3ZDIA

Glycogen synthase kinase 3 beta complexed with axin peptide and inhibitor 7d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
348
Chain Sequence
b'KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title 3,6-Diamino-4-(2-Halophenyl)-2-Benzoylthieno(2,3-B) Pyridine-5-Carbonitriles are Selective Inhibitors of Plasmodium Falciparum Glycogen Synthase Kinase-3 (Pfgsk-3)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 99
structure length 348
sequence length 349
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zdiA01
3K2LA 3NYOA 4DBNA 4ZAUA 5HCYA 5LVLA 4GUEA 5TT7A 5AADA 4O1OA 4DFNA 5I9YA 4IE9A 5HIBA 3CIKA 3QALE 4PL5A 5AP3A 3U9CA 3KMWA 4X2FA 2QOLA 4FK6A 4X21A 5BMMA 3OY1A 3U87A 3QYZA 1U54B 5EOLA 4BTFA 2GPHA 4TL0A 5FEEA 2UW6A 3WI6A 3ZXZA 4ZSLA 3GOPA 4EK8A 3R73A 5CSWA 3BRBA 4CXAA 3IGGA 2O63A 4IFCA 4EOQA 2VWBA 3D14A 4FTQA 4XUFA 5D1JA 4AGUA 5K4JA 4QTBA 5F94A 4C7TA 4CV8A 5C9CA 5BVNA 4ZS4A 3KRXA 3EWHA 4FSRA 2QU6A 5AWMA 2JBPA 3MIAA 4PY1A 3KREA 2IWIA 4X0MA 3LQ5A 2ITYA 4F9AA 3RK7A 4ACMA 4BI1A 1AD5A 3OS3A 5BUJA 2PMIA 3ORLA 5AV0A 2OSCA 4Q9ZA 1DAYA 3R7EA 3QZFA 4KRCA 3CEKA 4BBEA 5IQDA 2R3FA 3LFQA 5KO1A 4XYFA 4QTAA 5BVEA 3PZEA 3R2BA 4O83A 4I20A 1ERKA 4EOJA 2JFMA 4GJ2A 5F4NA 2G01A 3VBXA 3A62A 2XEYA 4FKJA 4M12A 1DS5A 3VJNA 3I0OA 3SHEA 4ASZA 3BGQA 1FMKA 2QU5A 4X3FC 4D5HA 1YWNA 5GIOE 4OGRA 3ALNA 4G31A 2CKEA 2J0LA 1E1XA 2BZKB 3D5UA 2UZDA 4F63A 3F5UA 3JPVA 1ZXEA 4MNEA 4W9WA 1SZMA 3RPYA 4TN6A 2OW3A 3HYHA 4Y46A 3TDVA 4MEDA 4PWNA 3R8UA 3ZFYA 4FV9A 2BTSA 1B6CB 4O0VA 3FJQE 4E6QA 3EQPA 4TNBA 4YLKA 2VTIA 2OH4A 3H0YA 3HP2A 2Z60A 4G6LA 2ERZE 5IISA 3VUTA 3R2YA 4C4EA 1KOAA 4DLJA 3E3BX 2JIUA 1WBNA 1OIYA 4RX5A 1E1VA 4ALUA 4U80A 2YDKA 2WZJA 2W1HA 4QPSA 3I7BA 1H00A 4A9TA 5LCJA 5BUIA 5DRDA 1ND4A 3VUHA 3EFKA 2ITWA 