KMJA 3CQEA 1EH4A 2P33A 4IJPA 5H8BA 3RZBA 3DFAA 5JGBA 2RG5A 2YITA 3Q4UA 3EKNA 4XLIA 1Q8UA 2VRXA 3TCPA 4FKPA 4UY9A 2BDWA 5HU9A 4F9AA 3R8VA 4RWJA 4CTBA 3EFJA 5ETCA 5LMBA 4KSQA 5DE2A 3EN4A 4FT5A 4XV2A 3H9OA 1WMKA 3CJGA 3NW6A 5TF9A 3HZTA 4GJ3A 4A9SA 2DUVA 4KIOA 5LMKC 4PMMA 3FEGA 3FWQA 3CP9A 2PE2A 4D2SA 5LVMA 3E8EA 2YIYA 4NW5A 1FMOE 4DEAA 3LJ1A 3I79A 3KN6A 3AGLA 5FLFA 2XK7A 4PNIA 2J0MB 4BGQA 5L2IA 2CNVA 3EQPA 4S32A 2BIYA 3ZDIA 4BIDA 2X2KA 4GVJA 3QRTA 3F7WA 3TZ8A 2EVAA 5HVYA 5HD7A 2EXEA 2VWWA 3LCKA 4O7WA 3RPVA 2ACXA 3LFNA 1CMKE 4DH3A 3P9JA 4LRKA 1URWA 2G2FA 3DY7A 3ERKA 5HVJA 3VBQA 4EJNA 3UQCA 3KRLA 4BTMA 2GSFA 2ZV8A 4ACMA 3CQWA 5DIAA 4EK8A 5IA0A 1PMNA 5DFPA 2WTWA 5M55A 5KHXA 4JX3A 4XG9A 3RALA 2YJSA 4HVHA 4YJOA 3ZU7A 5K4JA 3W55A 3TEIA 2GCDA 4GUEA 3EB0A 2QO7A 3EH9A 4C57A 3GXLA 1JSUA 4YNOA 3KK9A 5E90A 4DLJA 2I6LA 3M42A 2XIRA 3LHJA 4UMRA 3LLAA 1J91A 3ZO4A 2WTCA 4OBQA 3LJ2A 3ZRLA 2EXMA 4YNEA 5BX0A 3SV0A 3ZLSA 5JGAA 4BY9E 3OVVA 4G31A 4BCKA 2YIWA 3TDVA 3BYMA 4G3GA 1IA8A 5AP3A 3LMIA 3QTUA 2REIA 3G33A 3KK8A 4E7WA 3NUYA 1LUFA 2YDIA 2WFYA 4QPSA 2YA9A 4FEUA 3NUNA 3R9NA 4OTFA 2X1NA 2Y4PA 3A8XA 4D0XA 4MQ1A 2XK4A 3WZEA 1OIUA 1U54A 4NEUA 3SOAA 3PLSA 4QP8A 4IZ7A 5BVOA 1Q8ZA 2OF4A 3BU6A 3RK9A 2GU8A 4IACA 5CVGA 3RNIA 4DG3E 2PUPA 1YWNA 3CQUA 3L8PA 5EDRA 2ITOA 3MTFA 3TNQB 3FZTA 4NFMA 3KMWA 2QOCA 4I4FA 4RZVA 4YZCA 1W82A 2QD9A 4YZNA 5EM6A 4TPTA 2XKCA 3RM7A 4I5PA 2LAVA 3I4BA 2B0QA 3P86A 4ZSGA 2C6TA 1SVEA 2GNGA 2QHMA 1DAWA 4KWPA 3FQEA 4BCOA 4DFXE 4ZLZA 4ASDA 4L8MA 4GG7A 5CU2A 3KMMA 4IQ6A 4HVGA 3KKVA 3PRFA 1SYKA 1R3CA 4FG9A 3BU5A 4IZYA 4DA5A 2X0GA 3CTQA 2PPQA 2QKRA 4CXAA 2R3HA 5HX6A 2B4SB 3O8PA 3PY1A 3VW6A 3AMBA 1J3HA 2Q0BA 2UVXA 3CY3A 4DFZE 3DLSA 3DV3A 1FGIA 1ZMVA 3FKLA 3R9DA 2CKEA 4S34A 3V5WA 1UU3A 4O91A 2QU5A 4Y73A 4AX8A 4BCQA 3LCSA 1WVWA 4GKIA 5CTPA 3E62A 4LUEA 4K2RA 1TQPA 4L53A 5CALA 3F3WA 3MESA 4F4PA 5GNKA 1KE8A 2XK3A 3DAJA 3P08A 3R2YA 1YKRA 4JBPA 3A4OX 2F7EE 2J51A 3E8NA 3H0ZA 3Q9WA 4IDTA 4RJ5A 5M08A 3U55A 2XKDA 4ACCA 1OZ1A 1M2QA 5ACBC 2XIZA 4ASXA 2XA4A 2YACA 1JQHA 4HOKA 2RFSA 4PV0A 4F63A 5M4IA 3PXYA 4Y85A 4EYJA 5ACKA 2WMWA 3DGKA 5J95A 3V04A 5E8VA 5TO8A 4M66A 5AUVA 5AR2A 2XIYA 3HAVA 4WA9A 2CN8A 1ZWSA 2VWZA 2BFXA 3D0EA 4JI9A 5DPVA 4AA4A 5BUIA 3U6JA 3OWPA 3GU8A 3MA6A 2C3IB 2C5YA 4FT9A 1APME 4LFIA 4NUSA 4S30A 2GHGA 4FKQA 4LOQA 4UWBA 4HYUA 4RC4A 4RZWA 4EK6A 5JMSA 3TM0A 5CXZA 3TXOA 2PVLA 3E88A 4C2WA 5IQGA 4J52A 4BWXA 5AP5A 4Y83A 3LCOA 5M57A 3MDYA 5FRIA 4D58A 4YPDA 3P7CA 4PL3A 4JBOA 4AW5A 4W4XA 5CY3A 5IQBA 4UV0A 4PP7A 2W1EA 1U54B 4YO6A 2YZLA 3QQLA 1Y6AA 1WVYA 3PPKA 4TYHA 3G0EA 3ZLXA 4OR5A 3HV6A 3JR1A 5I9VA 4ACHA 4J1RA 1Q8TA 3RAWA 4AU8A 4C62A 5BVFA 4GSBA 4WO5A 1JVPP 3ZC5A 1Y6BA 1WAKA 2BUJA 5TE0A 1YVJA 2CLQA 1ZYLA 2DYLA 3QKMA 5FEQA 2CGWA 3SRVA 3NR9A 3ZM4A 2PE1A 2GMXA 3CR0A 2B9IA 4CYJA 3ODYX 3GUBA 4M13A 3UIBA 3OROA 3P4KA 3TJDA 2Q0NA 5CU6A 5IU2A 4XBUA 1IA9A 3NNWA 4FNYA 3RI1A 4U7ZA 3DK7A 1WBSA 3EN9A 3O7LB 3RPSA 5BVDA 2KULA 3BQCA 4X2KA 3ZDUA 3JY0A 3W8QA 3MFTA 4CT1A 1ZMWA 4EZ5A 3UGCA 3DQXA 3R7GA 2XS0A 2E2BA 3F2AA 3NWWA 4BZNA 2OJJA 2JIUA 4I6QA 4Y72A 3FZSA 3LXLA 1XQZA 2EWAA 4IAKA 2XEYA 5KMKA 3PJ8A 1XBAA 4FKOA 3KXNA 4CGAA 5FD2A 4HNIA 5FBOA 4CD0A 3VQUA 4D5HA 2FUMA 3G0FA 4OT6A 4X2FA 1OL6A 4ZJJA 5DN3A 4O6LA 5J9LA 3SXSA 3F2NA 3Q60A 5J87A 3FMEA 2JKQA 4EOQA 5J7HA 3F2RA 4YHTA 2XM9A 4GRBA 5AV3A 3DXPA 5AADA 1K2PA 3KEXA 4YPSA 2UW6A 4IB3A 3E63A 3E87A 4K33A 4J97A 1Q3WA 3TNIA 3QQKA 4LV5A 2BR1A 3UP7A 5K5XA 3ROYA 4DE4A 2UVZA 5IH4A 3BKBA 3UQFA 2GNFA 2OKRA 4FNWA 2ZDTA 3E93A 1PXOA 3F5XA 5ANDA 2ZJWA 3GC9A 4L7SA 3RK5A 3DZOA 2HXLA 3ZTXA 4O7VA 4KS8A 4BKJA 4K9YA 5E8WA 2ESMA 3FMMA 4OTQA 5L2QA 1BL6A 3G2FA 3QRKA 3UC4A 4AF3A 5EYCA 4CFXA 5BMSA 4PX6A 4IAAA 2BFYA 3GNIB 4NK9A 4B99A 3ZO3A 4EOLA 4L52A 1IASA 2WD1A 1UU9A 4DLIA 4M0YA 4F7NA 4KD1A 4TWCA 5IA1A 3CY2A 3KY2A 2BRNA 4CFUA 3R9OA 3PXKA 4HYIA 3NYXA 5CF5A 2ZOQA 4K6ZA 4PPAA 4P2KA 4S33A 3H9FA 3G5DA 3EKKA 4FV4A 4DTKA 3CPBA 2QKWB 3QUDA 1BYGA 3OP5A 3QF9A 5AP7A 4XHKB 4FZAB 2Y0AA 4FEXA 2YLEA 2WQMA 2UUEA 5FXSA 3QZHA 4JRVA 4MD7E 2F4JA 3I0QA 5IDPA 2OLCA 3EN6A 4IX5A 5E9EA 3RCJA 2IVTA 2WU6A 3U9CA 4LGGA 4F0FA 4ZEGA 4FX3A 4GYGA 4MD9E 2W9FB 5L3AA 3FYKX 3V5JA 4Q9SA 4E73A 1G3NA 5KUPA 2C0TA 3PXFA 1I44A 4R5YA 3MY0A 5BYYA 5DWRA 3MWUA 3BBTB 3JPVA 5AV1A 2V7AA 3SRVB 5E4HA 3OUNB 5FQDC 5T3QA 4JLCA 4TL0A 4QNYA 4USEA 3K3JA 4FK6A 3IECA 5JRSA 4JL9A 2HAKA 5EDPA 3ZC6A 3IGGA 3IK3A 4DCEA 4QMZA 5E8SA 2C3JA 1YXSA 4F9BA 4CNHA 4C02A 3NRMA 3C0IA 4G3EA 3W2RA 3ZFMA 4TWPA 4AGCA 2JITA 3W33A 3EN7A 4DFBA 3FUPA 5B7VA 5L2TA 4Z9LA 3WF6A 4K1BA 2W1DA 2W1CA 2VTRA 4O2PA 2BALA 4XG3A 5FUTA 3Q52A 3ZZWA 1Q8WA 4KBCA 1UU7A 2AC5A 4RC2A 4I41A 4IVCA 3N4UA 1PHKA 1QPJA 2XRWA 5EI6A 4DEGA 4DF3A 2BRBA 5CXHA 4HPUE 1SNXA 3PRIA 2OW3A 4JAIA 4GVAA 5EI2A 3VS7A 2I0HA 3BYUA 2ITXA 4H1JA 4XV3A 4E5AX 4ZZOA 5HLPA 3PSDA 3D7ZA 4DHFA 4F9YA 2WMRA 2GNLA 1G8SA 2X39A 2C0OA 2GPHA 3NNUA 2B9JA 2WZJA 5FP6A 2J4ZA 5TT7A 4E93A 3P1AA 3BV3A 