3ZDIA

Glycogen synthase kinase 3 beta complexed with axin peptide and inhibitor 7d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
348
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title 3,6-Diamino-4-(2-Halophenyl)-2-Benzoylthieno(2,3-B) Pyridine-5-Carbonitriles are Selective Inhibitors of Plasmodium Falciparum Glycogen Synthase Kinase-3 (Pfgsk-3)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 99
structure length 348
sequence length 349
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zdiA01
4YO6A 2UVXA 1JKKA 2A4LA 2FH9A 4TTHB 2QOBA 4KB8A 5CY3A 5EM8A 5HNGA 4BTMA 2V0DA 2J7TA 2UZDA 5DT0A 3NW5A 4UALA 4DAWA 4QP6A 4JRNA 4WG5A 5E7RA 4ASEA 3KXXA 4QMOA 1U4DA 4E4NA 3QZFA 5J79A 1KOBA 3WZEA 3R7VA 2ITNA 5K4IA 2XIZA 3KEXA 5HO8A 3FMLA 1QL6A 4LMUA 2VX1A 5L6OA 1A06A 3DLZA 5EKOA 3HV7A 1CSNA 4D55A 3NUXA 3MJ2A 5A3XA 1ZOHA 2R3RA 3RCJA 1S9IA 3VWAA 1SVHA 4EOOA 5L3AA 5E8UA 3POZA 4FV5A 5HX8A 3OEFX 1LEWA 3VUIA 3KK8A 3VBTA 3QQHA 4RVTA 5K4JA 2BCJA 4ZTSA 2WEIA 4EH7A 3ODYX 2C3LA 3AD6A 2PZIA 4PDSA 4NFNA 5AA9A 1H0VA 1H0WA 4PNIA 4IWPA 2QOLA 3DK7A 3QXPA 4F6SA 2IZRA 3G6HA 3BWJA 4FUXA 2BFYA 3OROA 3R2BA 3G33A 2X4ZA 4XV1A 2VU3A 4E8AA 1U54A 3MH2A 3VS5A 3PZEA 2HAKA 2B9IA 3DGKA 3F3VA 2X81A 3QCXA 4Z16A 4H1MA 4TNBA 4O2PA 5EI6A 1ZMWA 1PRYA 4QMZA 2V5QA 3P7BA 3SOAA 5A6OA 5IEYA 2ZV9A 3GU4A 3MB7A 4RX9A 4V01A 3U4UA 2WFYA 1JKLA 4WG3A 3UE4A 4EH9A 2GMXA 3QX4A 3EQDA 4NUSA 5M4CA 4AT4A 4GG5A 1AD5A 4BDGA 3JPVA 4XG8A 3QAME 3C51A 4HPTE 5CU0A 2H8HA 4C57A 4DEBA 2ETRA 4AAAA 2A0CX 3EQBA 2X9FA 4J1RA 4IJ9A 4IM3A 5CEQA 3FSKA 4EYMA 1ZYSA 4ERKA 3IW5A 4DFLA 4QMVA 3UVQA 5CXZA 3M42A 4IE9A 4QQCA 4EBVA 3R8MA 3HUBA 4GRBA 3V04A 3NUSA 3C4ZA 4LUEA 4IFCA 4DEDA 2VTRA 3PA4A 2UVYA 3UO6A 4G6OA 2WGJA 2Y8OA 3QC4A 2CPKE 1H1SA 3HDMA 2C47A 3TN8A 3F3ZA 5EOLA 5FM2A 3B8QA 2O3PA 5J8IA 4D2TA 3SVVA 2WTDA 3QTIA 2VWZA 4R5YA 2OXXA 4MK0A 4KKGA 2VTTA 3PG1A 1L8TA 2GHGA 3HV4A 3KKVA 5FWKK 2H9VA 3AT2A 5GJFA 3CQUA 1Q3WA 1WMKA 3G6GA 4UZHA 2OIDA 3PP1A 5AR5A 5HD4A 4F6UA 4ZMFA 2J0MB 2VD5A 1H1PA 4FOCA 5J5SA 3MESA 2WELA 4APPA 3DOGA 5ANEA 3V5WA 4CG8A 2OBJA 1VYWA 4F6WA 4L43A 4O7LA 4WNKA 4PF4A 4S31A 1JOWB 2X2MA 2V62A 3ZU7A 1PXPA 5A4QA 5JZNA 2RL5A 3FLNC 1REKA 3E8CA 4WSYA 5ICPA 4C37A 3AMYA 3DKGA 4Q9SA 3ANQA 1ZY5A 2R3KA 4C2WA 1URWA 5L8KA 3CPBA 2WTJA 3BHYA 2BILB 4C4IA 2BKKA 2FGIA 3PVBA 4U0IA 2R0IA 4FV1A 3SRVA 4AOTA 3ZM4A 5HOAA 1B38A 2VTIA 3I1AA 3R1QA 4PL5A 4YC6A 4DBNA 5EHOA 3R7EA 3EHAA 3GCUA 4RSSA 3OWPA 3UGCA 3QFVA 4PNKA 2G15A 2PMOX 4NM0A 4DFZE 5LVMA 4QYYA 2R0UA 3G90X 3IPHA 4W4VA 4RWKA 3PFQA 2AYPA 3F6XA 2QI8A 4HGEA 2GCDA 4KAOA 3LXNA 5IEVA 4JJRA 3DXPA 2QO7A 3DK6A 3FLQA 4BGGA 5I9UA 4MNEB 5ETAA 3QQUA 3ORLA 3FZPA 4JR7A 4PMPA 2X1NA 3QLFA 2ITOA 2R5TA 3LFFA 4FG9A 3VULA 3UO5A 4K9YA 3BYSA 5FTOA 4FEQA 3NS9A 1WZYA 2C1AA 4PX6A 2GSFA 4MQ1A 3WARA 3DNEA 4O7YA 1OIUA 1ZYCA 3EQPA 4UX9A 4FVPA 4KWPA 2W5AA 3GVUA 4ERWA 2QONA 2QR7A 1G8SA 2W17A 1VYZA 4AGCA 4BDIA 4IWQA 4EEVA 3R2YA 4GVJA 4EK5A 5I9WA 1OKVA 4QYGA 3KRRA 3OTVA 5CYIA 3BE2A 4C36A 5AAEA 4ZTLA 3TZ8A 2GQSA 4TWCA 3QRIA 4AZEA 4EOJA 3FSFA 3GBZA 2R3QA 4MF0A 5K0XA 3RM7A 4IVCA 5E8WA 5EQPA 3UIMA 3P86A 2R7IA 4RT7A 3BU3A 4DH5A 3NUPA 3MS9A 4F9AA 4Q5EA 4S32A 2C5OA 2WIHA 3UC3A 1PY5A 1O9UA 2IZUA 4AN3A 3OCSA 2ZM4A 4D0WA 2XA4A 2C6IA 2QCSA 1XH8A 2ZV7A 3DV3A 2WTKC 3LJ2A 4IJPA 5EH0A 3U6HA 3BU6A 4RC3A 4OW8A 3NUAA 1JKSA 2ZDUA 3E93A 1H4LA 3PYYA 4FV6A 3I5NA 4NFMA 5D11A 4LL0A 4BYIA 4FKTA 5CF8A 5E8SA 4O84A 3QXOA 4FNZA 3EL7A 4A9TA 2HWOA 4WKQA 2OI4X 5AFVA 5AR8A 5EDPA 4BWPA 4GVAA 5I9YA 3GC7A 2PZRA 2UW5A 2YIRA 4LMNA 5TR6A 4ZLYA 1JVPP 3LM5A 2PUNA 4HCUA 4LGDA 2GS7A 1PYEA 4QT1A 4MD9E 4O22A 2Z02A 5HICA 5M55A 3W1FA 5LMKC 1YDTE 1YHWA 5FTGA 1YOJA 4FKLA 4G5PA 4I24A 4KBAA 4RLLA 5LVNA 3SG8A 5DWRA 3LXKA 5IDPA 3CPCA 3JR1A 4YPDA 3E64A 1PMNA 3R1NA 4E20A 2VAGA 5C8KA 3CGFA 1FPUA 4RX7A 2JKMA 3VAPA 5FEDA 5B7VA 4IIRA 1DAYA 4BKZA 4BZDA 3MIAA 3Q2JA 1X8BA 2PK9A 3W16A 3DT1A 1B39A 2R3LA 3LFAA 5HE1A 2I0EA 4PY1A 4ZMEA 3K54A 3P1AA 3UMWA 4QP2A 4BHZA 4HNIA 5EYMA 3WF5A 4X3FB 2ACXA 4FKSA 4FKWA 4BIDA 3OUNB 2X7FA 3LM0A 4GS6A 4WT6A 4DBXA 2W1DA 4E5AX 4L01A 1YOMA 4MD7E 2HOGA 2VZ6A 4X6QC 4F9WA 4BDDA 5CSPA 5HX6A 3RZBA 4UMRA 2P4IA 5TF9A 3AC4A 3C0IA 3FQSA 4Y85A 4D2WA 2XF0A 4EH5A 4F65A 2WMRA 4BB4A 3GQLA 4JX7A 4QMMA 4DH3A 5C4KA 4K11A 2NPQA 4FTTA 3QYWA 4FKPA 4GK4A 5GJGA 2B7AA 3R9RA 3PJ1A 4NT4A 4ZEGA 4FKOA 4QMSA 4EQUA 3EFJA 3ERKA 5IQHA 4NEUA 4CFXA 4BY9E 1SNUA 2C5XA 4GIIA 3HGKA 3KFAA 3MVLA 2XIXA 4CCBA 4MXXA 3CKWA 3O8UA 4CYJA 2X8DA 5HHWA 5L2IA 2B0QA 4FSZA 3WYYA 4QTCA 1WBNA 2YIQA 1Q61A 3OS3A 4FKIA 2CLQA 4DH1A 4WNOA 2BVAA 3QTSA 4AA0A 5HZNA 3PPKA 3FI8A 4R77A 4JS8A 3SKCA 3HYHA 4IM0A 3UMXA 3BLQA 3QQKA 3ZCLA 1H1WA 2VTLA 4BKYA 3FKLA 3K2LA 4I5MA 4F9BA 2ITPA 4PP7A 4O7NA 4FICA 1QCFA 4XCUA 4O1PA 4NH1A 5LWNA 4C58A 2PUIA 4HJOA 4I6BA 5H8GA 2VX3A 4L8MA 3C0GA 4RFMA 4UWYA 2ONLA 4YJTA 5JFXA 5DH3A 5DE2A 4OTRA 4F4PA 2XKFA 5HVKA 2R3MA 3RP9A 2XKEA 4CFVA 4OTWA 4OTDA 1OPKA 3DJ5A 5M51A 2WQBA 1ZOGA 2CN8A 3FAAA 3NYXA 3UG1A 3ZUVA 3UQGA 5LMBA 3AC3A 5K0KA 4XMOA 4C8BA 4HGTA 2E9PA 