3L9PA 4YBJA 2X4FA 4KIKA 2YIRA 3ULIA 4ZZNA 3N4VA 3UVPA 4A9RA 3RWPA 3QQGA 4GVAA 4QMOA 5EFQA 4FKQA 4C4IA 5DT3A 4C38A 4ZSGA 5AAGA 1ATPE 3VUDA 4PMPA 2VU3A 4BDBA 5IU2A 2X4ZA 4IIRA 4TW9A 3ZXTA 4O81A 4N6ZA 4JRNA 2UW0A 3SAYA 4O0XA 2H96A 4ERWA 4KSPA 5BNJA 5JK3A 2B9JA 2GQGA 1GAGA 5DFPA 4F7SA 3C0GA 2IN6A 3ROCA 3NSZA 4RIYA 4FOBA 3TDWA 1R0PA 4IWPA 2CKQA 3DOGA 3GU8A 4RJ7A 4MXOA 3LFAA 2QOCA 1YHVA 3EQDA 1ZYJA 5CNNA 3R1NA 3ZDUA 2C6LA 2YDIA 4EK6A 3S00A 4C62A 2GNFA 3OD6X 3OT3A 4NT4A 3LAUA 4YNOA 3AQVA 5JZJA 1H1WA 2J6MA 2OICA 4A4LA 1APME 3Q96A 2OWBA 5IF1A 3P7BA 4MNEB 1E9HA 4UYAA 3SOCA 1W84A 2HOGA 5GZ8A 3S1HA 2P55A 3D83A 3KQ7A 4OTDA 4AGCA 5F1ZA 1IASA 4FT9A 5EM7A 4DE4A 2V55A 4HGLA 4QP2A 3DQWA 2FSTX 2QOQA 4JG6A 3GC0A 1UNHA 4K1BA 4FIGA 4IM0A 4O22A 1GJOA 4DEBA 4E5BA 4J98A 3V5JA 1YXUA 3COMA 4BYIA 1ZZ2A 4GSBA 2BAJA 4IM2A 4FEUA 5IQBA 3T9TA 2QHNA 4W4YA 1CTPE 4WBBB 5AEPA 5E4HA 3BV2A 3ZRKA 2YJSA 4S31A 4RJ3A 2O2UA 2HZIA 4EOKA 4ZLOA 4NJ3A 2G9XA 1JKSA 3COKA 5CANA 4KIKB 1QPEA 4E5WA 3PRIA 2J0IA 2ZYBA 1SNXA 4XV1A 4BDJA 4C4JA 3CTJA 3R8LA 3W18A 5AP0A 4R1YA 4ZXTA 2WIPA 2X8IA 3QUPA 4I0TA 5AP5A 4AOIA 4ZMEA 3NYNA 3KU2A 4RIXA 3NCGA 3NEWA 4R8QA 3NW5A 2XNBA 3QF9A 1JAMA 3TJCA 3LCTA 5CXHA 2YABA 5EHLA 5IH4A 3DFAA 4ZEGA 4U0IA 5EW9A 3UG2A 4CMOA 2PE0A 1PXLA 4Y73A 2B9FA 2QOFA 3HV5A 4L53A 5ANOA 4IWDA 2IW6A 4I1ZA 3RM7A 5J5SA 3MPAA 1XWSA 4O0TA 4Q5HA 3E7OA 2C1AA 3AMYA 4JG8A 5CEKA 3IONA 4LYNA 5C4LA 5FP6A 4ERKA 1WFCA 1SYKA 4XV9A 2VTAA 4DEIA 1KE7A 3MJ2A 5A6OA 3MPMA 3GGFA 2HW6A 3QWKA 4YTHA 4FV5A 1IG1A 2DYLA 4BDIA 5KMLA 4WKQA 3UQGA 3I60A 2G2FA 3BE2A 2UZNA 4JJRA 4YZCA 4N0SA 5L8JA 3CE3A 3H30A 5FLFA 4D2RA 2GFSA 2J51A 5JRQA 2WB8A 4NZWB 2X6EA 5JRSA 4IVDA 5HE0A 3K5UA 1Q3WA 3SLSA 3A7JA 3KEXA 4APPA 4M0YA 2CKPA 4W4XA 1H28A 4UZDA 4E4XA 3MN3A 5IQFA 2VO3A 2R3JA 2YCSA 