3F3VA 4MXZA 1PMVA 5M4UA 3RMFA 4GK3A 4H3BA 1PJKA 2CCHA 2IJMA 3OCSA 2QOLA 4LMUA 5CI6A 5EW9A 4CQEA 2VX0A 3LXNA 1UWHA 4V01A 2ETRA 3R00A 4PL5A 4YGAA 4QTEA 2Z7LA 5JFSA 4FV9A 5EM8A 3D14A 2X4ZA 3JUHA 4O0XA 5EOBA 1U5RA 5LVLA 3ZMMA 3MIYA 3A60A 5F20A 2QURA 4QQCA 1CDKA 2X8IA 1F3MC 3IW6A 5IQEA 2GNJA 3PP1A 5EI8A 3ALOA 3QKLA 4QP6A 4HCTA 1L8TA 4UMQA 1YRPA 2F7XE 5IUHA 1L3RE 3B2WA 4ALVA 4HZSA 3E3BX 1Q61A 3FI4A 2J50A 4ZZNA 1J7UA 4UMPA 4ANLA 3HAMA 3D5WA 4R1YA 2A4LA 3IGOA 4GIHA 1NW1A 4L43A 2J5FA 4BDDA 3R04A 4PMTA 5M06A 3TT0A 4XNEA 1YI4A 1FQ1B 3GOKA 3I81A 3QCXA 4B8LA 2QHNA 3L9MA 4PMPA 4IAYA 5HKMA 1M7QA 3FYJX 4LUDA 5M51A 2IG7A 1UV5A 3FPMA 4I6BA 5L8LA 3D5XA 4UYNA 3UBDA 5EQYA 2VZ6A 4D55A 2PULA 3C1XA 2C6EA 5FXRA 3BWJA 4C4FA 3ID6C 3KXXA 2RF9A 2VO3A 3PG1A 3EMGA 2ITPA 3NW5A 5AV4A 2Z2WA 4XEYA 5HIBA 1GZOA 4D2TA 3EQFA 5IZFA 4FSRA 3DBFA 4JXFA 1Q4LA 2QVSE 4FK3A 4MTAA 3H0YA 4GMYA 4RFYA 5KHWA 3V6RA 3NAXA 3TV4A 5LMKA 4FV2A 3BHTA 3I60A 4D1SA 4J96A 2YAKA 3E3PA 5IKWA 3NUPA 2XIXA 3L8SA 5GHVA 5LOHA 3BYSA 3DKOA 2WAJA 3CKXA 5CAUA 5DR2A 3ANRA 2BHEA 4CT2A 4FNXA 4D2PA 5HZNA 5EQPA 4DG2E 1FBNA 3BHUA 2W1GA 3UYSA 4LYNA 3COIA 4RA4A 3ZBFA 4DYMA 3OW4A 4J71A 3ORTA 3JVRA 3MVJA 3R71A 5L6PA 1CTPE 2O5KA 4ASEA 2ITUA 2PWLA 3VUHA 2H9VA 3CGFA 3BU3A 2E9PA 4FKTA 4FV0A 4JDJA 3ZUUA 5AA8A 4I1ZA 3EJ1A 3ZOSA 3ETAA 4DTBA 2GNHA 5J9ZA 2AC3A 5M56A 4MXAA 3Q2MA 3RP9A 4XOYA 3R1SA 4BWKA 2QNJA 3NNVA 4RJ4A 1SVHA 4DGGA 5M07A 4C59A 5CEIA 3DOGA 3OZ6A 5GZ9A 4BHNA 4P90A 3AD5A 4LQMA 5CF8A 1LPUA 2IVUA 4DTAA 3FXWA 2PVMA 3FE3A 3MA3A 3QXPA 2JGZA 3LJ0A 3AC3A 5FBNC 4OTDA 4JQEA 1Q5KA 4ZY6A 5D10A 4J7BA 4AT4A 2UZWE 4JQ8A 4YTHA 3WZJA 4OTHA 2GQRA 2ZYBA 3VUTA 3WIGA 2F9GA 1H25A 4BWPA 3ENHA 4DGLC 2PZPA 3E8CA 3LMGA 4ANMA 4DCAA 3KF4A 2YWVA 3DJ6A 4ZLOA 4IC7A 2QR8A 3HDMA 3LXKA 3CC6A 2P2HA 4RMZA 1QCFA 3EQIA 3HGKA 2YWPA 1H1PA 1Q62A 2WU7A 1LR4A 2WPAA 5LJJA 4RIXA 5CVHA 4M68A 2XKEA 1PMEA 4BI1A 5HBJA 4WSYA 2E9OA 2R3GA 5IQCA 2YN8A 4IAIA 2QO2A 4EH4A 4HCVA 3P5KA 1TVOA 1KE9A 4GT3A 4AE9A 4DG0E 4E1ZA 4ORKA 1R1WA 2VWYA 1B39A 2F57A 2R3NA 1YWVA 4XG7A 4XRJA 4C2VA 3IPHA 5J79A 5DT3A 3ET7A 4KABA 4QYEA 3ZEPA 3I5NA 3S2PA 4BDEA 4AZEA 4YJVA 2YM5A 3UG2A 4C61A 3KL8A 4FUYA 3QZIA 3OWLA 2VWUA 4F1OA 4WRSA 5G1XA 4UX9A 1XH7A 4KKEA 4BBEA 5ANIA 3RPRA 4BIBA 2R3RA 4CCUA 4ONAA 4H3PA 4X0MA 4IMYA 3D5UA 2PUNA 3PXRA 1V1KA 4PTGA 1W84A 3H3CA 5GZAA 4WG5A 2UW3A 3A7GA 4MF0A 5JZJA 3LFCA 1XJDA 2UW8A 4DFNA 3KULB 3LXPA 3UIXA 3EL7A 4DBXA 3NGAA 3I5ZA 4RVKA 5JFVA 2B54A 2IZRA 5KE0A 3OHTA 3PIYA 3W2QA 2HZNA 1VEBA 4DEEA 3O96A 4DT9A 2YDKA 3PZHA 2W1ZA 3OT8A 2AUHA 1YXUA 5HICA 4MXYA 2OI4X 3SD0A 4D1XA 4E6QA 4M15A 4BL1A 4G3FA 3QU0A 3LVPA 4UWCA 3L9NA 3TN8A 4BTFA 3VHEA 2ZV7A 3PE2A 4HGEA 3FKNA 5HD4A 4RT7A 4WG3A 4WD5A 3O51A 3GQLA 3PSCA 4O2ZA 5LWMA 3CTHA 3DNEA 1ZYSA 4FL1A 5E8ZA 3POOA 3UIMA 2GHLA 2J2IB 3PE1A 2HENA 3Q32A 4IZAA 4U40A 3VUKA 4Q9ZA 4ZSAA 4C58A 4O7NA 3QTXA 3SG8A 3KC3A 4DT8A 3ZXZA 4Z7HA 3HL7A 1OL5A 1R39A 1W8CA 4P5QA 5CSHA 5HEZA 1GNGA 3AT3A 3GC8A 4G16A 4BDKA 5IISA 4FOCA 2FSMX 3Q9YA 2I1MA 2X8EA 4H3QA 4MBIA 4JX7A 4FKGA 5FWKK 4BDFA 1ZZ2A 4RPVA 1Y91A 5FTGA 5BVKA 2CKQA 2HCKA 1KE6A 3UZTA 3QQGA 5AEPA 4F6SA 1JOWB 5DOSA 4YZDA 5E91A 2R3IA 4YLJA 4TTHB 4ZAUA 4L68A 4U0IA 3RJCA 3NAYA 2WMXA 1SZMA 4D28A 3MN3A 2OFUA 2JKKA 4TZRA 2V55A 3SKCA 3G9NA 3KXGA 4EOMA 3NUXA 4QMOA 4FKWA 5CU0A 3JVSA 5CZIA 2G9XA 2DWBA 1OPKA 3DKCA 4PF4A 4ZS0A 1LEZA 2CJMA 2QOKA 2C5XA 2BAQA 3GOPA 2F7ZE 4RIXB 3ZEWA 2Y4IB 2ITYA 5FEDA 5EW3A 2VX3A 3L8XA 4IB0A 4N57A 4QMVA 2VTHA 2PU8A 5L6WL 2EXCX 3CEKA 3KRWA 3R7IA 2V22A 4FBXA 3LFSA 4EK4A 5AP0A 4QQTA 2ITQA 4MBJA 2BHHA 4E6CA 4ZP5A 3W8LA 3S95A 3G90X 3MW1A 5GIPE 4R7HA 4CZTA 4EYMA 3HUCA 4D4VA 4ITIA 3O71A 3GQIA 1JKTA 3BQRA 1FMKA 2VNWA 2XKFA 3K54A 5AUWA 2OXYA 4WBBB 3SXRA 4DEHA 5IF1A 5IPJA 1O6LA 4IX6A 3PPZA 3O17A 5DLSA 1K3AA 2X9EA 4BTKA 4PTEA 3ZUTA 5AMNA 4FOBA 2BILB 2W1FA 4J8NA 4L00A 4NCTA 2B53A 4ZTSA 4XP3A 4ENYA 4TY1A 5AAGA 1OKYA 4R5SA 2UZVA 2R3KA 2YDJA 4LGHA 4O0TA 4B8MA 2HELA 4L45A 4FVQA 2O0UA 3KF7A 1YDSE 4H58A 2C6IA 3FLQA 5A46A 5L4QA 2BPMA 1OMWA 5EG3A 2WQOA 1YWRA 3PIXA 4X6QC 5B0XA 4CLJA 3IONA 5HX8A 3CTJA 2RFDA 4FV1A 5DA3A 2VV9A 2WTDA 3E8DA 2OIDA 3TKIA 4AZTA 5LVNA 4IB5A 4IJ9A 2WNTA 1ZXEA 2GFSA 1MP8A 3GENA 4YZMA 4KKGA 2HIWA 1OGUA 4U81A 4WBOA 3WBLA 5A4TA 3UO5A 3MFUA 3ZONA 4AA5A 4AQCA 3LE6A 2JD5A 1PW2A 4A4LA 5M53A 4UBAA 5IA5A 3KMUA 1Q97A 5HORA 3TV6A 1JWHA 4IX3A 3MSSA 5HLNA 4JBVA 2UZTA 5I5ZA 2J0LA 5HLWA 3TIYA 4AACA 2BRMA 3C5UA 3A61A 4IAFA 2C5VA 2WMQA 5BYZA 3FI3A 3GI3A 1S9IA 3LFDA 4FKIA 4M0ZA 4DGMA 5I4NA 4FYNA 3HMOA 4EEVA 4GKHA 1ZYJA 3R7EA 2ITVA 4L3LA 4NW6A 1ZOHA 1Y8YA 2GTMA 3FL4A 3RK7A 1RDQE 4G6LA 3C7QA 5LWNA 1R78A 3CKWA 2EU9A 3FC2A 4C3RA 3W18A 4BBMA 3F9NA 5AR3A 3I0OA 4AZWA 3R02A 3U8WA 5F95A 2Y4IC 4H1MA 5KZIA 3MGYA 4F99A 5J1VA 1FVTA 1H01A 4YC6A 3LOKA 4A7CA 5LARA 4YSMA 3AXWA 4ID7A 2V5QA 1Q3DA 3VJNA 1R0EA 3I1AA 4O0WA 5A3XA 2CN5A 3ANQA 5HG8A 4EUTA 3F5PA 3RCDA 1DI9A 5KMMA 4LRJA 1IG1A 3WF7A 1PKDA 2WEIA 3WYXA 4EOOA 