4AZSA 5CVFA 3MFSA 3LJ1A 4YNOA 4W9WA 4IB5A 4TPTA 1OZ1A 3G9LX 5HG9A 3ZO1A 3TM0A 5EDRA 3V5PA 2BPMA 5KMJA 2OJJA 4XG4A 2RGPA 3KXZA 2WPAA 4QQTA 5EW9A 3VBYA 4IFGA 1H24A 5E8XA 3TACA 5M08A 4PP9A 2C5NA 1PF8A 2HZ0A 4ZSJA 1FVVA 4YP8A 5ANKA 3O96A 3H30A 2EXEA 4MD8E 3HNGA 1DAWA 1XBAA 4XS2A 4IH8A 3RPRA 2QHNA 2FB8A 4FTCA 5M44A 1OBDA 3RHXA 3UJGA 2XRUA 4PPAA 5AP3A 4BDJA 5A4CA 3UNKA 3RCDA 1BLXA 3HV3A 3OT3A 1H28A 4FV9A 4EI4A 5KO1A 5FP6A 4QD6A 3S95A 3R00A 3VUHA 4FTRA 1H26A 1P2AA 4CFFA 5BX0A 3PWYA 3QRKA 2VV9A 3CY2A 4BHNA 2UW0A 4Y83A 3VRYA 3LFNA 4UXQA 4ZJVA 4X3JA 3UBDA 4Y72A 1U46A 5HU3A 3RNYA 1NW1A 3F5PA 4CV9A 3R02A 4ZSGA 3A7FA 3G0EA 3DZOA 4R7HA 3DJ6A 1YDRE 3DNDA 4GFGA 1OB3A 4OT6A 2YEXA 4FIJA 4QP3A 4I20A 5DHJA 5HVJA 3GU8A 4IC7A 3R0TA 4CLJA 4PWNA 1JSTA 3EFKA 4HVSA 4XG3A 5IA4A 4AW5A 4DHFA 4MVFA 3LHJA 2HZNA 5JGBA 1ERKA 5FXQA 4YHTA 2IW9A 2WTIA 1XH7A 3LXPA 3TNQB 2PE1A 2Z7LA 3JY9A 4I23A 4XRJA 5HCXA 3KULB 1WBOA 2EWAA 4FSQA 1HCLA 3BKBA 3MYGA 3IG7A 2F9GA 3W32A 4CT2A 3BELA 4B9DA 1ZYDA 5GZAA 2JKQA 1ZYLA 3TKUA 4MQ2A 4DEGA 3HRCA 5AR3A 4EOIA 5IH5A 4QMLA 5EOBA 5LVLA 4LM5A 4QMYA 1O6KA 3A62A 4EK8A 4ANBA 2IG7A 1T46A 5AP7A 5FDPA 5BVEA 2F7XE 5HE0A 1Q8WA 3CP9A 4EHGA 4RVLA 3MTLA 5F20A 4I5PA 4XV9A 3QZHA 2VTJA 5IPJA 3FMNA 3ZBXA 2EXMA 4IB1A 1SYKA 1KE8A 5EFQA 5L2QA 4RWLA 3UOHA 4M0YA 1OMWA 3NW7A 3SAYA 3VJOA 3O51A 4DFYA 2E9OA 3OOGA 3U55A 5HIBA 3R8LA 1UNGA 4TYHA 2Z8CA 4UB7A 5AP5A 4AQCA 5AV3A 4EC9A 2R3FA 4TY1A 1A48A 4IAYA 2YWPA 3OOMA 1K2PA 3DU8A 4K2RA 1W83A 5JSMA 3UIBA 2PZ5A 2IVTA 4X2FA 5KCVA 4OBOA 2WMQA 1OKZA 4FV4A 3NVMB 1JLUE 3QALE 4WNPA 3PDTA 4JQEA 5DMZA 4U44A 1Z9XA 3ZLYA 2CGWA 4UMPA 4BGHA 5BVFA 5BQ0A 2BROA 3O2MA 3MA3A 5CF5A 3DTWA 4NM5A 3OVVA 4L68A 4EUUA 3N51A 2OSCA 5BVKA 5EK7A 4F7NA 1O6YA 4BC6A 2JDVA 4DC2A 4TKSA 4O0YA 1M17A 3AGMA 3HP5A 4TWNA 4E3CA 4ZAUA 4ID7A 4AN9A 4LGGA 3H4JA 3NUNA 4FL3A 4M66A 4XX9A 3LPBA 3VQHA 4XG7A 5C4LA 1UWHA 4L00A 4XOZA 4ZOGA 2R3GA 5K9IA 2W1FA 2YERA 3N9XA 2NP8A 5HE3A 1LPUA 4TYEA 3R8UA 3TG1A 4E93A 5KZ0A 5EYCA 3EZRA 4WBOA 4ZSEA 2WZJA 3R83A 3UPXA 3IW4A 3JXWA 4C59A 1JWHA 4ZY5A 1E1VA 2DUVA 3OCGA 2DQ7X 3EN6A 4FZDB 4G3FA 3OXTA 4DEAA 2JLDA 3O23A 1JBPE 2UUEA 2XBAA 4JI9A 2QOKA 2CGUA 1OL1A 2XNPA 2HWPA 3PG3A 4EOKA 3F9NA 5BYLA 2EU9A 2XNNA 4ZP5A 4RC2A 2GQGA 4A9YA 4G9RA 4H3PA 3BGPA 2UZWE 2W1HA 5KNJA 2VTMA 4N6YA 3R9OA 2PMIA 3QKKA 5M4UA 4PDOA 4O0VA 3PZHA 3KN6A 2OJIA 4F99A 3ALOA 4C62A 4XP3A 2X39A 4RJ6A 4XH6A 5LVPA 4ASZA 4A4LA 4AA5A 3LCDA 3OW4A 5AIRA 3AXWA 2UZOA 4ITIA 4XP2A 5LARA 4C02A 3FLZA 4BWKA 3EL8A 4RVMA 3DS6A 4BCIA 2PVYA 2X7OA 4Y46A 3DBQA 5D10A 2OZAA 3Q60A 4AE9A 5BNJA 4HOKA 1FINA 4DG2E 4O0WA 5HG5A 5FG8A 3PLAE 2G2HA 4DT8A 2SRCA 3U9CA 3FQHA 2CKPA 3EQGA 4UMQA 3SDJA 2UW9A 1KUTA 2QVSE 3LQ5A 3SLSA 3G15A 4CTCA 1BL7A 3UQFA 1W98A 5AA8A 5ETFA 3DDPA 3R8ZA 2XIKA 3NIEA 2ITWA 3W8QA 3OMVA 4FZ6A 3W2OA 5ANDA 5GZ8A 4IM2A 3I7CA 4XBRA 2JBOA 5LCKA 1URCA 3D15A 4E26A 4X3FC 2WOUA 5IUGA 1BKXA 4YJQA 2RIOA 4CNHA 3KCKA 3NNUA 3Q4CA 4DEEA 3BYMA 4EOLA 3LMGA 5ANIA 2W4OA 2XBJA 3TV4A 1Q41A 4L44A 4M67A 4H3QA 5J1WA 3FY2A 2YIXA 2YA9A 4GL9A 4D5HA 2YM6A 3BEAA 5CAVA 3K5UA 2PVRA 3F2NA 4R5SA 1WCCA 5IU2A 3M2WA 1QMZA 5DEYA 2XEYA 2C69A 3M1SA 3Q9ZA 2YLFA 4PL4A 5CT0A 3Q2MA 5KMLA 1GOLA 3AQVA 3RK5A 3T9IA 4FR4A 3KN5A 1R0PA 3QD0A 3FMKA 2KULA 3GNIB 3W55A 1YOLA 4FI1A 3MTFA 4LRJA 4JVGA 4DF3A 4QYHA 4D0XA 2YACA 3KXGA 5AUXA 3SHEA 3P78A 3V8WA 5J9YA 2WQNA 1NXKA 2P33A 4N57A 5D12A 3T3VA 2CKEA 3GU5A 4DGGA 5AR2A 2FYSA 3A8XA 4N4SA 1Q99A 4IANA 5IQCA 4XOYA 2OJFE 4LOOA 2X6DA 4U9AA 2YCRA 1XKKA 2PL0A 3LZBA 3THBA 5M56A 2BHEA 3U9NA 1E1XA 4ANMA 3VN9A 2BRGA 5HEZA 2OO8X 2CDZA 1R1WA 4JG6A 2HY0A 3MJ1A 2XVDA 3V8TA 4QTDA 4EC8A 4TL0A 4RX5A 2VWWA 5M09A 5HG8A 4QMPA 3BU5A 3Q4TA 4FK6A 3P7AA 3MH3A 4I1ZA 3RINA 1ZMUA 4I0SA 5A4LA 2Z60A 4R3PA 5CLPA 3G2FA 5AUZA 1NA7A 3BI6A 2VRXA 5ACBC 3LJ0A 4FKJA 4NCTC 4W4WA 5FBNC 5D9HA 3A7JA 1OL7A 4RPVA 3KRWA 5FUTA 4AP7A 1O6LA 4CVAA 4XBUA 1M2RA 3H0ZA 1OUYA 3OWKA 4J52A 4MXCA 1H25A 4GU6A 2VO3A 3AC1A 5AADA 4I41A 4AF3A 1BMKA 2I6LA 2W4KA 3BCEA 4CV8A 5J5TA 3K3JA 4YNEA 1OPLA 3QTZA 4NM7A 3FI4A 3Q9XA 2HENA 4JAJA 4W4XA 3VW8A 3MH1A 4EHZA 2UVZA 5H8BA 2C3IB 5HNBA 5HNIX 4QMXA 4BCOA 3DKFA 3Q32A 4C7TA 2PMNX 2UZTA 3KCFA 5TO8A 2CNUA 4O0SA 2C0IA 4FMQA 5CU6A 1NT2A 3D7TA 4D2VA 3BQCA 2GNIA 1PHKA 2EVAA 2J4ZA 4YHFA 4MXOA 1OGUA 5AEPA 2GNJA 3PSDA 5L4QA 4RIXB 4GCJA 3FXZA 2C30A 4BIEA 3ZDUA 3CSVA 2WQOA 3O7LD 2CGVA 4BL1A 3QA0A 4KBCA 4WBBB 3PWDA 4QYFA 2BAKA 5FGKA 3N4VA 3F88A 1ZYJA 3QUEA 4XHKB 5DEWA 3T3UA 4YTFA 4RJ4A 4TYHB 3HA8A 4MWIA 3RM6A 3U6IA 4M14A 3ZSGA 3TEIA 2Q0NA 3WZKA 3TZMA 5JRQA 3DAEA 3O7LB 3KF4A 2B4SB 3NAYA 4MBIA 3R9HA 3TTJA 5BVWA 3DTCA 5AUVA 2JBPA 2XIYA 3VQUA 4CFNA 2XIRA 2XNEA 4FT0A 4BFMA 3KU2A 4IACA 4I92A 2JFMA 2RFSA 3ORKA 3Q3BA 4O7WA 5CS6A 5AUWA 1W84A 2J5FA 3GCPA 3UVPA 4Y5QA 3C0HA 4JIAA 5FEQA 3EOCA 4V0GA 2ITQA 3CY3A 2C3JA 3H10A 4GMYA 4YLKA 4BKJA 5IA2A 5CX9A 2GFCA 4G3EA 4UMTA 5C8MA 5CEOA 1Q24A 4TYJA 4YJOA 5CWZA 4AW1A 2QOHA 2GS2A 3C7QA 4AZWA 4C0TA 4BI0A 4HCTA 4ACCA 4U45A 3BHVA 2EXCX 4FKGA 1AQ1A 2R3HA 3GT8A 3P5KA 4FNWA 2IJMA 1WFCA 5LXMA 