4J96A 4CG9A 4QYYA 1YDSE 4F64A 4DF3A 3MSSA 4ZZOA 2QR8A 1OKWA 3FDNA 3DU8A 5HEZA 4ACDA 4DG3E 2B4SB 4IMYA 2C68A 3E8NA 4DTAA 3BHHA 3NW7A 5AX3A 2V7AA 4RIXB 2X7FA 3R7GA 5BUEA 3D0EA 1UVRA 1OIRA 5IPJA 2FUMA 2QR7A 4MF1A 4QMTA 4H36A 5CQWA 2HENA 3DY7A 2W4OA 1CKPA 2HXQA 4FODA 4Y85A 4CT1A 5DA3A 3QTQA 4IAZA 4X3JA 3VW6A 1Q61A 2E9NA 1PHKA 2BPMA 2XKEA 3DDPA 4ANBA 3DBFA 5KNJA 4KS8A 3KCFA 4FG9A 3PPKA 3EQIA 4IVCA 5AR3A 4D1SA 5C03A 4QP6A 4EQMA 5M4UA 1BX6A 3HUCA 4NKSA 3TCPA 4OT5A 3R21A 2NP8A 2W9ZB 3V8WA 2R4BA 4EUTA 5LVNA 1Y8GA 4AAAA 5AA8A 3DNEA 4F1MA 3ZBXA 4FSUA 5HG5A 3LFBA 4I4FA 3CD3A 3EQBA 1UU9A 4Y83A 2XM8A 4B0GA 1ZY4A 3FMEA 3F61A 1Q8YA 2RKUA 1J7UA 4O7WA 4U3YA 1UNGA 2WOUA 3D9VA 4QTCA 4YTFA 4BCHA 3OBGA 3BLHA 3OT8A 4JOAA 3CKXA 3MFRA 3RNIA 2YISA 1WBPA 4QP8A 4XMOA 1V0BA 2OJIA 4XG4A 4BFMA 4YHFA 3VS7A 4BCNA 1B38A 2Z7SA 1FPUA 3NUSA 1YXVA 4HPUE 4TWCA 4EH8A 5JGDA 5DI1A 3EQRA 4YUQA 2ZV8A 3ZUVA 2AUHA 2YM7A 5FRIA 1XKKA 3KB7A 2OIDA 3QBNA 5CEIA 5IMXA 3HMIA 4JDIA 3BKBA 3MBLA 4EOMA 4QP1A 4AU8A 2W4JA 5BVDA 3ATSA 3JYAA 1P4OA 5J1WA 3ZEWA 3GXLA 4IC7A 3P23A 1J91A 1PXNA 3BLQA 3BIZA 3ZO3A 4AACA 2OJGA 2PSQA 3M42A 2RG6A 5CEMA 1LEZA 2YZAA 3TV6A 2P33A 4GT5A 5J5TA 3F2NA 4GRBA 3ZMMA 2JEDA 3R30A 4YP8A 5A9UA 2WMRA 3O7LB 5M08A 4LOQA 3LFFA 4PPBA 4FKTA 2QG5A 4YZMA 4IZYA 3TL8A 2C3JA 1LP4A 5HG8A 3Q60A 4BIEA 5FM3A 5CQUA 4CKRA 4L68A 2O8YA 3IGOA 4IX5A 2QODA 3E93A 5DNRA 3DTCA 2ONLA 4MNFA 4QO9A 3VC4A 5I3OA 1GZ8A 4F4PA 5JSMA 3U6JA 3HV4A 3PPJA 5C8KA 2R5TA 4KIQA 2WTWA 4IADA 3ZM9A 2F7XE 3H9RA 2GTNA 4GFOA 4ZLYA 4PL4A 4DA5A 3FKLA 4TPTA 4UXQA 4IJPA 4BCMA 1RE8A 1YI6A 4KAOA 4K18A 4FV8A 4M8TA 4RGJA 5DEWA 4PMTA 2RSVA 4RWLA 2W5AA 1L3RE 3NIEA 5CYIA 3ULZA 4DEGA 2PTKA 2R3LA 4KRDA 5DE2A 2C3LA 1W8CA 4AW1A 4FEWA 4FKPA 4FNXA 4FTIA 1VJYA 1NY3A 4WNPA 5FEQA 3RGFA 5J7BA 