5IA3A 1IAJA 4USFA 2J0IA 3R6XA 4ZTHA 4Q5EA 4CV8A 3FI2A 2R5TA 2WMBA 2C6OA 3D2KA 4NT4A 5J8IA 3VBWA 4EHGA 3EQBA 2PMNX 3O2MA 4EWQA 4DBNA 4Q5HA 3O8TA 3O8UA 5DR9A 5CASA 3KCKA 2ERKA 1H1RA 4EQMA 1JKSA 2O3PA 4IM0A 2XNMA 3BHYA 5AR4A 2V0DA 2R3FA 3VULA 4AWIA 3OXIA 3CE3A 3VBTA 4X21A 1MRYA 4BZDA 1SVGA 5I9ZA 1J1BA 4FTMA 4OBPA 3MI9A 3UPZA 3MJ1A 5L8KA 2X7FA 1QPDA 4IWDA 1E1VA 2X7OA 5EOLA 4C3PA 1M2PA 1OPLA 3DPKA 5LCKA 4D1ZA 3A4PA 4DITA 1W7HA 2VTOA 4E4MA 2XJ0A 4GS6A 4MNFA 4FT3A 4G34A 2C5NA 2IN6A 2W05A 4F70A 3UZPA 4IBMA 4BKZA 3IW7A 4GV1A 4HCUA 4M12A 4I5CA 3Q04A 3WIKA 5BVEA 3VUIA 1GZKA 3FY0A 4AZSA 4M8TA 2VWBA 3VF8A 5M4CA 5DBXA 4DH5A 2ONLA 1WZYA 3F3TA 4E5BA 4FA2A 3MVLA 1OPJA 2NO3A 3FZRA 4EHEA 4OTPA 4YJRA 4NSTA 2YISA 3UE4A 5GJFA 4M3QA 3I6WA 4L7FA 5JQ5A 4L67A 4JS8A 2C6KA 1PXNA 3A2CA 4FF8A 2HWPA 3IO7A 2WIPA 3MY5A 1OUKA 5E8TA 3C51A 5I9YA 5E8UA 2HXQA 3MH3A 4E6AA 3FMHA 2FA2A 2HYYA 4GUBA 4QYYA 4RIYA 3HRBA 5FM3A 4EH5A 5HIEA 4EK3A 4O81A 4LMNA 3RINA 5HU3A 4XP0A 2VGOA 3DT1A 5F9EA 4NKAA 1FOTA 1XH4A 1NXKA 3QRIA 4KKHA 4YJTA 5AM6A 4KIKA 1G8AA 2PVFA 4NIFA 4HW7A 2YJRA 3COMA 4EOPA 4FVPA 4QMYA 2WIHA 3HRCA 4M69A 3TUDA 2A27A 2WELA 4Y5HA 3GP0A 4MKCA 3R7UA 4QPMA 4KSPA 3B2TA 5H2UA 1NVSA 5HVKA 5BVNA 5LVPA 4RFZA 1RW8A 3GFWA 2OICA 3D2IA 4RFMA 4M97A 4BDIA 2CLXA 3VIDA 4ACDA 4OAUC 2J5EA 2PZ5A 1PYXA 5HE2A 4BC6A 3RAKA 4BB4A 3LFEA 4ERWA 2A19B 3V8WA 4GG5A 5CYIA 2E9VA 3UQGA 3IW8A 5IQDA 3DFCB 4PPBA 3UNJA 4O7TA 2SRCA 3NMUF 1PXLA 4EWHA 4QP1A 4KRDA 5K0KA 3LFBA 3TNHA 4XH6A 1WBWA 4GJ2A 3SDJA 4EC9A 4NU1A 3I7BA 4QO9A 1ZY4A 2XK6A 5GZ8A 2WB8A 2C47A 2PVRA 4I6FA 3VNTA 4NM7A 2FO0A 1KOBA 2VWIA 3PJCA 2BZIB 4BZOA 4E5WA 5F4NA 4II5A 2R3JA 3D4QA 4XLVA 3UJGA 3TKHA 2YIQA 5CSPA 4C0TA 3EQHA 3QHRA 4G9RA 4NCTC 2W4OA 2RFNA 5JQ8A 4RJ7A 4JG8A 4IHPA 3KXHA 1V0PA 1ZAOA 3KVXA 1MRUA 2ITTA 4BRXA 4LL0A 1GAGA 1MQBA 2WO6A 3KXZA 1H28A 3KRRA 2P2IA 3MBLA 3H10A 4FL2A 5K5NA 3UG1A 5F94A 3TKUA 1OIRA 2BVAA 4C4HA 3C4CA 1H1SA 2E9UA 4G3DA 4UN0C 2W7XA 3MFRA 4AAAA 3LLTA 1O9UA 4JQ7A 5IH5A 5EQEA 2YABA 3ZFYA 4BF2A 1UA2A 5C1QB 5ANOA 3K2LA 4JG6A 4A4XA 3NUAA 5DRBA 5AR5A 3EIDA 4UB7A 3U9NA 2BKKA 2CSNA 3CLYA 3P78A 4DC2A 2WMSA 4FV6A 4L9IA 5J1WA 3MYGA 3R83A 5DEYA 3QWKA 4AT5A 4MD8E 3WILA 2PZYA 5HCXA 3ITZA 3TTJA 4YJNA 3BYOA 2W4JA 2JFMA 5AX3A 4QQ5A 3Q5IA 5B2KA 1R0PA 2G15A 3FLNC 3BRBA 3PSBA 3VAPA 1T45A 4CFWA 3BZ3A 5I9WA 4YUQA 3DAEA 2YERA 4KINA 4RIYB 4FEVA 3PZEA 3AD4A 2C69A 2O64A 4K77A 3W32A 4XJ0A 4F7SA 5JN2A 2XNGA 1OBGA 3QXOA 4XBRA 4KIKB 4NIFB 1ZY5A 4XG6A 2YCQA 3WZUA 1VYWA 2KTYA 3FAAA 4Q2AA 2JKOA 2CGUA 4M69B 2I0EA 2XB7A 4BBFA 2P4IA 4FKJA 4JNWA 4V0GB 1MQ4A 4PUZA 5A4CA 1ERKA 3SA0A 4ZJIA 3U54A 2JKMA 1XR1A 4CKJA 4GK2A 4L44A 2JDOA 1ATPE 3A62A 2DQ7X 4FGBA 4F7LA 2NP8A 3QRJA 5M09A 4TW9A 3HEGA 5AV2A 5JT2A 5DHJA 3UIUA 2VTMA 4OLIA 3ZYAA 3HECA 3I6UA 5D11A 5HTBA 1PXIA 1JAMA 3ORKA 1GY3A 3ZLWA 4BR3A 3EOCA 4KNBA 5A6OA 3QCQA 4XS2A 3VF9A 5D7VA 4YBKA 2EB2A 1KV2A 4N70A 3NZ0A 3BGPA 4U41A 2G01A 3A8WA 1XKKA 4I92A 5J5SA 4C4JA 4E20A 3BLRA 4R3RA 4ZTNA 4FTQA 4MWHA 4O0SA 3R63A 2YEXA 4G5JA 5E7RA 4RRVA 3SHEA 3TG1A 4NJDA 4YMJA 2YCRA 4I4EA 2P3GX 1HOWA 5HIDA 1KV1A 4LV8A 3BGQA 1UWJA 2QC6A 3QA8A 5KBQA 3OEFX 2VTLA 2ZV2A 3NCGA 3FKOA 1ZZLA 3DS6A 3R2BA 4HGTA 4NWMA 4TT7A 3SX9A 2G2IA 2UW9A 2YIXA 3FLZA 4IWOA 2JBPA 5M4FA 2IZSA 3PJ2A 4B9DA 3IQ7A 4IX4A 4U43A 5CSXA 4U42A 4FODA 4ZY5A 5IQIA 4IXPA 1YDTE 2C5OA 1X8BA 3IW5A 4HYHA 3KVWA 4O96A 5JSMA 2WQEA 3ORLA 3F5UA 4TYIA 1CSNA 4CRSA 2ITZA 1Z57A 4C33A 2ZM3A 3QTRA 3C5IA 5CSWA 2VX1A 2ONLC 2JLDA 3GEQA 3GU5A 4MYGA 4U9AA 5D7AA 3UTOA 3NSZA 4XCUA 3PWDA 2YLFA 3WARA 4XV9A 3BELA 1BLXA 2JDVA 3HMIA 4NTSA 3Q6WA 2UW4A 2X2LA 2JAVA 3OCTA 3HMPA 5GINE 5FM2A 4DH7A 4EI4A 3V01A 4F08A 1OB3A 4OTIA 4EJ7A 2R3LA 4ZMFA 5CAOA 5CEOA 3RPOA 2H96A 4GFMA 2HWOA 4QMQA 4PL4A 1FVVA 3L8VA 3PXQA 3JYAA 3DTWA 4G3CA 3PJ1A 4NM5A 4U5JA 2OXXA 3QLFA 3SVVA 5CNNA 1YOMA 3WF5A 5EW8A 4FTTA 3UMXA 4M14A 2GS7A 2XNBA 2C1AA 2CNUA 4XX9A 4RJ8A 4O7LA 4JVGA 3FL5A 4XMOA 3R22A 3S3IA 5IA4A 3N4VA 5H9BA 2Q83A 4G17A 3QZGA 4A9RA 2UZUE 5JZNA 3R8PA 2LGCA 4L01A 3VBVA 1T46A 4RVLA 1PF8A 2J6MA 3PYYA 4O27B 5G6VA 4FUXA 1LEWA 3ZM9A 3D7TB 1XH8A 3FV8A 3G6GA 3D5VA 1H1WA 4N6YA 2XK8A 3R7VA 3GVUA 4PDPA 3ZZEA 3ZH8A 1YXTA 3EHAA 4TKSA 4C34A 5IMXA 3Q2JA 3W2SA 2WMTA 4L46A 4G2FA 2XNOA 5CQUA 3BE9A 4D9TA 4PNKA 5C26A 4WT6A 1V0OA 4QP2A 2W17A 3JS2A 4C4GA 4TWNA 5HO6A 4DGOA 4C37A 1SMHA 4R6VA 4RX7A 5C27A 3O50A 2RL5A 3KA0A 5AP1A 2OK1A 3VJOA 1UNHA 2CHLA 1P4FA 4BDAA 4EHZA 3KULA 2BZHB 4QTDA 3OTUA 4CLIA 3MV5A 4EORA 3OBJA 1OL2A 4ACGA 2I7QA 4AW1A 4FKVA 1DAYA 2B9HA 3Q9ZA 4NM0A 4AA0A 4DFLA 4CFMA 3EZVA 4I23A 2C1BA 3AGMA 2PYWA 4IWQA 3BYVA 1H26A 3O7LD 5CT7A 4O86A 3NCZA 5EYKA 4AFJA 5BQ0A 4QMUA 2Z7QA 2CGXA 2UZNA 4GEOA 3QAME 5FP5A 3EQRA 3KCFA 4F0IA 2B55A 4RLKA 3QQFA 4U8ZA 4AN9A 4BCFA 2ITWA 4QYFA 3UVQA 5CAQA 3TDWA 3VWAA 4MF1A 4KBKA 3W1FA 2JBOA 2B1PA 4ZTRA 4OBOA 1ZMUA 3C13A 3EL8A 3PP0A 4IZ5A 4BDBA 3FQHA 4BFMA 3TNWA 3PFQA 2WOTA 1GIHA 2ZVAA 3T3VA 4FTIA 3UODA 3DJ5A 