5IQEA 4YTIA 4ZLZA 3NYVA 3Q4UA 2WMTA 4ACGA 3ZTXA 5M57A 3TUCA 4ZIMA 3FZRA 2F4JA 3AMBA 3VBVA 4F0GA 4PMSA 2WB8A 4QTAA 3U51A 4NU1A 2J2IB 3OC1A 4I3ZA 4YC3A 1MRUA 5AUUA 3DCVA 4E1ZA 2WD1A 3A7HA 5J87A 4EK6A 4L45A 5CF6A 5KMOA 3QBNA 3MPTA 2GQRA 3NX8A 2UW7A 4ALVA 4E73A 3RPYA 2JKKA 3FKNA 2XP2A 3PXRA 3TXOA 4EOPA 5ETCA 4CT1A 3OXIA 1Q8ZA 3IOKA 4J97A 4QMUA 4PPCA 5A46A 3I79A 4LV8A 3CEKA 4CZYB 4BF2A 3UG2A 4EH6A 2CHLA 4GSBA 3VS2A 2OWBA 3AGLA 2OZAB 2VO7A 3ELJA 5JFSA 5HIDA 3TZ7A 2IW6A 2CGXA 4LFIA 3DAKA 3ATSA 5DR6A 2WU6A 3C1XA 2JFLA 3R7OA 2G2IA 4IBMA 4LUDA 3F82A 4M69A 4C34A 4ACHA 3IQ7A 5JZJA 4I0TA 4WRSA 1Q62A 2C5VA 4AU8A 4BDHA 3TNIA 4NL0A 1G5SA 5CVGA 3RTPA 1LP4A 3D5XA 3HMOA 4C61A 2H34A 5FEEA 3QRUA 4ZK5A 4BI2A 5I9VA 1XH9A 3VBXA 3UZPA 3PA5A 3UYTA 4EJNA 4FSUA 2QNJA 3CJGA 5IQIA 2UZEA 3GXLA 4RJ5A 3N4UA 4YTHA 2IO6A 4CFUA 1MQ4A 2VTSA 4BTJA 3ZC5A 1P14A 3PVWA 2OK1A 2GNHA 5HCZA 4RIYB 3DFCB 2R3JA 3LLAA 3KC3A 2OIBA 4OR5A 4R3CA 3WZJA 4K0YA 1YXUA 3VUKA 4QPAA 3V5LA 2GPHA 4IHPA 4RQKA 4KKHA 1K3AA 5JQ5A 1BI7A 4H36A 5AX3A 3PXKA 3VUDA 5KMKA 3RPVA 5A9UA 4E6CA 3SD0A 4RQVA 2R3NA 5JQ8A 5JH6A 2UW8A 3HECA 3UP2A 3D94A 2E9VA 2BR1A 4X7QA 1AGWA 2CNQA 3SW7A 4X6RA 1TKIA 3A4PA 2X8IA 3OBGA 4DFXE 3VIDA 3Q6WA 1OM1A 3FL4A 3JYAA 4C3RA 4O7TA 1XH4A 3BX5A 4U3ZA 5CQWA 4A9UA 1PMEA 2QOOA 4AT5A 3TUDA 2Y4IB 3MVMA 5C9CA 4EK4A 1YVJA 2F2CB 4FX3A 4OTQA 4F7JA 3OFMA 2ERZE 3NCGA 2WMAA 1IR3A 2W05A 4ONAA 4OLIA 5I4NA 1V0PA 4USFA 3GENA 3CKXA 4P7EA 2QKRA 3ZO3A 3DQXA 1M2PA 4IDTA 2DWBA 3KA0A 4K77A 4O7ZA 4HYIA 4YZCA 1WBPA 2W1GA 2I0YA 4PTCA 3VF9A 3WF7A 5D41A 3PE1A 3TI1A 4H39A 4K1BA 2B9HA 2FUMA 4FGBA 3FMEA 3ZEPA 2WQEA 3A7GA 2B53A 3HKOA 1M52A 4QPSA 5EG3A 5IEXA 3G0FA 3QZGA 3OUKA 4S33A 3EQIA 3OCTA 3LW0A 2CMWA 2YCFA 5EYKA 4NYEA 5M06A 3FYKX 2YM5A 5BVDA 4IVAA 3VRZA 3A8WA 1JAMA 4GV1A 4X2GA 3OWJA 4JDKA 3E7VA 4QPMA 4E6DA 3N4TA 2WNTA 4JQ8A 4LI5A 3CGOA 2RFDA 4D1XA 3G51A 5FD2A 5LMAA 5J7BA 3ROCA 3ZZWA 4DFUA 1GNGA 3MPAA 4GK2A 4ALWA 4DFNA 1JQHA 4XLIA 2XK3A 4EH3A 4AS0A 5A54A 1IAHA 5DYJA 1G3NA 3LCTA 5L8JA 4CKRA 2G2FA 2YDJA 1OPJA 3I0OA 2WAJA 2C5YA 4F08A 1IA8A 3D14A 4FZFB 4UEUA 5AV1A 2Y6MA 3QGYA 3LQ8A 1JSVA 3PRFA 3FMJA 4JOAA 4QTBA 3HDNA 2GDOA 4PPBA 4BCNA 3K3IA 3IOPA 5C8NA 2QC6A 4TW9A 1TQPA 4KIPA 1WVYA 2I0HA 4C4FA 1WBWA 2H6DA 3D5VA 3FMDA 3ZBFA 3I81A 2CKOA 1PXMA 4TRLA 5E8YA 3ZYAA 3FMHA 4S2ZA 3UVRA 2YFXA 2VWIA 5DT4A 4EOSA 3R71A 1TQMA 3MFTA 3IS5A 4YHJA 2V22A 4MCVA 2YN8A 3F61A 5E8VA 3EN5A 4C35A 4W8EA 4DTAA 1ZWSA 2OH0E 1VEBA 2AC5A 5FP5A 1YWNA 2XZSA 2ZVAA 3ETAA 4Y8DA 2J0JA 1U54B 2E9NA 2I40A 2C68A 2EUFB 4LQMA 2OKRA 4M12A 5AJQA 5CT7A 4JBQA 5IA0A 5JMSA 4G2FA 1VJYA 2ITXA 4OTGA 4UZDA 1WAKA 4YSJA 1MUOA 1R3CA 2OG8A 2UZBA 3I7BA 2JC6A 3NUYA 4L67A 3F3TA 4UBAA 4YC8A 4AGWA 5C1QB 4IC8A 3QA8A 3O8TA 2W4JA 4EHEA 4BBEA 2BTRA 3PIXA 1Q4LA 1W7HA 4IZAA 3RGFA 2OH4A 4MEDA 4AOJA 1CDKA 2ITUA 3CIKA 3MY1A 4BCQA 3DK3A 4G9CA 1FBNA 4XRLA 5CZHA 2WU7A 4JXFA 4LOQA 1ATPE 2J6MA 2WKMA 5K5XA 4PMTA 2P3GX 5T3QA 4JDJA 1RJBA 4KS8A 2B54A 2PULA 3C4WA 3R7GA 2AC3A 3QRTA 3QCQA 4JX3A 4ZSLA 3RWQA 3TV7A 5AAGA 5CAQA 1IA9A 3QF9A 3VUTA 5B2MA 3U54A 5H9BA 4E4XA 3C4CA 3O50A 3HMPA 4FC0A 3FI2A 4G5JA 4G6LA 1U5QA 3COKA 2CJMA 3HEGA 3CTQA 3FUPA 1PXNA 4X0MA 4BYJA 4U7ZA 4DGMA 4X2JA 4ZS4A 1RQQA 3KVWA 3P23A 4NJDA 3V5TA 2XNOA 5EHLA 4FV7A 4BZNA 2VWBA 4J7BA 4E6AA 3MI9A 3E62A 5GINE 1ZZ2A 2ITZA 3W2PA 5I0BA 3EJ1A 5DRBA 3D83A 2UW3A 3FPQA 4NSTA 3EKKA 4FK3A 4IXPA 2Y6OA 2E2BA 4RIWA 3IW6A 1REJA 2J9MA 4OTHA 3I6UA 3UODA 3E8NA 2YJRA 3W8LA 1W8CA 2XB7A 2WHBA 2X4FA 2PVNA 5EI2A 4D5KA 5IA3A 5CNNA 5CEIA 4XEYA 1JNKA 2X8EA 3FPMA 4FNYA 3U87A 1UKIA 2ERKA 3ULZA 3OY3A 3KXMA 2PWLA 2QOIA 2Y7JA 1MRYA 3A99A 3P7CA 2BZKB 3BHHA 2XM9A 5BPYA 3GC8A 4FV3A 4MF1A 3L1SA 3ZLXA 3MW1A 3HAMA 4Y73A 3HUCA 3MFRA 3UOLA 3I60A 5M53A 1NVRA 3PJ8A 3MN3A 4C33A 4BDBA 3SRVB 4D4VA 5LMKA 5AP4A 4R78A 4U81A 3L8XA 3ZUUA 3MY5A 4CMOA 4DH7A 5H8EA 5T6KA 3EYHA 2PZYA 3CD3A 2BAJA 5HU9A 1OUKA 2BDWA 3S1HA 4UYAA 1IASA 2HELA 3WIGA 4FEXA 1Z5MA 1HCKA 2ZDTA 1UU7A 4HZRA 4C4GA 5CEPA 3S0OA 4KNBA 4FT5A 4ENYA 1XO2B 5BVOA 4KINA 3IDBA 3EFWA 4ZY6A 5DR2A 4UMUA 3V51A 2YJSA 3QD4A 4FT9A 4FV8A 1H1QA 2OJGA 3FQEA 2G1TA 3HRFA 4B0GA 1SVGA 3QU0A 3GGFA 4LL5A 4DTKA 4WIHA 1YI3A 2ZV2A 3VVHA 2IPXA 4MXAA 3KMMA 1I09A 4EQCA 4D4SA 1M7QA 4G6NA 1OECA 1A9UA 2OGVA 3NYNA 3OHTA 4QMWA 2R9SA 3O0GA 4XUFA 5EW8A 2C3KA 5I3RA 4FIHA 4NM3A 1P4FA 3KXHA 4CZTA 4ANQA 3QHRA 3HA6A 3ORXA 3IDPA 2VNWA 3R01A 1YXTA 3POOA 3OBJA 1KE7A 4EJ7A 3EYGA 2UZNA 2FVDA 4WHZA 3BZ3A 5EDQA 3VHKA 2W7XA 3OCBA 4YLJA 2CN5A 3DXQA 1TVOA 2ITYA 4YJSA 1KV1A 4ZY4A 4C4HA 4YTCA 5M4FA 4A7CA 1GAGA 2WO6A 3BE9A 4I5HA 3HL7A 2F2UA 4L53A 4QNAA 4RFZA 3TNWA 2J5EA 3LFQA 4MH7A 2W06A 2WMBA 3ACKA 4CXAA 2JEDA 4Z3VA 4EH8A 3FLYA 4MBJA 1STCE 2PE0A 5E4HA 4IMYA 4AN2A 4DE4A 4JBPA 3MB6A 2I7QA 2PVJA 1I44A 2XJ1A 1FVRA 5FBOA 5F94A 3HRBA 3R9DA 2F49A 2JAVA 5HLNA 4DYMA 2P55A 4AT3A 2REIA 4R6VA 2PY3A 3LCSA 4YGAA 1JPAA 4O81A 5BMSA 3ZEWA 1UV5A 4JNWA 2NRYA 4UV0A 3L9LA 2XNGA 4L3JA 2HZ4A 3BV2A 4FGRA 3A2CA 3L9MA 4QP7A 4F9YA 2A27A 3FWQA 2W9FB 5TOZA 4M3QA 1RW8A 3R1YA 4USDA 5JFWA 1P4OA 