4U8ZA 1OMWA 3VO3A 3NVMB 3QZIA 3ORKA 2PU8A 4ITJA 4C3FA 3PWDA 4RRVA 3JY9A 5A4QA 1IA9A 2HCKA 5C27A 1YWVA 2W99B 3DKCA 2J4ZA 4BI0A 2R2PA 2BILB 5IA4A 3V5LA 3ENMA 2XK9A 2XYNA 4DITA 3GEQA 2UW4A 5ETFA 2VTNA 3W55A 4ANNA 3L9MA 4I6BA 4OTQA 2CN5A 2XVDA 3II5A 3LM0A 3NNVA 4L67A 4FT3A 5J8IA 3WE8A 1FOTA 4UX9A 3A4PA 4AZFA 4BN1A 3FMDA 1FMOE 2WEIA 3I5NA 3ZSGA 4DGMA 1TKIA 3JR1A 4H3QA 3ORMA 1OL7A 2P2HA 3ERKA 1H01A 4FKUA 4AE9A 3ROYA 3N4TA 3R83A 4GYIA 2Y9QA 3QCYA 3DV3A 4YURA 3ZC6A 4QPMA 1A9UA 4BIDA 3R0TA 3H9OA 4FEVA 3GCPA 4YLLA 2GNJA 2PVJA 4IEBA 1LEWA 2ACXA 3BCEA 3IQ7A 1VYZA 4G5PA 3UNKA 4MWHA 5DR9A 4JQ8A 4LMNA 4UMQA 4DFUA 2IPXA 3E5AA 5TO8A 2GS7A 3TM0A 1H0VA 3DBDA 3FI2A 1JSTA 4LUEA 3PVUA 4O1PA 2R9SA 2PVNA 3VBWA 3M11A 2WQMA 4AOJA 5HESA 4GT3A 4IZ7A 1IEPA 4YJVA 1G5SA 3Q32A 4PMMA 3TZMA 3AOXA 3ZRLA 2UW5A 1GIHA 3FMMA 4UMTA 3TNHA 4OUCA 2QO7A 4AN3A 5L3AA 5J79A 2X81A 3FZRA 5HO8A 5CEOA 4QYGA 3O23A 1P4FA 4E4NA 3E87A 3A99A 2VD5A 3SX9A 4JBOA 3UIMA 1KV2A 1UNLA 5D9HA 3OWKA 4MBJA 5EI2A 4FSQA 1Q3DA 2B53A 4I6FA 3H3CA 4IX4A 4HNFA 5H9BA 4BYJA 1STCE 2HZ0A 2R3MA 2VAGA 4EOOA 4IZ5A 5HNGA 3ZRMA 4DLIA 4Z7HA 5IG1A 4PNKA 3SA0A 3NZ0A 3O8PA 4EUUA 5HX8A 1OGUA 4AFEA 2W4KA 3VHEA 3BYUA 1PRYA 4Z9LA 3ZFMA 5E8XA 4ASXA 4WNKA 3KN6A 3T3VA 4NM3A 3IOKA 3KA0A 5LARA 3MY1A 5GJDA 3Q2MA 3F3VA 2OO8X 4D2VA 3O96A 5T68A 3SRVA 4JX3A 4EH4A 3BWJA 4AQCA 3KMMA 4MD8E 2R7BA 2KULA 5DVRA 4BTMA 3RWQA 4D1XA 3CLYA 2O0UA 2YITA 3MV5A 4HVGA 4UWCA 2GHMA 1ZYDA 4MKCA 4FV1A 2WTCA 4FKGA 4AA5A 2PE1A 4FL3A 4BDAA 2ZM3A 4MVFA 3R7YA 5L2SA 1M2QA 4KD1A 3KXXA 4KBCA 2C5OA 4FIEA 2VTSA 4O91A 3C9WA 3HNGA 3KXHA 3LMIA 1VZOA 2EB2A 3QD2B 3WZDA 2QO9A 3OXZA 4KBAA 4V0GA 3DKGA 4XH6A 3LFNA 5HORA 4PTGA 2HY0A 1ZMUA 4DEDA 5KZ0A 2X2LA 3D4QA 3R9HA 3U6IA 1U46A 4NWMA 3QFVA 4F08A 5FD2A 5JGAA 1EH4A 2XNMA 3GCSA 3GU4A 