3TL8A 3ZRKA 4FKRA 4U80A 3KN5A 2QU6A 1Q8YA 5BVWA 5ANGA 5CEQA 3ZRMA 2HW7A 4MNEA 3C0HA 3COKA 3HNGA 4W4YA 3VUGA 3ACKA 4HPTE 4FC0A 5J7BA 4FTAA 3R1YA 3R8LA 2CDZA 5HE0A 1JNKA 4M84A 2CKPA 4CYIA 2P55A 3COHA 2ZAZA 2F49A 3VHKA 3BBWA 2Z7RA 3OWKA 3NVKI 3ZLYA 1AD5A 1XH6A 5FDPA 2B7AA 2GQGA 4ANNA 1WVXA 4PDOA 1UKIA 3HUBA 4ZZMA 2XNNA 2FSLX 4EOSA 5GJGA 2PZIA 5A14A 2VD5A 2GQSA 3C9WA 3MVHA 4FSUA 4PMSA 3TUBA 2Z02A 3UVRA 5CQWA 4E4NA 3SW4A 3Q4CA 2W0JA 4CG9A 3V3VA 1OECA 2R7BA 3P7AA 3L1SA 3MVMA 3VS3A 2IPXA 4RA5A 4FTLA 3WI6A 4FV5A 4F7JA 3L9LA 3EZRA 4X2JA 1PY5A 3ATSA 3FMLA 4FIHA 5CSVA 5DGZA 5BNJA 3GB2A 2YHVA 4F09A 2O2UA 1OL1A 4NFNA 2A2AA 5L2WA 3SLSA 4I93A 2HK5A 4TYJA 4O1OA 1VR2A 3PG3A 1Q99A 2WTKB 3LFFA 5A6NA 3II5A 2GTNA 2W5AA 3IW4A 2RFEA 4M67A 2X81A 2IVVA 2OJFE 5EYMA 1JLUE 4WUNA 2EB3A 2Y6MA 1GIJA 1H0VA 4F1TA 1MUOA 2W1IA 4YHJA 3BE2A 3TI1A 3WF8A 3VS0A 4BHZA 2YCFA 2ZDUA 4IFGA 3JY9A 2WQBA 4UEUA 4F6UA 4ITJA 5K9IA 3OWJA 4QD6A 4W4VA 4JG7A 3QC4A 4FZDB 4AOIA 4P5ZA 2WKMA 1XWSA 3AC2A 4C8BA 3K5UA 2W06A 3BHHA 3BEGA 3R1QA 4FTCA 4KA3A 1J7IA 2YAAA 4X3FA 1JKLA 4R3CA 4RIWA 3FMKA 4CMOA 2BTSA 2VTJA 5TOZA 1KE5A 2XJ2A 4FT0A 4I0RA 2BTRA 3R7OA 3S4QA 4APCA 3TACA 3D15A 2G2HA 4QMPA 4N4SA 4QRCA 3V6SA 5HQ0A 5HESA 3DB8A 4WIHA 3U4UA 3QYZA 3GCVA 3OMVA 2YM6A 1NA7A 1PMUA 5JRQA 2XJ1A 3KQ7A 3QD2B 3QTQA 5I3RA 1O6KA 2R3PA 3PY0A 3PWYA 3C4ZA 3EFKA 3PXZA 4D4RA 2IW8A 4KRCA 2OBJA 2X7GA 3WZKA 4CKIA 4EH2A 4WRGA 4EK5A 2QODA 2PSQA 3EFWA 2PK9A 2BDFA 3ORIA 3THBA 4DFYA 2XRUA 1M52A 4UALA 3IS5A 4RJ6A 3S00A 3RZFA 2OZAA 4MNEB 4DN5A 5KMNA 5C01A 5HCZA 3PPJA 4WG4A 4PTCA 2HZ0A 3IOPA 4OW8A 3KB7A 4ENXA 4L6QA 3OCBA 4E4LA 2ZB0A 5CF4A 1CKIA 5HNBA 5EK7A 4MEDA 5EH0A 4EH6A 4A4OA 4QPAA 4TWOA 2CCIA 3SC1A 3W2CA 5FXQA 4EL9A 2ZV9A 1CM8A 3VW8A 2GHMA 3R28A 2W5HA 3R8MA 3CXWA 4ANQA 4PWNA 1XBBA 4YSJA 2ZB1A 5TR6A 4IC8A 4QT1A 4TRLA 5CS6A 5D1JA 2BCJA 3TIZA 2HZIA 4W8DA 2VNYA 3C0GA 5JFXA 4E26A 1SNUA 2O63A 4NJ3A 5LQFA 2VWXA 3F82A 3QQHA 3BPRA 1F5QA 3RVGA 4FSMA 1P4OA 2PL0A 4G5PA 5FEEA 4DFUA 4I0TA 3R73A 4GCJA 3RWPA 4AW2A 3ZFXA 3T3UA 5IH6A 5IEXA 4FZ6A 3ENMA 1CKJA 5M44A 1FINA 2W1HA 1GIIA 2P0CA 2QOHA 3BLHA 3F3ZA 4GK4A 2XNEA 2WTKC 3OFMA 3OXTA 4KAOA 4Y8DA 1NT2A 2OO8X 5ANJA 4AN2A 4XOZA 1H00A 4S2ZA 4F64A 1UNLA 3EYGA 4QMNA 4ZY4A 3LPBA 3E7OA 3UZRA 1H24A 4BCPA 4OTRA 1OKVA 3GCQA 2BAJA 5HGIA 5LVOA 4EH3A 4D2WA 3BHVA 4EOIA 2G1TA 2ITNA 2X9FA 3QALE 3QZFA 4BCHA 5KX8A 5DMZA 4ZMEA 4IANA 3DLZA 3F88A 5AV0A 4DH8A 4JRNA 2Y7JA 3ORPA 1KSWA 3HV4A 3CD3A 2NPQA 3HV5A 4ALWA 4CG8A 3PIZA 3RTPA 3HX4A 2ZM4A 3IG7A 5EM7A 2AYPA 1OITA 2W96B 2OGVA 1LP4A 4Z3VA 3R21A 2PTKA 2XYNA 4XG2A 2C6LA 3QWJA 2UW5A 1V0BA 3UOLA 4BVUA 3NYOA 4O0VA 4H36A 5ITAA 4L42A 1TKIA 3NX8A 3U51A 3CD8A 3A7JA 4RIWB 4X3FB 5CU4A 3VUMA 3UVPA 4ANSA 4BCNA 2O65A 3GCSA 3VBYA 3FJQE 3BLQA 3HV7A 4CZYB 5F1ZA 4U3YA 2EUFB 4RC3A 2B9FA 3HV3A 4DEDA 1JPAA 1YQJA 3MH2A 3OOMA 4QNAA 2UZOA 4RWIA 5CEKA 3HMMA 5C8NA 4O0YA 2OJGA 2V7OA 4I0SA 5EHOA 3TZMA 3A7FA 2RSVA 4I5MA 4LRMA 1M7NA 2UV2A 3VRYA 3GC7A 3DB6A 4OUCA 3AD6A 4UXLA 5HTCA 4KS7A 4AT3A 5CEPA 3U6HA 2YM3A 3AC4A 5KZ0A 1W0XC 2FVDA 4RX5A 4X6RA 2XZSA 4QMXA 2UZLA 2XCKA 3V8TA 5HO7A 3G15A 4GT4A 3HKOA 4U45A 2OZAB 4PQNA 1BL7A 3V51A 4R77A 5AFVA 3GFEA 4FI1A 1STCE 5BPYA 4O7ZA 4FZ7A 2XIKA 4A07A 1YOLA 2JDRA 2WTVA 3BV2A 3LAUA 4O21A 1WBOA 4PDSA 2FSOX 2VAGA 2VO7A 1CKPA 3R01A 5CANA 3VVHA 2R3OA 4X7QA 5HTIA 2R2PA 2B52A 3IDCA 3QYWA 4IVAA 4FSWA 3RWQA 3P23A 4ASZA 4ZSJA 5A4LA 3QTIA 4FSNA 5K3YA 3N9XA 4FIFA 3QFVA 3WE4A 2PVNA 3V5TA 2IZUA 3HP5A 1ZLTA 2VUWA 4O7YA 2OF2A 4FG7A 1PKGA 2J0JA 3LFQA 1U59A 4GH2A 2J90A 2FB8A 1JSTA 1WCCA 5C8MA 4I24A 4A9TA 2IW9A 4AGUA 2JC6A 3DNDA 3L9PA 4WNMA 4EZ3A 2F2CB 5DRDA 5CU3A 3ORZA 4GW8A 5DVRA 3C4EA 4FSQA 5AAFA 2R3MA 1Z5MA 3DZQA 3P0MA 4XP2A 2XYUA 4AS0A 3DAKA 3WYYA 1W83A 4FKLA 2GFCA 1Y8GA 1OI9A 2YM4A 2H6DA 3M11A 1F0QA 3UMWA 3NUSA 2UW7A 3KREA 4U6RA 4YURA 4MK0A 5AM7A 1BUHA 4ZXTA 3HDNA 1YDRE 4GFOA 2QLQA 2HOGA 3AQVA 5BMMA 2HY0A 3D83A 3NYVA 2OWBA 4WOVA 4IWPA 4W9XA 4FSYA 4OTWA 2OSCA 4TNBA 5E1SA 4DH1A 5K0XA 3EWHA 3QCYA 4HZRA 4FTRA 2OFVA 2VTAA 3Q96A 3FXZA 5ICPA 1IAHA 4HGSA 4X3FC 3UOHA 2H34A 3R9RA 3C4WA 5LMAA 3RHKA 2VGPA 4IW0A 4C7TA 2WMVA 4D2RA 3FZ1A 4M7IA 4H05A 2FYSA 4RX9A 4I6HA 2PVJA 3ORXA 3F3UA 4LGDA 1OKZA 3RAHA 5LCJA 1BKXA 3POZA 2J0KA 2WXVA 3S0OA 4YJQA 2BAKA 4IEBA 4RBLA 4EQUA 4TYEA 3ZSHA 5IMEA 3HLLA 2IO6A 2QR7A 3O0GA 2PUIA 3DXQA 3ZBXA 4K0YA 4O0RA 3V5LA 3CSVA 4R7BA 5IQFA 5IQAA 3AC5A 3D9VA 4LOOA 3NW7A 4QOXA 4S31A 3DKFA 5KNJA 4QQJA 4D0WA 1OUYA 3H30A 4H39A 4XUFA 3QGWA 2XEZA 4RVMA 3V5PA 4YTFA 2QG5A 2RKUA 4HVSA 5BUEA 3WF9A 4EZ7A 5AUTA 1A9UA 2QI8A 2X6EA 3NPCA 5ETFA 1H8FA 4BTJA 4I3ZA 3AC8A 3I7CA 4OGRA 3F6XA 5TKDA 3GGFA 4E3CA 4KIPA 3DKGA 3NIEA 4I20A 4FKSA 2UZEA 2VN9A 4IB1A 4MCVA 2J7TA 4QP3A 5FGKA 3AT2A 3R9HA 5C8KA 4F65A 3AT4A 5HBHA 3FLSA 3VBXA 2YIRA 3AC1A 4KIQA 3H9RA 2W9ZB 1KOAA 2WHBA 3MTLA 5EDQA 2A1AB 1P2AA 3EQGA 3ZSGA 1TQMA 3FMNA 4F9CA 4HJOA 4V0GA 3P7BA 4V05A 3NVMB 3T8OA 2ZMDA 3CIKA 2RIOA 4FICA 