4B8LA 3U8WA 4BBFA 3RZFA 4OAVB 3IGGA 5IMEA 3FHRA 2YDIA 3CR0A 1J7IA 3VW6A 2JGZA 5CSWA 5HBEA 4BICA 4DG3E 4DITA 4O7VA 4G31A 3TNHA 2F7EE 4AFEA 3LKMA 1QPJA 4BCHA 3FE3A 5EYDA 5GHVA 1OIRA 2W99B 3ZFYA 2HXQA 4L7FA 3KF7A 4EONA 5CALA 5EM6A 3TKHA 2OF2A 3GB2A 3FY0A 3KREA 3FZ1A 3QTUA 1ZY4A 4L46A 5FLFA 3SOCA 4F64A 3MV5A 3TTIA 3LFSA 2G01A 3KB7A 3GFWA 1H8FA 3VJNA 4AX8A 4OBQA 1YXVA 4EQMA 3I5ZA 4BDAA 4O7SA 4TYGA 4AGUA 3PA3A 5ANOA 1CKIA 3P0MA 5HE2A 3RNIA 4F7LA 3S00A 2IVSA 4MX9A 3IECA 3LFBA 4K18A 1CMKE 5CSXA 2O64A 2BAQA 2Y4IC 3COMA 3LLTA 4FF8A 3TT0A 3GC0A 5CZIA 1YDSE 3TWJA 2QQ7A 4F9CA 3D2IA 3PXQA 3BYOA 2OJ9A 3RVGA 4QP8A 5M4IA 3ATTA 2GNFA 1Y8YA 5IUIA 3F7WA 4JT3A 1DM2A 2W1CA 4FSWA 2GNLA 4CQEA 1OL6A 4NK9A 4QMNA 3LFCA 3PUPA 4Q9ZA 2QLQA 4YMJA 1UNLA 4FIEA 1FMOE 3NRMA 3O17A 3O8PA 5HESA 3D9VA 3I4BA 2VTHA 2WMVA 4WA9A 2OXYA 2PYWA 4G3GA 3DA6A 3BRBA 4PQNA 4RIOA 2PHKA 4NW6A 1FGKA 4D4RA 2P2HA 4FIFA 4J8NA 3VS6A 5KHXA 3BLRA 5AP0A 2OXDA 3ZRKA 1Y91A 1Z57A 4LV5A 4MHAA 3GP0A 4N0SA 3F2AA 3CTHA 5FXSA 3R9NA 3REPA 1NVQA 3W18A 5CF4A 5IH4A 2ITVA 2R3OA 3G9NA 3SXRA 5KUPA 4D2RA 3HP2A 2XNBA 2VTPA 2W1IA 3NUUA 1YW2A 3E87A 4X2KA 2C6DA 3VS1A 3TNPC 3JUHA 4JL9A 5TT7A 2XKCA 2W9ZB 3P08A 3Q9WA 3F3UA 4RA4A 1WVXA 2OFUA 4C3FA 1LEZA 3DB6A 1OIQA 2X2KA 4NZWB 5EM5A 3LCOA 4DCAA 4ITJA 4D28A 4OTIA 2YDKA 2ZJWA 3DLSA 4AGDA 5I9XA 1PMVA 4KUJA 2CCIA 4QO9A 3ZSHA 3D5WA 3AD4A 5CEMA 1S9JA 4EZ5A 3ALNA 3DJ7A 4YUQA 3JVRA 3L9PA 5FQDC 1ZLTA 3NZ0A 3GC9A 5I3OA 3LMHA 3EKNA 2WXVA 3UO4A 4YSMA 4CQGA 2PUUA 2JIVA 1UNHA 4WOVA 4FTIA 2NO3A 3K5VA 1CKPA 2XK9A 3F2RA 4ALUA 3QD3A 2QU6A 4BDFA 2XJ0A 4AFJA 1T45A 5IDNA 5JKGA 4FIGA 2HXLA 3R7YA 1IG1A 2B1PA 3R7IA 5KKRB 2A2AA 3FZSA 2ZM3A 3ACJA 2BZHB 2WTWA 2X9EA 2VN9A 3DBEA 4NKSA 2V55A 2Q0BA 2W5BA 1XBCA 4TXCA 5ETIA 4M13A 5JN2A 4BIBA 4ANOA 3RI1A 2YLEA 3ULIA 1YI4A 5IQFA 3SXFA 2GTNA 2WIPA 4MNEA 3R22A 2YCQA 3WZUA 4YU2A 2PVLA 2ZV8A 1SZMA 5ANJA 5HKMA 4AG8A 3Q4ZA 4D4YA 2B9FA 2HYYA 4O2ZA 1WBSA 3ZRLA 5J7HA 4EWHA 2YM7A 3CBLA 3C4XA 1GJOA 2BRHA 4HNFA 2LAVA 3OT8A 3TCPA 3WF9A 3PLSA 2PMLX 2QG5A 2VNYA 3HMMA 4S30A 4DA5A 1BUHA 2BZJA 5CI7A 5J1VA 4WRGA 4CRSA 2BMCA 3V5QA 4GU9A 3MPMA 5FDXA 4EOMA 4ZTRA 4EH4A 3ID6C 3PY0A 1KWPA 4IB0A 5AM7A 3NNXA 5TE0A 5GNKA 1UU3A 2IVUA 2FA2A 3F5GA 4HYSA 2PZPA 1YWVA 3E8EA 1UU8A 2VWVA 3Q6UA 3OTUA 2OFVA 5E1SA 2X2LA 4RWJA 3RPSA 4ZZMA 3CXWA 1XR1A 4O0UA 4YJNA 4BCMA 4GIHA 4M15A 3WI6A 3PVGA 3PSBA 2VWUA 1ZRZA 4LG4A 2BHHA 2PVHA 4I22A 1MP8A 2O0UA 5AM6A 5DT3A 2YISA 3TL8A 1W82A 1PKDA 4IW0A 4KIOA 3H9RA 2VTNA 3Q52A 4BDKA 4F0IA 2E9UA 2JITA 3FLWA 2RFNA 4R7IA 1VZOA 2CCHA 3C4EA 2B52A 1ZOEA 3PXZA 4I94A 4HVGA 4CMTA 2QHMA 4HGSA 4L6QA 3R73A 3W33A 4IAZA 4YZDA 4FTNA 4FEUA 2C6EA 4U8ZA 2RG6A 3UTOA 3QCYA 2O65A 4FNXA 3FMMA 4HPUE 5FRIA 5IQDA 4K8AA 2NRUA 3EQCA 4AOIA 4JBOA 4USEA 3LMIA 4C4EA 3PPJA 3HVCA 3TIYA 3CE3A 3LFDA 4WNMA 2J90A 4O38A 3IONA 5EM7A 1U5RA 3BEGA 3GQIA 4FUYA 4GT3A 4AA4A 2XK8A 4M68A 4G3DA 4ACMA 4BTKA 1J7LA 4FTMA 1Y57A 1Q8UA 4YBKA 2WTCA 2HK5A 2V7AA 2XKDA 3IK3A 3RHKA 4I6QA 3UZTA 3KRXA 3EN9A 4IDVA 5F1ZA 5T68A 3ZM9A 5KBRA 4MTAA 4L7SA 1WVWA 3UPZA 3ZO2A 4BCFA 5AUTA 4DINA 4XNEA 3IDCA 3CQEA 4PTGA 1YKRA 3LCKA 4TN6A 4GUEA 1DI8A 2CNVA 1IAJA 5A6NA 2ETMA 4AZTA 4J53A 2P0CA 5HBHA 2OW3A 5HBJA 1KE6A 4CCUA 5EW3A 2ZM1A 4FV2A 3AD5A 4GJ3A 4FSNA 4X3FA 4YO4A 5JFVA 3TDVA 2CSNA 3IGOA 1J7UA 2GFSA 2C6LA 2WOTA 3GFEA 3Q5ZA 3GOKA 3B8RA 1M7NA 3VS4A 3FC1X 3NGAA 3GCSA 4RRVA 5L6PA 4BZOA 2WMWA 2JDSA 5BUEA 4CFWA 1PKGA 3MVHA 4EBWA 4RLKA 5IUHA 3VF8A 2QG7A 4DLIA 1V0OA 3ENHA 5CU4A 3F3WA 4GK3A 2BDFA 5IQBA 3PTGA 4CLIA 5AR7A 5DNRA 4DEIA 4RJ7A 1PXLA 3DY7A 5AIKA 3JVSA 3NIZA 4KSQA 5AWMA 3S4QA 2AUHA 4JR3A 4B6LA 3RAHA 1TQIA 2W1ZA 5HVYA 3AC8A 3ZSIA 3ZOSA 2X0GA 5FM3A 4B4LA 4CZUA 2C6TA 1B6CB 4PMMA 2OICA 3FXXA 3KXNA 3NWWA 3LVPA 4QTEA 5IQGA 4ZZOA 4QP9A 2CLXA 2VWYA 3H9OA 5HLWA 1FQ1B 1F5QA 4FIIA 5CVHA 2VO0A 2I1MA 4Q2AA 5KE0A 1Q3DA 1W0XC 4TWOA 4XLVA 2JIUA 3GUBA 5DPVA 2Z2WA 3F7ZA 2WEVA 3PJCA 2J0KA 5TKDA 4IWOA 3BWFA 3KMWA 2C6KA 3C50A 2FSMX 3UNZA 4M8TA 4E4MA 1QPEA 3RWPA 3LAUA 5BYZA 4KBKA 1YWRA 3ZONA 4NCTA 3SC1A 1KE5A 4NW5A 1YHVA 4DCEA 4D9TA 4YPSA 5DLSA 3IW8A 2FSLX 5DIAA 1P5EA 4FKRA 3MA6A 3FI3A 4ZTHA 5E9EA 3DKCA 1XHAA 4OT5A 4YLLA 1ZARA 1IRKA 4I4FA 4NIFA 2XUUA 4C4JA 4E7WA 4PUZA 3E7OA 4I21A 3CD8A 4JG7A 4YZBA 4BWXA 4A4OA 1FMKA 3C5IA 4Z55A 3PY3A 4LOPA 3PIYA 5GZ9A 3QUPA 4W9XA 3S3IA 4CYIA 2GTMA 2FSOX 2XK7A 5CTPA 5HIEA 5AMNA 4EUTA 4U40A 3QTQA 4J96A 5CENA 3ZH8A 3DKOA 3KL8A 1VR2A 5FTQA 5M07A 5B2LA 2ZMDA 2RSVA 3FKOA 2G9XA 5AP6A 5ACKA 3MFUA 4RGJA 4EZ3A 1UWJA 3CS9A 3FLSA 4U43A 4JBVA 1PJKA 3ODZX 2X6EA 1CM8A 2OZOA 3LE6A 4M84A 4O27B 2RG5A 3KQ7A 3NSZA 2XJ2A 4LGHA 5BMMA 1PXKA 4DN5A 5K3YA 3T8OA 5A14A 3CTJA 5IZFA 3H9FA 4ZSAA 5A4EA 4GT5A 4M0ZA 4ENXA 4QYEA 5KX8A 5EQYA 4EWQA 4FSRA 2C1BA 4BDEA 5DI1A 2J0LA 4ZLOA 2ZOQA 3OG7A 5AV4A 4CFMA 5IA1A 5CU3A 5L6WL 4P5QA 1NY3A 4MWHA 3SV0A 1MQBA 4OUCA 2KTYA 3AC2A 4FVQA 4U80A 1R0EA 1YXSA 1H00A 2YZLA 5HQ0A 3SXSA 4ASXA 2PPQA 4C2VA 4G34A 3R7UA 1V1KA 3RPOA 3NDMA 4GW8A 4CKJA 4HYHA 1FGIA 3Q53A 2VX0A 4PTEA 4L3LA 5KZIA 5H2UA 3CCNA 4DEHA 3DPKA 