5C4LA 5J9YA 5DI1A 2CNQA 3B8RA 1OM1A 3BGZA 4CFNA 3WZDA 3VN9A 3W10A 4AZVA 2I40A 4FMQA 5E8YA 4CFVA 2IWIA 3QKKA 4O1PA 2BZJA 3OCGA 5HOAA 5JFWA 4D4YA 2WGJA 4YHFA 2H8HA 3EN5A 4YC8A 1KWPA 1ZRZA 2C0IA 2XH5A 1QPCA 2GDOA 4ANBA 3DBDA 4FT7A 4BI0A 1UU8A 4ZJVA 2XF0A 2JDSA 4CCBA 1TQIA 4CSVA 4F0GA 4JR3A 3IDBA 4NH1A 2JDTA 1XHAA 3NEWA 4IFCA 3G51A 5AR7A 2DS1A 4BICA 4YR8A 5B2LA 3VS4A 1M17A 1QMZA 1SM2A 4GL9A 1K9AA 4ARKA 2QOFA 3OTVA 5CEMA 4MX9A 3ZXTA 3FHIA 3LW0A 4K18A 5L8JA 4EH7A 3S1HA 3QTSA 5ANKA 1OKWA 1GJOA 1YXXA 2W4KA 3DA6A 4IAZA 1Q41A 3NIZA 2Y6OA 3ZO2A 2YZAA 1O6YA 4PRJA 5AIKA 3IDPA 4CMUA 4NL0A 1DM2A 2PE0A 3QD3A 2OG8A 3PVGA 3R7YA 3R8ZA 3VS5A 4GFGA 4BI2A 1BI7A 4MVFA 2CKOA 2CGVA 2V62A 2XM8A 3FC1X 4UZDA 5GIOE 5HHWA 1JKKA 3MH0A 2YCSA 4R7IA 1U46A 5IUGA 4EUUA 2PMLX 4PPCA 1IR3A 1WBVA 2OZOA 1IEPA 4RSSA 5AUZA 4ERKA 4O7RA 5IUIA 4K8AA 1ZYCA 3QLGA 4J53A 1G5SA 5CVFA 3UOKA 3KU2A 5E8XA 4C4IA 2XMYA 1ZOEA 3FPQA 1JBPE 1H0WA 4WKQA 4BN1A 2YM7A 2WQNA 3NLBA 4P4CA 4XV1A 5DT4A 5HNGA 5A9UA 5K4IA 4IVBA 2XNPA 3RPYA 3PA5A 4LOPA 2WTIA 3MB6A 5FTQA 4FZFB 2ZMCA 5H3QA 1AQ1A 3ACJA 2IVSA 3DTCA 3PA3A 3Q9XA 4QP7A 4U44A 2OH0E 4YC3A 5EHYA 3SAYA 4RX8A 4ALUA 3FSKA 4USDA 3VUDA 4JDIA 2I0VA 3F61A 5CX9A 3UPXA 4CEGA 2Z8CA 2PY3A 4LM5A 1GOLA 1PXJA 2ETMA 3MPTA 5AP6A 2OXDA 2RG6A 3CJFA 3M1SA 3RKBA 2GS2A 1AGWA 2BRHA 3RBWA 3UNKA 2QCSA 1IRKA 3SOCA 3IOKA 4J98A 1A06A 2X4FA 3F66A 5KMLA 2C3KA 2R0IA 3GCUA 4ANOA 3R1NA 2QG7A 3SGCA 5EHLA 2OIQA 4ZOGA 1H07A 1RJBA 4AE6A 4QMMA 3IKAA 4FSTA 5DYJA 1H08A 1FGKA 4FIIA 4LI5A 4E4XA 2UVYA 5AUYA 2YFXA 1H4LA 1YOJA 5CLPA 2WTJA 1OL7A 3OXZA 4O38A 1Y57A 3FQSA 4ZTLA 4GU9A 1NVRA 3T9TA 4JIAA 3ZO1A 3KRXA 4R8QA 5HG7A 3QX4A 5AA9A 4B4LA 4R3PA 4N0SA 5C4KA 2QQ7A 5KCVA 3D7TA 4EKKA 2VWVA 4IH8A 3UNZA 3UC3A 2FH9A 3E92A 3NNXA 4KUJA 2PVHA 2X6DA 1S9JA 2QOBA 4OAVB 3Q3BA 4D4SA 4YP8A 5HBEA 4ZK5A 3PY3A 3DDQA 3ORNA 4AN3A 2C30A 4YZBA 2UZDA 4APPA 2WMAA 1OBDA 4QTAA 5AP2A 5JGDA 3EFLA 1OVEA 3R8UA 1WFCA 4G1WA 4GIIA 5D41A 2BZKB 2BRGA 4C35A 4ZLYA 2NRUA 2QOIA 3HYHA 3SXFA 1VJYA 5DT0A 3C4FA 2OIBA 3TTIA 3OOGA 3G6HA 1DI8A 3QBNA 4RVTA 1YHSA 5JEBA 3VO3A 3A7HA 4TYHB 4FR4A 2UW0A 2VTPA 4QP4A 5CAVA 3M2WA 4JDKA 4A06A 3QC9A 4C4EA 4FG8A 4N6ZA 4CZUA 5A4QA 5AUXA 2R64A 3LM5A 4WUAA 4XG4A 5CT0A 4UMUA 4QMTA 3OC1A 4U97A 1A48A 1W98A 4YBJA 4IE9A 3BEAA 5IA2A 3OY3A 4KBAA 3C4XA 5H8EA 2FSTX 1QL6A 4AUAA 4YJPA 2O8YA 4WNOA 4NKSA 1FPUA 4R1VA 3RGFA 3DXNA 3ZSIA 4QMLA 3TZ9A 4CV9A 5JH6A 1M2RA 3RM6A 3NUUA 5I3OA 5EM5A 3PDTA 3Q5ZA 2VO0A 3DK6A 4HYSA 4MXCA 1XH5A 3OY1A 4FKUA 4C38A 4YLLA 3W2PA 4WNPA 4B6LA 3C50A 4AGWA 5HI2A 1XBCA 3U4WA 4WNKA 4LL5A 4EC8A 4FSZA 2X2MA 3FZPA 2C6DA 4AP7A 5KMOA 2JEDA 3V8SA 4F1MA 4EONA 2QOOA 4MBLA 4O22A 4EBWA 1WBTA 5HO8A 4UYAA 1XH9A 4P7EA 1Q24A 3A99A 3NYNA 3QD0A 3UP2A 1QPEA 4C3FA 4B0GA 4CQGA 1E9HA 2UZBA 2A0CX 3HRFA 3FY2A 3WOWA 2Z7SA 4I5HA 3AG9A 4MAOA 4CMTA 2OJ9A 4WHZA 4DINA 4JOAA 5KMIA 3FLYA 1FVRA 1NY3A 4RGJA 3GT8A 4DEIA 3ATTA 4FYOA 4O82A 3PVWA 2XK9A 5ANEA 3ROCA 4B7TA 5FG8A 4QP9A 3GU7A 2R0UA 3FHRA 4BCGA 3PTGA 5J5TA 2BROA 1KE7A 3G9LX 3GU6A 5AIRA 4EH9A 3BX5A 4GU6A 1PXKA 1PYEA 2PMOX 3VS6A 1YXVA 3A7IA 3OUKA 3LMHA 3RNYA 4E6DA 2JIIA 4BDCA 3TJCA 3QGYA 5AJQA 4HGLA 3QTWA 3TUCA 3MH1A 3KXMA 4RLLA 4YJSA 3EYHA 4JJRA 1YI6A 5L6OA 2HY81 5HG9A 3O23A 3BI6A 1XO2B 3P79A 5GJDA 3MY1A 3LKMA 1H27A 4PDYA 4BGGA 3TV7A 3PLAE 4OT5A 5L2SA 3ELJA 4UZHA 3FLWA 3HP2A 4RQVA 4BYIA 4EBVA 2Z60A 2E9NA 4E8AA 3OBGA 4FTUA 5IEVA 4AGDA 1BI8A 3DBCA 4L3JA 1J1CA 1DS5A 3CGOA 4LG4A 3LQ3A 4FE2A 1I09A 3NS9A 3QUEA 3R0TA 4IADA 4C36A 4IM2A 3MB7A 2HZ4A 1YHVA 3U6IA 3QCSA 3LIJA 2F2UA 5DNRA 4Z7GA 2PVYA 4RIOA 1REJA 3NDMA 4HVDA 5JKGA 2XBJA 4FV8A 4HNFA 3AMAA 1MRVA 4FGRA 3PUPA 2OU7A 2XP2A 1Z9XA 2CMWA 4IIRA 1RQQA 3KGAA 4O6EA 1M14A 4FIEA 1PXPA 1PXMA 3W16A 4AXAA 4U79A 3OD6X 4W9WA 3SQQA 2NRYA 3QRUA 4JT3A 4BDHA 4AFEA 2X8DA 3T9IA 2XBAA 4RWKA 2OH4A 3AOXA 3MPAA 4QMSA 4FV7A 1U4DA 4FTOA 4OTGA 4G6OA 4IM3A 4EOJA 4MWIA 3E5AA 1BMKA 2JIVA 3TWJA 3JXWA 3D94A 4YO4A 4TYGA 2R7IA 4QTCA 4UXQA 1JSVA 3GU4A 5HE3A 4CTCA 2NNWB 2C68A 2GNIA 3BWFA 4HVIA 1HCKA 1E1XA 3ORMA 4D2VA 3E7VA 2VTSA 2YM8A 5E1EA 3UO6A 4YTCA 3DU8A 2C4GA 4YJUA 3GCPA 4FL3A 4JBQA 4PP9A 4V04A 2Y9QA 3OS3A 5HCYA 1H1QA 3VS2A 3LQ8A 4BDJA 4RG0A 4A9UA 4AZFA 4ZIMA 2Y8OA 3H4JA 4JIKA 2VTIA 4MQ2A 2VO6A 4O0UA 5H8GA 3ZCLA 2R4BA 4CRLA 3ODZX 3RHXA 4Y5QA 3W2OA 4D5KA 5IEYA 4FTKA 4QYHA 3ULZA 5EKNA 3B8QA 1U5QA 3FSFA 3HMNA 4L3PA 4I94A 5HG5A 4EHVA 4FTJA 3Q4TA 4W4WA 4TXCA 2ZM1A 3DBEA 5CENA 2BDJA 4AW0A 2R3QA 4BCIA 4G6NA 5A4EA 4ZTMA 4AOJA 4MXOA 3R30A 3UO4A 3VS1A 3ALNA 4ITHA 5IQHA 3LM0A 4BYJA 4EKLA 3DK3A 4XRLA 4F6WA 4XYFA 5KKRB 1B38A 3OT3A 4JAJA 3ZHPC 3CCNA 4RQKA 1NVQA 5CNOA 2QONA 3VQHA 3DCVA 1J7LA 3U87A 3DBQA 3BIZA 2I0YA 2W99B 5HE1A 5IG1A 5FDXA 3SW7A 5CWZA 1B6CB 2JFLA 2GS6A 4KB8A 4D9UA 4I22A 5AR8A 5I9XA 4I21A 4PY1A 4A9YA 4TNDA 4MHAA 1P5EA 3GC0A 3F5GA 4X2NA 3N4TA 4EQCA 1YI3A 2QO9A 2HW6A 5AX9A 4NZWB 3AMYA 4AG8A 5T6KA 5AP4A 3BCEA 1YHWA 2C3LA 4XG8A 2ERZE 3GBZA 3REPA 1UNGA 4YZ9A 3FBVA 4R78A 2JAMA 4DEBA 2VTTA 1UKHA 3F7ZA 2IW6A 2XCHA 5JK3A 2BIKB 4FVRA 1ZYDA 4J8MA 3PJ3A 4GT5A 4QYGA 3QQUA 1UVRA 4GYIA 2PUUA 3MS9A 4MH7A 3HA6A 2WEVA 4BCJA 3CS9A 1OIYA 4FEQA 2PZRA 3LCDA 5CF6A 5CZHA 3PVUA 4UMTA 3Q6UA 3QX2A 4QMWA 4X2GA 2CPKE 3QA0A 4BCMA 4O84A 1RE8A 4TN6A 3LQ5A 3OEZA 1YW2A 4BDGA 5KO1A 5ETIA 3RAIA 3MPMA 1PRYA 5ETAA 3PVBA 1BX6A 5DEWA 3TNPC 4U3ZA 2BMCA 2J9MA 4UWYA 2WMUA 4NYEA 3V5QA 3DJ7A 4JR7A 3EQDA 3K3IA 5C9CA 3FZOA 3DDPA 4K11A 4CVAA 2XVDA 4W8EA 5AAEA 3E64A 4YU2A 4FEWA 4CKRA 4ZSLA 1WBPA 3LCTA 2RGPA 3KFAA 5AWMA 3VRZA 3ULIA 4FNZA 4NM3A 4F9WA 2W5BA 1VYZA 3HA8A 4QTBA 3OG7A 4BGHA 3K5VA 5B2MA 5BYLA 2VU3A 3KRJA 3UOJA 4AOTA 2IZTA 3DQWA 4ZSEA 5AUUA 5A54A 2OJIA 5DG5A 2QOQA 5LXMA 1VZOA 4J99A 5EFQA 2FGIA 3UYTA 3MJ2A 4MXXA 4DAWA 4RJ3A 2QLUA 3QL8A 3ZUVA 4RWLA 4IVDA 3EQCA 5I9UA 1WBNA 4ZS4A 3OF0A 5DR6A 3UDBA 3ZS5A 5KKRC 1ZOGA 3QTZA 3MIAA 5D9HA 3WE8A 4Y46A 2XUUA 4EH8A 1KUTA 5EKOA 3VC4A 1URCA 2WOUA 3FMDA 3QQJA 3FI8A 4ZTQA 5BUJA 3CPCA 1OIQA 2PHKA 4BIEA 4EOKA 5IDNA 4CFFA 2C6MA 3QHWA 4X3JA 1HCLA 4FV3A 5I0BA 5T68A 3CBLA 4DGNA
chains in the Genus database with same CATH superfamily
3F69A 1REKA 1ZARA 4WSQA 1GZ8A 2ETKA 4O83A 3Q53A 1GZNA 3PA4A 4IDVA 4YTIA 4G9CA 4FIGA 4FIJA 4FTNA 1ND4A 3QD4A 1P14A 2R9SA 3N51A 5EYDA 2VTNA 5FTOA 5KBRA 3LFAA 3QUPA 3FMJA 4Y95A 3Q4ZA 4JDHA 3FDNA 3TZ7A 4O7SA 3HVCA 4Z16A 5CAPA 2BKZA 3MFSA 5HNIX 3LZBA 2PMIA 3FXXA 5D12A 3SG9A 2VTQA 4BKYA 2PVKA 4J95A 5CI7A 4NTTA 4Z55A 4YLKA 3OW3A 5DH3A 5C03A 5E92A 5KMJA 3CQEA 1EH4A 2P33A 4IJPA 5H8BA 3RZBA 3DFAA 5JGBA 2RG5A 2YITA 3Q4UA 3EKNA 4XLIA 1Q8UA 2XAMA 2VRXA 3TCPA 4FKPA 4UY9A 2BDWA 5HU9A 4F9AA 3R8VA 4RWJA 4CTBA 4AAYA 3EFJA 5ETCA 5LMBA 4KSQA 5DE2A 3EN4A 4FT5A 4XV2A 3H9OA 1WMKA 4DHIB 3CJGA 3NW6A 5TF9A 3HZTA 4GJ3A 4A9SA 2DUVA 4KIOA 5LMKC 4PMMA 3FEGA 3FWQA 3CP9A 2PE2A 4D2SA 5LVMA 3E8EA 2YIYA 4NW5A 1FMOE 4DEAA 3LJ1A 3I79A 3KN6A 3AGLA 5FLFA 2XK7A 4PNIA 2J0MB 4BGQA 5L2IA 2CNVA 3EQPA 4S32A 2BIYA 3ZDIA 4BIDA 2X2KA 1XMLA 4GVJA 3QRTA 3F7WA 3TZ8A 2EVAA 5HVYA 5HD7A 2EXEA 2VWWA 3LCKA 4O7WA 3RPVA 2ACXA 3LFNA 1CMKE 4DH3A 3P9JA 4LRKA 1URWA 2G2FA 3DY7A 3ERKA 5HVJA 3VBQA 4EJNA 3UQCA 3KRLA 4BTMA 2GSFA 2ZV8A 4ACMA 3CQWA 4QEBA 5DIAA 4EK8A 5IA0A 1PMNA 5DFPA 2WTWA 5M55A 5KHXA 4JX3A 4XG9A 3RALA 2YJSA 4HVHA 4YJOA 3ZU7A 5K4JA 3W55A 3TEIA 2GCDA 4GUEA 3EB0A 2QO7A 3EH9A 4C57A 3GXLA 1JSUA 4YNOA 3KK9A 5E90A 4DLJA 2I6LA 3M42A 2XIRA 3LHJA 4UMRA 3LLAA 1J91A 3ZO4A 2WTCA 4OBQA 3LJ2A 3ZRLA 2EXMA 4YNEA 5BX0A 3SV0A 3ZLSA 5JGAA 4BY9E 3OVVA 4G31A 4BCKA 2YIWA 3TDVA 3BYMA 4G3GA 1IA8A 5AP3A 3LMIA 3QTUA 2REIA 3G33A 3KK8A 4E7WA 3NUYA 1LUFA 2YDIA 2WFYA 4QPSA 2YA9A 4FEUA 3NUNA 3R9NA 4OTFA 2X1NA 2Y4PA 3A8XA 4D0XA 4MQ1A 2XK4A 3WZEA 1OIUA 1U54A 4NEUA 3SOAA 3PLSA 4QP8A 4IZ7A 5BVOA 1Q8ZA 2OF4A 3BU6A 3RK9A 2GU8A 4IACA 5CVGA 3RNIA 4DG3E 2PUPA 1YWNA 3CQUA 3L8PA 5EDRA 2ITOA 3MTFA 3TNQB 3FZTA 4NFMA 3KMWA 2QOCA 4I4FA 4RZVA 4YZCA 1W82A 2QD9A 4YZNA 5EM6A 4TPTA 2XKCA 3RM7A 4I5PA 2LAVA 3I4BA 2B0QA 3P86A 5BV3A 4ZSGA 2C6TA 1SVEA 2GNGA 2QHMA 1DAWA 4KWPA 3FQEA 4BCOA 4DFXE 4ZLZA 4ASDA 4L8MA 4GG7A 5CU2A 3KMMA 4IQ6A 4HVGA 3KKVA 3PRFA 1SYKA 1R3CA 4FG9A 3BU5A 4IZYA 4DA5A 2X0GA 3CTQA 2PPQA 2QKRA 4CXAA 2R3HA 5HX6A 2B4SB 3O8PA 3PY1A 3VW6A 3AMBA 1J3HA 2Q0BA 2UVXA 3CY3A 4DFZE 3DLSA 3DV3A 1FGIA 1ZMVA 3FKLA 3R9DA 2CKEA 4S34A 3V5WA 1UU3A 4O91A 2QU5A 4Y73A 4AX8A 4BCQA 3LCSA 1WVWA 2AEGA 4GKIA 5CTPA 3E62A 4LUEA 4K2RA 1TQPA 4L53A 5CALA 3F3WA 3MESA 4F4PA 5GNKA 1KE8A 2XK3A 3DAJA 3P08A 3R2YA 1YKRA 4JBPA 3A4OX 2F7EE 2J51A 3E8NA 3H0ZA 3Q9WA 4IDTA 4RJ5A 5M08A 3U55A 2XKDA 4ACCA 1OZ1A 1M2QA 5ACBC 2XIZA 4ASXA 2XA4A 2YACA 1JQHA 4HOKA 2RFSA 4PV0A 4F63A 5M4IA 4AXCA 3PXYA 4Y85A 4EYJA 4I6LA 5ACKA 2WMWA 3DGKA 5J95A 3V04A 5E8VA 5TO8A 4M66A 5AUVA 5AR2A 2XIYA 3HAVA 4WA9A 2CN8A 1ZWSA 2VWZA 2BFXA 3D0EA 4JI9A 5DPVA 4AA4A 5BUIA 3U6JA 3OWPA 3GU8A 3MA6A 2C3IB 2C5YA 4FT9A 1APME 4LFIA 4NUSA 4S30A 2GHGA 4FKQA 4LOQA 4UWBA 4HYUA 4RC4A 4RZWA 4EK6A 5JMSA 3TM0A 5CXZA 3TXOA 2PVLA 3E88A 4C2WA 5IQGA 4J52A 4BWXA 5AP5A 4Y83A 3LCOA 5M57A 3MDYA 5FRIA 4D58A 4YPDA 3P7CA 4PL3A 4JBOA 4AW5A 4W4XA 5CY3A 5IQBA 4UV0A 4PP7A 2W1EA 1U54B 4YO6A 2YZLA 3QQLA 1Y6AA 1WVYA 3PPKA 4TYHA 3G0EA 3ZLXA 4OR5A 3HV6A 3JR1A 5I9VA 4ACHA 4J1RA 1Q8TA 3RAWA 4AU8A 4C62A 5BVFA 4GSBA 4WO5A 1JVPP 3ZC5A 1Y6BA 1WAKA 2BUJA 5TE0A 1YVJA 2CLQA 1ZYLA 2DYLA 3QKMA 5FEQA 2CGWA 3SRVA 3NR9A 3ZM4A 2PE1A 2GMXA 3CR0A 2B9IA 4CYJA 3ODYX 3GUBA 4M13A 3UIBA 3OROA 3P4KA 3TJDA 2Q0NA 5CU6A 5IU2A 4XBUA 1IA9A 3NNWA 4FNYA 3RI1A 4U7ZA 3DK7A 1WBSA 3EN9A 3O7LB 3RPSA 5BVDA 2KULA 3BQCA 4X2KA 3ZDUA 3JY0A 3W8QA 4JMQA 3MFTA 4CT1A 1ZMWA 4EZ5A 3UGCA 3DQXA 3R7GA 2XS0A 2E2BA 3F2AA 3NWWA 4BZNA 2OJJA 2JIUA 4I6QA 4Y72A 3FZSA 3LXLA 1XQZA 2EWAA 4IAKA 2XEYA 5KMKA 3PJ8A 1XBAA 4FKOA 3KXNA 4CGAA 5FD2A 4HNIA 5FBOA 4CD0A 3VQUA 4D5HA 2FUMA 3G0FA 4OT6A 4X2FA 1OL6A 4ZJJA 5DN3A 4O6LA 5J9LA 3SXSA 3F2NA 3Q60A 5J87A 3FMEA 2JKQA 4EOQA 5J7HA 3F2RA 4YHTA 2XM9A 4GRBA 5AV3A 3DXPA 5AADA 1K2PA 