2Q83A 3FBVA 4KS7A 4FYNA 4Y5HA 4AW2A 4RX8A 2R7BA 4J99A 3RK9A 4G17A 4IX4A 2C6OA 4F1TA 2O5KA 2BKZA 3AT3A 3EQHA 2BIYA 4UWCA 3LXLA 3D4QA 3EWHA 1KV2A 3LIJA 4QP4A 2NNWB 1GZOA 4GG7A 4BCPA 4TWPA 3DDQA 3ORIA 3UC4A 2W96B 1RDQE 3G5DA 4A9RA 3H3CA 5KMNA 3DBDA 1BL6A 3UNJA 2W0JA 2C6MA 3HX4A 2ONLC 1UU9A 3RK7A 3EFLA 4I6FA 3O71A 3ZXTA 2VWXA 2XRWA 2JAMA 1SVEA 3ORNA 5G1XA 3SGCA 4EZ7A 4BCGA 4XYFA 3F66A 3QLGA 4EKKA 5CAUA 3KULA 3PSCA 3VHEA 4DG0E 4KRCA 4OBPA 4TYIA 2JDRA 2J51A 3P4KA 3PY1A 3QUDA 4HVHA 3QL8A 4MXYA 4CG9A 2PVKA 3QD2B 2UZVA 5J95A 4E5BA 1L3RE 2HW7A 3QKLA 1YHSA 3QTRA 3BYUA 5DRDA 3NNWA 2YHVA 4P5ZA 3DBCA 2J50A 4RA5A 4D1SA 2JD5A 4F63A 2RF9A 5IG1A 3UYSA 3FV8A 5CI6A 5HORA 4J8MA 4FZ7A 4GYGA 4KSPA 4Z7HA 4HYUA 3I6WA 5KHWA 3D7TB 1PXOA 1E9HA 3Q9YA 4LRKA 3NAXA 2YZAA 4UWBA 5HD7A 3TZ9A 2VTQA 4U3YA 4FTUA 3KGAA 3PJ2A 4C38A 3E92A 1DS5A 2GHMA 4PDYA 2YAKA 2Z7QA 3OW3A 3PXFA 3IKAA 3IO7A 3FZTA 5KKRC 3BGZA 1GIJA 2IVVA 4ZTQA 4FG7A 1OKWA 4H1JA 5DFPA 3EB0A 1ZZLA 3QHWA 4A07A 3PJ3A 3WILA 4FTJA 2P2IA 4HVIA 3LFEA 3W10A 5DVRA 3FXWA 3HV5A 4E4LA 4F1OA 3EH9A 3ROYA 1OL2A 4RMZA 4M7IA 4DTBA 2IWIA 4L3PA 5C27A 2LGCA 3D5UA 3VNTA 5ITAA 3QQLA 2C0TA 2HZIA 4D1ZA 2YWVA 1JSUA 1J3HA 2F57A 3V6SA 4GUBA 1KOAA 4FTKA 4BDCA 4KRDA 3ZLSA 3UIUA 2PVFA 4U79A 2XS0A 3AG9A 3DXNA 3E3PA 3A61A 2QODA 3HLLA 4G3CA 3MH0A 2R64A 4KA3A 1F3MC 5HO6A 3ZO4A 5GJDA 4FTOA 4F1MA 4TNDA 5DG5A 5IMXA 3TIZA 4IEBA 3WE8A 5DOSA 2RFEA 3DFAA 4EOQA 2B55A 4FSMA 4ZTNA 3CLYA 2BALA 1UA2A 5CSHA 4V0GB 2CKQA 3B2WA 4A9SA 4CKIA 3BHTA 3VUGA 4YJRA 2VUWA 4HCVA 3PIZA 5IKWA 4AZVA 2BZIB 5H3QA 5D1JA 4O21A 5EQEA 3QWJA 3RAIA 4IWDA 4DFBA 4PDPA 2WMSA 4U41A 4R1VA 2GU8A 4QRCA 1CTPE 4P2KA 2XNMA 3L8SA 4CTBA 3SX9A 5K5NA 2YITA 4BN1A 4EKLA 2FO0A 1J1CA 2XEZA 4EH2A 2J0IA 4I6HA 3TV6A 3R30A 2IZSA 4CD0A 4YR8A 2BDJA 3DQWA 4H05A 5DGZA 3BHUA 2OIQA 1U59A 5CU2A 3TJCA 3VS3A 4D9UA 4OTPA 5EHYA 3CJFA 2Z7SA 1GY3A 2VGOA 2ZB0A 2ESMA 2UW4A 1LUFA 2I0VA 4L42A 2XK4A 5E92A 4J71A 1PW2A 3SA0A 2VTAA 2R3IA 3QRJA 4XG9A 3B2TA 5DBXA 1Q8YA 3V8SA 3ZUTA 3ZLWA 4M97A 3TJDA 1SMHA 3ORZA 4UN0C 2VO6A 3UQCA 2W5HA 4KIKA 5AAFA 3S2PA 3SG9A 4K33A 2GHLA 3Q04A 2UZLA 1RE8A 3QTXA 3QWKA 2A1AB 4NKAA 2QLUA 4O96A 4MBLA 5AX9A 2PSQA 4UXLA 3V01A 4EYJA 3AMAA 5GIOE 2GNGA 4JQ7A 4NTSA 3FDNA 4R1YA 4B7TA 5LOHA 3I0QA 4ORKA 3QKMA 4WG4A 2JIIA 5AP1A 2YIWA 5L2TA 3NVKI 5HTIA 5C03A 2UW6A 4CMUA 4KD1A 4LRMA 1V0BA 4YJVA 2IN6A 3EN7A 4IAIA 1ZXEA 3NPCA 4BI1A 4QOXA 3MDYA 2X7GA 2IW8A 4P90A 2QURA 1KE9A 3ITZA 3M11A 4N6ZA 4NIFB 2BTSA 4M69B 4QMQA 3UZRA 4AW0A 3L9NA 4O82A 4OAUC 1CKJA 4I5CA 5JEBA 2XYNA 3SQQA 4D2SA 5CASA 2ZMCA 3COHA 4XJ0A 4GFMA 3CQWA 3EN4A 4FTQA 4XV2A 4O83A 2PTKA 4H58A 3NYOA 4RVKA 4B8MA 2JDOA 4YZMA 3FEGA 4IVBA 2O63A 2R4BA 1H1RA 3FZOA 2VGPA 1BYGA 4FTAA 3TKIA 5D7VA 4HGLA 2YIYA 4O7RA 2DYLA 2WTVA 3F69A 3SW4A 2BRBA 4E5WA 1H01A 3OZ6A 4R3RA 4NTTA 4FVRA 3BGQA 4QP1A 3P79A 3R28A 4C3PA 1GZKA 3PPZA 3KMUA 5CAPA 3II5A 4IAKA 3CC6A 3HAVA 3RALA 2VTOA 3FC2A 5B0XA 4K6ZA 1FVTA 3HMNA 3BQRA 4FEVA 1OI9A 1OL5A 4WUNA 3ZS5A 2QO2A 4JG8A 4F09A 4YJPA 3W2RA 4X2NA 4AUAA 4L52A 3A4OX 5FXRA 3EZVA 4OGRA 5IA5A 4CGAA 4CEGA 5IH6A 4YZNA 1NVSA 1XWSA 1Y8GA 4GEOA 3LOKA 4X21A 5L2SA 4FG8A 5DN3A 4PV0A 4BCJA 2Y4PA 3BYVA 4PL3A 3UOJA 2B9JA 3ZXZA 1BX6A 2BRNA 1QPCA 3C5UA 3OF0A 3KK9A 4JIKA 4U97A 4BGQA 3PRIA 4EORA 4J95A 4APCA 4QNYA 2HCKA 3PE2A 1QPDA 1BI8A 4KKEA 1K9AA 4AZFA 4FEWA 1YI6A 4FT3A 4GKHA 3QTWA 3NR9A 3U4WA 3IW7A 4FZAB 3L8VA 3ANRA 3ENMA 3QQGA 4U6RA 4WSQA 2QD9A 4UY9A 2F7ZE 5JT2A 1M14A 2BUJA 4IB3A 3OEZA 4FOBA 5I5ZA 4D58A 3E3BX 4MKCA 4TT7A 2DS1A 3QC9A 3NLBA 3VBWA 5DA3A 1M2QA 3BPRA 3Q96A 5HCYA 2FSTX 1Y6AA 4FYOA 2HY81 5AR4A 3UOKA 5F9EA 4FODA 4V05A 3QCSA 3RJCA 4I0RA 1H27A 2XH5A 3JS2A 4FT7A 5HI2A 4UYNA 1F0QA 3E88A 4ACDA 4E6QA 2PE2A 3R21A 4YJUA 1H07A 2BRMA 2C4GA 2JDTA 5L2WA 2PUPA 2XCKA 5B2KA 2JKOA 2GS6A 4U42A 4XV3A 3FJQE 4EHVA 3OWLA 4N70A 3KY2A 4HZSA 4NJ3A 3DZQA 4BTFA 5LVOA 2ITTA 3EIDA 4A4XA 5I9ZA 4JDHA 1J1BA 4RIXA 2QOCA 2QR8A 3AOXA 3WF8A 5IF1A 2BFXA 3UIXA 4IAAA 2QOFA 3BV3A 4ITHA 1XJDA 4IZ7A 4I93A 4O91A 1GZNA 1H08A 3GCQA 5CSVA 3WF6A 1YXXA 1OBGA 3MIYA 1KSWA 4OTFA 4IZ5A 4LYNA 3R1SA 5ANGA 4W8DA 4IADA 5E91A 2PU8A 3NCZA 5IISA 5EI8A 1WBTA 2XMYA 4JDIA 4FBXA 4RZVA 3NNVA 4RJ3A 5LQFA 2H96A 4DT9A 4S34A 3C4FA 3C9WA 3RMFA 4MNFA 4HVDA 4AXAA 5HG7A 3VS0A 1OIYA 4GFOA 2WMXA 4YURA 5A4TA 2QOQA 2WMUA 4MAOA 3ZHPC 5J9ZA 3OP5A 5LWMA 1Q8TA 5G6VA 3Q5IA 3ZDIA 3ZZEA 4BBMA 4DGLC 1G8AA 3TDWA 4DLJA 3A7IA 3WE4A 3WBLA 2XK6A 3OD6X 3PP0A 3DB8A 5J9LA 3DBFA 4XG2A 3V3VA 1Q97A 2OLCA 4J98A 5CEKA 2PVMA 3VBQA 4NWMA 3ZFMA 3FYJX 4DGOA 1XH6A 4FSYA 3D2KA 1Q5KA 3VUMA 5C26A 5LCJA 1LR4A 3HMIA 4FSTA 4JRVA 3BIZA 5AV2A 5C01A 4GKIA 4YZ9A 5D7AA 4RC4A 1PXJA 5KBQA 3RBWA 1PXIA 3E63A 2OF4A 3FL5A 4WO5A 4P4CA 3FHIA 4F0FA 2WQMA 2R2PA 4MXZA 3WZDA 1DI9A 4FA2A 5BVNA 3AC5A 2XM8A 1JKTA 3U6JA 4YBJA 4FKVA 2ZB1A 1ND4A 4QQ5A 3MWUA 5AV0A 2Y9QA 5E1EA 2C0OA 3BBWA 5BUJA 3W2CA 5HTBA 2QU5A 4ANLA 3W2SA 5L8LA 1UKHA 4B99A 3GCVA 5BUIA 4AE6A 4FTLA 3UP7A 3LQ3A 4IAFA 5CXHA 2YM8A 3MGYA 3RAWA 3OXZA 5JGDA 1WBVA 3AT4A 3F5UA 4O0XA 4O6EA 4ZJJA 4FL2A 4HW7A 