3KEXA 4YPSA 2UW6A 4IB3A 3E63A 3E87A 4K33A 4J97A 1Q3WA 3TNIA 3QQKA 4LV5A 2BR1A 3UP7A 5K5XA 3ROYA 4DE4A 2UVZA 5IH4A 3BKBA 3UQFA 2GNFA 2OKRA 4FNWA 2ZDTA 3E93A 1PXOA 3F5XA 5ANDA 2ZJWA 3GC9A 4L7SA 3RK5A 3DZOA 2HXLA 3UDZA 3ZTXA 4O7VA 4KS8A 4BKJA 4K9YA 5E8WA 2ESMA 3FMMA 4OTQA 5L2QA 1BL6A 3G2FA 3QRKA 3UC4A 4AF3A 5EYCA 4CFXA 5BMSA 4PX6A 4IAAA 2BFYA 3GNIB 4NK9A 4B99A 3ZO3A 4EOLA 4L52A 1IASA 2WD1A 1UU9A 4DLIA 4M0YA 4F7NA 4KD1A 4TWCA 5IA1A 3CY2A 3KY2A 2BRNA 4CFUA 3R9OA 3PXKA 4HYIA 3NYXA 5CF5A 2ZOQA 4K6ZA 4PPAA 4P2KA 4S33A 3H9FA 3G5DA 3EKKA 4FV4A 4DTKA 3CPBA 2QKWB 3QUDA 1BYGA 3OP5A 3QF9A 5AP7A 4XHKB 4FZAB 2Y0AA 4FEXA 2YLEA 2WQMA 2UUEA 5FXSA 2X0QA 3QZHA 4JRVA 4MD7E 2F4JA 3I0QA 5IDPA 2OLCA 3EN6A 4IX5A 5E9EA 3UDTA 3RCJA 2IVTA 2WU6A 3U9CA 4LGGA 4F0FA 4ZEGA 4FX3A 4GYGA 4MD9E 2W9FB 5L3AA 3FYKX 3V5JA 4Q9SA 4E73A 1G3NA 5KUPA 2C0TA 3PXFA 1I44A 4R5YA 3MY0A 5BYYA 5DWRA 3MWUA 3BBTB 3JPVA 5AV1A 2V7AA 3SRVB 5E4HA 3OUNB 5FQDC 5T3QA 4JLCA 4TL0A 4QNYA 4USEA 3K3JA 4FK6A 3IECA 5JRSA 4JL9A 2HAKA 5EDPA 3ZC6A 3IGGA 3IK3A 4DCEA 4QMZA 5E8SA 2C3JA 1YXSA 4F9BA 4CNHA 4C02A 3NRMA 3C0IA 4G3EA 3W2RA 3ZFMA 4TWPA 4AGCA 2JITA 3W33A 3EN7A 3P5JC 4DFBA 3FUPA 5B7VA 5L2TA 4Z9LA 3WF6A 4K1BA 2W1DA 2W1CA 2VTRA 4O2PA 2BALA 4XG3A 5FUTA 3Q52A 3ZSGA 3ZZWA 1Q8WA 4KBCA 3NFFB 1UU7A 2AC5A 4RC2A 4I41A 4IVCA 3N4UA 1PHKA 1QPJA 2XRWA 5EI6A 4DEGA 4DF3A 2BRBA 5CXHA 4HPUE 1SNXA 3PRIA 2OW3A 4JAIA 4GVAA 5EI2A 3VS7A 2I0HA 3BYUA 2ITXA 4H1JA 4XV3A 4E5AX 4ZZOA 5HLPA 3PSDA 3D7ZA 4DHFA 4F9YA 2WMRA 2GNLA 1G8SA 2X39A 2C0OA 2GPHA 3NNUA 2B9JA 2WZJA 5FP6A 2J4ZA 5TT7A 4E93A 3P1AA 3BV3A 3F3VA 4MXZA 1PMVA 5M4UA 3RMFA 4GK3A 4H3BA 1PJKA 2CCHA 2IJMA 3OCSA 2QOLA 4LMUA 5CI6A 5EW9A 4CQEA 2VX0A 3TYKA 3LXNA 1UWHA 4V01A 2ETRA 3R00A 4PL5A 4YGAA 4QTEA 2Z7LA 4O4DA 5JFSA 4FV9A 5EM8A 3D14A 3W0QA 2X4ZA 3JUHA 4O0XA 5EOBA 1U5RA 5LVLA 3ZMMA 3MIYA 3A60A 5F20A 2QURA 4QQCA 1CDKA 2X8IA 1F3MC 3IW6A 5IQEA 2GNJA 2IF8A 3PP1A 5EI8A 3ALOA 3QKLA 4QP6A 4HCTA 1L8TA 4UMQA 1YRPA 2F7XE 5IUHA 1L3RE 3B2WA 4ALVA 4HZSA 3E3BX 1Q61A 3FI4A 2J50A 4ZZNA 1J7UA 4UMPA 4ANLA 3HAMA 3D5WA 4R1YA 2A4LA 3IGOA 4GIHA 1NW1A 4L43A 2J5FA 4BDDA 3R04A 4PMTA 3KIOC 5M06A 3TT0A 4XNEA 1YI4A 1FQ1B 3GOKA 3I81A 3QCXA 4B8LA 2QHNA 3L9MA 4PMPA 4AXFA 4IAYA 5HKMA 1M7QA 3FYJX 4LUDA 5M51A 2IG7A 1UV5A 1ST4A 3FPMA 4I6BA 5L8LA 3D5XA 4UYNA 3UBDA 5EQYA 2VZ6A 4D55A 2PULA 3C1XA 2C6EA 5FXRA 3BWJA 4C4FA 3ID6C 3KXXA 2RF9A 2VO3A 3PG1A 3EMGA 2ITPA 3NW5A 5AV4A 2Z2WA 4XEYA 5HIBA 1GZOA 4D2TA 3EQFA 5IZFA 4FSRA 3DBFA 4JXFA 1Q4LA 2QVSE 4FK3A 4MTAA 3H0YA 4GMYA 4RFYA 5KHWA 3V6RA 3NAXA 3TV4A 5LMKA 4FV2A 4O4BB 3BHTA 3I60A 4D1SA 4J96A 2YAKA 3E3PA 5IKWA 3NUPA 2XIXA 3L8SA 5GHVA 5LOHA 3BYSA 3DKOA 2WAJA 3CKXA 4DDGA 5CAUA 5DR2A 3ANRA 2BHEA 4CT2A 4FNXA 4D2PA 5HZNA 5EQPA 4DG2E 1FBNA 3BHUA 2W1GA 3UYSA 4LYNA 3COIA 4RA4A 3ZBFA 4DYMA 1W2FA 3OW4A 3ORTA 3JVRA 4J71A 3MVJA 3R71A 5L6PA 1CTPE 2O5KA 4ASEA 2ITUA 2PWLA 3VUHA 2H9VA 3CGFA 3BU3A 2E9PA 4FKTA 4FV0A 4JDJA 3ZUUA 5AA8A 4I1ZA 3EJ1A 3ZOSA 3ETAA 4DTBA 2GNHA 5J9ZA 2AC3A 5M56A 4MXAA 3Q2MA 3RP9A 4XOYA 3R1SA 4BWKA 2QNJA 3NNVA 4RJ4A 1SVHA 4DGGA 5M07A 4C59A 5CEIA 3DOGA 3OZ6A 5GZ9A 4BHNA 4P90A 3AD5A 4LQMA 5CF8A 1LPUA 2IVUA 4DTAA 3FXWA 3BL7A 4FJVA 2PVMA 3FE3A 3MA3A 3QXPA 2JGZA 3LJ0A 3AC3A 5FBNC 4OTDA 4JQEA 1Q5KA 4ZY6A 5D10A 4J7BA 4AT4A 2UZWE 4JQ8A 4YTHA 3WZJA 4OTHA 2GQRA 2ZYBA 3VUTA 3WIGA 2F9GA 1H25A 4BWPA 3ENHA 4DGLC 2PZPA 3E8CA 3LMGA 4ANMA 4DCAA 3KF4A 2YWVA 3DJ6A 4ZLOA 4IC7A 2QR8A 3HDMA 3LXKA 3CC6A 2P2HA 4RMZA 1QCFA 3EQIA 3HGKA 2YWPA 1H1PA 1Q62A 2WU7A 1LR4A 2WPAA 5LJJA 4RIXA 5CVHA 4M68A 2XKEA 1PMEA 4BI1A 5HBJA 4WSYA 2E9OA 2R3GA 5IQCA 2YN8A 4IAIA 2QO2A 4EH4A 4HCVA 3P5KA 1TVOA 1KE9A 4GT3A 4AE9A 4DG0E 4E1ZA 4ORKA 1R1WA 2VWYA 1B39A 2F57A 2R3NA 1YWVA 4XG7A 4XRJA 4C2VA 3IPHA 5J79A 5DT3A 3ET7A 4KABA 4QYEA 3ZEPA 3I5NA 3S2PA 4BDEA 4AZEA 4YJVA 2YM5A 3UG2A 4C61A 3KL8A 4FUYA 3QZIA 3OWLA 2VWUA 4F1OA 4WRSA 5G1XA 4UX9A 1XH7A 4KKEA 4BBEA 2XALA 5ANIA 3RPRA 4BIBA 2R3RA 4CCUA 4ONAA 4H3PA 4X0MA 4IMYA 3D5UA 2PUNA 3PXRA 1V1KA 4PTGA 1W84A 3H3CA 5GZAA 4WG5A 2UW3A 3A7GA 4MF0A 5JZJA 3LFCA 1XJDA 2UW8A 4DFNA 3KULB 3LXPA 3UIXA 3EL7A 4DBXA 3NGAA 3I5ZA 4RVKA 5JFVA 2B54A 2IZRA 5KE0A 3OHTA 3PIYA 3W2QA 2HZNA 1VEBA 4DEEA 3O96A 4DT9A 2YDKA 3PZHA 2W1ZA 3OT8A 2AUHA 1YXUA 5HICA 4MXYA 2OI4X 3SD0A 4D1XA 4E6QA 4M15A 4BL1A 4G3FA 3QU0A 3LVPA 4UWCA 3L9NA 3TN8A 4BTFA 3VHEA 2ZV7A 3PE2A 4HGEA 3FKNA 5HD4A 4RT7A 4WG3A 4WD5A 3O51A 3GQLA 3PSCA 4O2ZA 5LWMA 3CTHA 3DNEA 1ZYSA 4FL1A 5E8ZA 3POOA 3UIMA 2GHLA 2J2IB 3PE1A 2HENA 3Q32A 4IZAA 4U40A 3VUKA 4Q9ZA 4ZSAA 3W0SA 4C58A 4O7NA 3QTXA 3SG8A 3KC3A 4DT8A 3ZXZA 1G8JA 4Z7HA 3HL7A 1OL5A 1R39A 1W8CA 4P5QA 5CSHA 5HEZA 1GNGA 3AT3A 3GC8A 4G16A 4BDKA 5IISA 4FOCA 2FSMX 3Q9YA 2I1MA 2X8EA 4H3QA 4MBIA 4JX7A 4FKGA 5FWKK 4BDFA 1ZZ2A 4RPVA 1Y91A 5FTGA 5BVKA 2CKQA 2HCKA 2XANA 1KE6A 3UZTA 3QQGA 5AEPA 4F6SA 1JOWB 5DOSA 4YZDA 5E91A 4QDEA 2R3IA 4YLJA 4TTHB 4ZAUA 4L68A 4U0IA 3RJCA 3NAYA 2WMXA 1SZMA 4D28A 3MN3A 