4ZZNA 4O1OA 1SM2A 2HIWA 4RFYA 3QYZA 4G1WA 5F4NA 3E8DA 5JK3A 4KIKB 3L8PA 2QKWB 5CANA 4DH8A 3QGWA 1PYXA 3D0EA 4RIWB 5KMMA 4TZRA 4GYIA 3QZIA 2V7OA 2HW6A 4D2PA 2WTKB 4EK3A 4QMTA 2O8YA 3EMGA 5JRSA 3OY1A 4KIQA 3ZRMA 4BRXA 4MYGA 4QQJA 5CQUA 4FL1A 5EKNA 1FOTA 4RZWA 2UV2A 4Y95A 1Y6BA 1OVEA 4IQ6A 4GH2A 4ASDA 2XYUA 3QQJA 4BR3A 4RWIA 4Z7GA 1R78A 3T9TA 4O0RA 4A06A 3RKBA 4ANNA 4U5JA 4II5A 4EL9A 1OITA 4Z9LA 1PMUA 5HO7A 4H3BA 2RKUA 3HV6A 3H0YA 3GI3A 2IZTA 4IX3A 4RJ8A 4R7BA 2YM4A 2OU7A 3ORPA 3VC4A 1HOWA 3MSSA 1IEPA 4KABA 4WUAA 4CSVA 3RAKA 5IQAA 2YM3A 3KRLA 1APME 4Q5HA 2XCHA 3NW6A 3GOPA 3MVJA 3R8PA 1XH5A 4RIYA 1GIHA 3COIA 4RBLA 4BCKA 4BVUA 4V04A 3JY0A 5F95A 4GT4A 1GIIA 2EB3A 2Y0AA 3DAJA 5LJJA 2QO9A 3R6XA 3D7ZA 5CNOA 4ZXTA 3WIKA 4XG6A 3HZTA 3ORTA 4FKUA 4ANSA 5CAOA 2Z7RA 3GU6A 3ORMA 3VO3A 3KVXA 4F70A 3W2QA 4IVDA 4W4YA 3E5AA 3ET7A 4O0TA 3PXYA 4JAIA 1YQJA 2ETKA 4PRJA 1YRPA 2ZYBA 5E8ZA 5AP2A 1GZ8A 1SNXA 3V5JA 3ZFXA 3V6RA 3PVUA 4CRLA 4AACA 3C13A 3R63A 4FE2A 4IX5A 4FKQA 3MBLA 4IZYA 2ZAZA 3A60A 4L9IA 3R04A 4IX6A 4XP0A 3R8VA 5HLPA 4R8QA 3P9JA 5AUYA 2YCSA 5HTCA 1XBBA 5DR9A 4ZJIA 1R39A 3BLHA 2YAAA 3QX2A 2O2UA 3GU7A 3ZC6A 1ZAOA 3TUBA 4F7SA 3NEWA 3QQFA 1MRVA 2UZUE 3MY0A 4O6LA 3GEQA 4AWIA 4JLCA 3WYXA 4GJ2A 4DGNA 3F5XA 3KRJA 5E8TA 5HGIA 5KMIA 1EH4A 5JGAA 1ZMVA 3EQRA 3NMUF 4G16A 1OKYA 4ARKA 3VS7A 2R3PA 4ZTMA 5GIPE 2W1EA 2BIKB 3UDBA 4WD5A 2A19B 5E90A 3BBTB 4RG0A 2YABA 4FV0A 3WOWA 4I4EA 1UVRA 5BYYA 1XQZA 2EB2A 3EQFA 4ZS0A 4O86A 3ZMMA 1J91A
chains in the Genus database with same CATH superfamily
4YO6A 2UVXA 1JKKA 2A4LA 2FH9A 4TTHB 2QOBA 4KB8A 5CY3A 5EM8A 5HNGA 4BTMA 2V0DA 2J7TA 2UZDA 5DT0A 3NW5A 4UALA 4DAWA 4QP6A 4JRNA 4WG5A 5E7RA 4ASEA 3KXXA 4QMOA 1U4DA 4E4NA 3QZFA 5J79A 1KOBA 3WZEA 3R7VA 2ITNA 5K4IA 2XIZA 3KEXA 5HO8A 3FMLA 1QL6A 4LMUA 2VX1A 5L6OA 1A06A 3DLZA 5EKOA 3HV7A 1CSNA 4D55A 3NUXA 3MJ2A 5A3XA 1ZOHA 2R3RA 3RCJA 1S9IA 3VWAA 1SVHA 4EOOA 5L3AA 5E8UA 3POZA 4FV5A 5HX8A 3OEFX 1LEWA 3VUIA 3KK8A 3VBTA 3QQHA 4RVTA 5K4JA 2BCJA 4ZTSA 2WEIA 4EH7A 3ODYX 2C3LA 3AD6A 2PZIA 4PDSA 4NFNA 5AA9A 1H0VA 1H0WA 4PNIA 4IWPA 2QOLA 3DK7A 3QXPA 4F6SA 2IZRA 3G6HA 3BWJA 4FUXA 2BFYA 3OROA 3R2BA 3G33A 2X4ZA 4XV1A 2VU3A 4E8AA 1U54A 3MH2A 3VS5A 3PZEA 2HAKA 2B9IA 3DGKA 3F3VA 2X81A 3QCXA 4Z16A 4H1MA 4TNBA 4O2PA 5EI6A 1ZMWA 1PRYA 4QMZA 2V5QA 3P7BA 3SOAA 5A6OA 5IEYA 2ZV9A 3GU4A 3MB7A 4RX9A 4V01A 3U4UA 2WFYA 1JKLA 4WG3A 3UE4A 4EH9A 2GMXA 3QX4A 3PUFC 3EQDA 4NUSA 5M4CA 4AT4A 4GG5A 1AD5A 4BDGA 3JPVA 4XG8A 3QAME 3C51A 4HPTE 5CU0A 2H8HA 4C57A 4DEBA 2ETRA 4AAAA 2A0CX 3EQBA 2X9FA 4J1RA 4IJ9A 4IM3A 5CEQA 3FSKA 4EYMA 1ZYSA 4ERKA 3IW5A 4DFLA 4QMVA 3UVQA 5CXZA 3M42A 4IE9A 4O4BB 4QQCA 4EBVA 3R8MA 3HUBA 4GRBA 3V04A 3NUSA 3C4ZA 4LUEA 4IFCA 4DEDA 2VTRA 3PA4A 2UVYA 3UO6A 4G6OA 2WGJA 2Y8OA 3QC4A 2CPKE 1H1SA 3HDMA 2C47A 3TN8A 3F3ZA 5EOLA 5FM2A 3B8QA 2O3PA 5J8IA 4D2TA 3SVVA 2WTDA 3QTIA 2VWZA 4R5YA 2OXXA 4MK0A 4KKGA 2VTTA 3PG1A 1L8TA 2GHGA 3HV4A 3KKVA 5FWKK 2H9VA 3AT2A 5GJFA 3CQUA 1Q3WA 1WMKA 3G6GA 4UZHA 2OIDA 3PP1A 5AR5A 5HD4A 4F6UA 4ZMFA 1OGYA 2J0MB 2VD5A 1H1PA 4FOCA 5J5SA 3MESA 2WELA 4APPA 3DOGA 5ANEA 3V5WA 4CG8A 2OBJA 1VYWA 4F6WA 4L43A 3BLAA 4O7LA 4WNKA 4PF4A 2IF8A 4S31A 1JOWB 2X2MA 2V62A 3ZU7A 1PXPA 5A4QA 5JZNA 2RL5A 3FLNC 1REKA 3E8CA 4WSYA 5ICPA 4C37A 3AMYA 3DKGA 4Q9SA 3ANQA 1ZY5A 2R3KA 4C2WA 1URWA 5L8KA 3CPBA 2WTJA 3BHYA 2BILB 4C4IA 2BKKA 2FGIA 3PVBA 4U0IA 2R0IA 4FV1A 3SRVA 4AOTA 3ZM4A 5HOAA 1B38A 2VTIA 3I1AA 3R1QA 4PL5A 4YC6A 4DBNA 5EHOA 3R7EA 3EHAA 3GCUA 4RSSA 3OWPA 3UGCA 3QFVA 4PNKA 2G15A 2PMOX 4NM0A 4DFZE 5LVMA 4QYYA 2R0UA 3G90X 3IPHA 4W4VA 4RWKA 3PFQA 2AYPA 3F6XA 4JMQA 2QI8A 4HGEA 2GCDA 4KAOA 3LXNA 5IEVA 4JJRA 3DXPA 2QO7A 3DK6A 3FLQA 4BGGA 5I9UA 4MNEB 5ETAA 3QQUA 3ORLA 3FZPA 4JR7A 4PMPA 2X1NA 3QLFA 2ITOA 2R5TA 3LFFA 4FG9A 3VULA 3UO5A 4K9YA 3BYSA 5FTOA 4FEQA 3NS9A 1WZYA 2C1AA 4PX6A 2GSFA 4MQ1A 3WARA 3DNEA 2XAMA 4O7YA 1OIUA 1ZYCA 3EQPA 4UX9A 4FVPA 4KWPA 2W5AA 3GVUA 4ERWA 2QONA 2QR7A 1G8SA 2W17A 1VYZA 4AGCA 4BDIA 4IWQA 4EEVA 3R2YA 4GVJA 4EK5A 5I9WA 1OKVA 4QYGA 3KRRA 3OTVA 5CYIA 3BE2A 4C36A 5AAEA 4ZTLA 3TZ8A 2GQSA 4TWCA 3QRIA 4AZEA 4EOJA 3FSFA 3GBZA 2R3QA 4MF0A 4DHJA 5K0XA 3RM7A 4IVCA 5E8WA 5EQPA 3UIMA 3P86A 2R7IA 4RT7A 3BU3A 4DH5A 3NUPA 3MS9A 4F9AA 4Q5EA 4S32A 2C5OA 2WIHA 3UC3A 1PY5A 1O9UA 2IZUA 4AN3A 3OCSA 2ZM4A 4D0WA 2XA4A 2C6IA 2QCSA 1XH8A 2ZV7A 3DV3A 4LV7A 2WTKC 3LJ2A 4IJPA 5EH0A 3U6HA 3BU6A 4RC3A 4OW8A 3NUAA 1JKSA 2ZDUA 3E93A 1H4LA 3PYYA 4FV6A 3I5NA 4NFMA 5D11A 4LL0A 4BYIA 4FKTA 5CF8A 5E8SA 4O84A 3QXOA 4FNZA 3EL7A 4A9TA 2HWOA 4WKQA 2OI4X 5AFVA 5AR8A 5EDPA 4BWPA 4GVAA 5I9YA 3GC7A 2PZRA 2UW5A 2YIRA 4LMNA 5TR6A 4ZLYA 1JVPP 3LM5A 2PUNA 4HCUA 4LGDA 2GS7A 1PYEA 4QT1A 4MD9E 4O22A 2Z02A 5HICA 5M55A 3W1FA 5LMKC 1YDTE 1YHWA 5FTGA 1YOJA 4FKLA 4G5PA 4I24A 4KBAA 4RLLA 5LVNA 3SG8A 5DWRA 3LXKA 5IDPA 3UDTA 3CPCA 3JR1A 4YPDA 3E64A 1PMNA 3R1NA 4E20A 2VAGA 5C8KA 3CGFA 1FPUA 4RX7A 2JKMA 3VAPA 5FEDA 5B7VA 4IIRA 1DAYA 4BKZA 4BZDA 3MIAA 3Q2JA 1X8BA 2PK9A 3W16A 3DT1A 1B39A 2R3LA 3LFAA 5HE1A 2I0EA 4PY1A 4ZMEA 3K54A 3P1AA 3UMWA 4QP2A 4BHZA 4HNIA 5EYMA 3WF5A 4X3FB 2ACXA 4FKSA 4FKWA 4BIDA 3OUNB 2X7FA 3LM0A 4GS6A 4WT6A 4DBXA 2W1DA 4E5AX 4L01A 1YOMA 4MD7E 2HOGA 2VZ6A 4X6QC 4F9WA 4BDDA 5CSPA 5HX6A 3RZBA 4UMRA 2P4IA 1XMLA 5TF9A 3AC4A 3C0IA 3FQSA 4Y85A 4D2WA 2XF0A 4EH5A 4F65A 2WMRA 4BB4A 3GQLA 4JX7A 4QMMA 4DH3A 5C4KA 4K11A 2NPQA 4FTTA 3QYWA 4FKPA 4GK4A 5GJGA 2B7AA 3R9RA 3PJ1A 4NT4A 4ZEGA 4FKOA 4QMSA 4EQUA 3EFJA 3ERKA 5IQHA 4NEUA 4CFXA 4BY9E 1SNUA 2C5XA 4GIIA 3HGKA 3KFAA 3MVLA 2XIXA 4CCBA 4MXXA 3CKWA 3O8UA 4CYJA 2X8DA 5HHWA 5L2IA 2B0QA 4FSZA 3WYYA 4QTCA 1WBNA 2YIQA 1Q61A 3OS3A 4FKIA 2CLQA 4DH1A 4WNOA 2BVAA 3QTSA 4AA0A 5HZNA 3PPKA 3FI8A 4R77A 4JS8A 3SKCA 3HYHA 4IM0A 3UMXA 3BLQA 3QQKA 3ZCLA 1H1WA 2VTLA 4BKYA 3FKLA 3K2LA 4I5MA 4F9BA 2ITPA 4PP7A 4O7NA 4FICA 1QCFA 4XCUA 4O1PA 4NH1A 5LWNA 4C58A 2PUIA 4HJOA 4I6BA 5H8GA 2VX3A 4L8MA 3C0GA 4RFMA 4UWYA 2ONLA 4YJTA 4AQKA 5JFXA 5DH3A 5DE2A 4OTRA 4F4PA 2XKFA 5HVKA 2R3MA 3RP9A 2XKEA 4CFVA 4OTWA 4OTDA 1OPKA 3DJ5A 1VLRA 5M51A 2WQBA 1ZOGA 2CN8A 3FAAA 3NYXA 3UG1A 3ZUVA 3UQGA 5LMBA 3AC3A 5K0KA 4XMOA 4C8BA 4HGTA 2E9PA 4AZSA 5CVFA 3MFSA 3LJ1A 4YNOA 4W9WA 4IB5A 4TPTA 1OZ1A 3G9LX 5HG9A 3ZO1A 3TM0A 5EDRA 3V5PA 2BPMA 5KMJA 2OJJA 4XG4A 2RGPA 3KXZA 2WPAA 4QQTA 5EW9A 3VBYA 4IFGA 1H24A 5E8XA 3TACA 5M08A 4PP9A 2C5NA 1PF8A 2HZ0A 4ZSJA 1FVVA 4YP8A 5ANKA 3O96A 3H30A 2EXEA 4MD8E 3HNGA 1DAWA 1XBAA 4XS2A 4IH8A 3RPRA 2QHNA 2FB8A 4FTCA 5M44A 1OBDA 3RHXA 3UJGA 2XRUA 3W0RA 4PPAA 5AP3A 4BDJA 5A4CA 3UNKA 3RCDA 1BLXA 3HV3A 3OT3A 1H28A 4FV9A 4EI4A 5KO1A 5FP6A 4QD6A 3S95A 3R00A 3VUHA 4FTRA 1H26A 1P2AA 4CFFA 5BX0A 3PFYA 3PWYA 3QRKA 2VV9A 3CY2A 4BHNA 2UW0A 4Y83A 3VRYA 3LFNA 4UXQA 4ZJVA 4X3JA 3UBDA 4Y72A 1U46A 5HU3A 3RNYA 1NW1A 3F5PA 4CV9A 3R02A 4ZSGA 3A7FA 3G0EA 3DZOA 4R7HA 3DJ6A 1YDRE 3DNDA 4GFGA 1OB3A 4OT6A 2YEXA 4FIJA 4QP3A 4I20A 5DHJA 5HVJA 3GU8A 4IC7A 3R0TA 4CLJA 4PWNA 1JSTA 3EFKA 4HVSA 4XG3A 5IA4A 4AW5A 4DHFA 4MVFA 3LHJA 2HZNA 5JGBA 1ERKA 5FXQA 4YHTA 2X0PA 4O4FA 2WTIA 1XH7A 3LXPA 2IW9A 3TNQB 2XALA 2PE1A 2Z7LA 3JY9A 4I23A 4XRJA 5HCXA 3KULB 1WBOA 2EWAA 4FSQA 1HCLA 3BKBA 3MYGA 3IG7A 2F9GA 4DHZA 3W32A 4CT2A 3BELA 4B9DA 1ZYDA 5GZAA 2JKQA 1ZYLA 3TKUA 4MQ2A 4DEGA 3HRCA 5AR3A 4EOIA 5IH5A 4QMLA 5EOBA 5LVLA 4LM5A 4QMYA 1O6KA 3A62A 4EK8A 4ANBA 2IG7A 1T46A 5AP7A 5FDPA 5BVEA 2F7XE 5HE0A 1Q8WA 3CP9A 4EHGA 4RVLA 3MTLA 5F20A 4I5PA 4XV9A 3QZHA 2VTJA 5IPJA 3FMNA 3ZBXA 2EXMA 4IB1A 1SYKA 1KE8A 5EFQA 5L2QA 4RWLA 3UOHA 4M0YA 1OMWA 3NW7A 3SAYA 3VJOA 3O51A 4DFYA 2E9OA 3OOGA 3U55A 5HIBA 3R8LA 1UNGA 4TYHA 2Z8CA 4UB7A 5AP5A 4AQCA 5AV3A 4EC9A 2R3FA 4TY1A 1A48A 4IAYA 2YWPA 3OOMA 1K2PA 3DU8A 4K2RA 1W83A 5JSMA 3UIBA 2PZ5A 2IVTA 4X2FA 5KCVA 4OBOA 2WMQA 1OKZA 4FV4A 3NVMB 1JLUE 3QALE 4WNPA 3PDTA 4JQEA 5DMZA 4U44A 1Z9XA 3ZLYA 2CGWA 4UMPA 4BGHA 5BVFA 5BQ0A 2BROA 3O2MA 3MA3A 5CF5A 3DTWA 4NM5A 3OVVA 4L68A 4EUUA 3N51A 2OSCA 5BVKA 5EK7A 4F7NA 1O6YA 4BC6A 2JDVA 4DC2A 4TKSA 4O0YA 1M17A 3AGMA 3HP5A 4TWNA 4E3CA 4ZAUA 4ID7A 4AN9A 4LGGA 3H4JA 3NUNA 4FL3A 4M66A 4XX9A 3LPBA 3VQHA 4XG7A 5C4LA 1UWHA 4L00A 4XOZA 4ZOGA 2R3GA 5K9IA 2W1FA 2YERA 3N9XA 2NP8A 5HE3A 1LPUA 4TYEA 3R8UA 3TG1A 4E93A 5KZ0A 5EYCA 3EZRA 1TFFA 4WBOA 4ZSEA 2WZJA 3R83A 3UPXA 3IW4A 3JXWA 4C59A 1JWHA 4ZY5A 1E1VA 2DUVA 3OCGA 2DQ7X 3EN6A 4FZDB 4G3FA 3OXTA 4DEAA 2JLDA 3O23A 1JBPE 2UUEA 2XBAA 4JI9A 2QOKA 2CGUA 1OL1A 2XNPA 2HWPA 3PG3A 4EOKA 3F9NA 5BYLA 2EU9A 2XNNA 4ZP5A 4RC2A 2GQGA 4A9YA 4G9RA 4H3PA 3BGPA 2UZWE 2W1HA 5KNJA 2VTMA 4N6YA 3R9OA 2PMIA 3QKKA 5M4UA 4PDOA 4O0VA 3PZHA 3KN6A 2OJIA 4F99A 3ALOA 4C62A 4XP3A 2X39A 4RJ6A 4XH6A 5LVPA 4ASZA 4A4LA 4AA5A 3LCDA 3OW4A 5AIRA 3AXWA 2UZOA 3P5JC 4ITIA 4XP2A 5LARA 4C02A 3FLZA 4BWKA 3EL8A 4RVMA 3DS6A 4BCIA 2PVYA 2X7OA 4Y46A 3DBQA 5D10A 2OZAA 3Q60A 4AE9A 5BNJA 4HOKA 1FINA 4DG2E 4O0WA 5HG5A 5FG8A 3PLAE 2G2HA 4DT8A 2SRCA 3U9CA 3FQHA 2CKPA 4DDIA 3EQGA 4UMQA 3SDJA 2UW9A 1KUTA 2QVSE 3LQ5A 3SLSA 3G15A 4CTCA 1BL7A 3UQFA 1W98A 5AA8A 5ETFA 3DDPA 3R8ZA 2XIKA 3NIEA 2ITWA 3W8QA 3OMVA 4FZ6A 3W2OA 5ANDA 5GZ8A 4IM2A 3I7CA 4XBRA 2JBOA 5LCKA 1URCA 3D15A 4E26A 4X3FC 2WOUA 5IUGA 1BKXA 4YJQA 2RIOA 4CNHA 3KCKA 3NNUA 3Q4CA 4DEEA 3BYMA 4EOLA 3LMGA 5ANIA 2W4OA 2XBJA 3TV4A 1Q41A 4L44A 4M67A 4H3QA 5J1WA 3FY2A 2YIXA 2YA9A 4GL9A 4D5HA 2YM6A 3BEAA 5CAVA 3K5UA 2PVRA 3F2NA 4R5SA 1WCCA 5IU2A 3M2WA 1QMZA 5DEYA 2XEYA 2C69A 3M1SA 3Q9ZA 2YLFA 4PL4A 5CT0A 3Q2MA 5KMLA 1GOLA 3AQVA 3RK5A 3T9IA 4FR4A 3KN5A 1R0PA 3QD0A 3FMKA 2KULA 3GNIB 3W55A 1YOLA 4FI1A 3MTFA 4LRJA 4JVGA 4DF3A 4QYHA 4D0XA 2YACA 3KXGA 5AUXA 3SHEA 3P78A 3V8WA 5J9YA 2WQNA 1NXKA 2P33A 4N57A 5D12A 3T3VA 2CKEA 3GU5A 4DGGA 5AR2A 2FYSA 4DHIB 3A8XA 4N4SA 3VONA 1Q99A 4IANA 5IQCA 4XOYA 2OJFE 4LOOA 2X6DA 4U9AA 2YCRA 1XKKA 2PL0A 3LZBA 3THBA 5M56A 2BHEA 3U9NA 1E1XA 4ANMA 3VN9A 2BRGA 5HEZA 2OO8X 2CDZA 1R1WA 4JG6A 2HY0A 3MJ1A 2XVDA 3V8TA 4QTDA 4EC8A 4TL0A 4RX5A 2VWWA 5M09A 5HG8A 4QMPA 3BU5A 3Q4TA 4FK6A 3P7AA 3MH3A 4I1ZA 3RINA 1ZMUA 4I0SA 5A4LA 2Z60A 4R3PA 5CLPA 3G2FA 5AUZA 1NA7A 3BI6A 2VRXA 5ACBC 3LJ0A 4FKJA 4NCTC 4W4WA 5FBNC 5D9HA 3A7JA 1OL7A 4RPVA 3KRWA 5FUTA 4AP7A 1O6LA 4CVAA 