2OFUA 2JKKA 4TZRA 2V55A 3SKCA 3G9NA 3KXGA 4EOMA 3NUXA 4QMOA 4FKWA 5CU0A 3JVSA 5CZIA 2G9XA 2DWBA 1OPKA 3DKCA 4PF4A 4ZS0A 1LEZA 2CJMA 2QOKA 2C5XA 2BAQA 3GOPA 2F7ZE 4RIXB 3ZEWA 2Y4IB 2ITYA 5FEDA 5EW3A 2VX3A 3L8XA 4IB0A 4N57A 4QMVA 2VTHA 2PU8A 5L6WL 2EXCX 3CEKA 3KRWA 3R7IA 2V22A 4FBXA 3LFSA 4EK4A 5AP0A 4QQTA 2ITQA 4MBJA 2BHHA 4E6CA 4ZP5A 3W8LA 3S95A 3G90X 3MW1A 5GIPE 4R7HA 2X0PA 4CZTA 4EYMA 3HUCA 4D4VA 4ITIA 3O71A 3GQIA 1JKTA 3BQRA 1FMKA 2VNWA 2XKFA 3K54A 5AUWA 2OXYA 4WBBB 3SXRA 4DEHA 5IF1A 5IPJA 1O6LA 4IX6A 3PPZA 3O17A 5DLSA 1K3AA 2X9EA 4BTKA 4PTEA 3ZUTA 5AMNA 4FOBA 2BILB 2W1FA 4J8NA 4L00A 4NCTA 2B53A 4ZTSA 4XP3A 4ENYA 4TY1A 5AAGA 1OKYA 4R5SA 2UZVA 2R3KA 2YDJA 4LGHA 4O0TA 4B8MA 2HELA 4L45A 4FVQA 2O0UA 3KF7A 1YDSE 4H58A 2C6IA 3FLQA 5A46A 5L4QA 2BPMA 1OMWA 5EG3A 2WQOA 1YWRA 3PIXA 4X6QC 5B0XA 4CLJA 3IONA 5HX8A 3CTJA 2RFDA 4FV1A 5DA3A 2VV9A 2WTDA 3E8DA 2OIDA 3TKIA 4AZTA 5LVNA 4IB5A 4IJ9A 2WNTA 1ZXEA 2GFSA 1MP8A 3GENA 4YZMA 4KKGA 2HIWA 1OGUA 4U81A 4WBOA 3WBLA 5A4TA 3UO5A 3MFUA 3ZONA 4AA5A 4AQCA 3LE6A 2JD5A 1PW2A 1VLRA 4A4LA 5M53A 4UBAA 5IA5A 3KMUA 1Q97A 5HORA 3TV6A 1JWHA 4IX3A 3MSSA 1OGYA 5HLNA 4JBVA 2UZTA 5I5ZA 2J0LA 5HLWA 3TIYA 4AACA 2BRMA 3C5UA 3A61A 4IAFA 2C5VA 2WMQA 5BYZA 3FI3A 3GI3A 1S9IA 3LFDA 4FKIA 4M0ZA 4DGMA 5I4NA 4FYNA 3HMOA 4EEVA 4GKHA 1ZYJA 3R7EA 2ITVA 4L3LA 4NW6A 1ZOHA 1Y8YA 2GTMA 3FL4A 3RK7A 1RDQE 4G6LA 2XAOA 3C7QA 5LWNA 1R78A 3CKWA 2EU9A 3FC2A 4C3RA 3W18A 4BBMA 3F9NA 5AR3A 3I0OA 4AZWA 3R02A 3U8WA 5F95A 2Y4IC 4H1MA 5KZIA 3MGYA 4F99A 5J1VA 1FVTA 1H01A 4YC6A 3LOKA 4A7CA 5LARA 4YSMA 3AXWA 4ID7A 2V5QA 1Q3DA 3VJNA 1R0EA 3I1AA 4O0WA 5A3XA 2CN5A 3ANQA 5HG8A 4EUTA 3F5PA 3RCDA 1DI9A 5KMMA 4LRJA 1IG1A 3WF7A 1PKDA 2WEIA 3WYXA 4EOOA 5IA3A 1IAJA 4USFA 2J0IA 3R6XA 4ZTHA 4Q5EA 4CV8A 3FI2A 2R5TA 2WMBA 2C6OA 3D2KA 4NT4A 5J8IA 3VBWA 4EHGA 3EQBA 2PMNX 3O2MA 4EWQA 4DBNA 4Q5HA 3O8TA 3O8UA 5DR9A 5CASA 3KCKA 2ERKA 1H1RA 4EQMA 1JKSA 2O3PA 4IM0A 2XNMA 3BHYA 5AR4A 2V0DA 2R3FA 3VULA 4AWIA 3OXIA 3CE3A 3VBTA 4AXDA 4X21A 1MRYA 4BZDA 1SVGA 5I9ZA 1J1BA 4FTMA 4OBPA 3MI9A 3UPZA 3MJ1A 5L8KA 2X7FA 1QPDA 4IWDA 1E1VA 2X7OA 5EOLA 4C3PA 1M2PA 1OPLA 3DPKA 5LCKA 4D1ZA 3A4PA 4DITA 1W7HA 2VTOA 4E4MA 2XJ0A 4GS6A 4MNFA 4FT3A 4G34A 2C5NA 2IN6A 2W05A 4F70A 3UZPA 4IBMA 4BKZA 3IW7A 4GV1A 4HCUA 4M12A 3VONA 4I5CA 3Q04A 3WIKA 5BVEA 3VUIA 1GZKA 3FY0A 4AZSA 4M8TA 2VWBA 3VF8A 5M4CA 4QDVA 5DBXA 4DH5A 2ONLA 1WZYA 3F3TA 4E5BA 4FA2A 3MVLA 1OPJA 2NO3A 3FZRA 4EHEA 4OTPA 4YJRA 4NSTA 2YISA 3UE4A 5GJFA 4M3QA 3I6WA 4L7FA 5JQ5A 4L67A 4JS8A 2C6KA 1PXNA 3A2CA 4FF8A 2HWPA 3IO7A 2WIPA 3MY5A 1OUKA 5E8TA 3C51A 5I9YA 5E8UA 2HXQA 3MH3A 4E6AA 3FMHA 2FA2A 2HYYA 4GUBA 4QYYA 4RIYA 3HRBA 5FM3A 4EH5A 5HIEA 4EK3A 4O81A 4LMNA 3RINA 5HU3A 4XP0A 2VGOA 3DT1A 5F9EA 4NKAA 1FOTA 1XH4A 1NXKA 3QRIA 4KKHA 4YJTA 5AM6A 4KIKA 1G8AA 2PVFA 4NIFA 4HW7A 2YJRA 3COMA 4EOPA 4FVPA 4QMYA 2WIHA 3HRCA 4M69A 3TUDA 2A27A 2WELA 4Y5HA 3GP0A 4MKCA 3R7UA 4QPMA 4KSPA 3B2TA 5H2UA 1NVSA 5HVKA 5BVNA 5LVPA 4RFZA 1RW8A 3GFWA 2OICA 3D2IA 4RFMA 4M97A 4BDIA 2CLXA 3VIDA 4ACDA 4OAUC 2J5EA 2PZ5A 1PYXA 5HE2A 4BC6A 3RAKA 4BB4A 3LFEA 4ERWA 2A19B 3V8WA 4GG5A 5CYIA 2E9VA 3UQGA 3IW8A 5IQDA 3DFCB 4PPBA 3UNJA 4O7TA 2SRCA 3NMUF 1PXLA 4EWHA 4QP1A 4KRDA 5K0KA 3LFBA 3TNHA 4XH6A 1WBWA 4GJ2A 3SDJA 4EC9A 4NU1A 3I7BA 4QO9A 1ZY4A 2XK6A 5GZ8A 2WB8A 2C47A 2PVRA 4I6FA 3VNTA 4NM7A 2FO0A 1KOBA 2VWIA 3PJCA 2BZIB 4BZOA 4E5WA 5F4NA 4II5A 2R3JA 3D4QA 4XLVA 3UJGA 3TKHA 2YIQA 5CSPA 4C0TA 3EQHA 3QHRA 2AQXA 4G9RA 4NCTC 2W4OA 2RFNA 5JQ8A 4RJ7A 4JG8A 4IHPA 3KXHA 1V0PA 1ZAOA 3KVXA 1MRUA 2ITTA 4BRXA 4LL0A 1GAGA 1MQBA 2WO6A 3KXZA 4LV7A 1H28A 3KRRA 2P2IA 3MBLA 3H10A 4FL2A 5K5NA 3UG1A 5F94A 3TKUA 1OIRA 2BVAA 4C4HA 3C4CA 1H1SA 2E9UA 4G3DA 4UN0C 2W7XA 3MFRA 4AAAA 3LLTA 1O9UA 4JQ7A 5IH5A 5EQEA 2YABA 3ZFYA 4BF2A 1UA2A 5C1QB 5ANOA 3K2LA 4JG6A 4A4XA 3NUAA 5DRBA 5AR5A 3EIDA 4UB7A 3U9NA 2BKKA 2CSNA 3CLYA 3P78A 4DC2A 2WMSA 4FV6A 4L9IA 5J1WA 3MYGA 3R83A 5DEYA 3QWKA 4AT5A 4MD8E 3WILA 2PZYA 5HCXA 3ITZA 3TTJA 4YJNA 3BYOA 2W4JA 2JFMA 5AX3A 4QQ5A 3Q5IA 5B2KA 1R0PA 2G15A 3FLNC 3BRBA 3PSBA 3VAPA 1T45A 4CFWA 3BZ3A 5I9WA 4YUQA 3DAEA 2YERA 4KINA 4RIYB 4FEVA 3PZEA 3AD4A 2C69A 2O64A 4K77A 3W32A 4XJ0A 4F7SA 5JN2A 2XNGA 1OBGA 3QXOA 4XBRA 4KIKB 4NIFB 1ZY5A 4XG6A 2YCQA 3WZUA 1VYWA 2KTYA 3FAAA 4Q2AA 2JKOA 2CGUA 4M69B 2I0EA 2XB7A 4BBFA 2P4IA 4FKJA 4JNWA 4V0GB 1MQ4A 4PUZA 5A4CA 1ERKA 3SA0A 4ZJIA 3U54A 2JKMA 1XR1A 4CKJA 4GK2A 4L44A 2JDOA 1ATPE 3A62A 2DQ7X 4FGBA 4BJJB 4F7LA 2NP8A 3QRJA 5M09A 4TW9A 3HEGA 5AV2A 5JT2A 5DHJA 3UIUA 2VTMA 4OLIA 3ZYAA 3HECA 3I6UA 5D11A 5HTBA 1PXIA 1JAMA 3ORKA 1GY3A 3ZLWA 4BR3A 3EOCA 4KNBA 5A6OA 3QCQA 4XS2A 3VF9A 5D7VA 4YBKA 2EB2A 1KV2A 4N70A 3NZ0A 3BGPA 4U41A 2G01A 3A8WA 1XKKA 4I92A 5J5SA 4C4JA 4E20A 3BLRA 4R3RA 4ZTNA 4FTQA 4MWHA 4O0SA 3R63A 2YEXA 4G5JA 5E7RA 4RRVA 3SHEA 3TG1A 4NJDA 4YMJA 2YCRA 4I4EA 2P3GX 1HOWA 5HIDA 1KV1A 4LV8A 3BGQA 1UWJA 2QC6A 3QA8A 5KBQA 3OEFX 2VTLA 2ZV2A 3NCGA