4XBUA 1M2RA 3H0ZA 1OUYA 3OWKA 4J52A 4MXCA 3UDSA 1H25A 4GU6A 2VO3A 3AC1A 5AADA 4I41A 4AF3A 1BMKA 2I6LA 2W4KA 3BCEA 4CV8A 5J5TA 3K3JA 4YNEA 1OPLA 3QTZA 4NM7A 3FI4A 3Q9XA 2HENA 4JAJA 4W4XA 3VW8A 3MH1A 4EHZA 2UVZA 5H8BA 2C3IB 5HNBA 5HNIX 2XAOA 4QMXA 4BCOA 3DKFA 3Q32A 4C7TA 2PMNX 2UZTA 3KCFA 5TO8A 2CNUA 4O0SA 2C0IA 4FMQA 5CU6A 1NT2A 3D7TA 4D2VA 3BQCA 2GNIA 1PHKA 2EVAA 2J4ZA 4YHFA 4MXOA 1OGUA 5AEPA 2GNJA 3PSDA 5L4QA 4RIXB 4GCJA 3FXZA 2C30A 4BIEA 4DDGA 3ZDUA 3CSVA 2WQOA 3O7LD 2CGVA 4BL1A 3QA0A 4KBCA 4WBBB 3PWDA 4QYFA 2BAKA 5FGKA 3N4VA 3F88A 1ZYJA 3QUEA 4XHKB 5DEWA 3T3UA 4YTFA 4RJ4A 4TYHB 3HA8A 4MWIA 3RM6A 3U6IA 4M14A 3ZSGA 3TEIA 2Q0NA 3WZKA 3TZMA 5JRQA 3DAEA 3O7LB 3KF4A 2B4SB 3NAYA 2A98A 4MBIA 3R9HA 3TTJA 5BVWA 3DTCA 5AUVA 2JBPA 2XIYA 3VQUA 4CFNA 2XIRA 2XNEA 4FT0A 4BFMA 3KU2A 4IACA 4I92A 2JFMA 2RFSA 3ORKA 3Q3BA 4O7WA 5CS6A 5AUWA 1W84A 2J5FA 3GCPA 3UVPA 4Y5QA 3C0HA 4JIAA 5FEQA 3EOCA 4V0GA 2ITQA 3CY3A 2C3JA 3H10A 4GMYA 4YLKA 4BKJA 5IA2A 5CX9A 2GFCA 4G3EA 4UMTA 5C8MA 5CEOA 3ML1A 1Q24A 4TYJA 4YJOA 5CWZA 4AW1A 2QOHA 2GS2A 3C7QA 4AZWA 4C0TA 4BI0A 4HCTA 4ACCA 4U45A 3BHVA 2EXCX 4FKGA 1AQ1A 2R3HA 3GT8A 3P5KA 4FNWA 2IJMA 1WFCA 5LXMA 5IQEA 4YTIA 4ZLZA 3NYVA 3Q4UA 2WMTA 4ACGA 3W0SA 3ZTXA 5M57A 3TUCA 4I6LA 4ZIMA 3FZRA 2F4JA 3AMBA 3VBVA 4F0GA 4PMSA 2WB8A 4QTAA 3U51A 4NU1A 2J2IB 3OC1A 4I3ZA 4YC3A 1MRUA 5AUUA 3DCVA 4E1ZA 2WD1A 3A7HA 5J87A 4EK6A 4L45A 5CF6A 5KMOA 3QBNA 3MPTA 2GQRA 3NX8A 2UW7A 4ALVA 4E73A 3RPYA 2JKKA 3FKNA 2XP2A 3PXRA 3TXOA 4EOPA 5ETCA 4CT1A 3OXIA 1Q8ZA 3IOKA 4J97A 4QMUA 4PPCA 5A46A 3I79A 4AXFA 4LV8A 3CEKA 4CZYB 4BF2A 3UG2A 4EH6A 2CHLA 4GSBA 3VS2A 2OWBA 3AGLA 2OZAB 2VO7A 3ELJA 5JFSA 5HIDA 3TZ7A 2IW6A 1ST0A 2CGXA 4LFIA 3DAKA 3ATSA 5DR6A 2WU6A 3C1XA 2JFLA 3R7OA 2G2IA 4IBMA 4LUDA 3F82A 4M69A 4C34A 4ACHA 3IQ7A 5JZJA 4I0TA 4WRSA 1Q62A 2C5VA 4AU8A 4BDHA 3TNIA 4NL0A 1G5SA 5CVGA 3RTPA 1LP4A 3D5XA 3HMOA 4C61A 2H34A 5FEEA 3QRUA 4ZK5A 4BI2A 5I9VA 1XH9A 3VBXA 3UZPA 3PA5A 3UYTA 4EJNA 4FSUA 2QNJA 3CJGA 5IQIA 2UZEA 3GXLA 4RJ5A 1G8JA 4YTHA 3N4UA 2IO6A 4CFUA 1MQ4A 2VTSA 4BTJA 3ZC5A 1P14A 3PVWA 2OK1A 2GNHA 5HCZA 4RIYB 3DFCB 2R3JA 3LLAA 3KC3A 2OIBA 4OR5A 4R3CA 3WZJA 4K0YA 1YXUA 3VUKA 4QPAA 3V5LA 2GPHA 4IHPA 4RQKA 3O5AA 4KKHA 3UDZA 1K3AA 5JQ5A 1BI7A 4H36A 5AX3A 3PXKA 3VUDA 5KMKA 3RPVA 5A9UA 4E6CA 3SD0A 4RQVA 2R3NA 5JQ8A 5JH6A 2UW8A 3HECA 3UP2A 3D94A 2E9VA 2BR1A 4X7QA 4BJJB 1AGWA 2CNQA 3SW7A 4X6RA 1TKIA 3A4PA 2X8IA 3OBGA 4DFXE 3VIDA 3Q6WA 1OM1A 3FL4A 3JYAA 4C3RA 4O7TA 1XH4A 3BX5A 4U3ZA 5CQWA 4A9UA 1PMEA 2QOOA 4AT5A 3TUDA 2Y4IB 3MVMA 5C9CA 4EK4A 1YVJA 2F2CB 4FX3A 4OTQA 4F7JA 3OFMA 2ERZE 3NCGA 2WMAA 1IR3A 2W05A 4ONAA 4OLIA 5I4NA 1V0PA 4USFA 3GENA 3CKXA 4P7EA 2QKRA 3ZO3A 3DQXA 1M2PA 4IDTA 2DWBA 3KA0A 4K77A 4O7ZA 4HYIA 4YZCA 1WBPA 2W1GA 2I0YA 4PTCA 3VF9A 3WF7A 5D41A 3PE1A 3TI1A 4H39A 4K1BA 2B9HA 2FUMA 4FGBA 3FMEA 3ZEPA 2WQEA 3A7GA 2B53A 3HKOA 1M52A 4QPSA 5EG3A 5IEXA 3G0FA 3QZGA 3OUKA 4S33A 3EQIA 3OCTA 3LW0A 2CMWA 2YCFA 5EYKA 4NYEA 5M06A 3FYKX 2YM5A 5BVDA 4IVAA 3VRZA 3A8WA 1JAMA 4GV1A 4X2GA 3OWJA 4JDKA 3E7VA 4QPMA 4E6DA 3N4TA 2WNTA 4JQ8A 4LI5A 3CGOA 2RFDA 4D1XA 3G51A 3NFFB 5FD2A 5LMAA 5J7BA 3ROCA 3ZZWA 4DFUA 1GNGA 3MPAA 4GK2A 4ALWA 4DFNA 1JQHA 4XLIA 2XK3A 4EH3A 4AS0A 5A54A 1IAHA 5DYJA 1G3NA 3LCTA 5L8JA 4CKRA 2G2FA 2YDJA 1OPJA 3I0OA 2WAJA 2C5YA 4F08A 1IA8A 3D14A 4FZFB 4UEUA 5AV1A 2Y6MA 3QGYA 3LQ8A 1JSVA 3PRFA 3FMJA 4JOAA 4QTBA 3HDNA 2GDOA 4PPBA 4BCNA 3K3IA 3IOPA 5C8NA 2QC6A 4TW9A 1TQPA 4KIPA 1WVYA 2I0HA 4C4FA 1WBWA 2H6DA 3D5VA 3FMDA 3ZBFA 3I81A 2CKOA 1PXMA 4TRLA 5E8YA 3ZYAA 3FMHA 4S2ZA 3UVRA 2YFXA 2VWIA 5DT4A 4EOSA 3TYKA 3R71A 1TQMA 3MFTA 3IS5A 4YHJA 2V22A 4MCVA 2YN8A 3F61A 5E8VA 3EN5A 4C35A 4W8EA 4DTAA 1ZWSA 2OH0E 1VEBA 2AC5A 5FP5A 1YWNA 2XZSA 2ZVAA 3ETAA 4Y8DA 2J0JA 1U54B 2E9NA 2I40A 2C68A 2EUFB 4LQMA 2OKRA 4M12A 5AJQA 5CT7A 4JBQA 5IA0A 5JMSA 4G2FA 1VJYA 2ITXA 4OTGA 4UZDA 1WAKA 4YSJA 1MUOA 1R3CA 2OG8A 2UZBA 3I7BA 2JC6A 3NUYA 4L67A 3F3TA 4UBAA 4YC8A 4AGWA 5C1QB 4IC8A 3QA8A 3O8TA 2W4JA 4EHEA 4BBEA 2BTRA 3PIXA 1Q4LA 1W7HA 4IZAA 3RGFA 2OH4A 4MEDA 4AOJA 1CDKA 2ITUA 3CIKA 3MY1A 4BCQA 3DK3A 4G9CA 1FBNA 4XRLA 5CZHA 2WU7A 4JXFA 4LOQA 1ATPE 2J6MA 2WKMA 5K5XA 4PMTA 2P3GX 5T3QA 4JDJA 1RJBA 5BV3A 4KS8A 2B54A 2PULA 3C4WA 3R7GA 2AC3A 3QRTA 3QCQA 4JX3A 4ZSLA 3RWQA 3TV7A 5AAGA 5CAQA 1IA9A 3QF9A 3VUTA 5B2MA 3U54A 5H9BA 4E4XA 3C4CA 3O50A 3HMPA 4FC0A 3FI2A 4G5JA 4G6LA 1U5QA 3COKA 2CJMA 3HEGA 3W0QA 3CTQA 3FUPA 1PXNA 4X0MA 4BYJA 4U7ZA 4DGMA 4X2JA 4ZS4A 1RQQA 3KVWA 3P23A 4O4CA 4NJDA 3V5TA 2XNOA 5EHLA 4FV7A 4BZNA 2VWBA 4J7BA 4E6AA 3MI9A 3E62A 5GINE 1ZZ2A 2ITZA 3W2PA 5I0BA 3EJ1A 5DRBA 3D83A 2UW3A 3FPQA 4NSTA 3EKKA 4FK3A 4IXPA 2Y6OA 2E2BA 4RIWA 3IW6A 1REJA 2J9MA 4OTHA 3I6UA 3UODA 3E8NA 2YJRA 3W8LA 1W8CA 2XB7A 2WHBA 2X4FA 2PVNA 5EI2A 4D5KA 5IA3A 5CNNA 5CEIA 4XEYA 1JNKA 2X8EA 3FPMA 4FNYA 3U87A 1UKIA 2ERKA 3ULZA 3OY3A 3KXMA 2PWLA 2QOIA 2Y7JA 1MRYA 3A99A 3P7CA 2BZKB 3BHHA 2XM9A 5BPYA 3GC8A 4FV3A 4MF1A 3L1SA 3ZLXA 3MW1A 3HAMA 4Y73A 3HUCA 3MFRA 3UOLA 3I60A 5M53A 1NVRA 3PJ8A 3MN3A 4C33A