5CNOA 4JIKA 3L8VA 3NYXA 2BALA 3QKLA 4NM7A 5E8TA 1OPLA 4FTKA 4S2ZA 4OAUC 2ZDTA 3THBA 4I5MA 4E20A 3AD6A 1HCLA 4P2KA 1Y91A 2WNTA 1IAJA 4G3EA 4A06A 2XB7A 1WBVA 3CGFA 3R22A 4QOXA 4GW8A 1OL1A 4EKKA 5T3QA 4FZ7A 4OTIA 2WMVA 5EI6A 2W06A 4FL1A 3KL8A 4FICA 3SRVB 2VTMA 5K5XA 1LR4A 3RBWA 3TIZA 4EOLA 5FGKA 4UYNA 2JBOA 3DK7A 4KABA 3UZPA 3WYXA 3UZTA 3GU5A 3NAXA 3BI6A 5A4CA 3U6HA 2V5QA 3ZEPA 4AN2A 4O0SA 3SOAA 2HAKA 3R6XA 2IZRA 2WTJA 4FEQA 4UXLA 1F0QA 2OZAA 2QURA 3R8PA 4L00A 4RQVA 2LAVA 3PLSA 4ZTHA 3VS3A 2IVSA 4E6AA 2VX1A 2XA4A 2WMWA 2DUVA 3NUUA 4NM0A 5AUUA 1PMNA 1YDTE 2ZOQA 3NNUA 3OCTA 4BR3A 2FA2A 3LFSA 3OBJA 4XG2A 3PTGA 3F66A 4ZIMA 5KBRA 4YPSA 3IDCA 1UA2A 3PPZA 4XBRA 2W1CA 2WMUA 4FUYA 4AGDA 4L3PA 4XOYA 3DXNA 4MXCA 4BCOA 1FVRA 1ZARA 2YLEA 5HD7A 5DPVA 3OXTA 4YC6A 3DBQA 4RWIA 5DBXA 3T3UA 5CI6A 3ORZA 2W1FA 4GH2A 4P7EA 3SDJA 4MCVA 4EQUA 4XLIA 5BQ0A 3PP0A 3BQCA 4FTTA 1I44A 3T8OA 4RA5A 5AV2A 2VTHA 5EM5A 3QRUA 3PWYA 4R6VA 3HKOA 3VS5A 3C51A 2VWUA 2QOKA 3U54A 2W7XA 3KVWA 2BRGA 2WFYA 3P7CA 2BVAA 2PE2A 3RPVA 2JDOA 4I6QA 3AGMA 3OROA 4EQCA 5C8MA 5F9EA 2F57A 4KKGA 1W83A 4QQ5A 4JR3A 4E26A 4BDFA 4LV5A 2Z7QA 4QYFA 3ZZEA 4R5SA 3VRYA 1MQ4A 1TVOA 1XBBA 2XNPA 5EDRA 4OR5A 4C4FA 5IQIA 4IAIA 4IQ6A 3ZO4A 2WTIA 1OZ1A 1XH6A 2VNYA 2JITA 3PVGA 2JD5A 3TKUA 3VS4A 4HOKA 3HECA 5JQ8A 3VHKA 3UIUA 2C5YA 2OZAB 3PFQA 3EQCA 5BVKA 2CNQA 5L8KA 2BRMA 2JC6A 3CS9A 4NW6A 2QD9A 5E8SA 1JVPP 5EK7A 4EC9A 5KCVA 4NFMA 3FQSA 2PY3A 3TNIA 3FPMA 2CGWA 3QXOA 2PULA 1YDRE 2IVUA 4H1MA 4DH8A 3IECA 3JVRA 3I4BA 5LQFA 1JPAA 5L4QA 3RM6A 3ACJA 3ZLSA 5IQGA 4FTJA 4N6YA 5J7HA 2DWBA 5AUWA 3CR0A 5HTBA 4IX3A 3DGKA 2BCJA 2W1GA 3BU3A 3LLTA 4YC3A 4TYIA 3P08A 1CMKE 3D5VA 1PMEA 4CCBA 1WMKA 3L8XA 4HZRA 2XF0A 4RPVA 2IO6A 2ONLC 2VWYA 4C36A 3ID6C 5CVHA 3Q5ZA 4BZNA 2I7QA 3F7ZA 3L9LA 5EYCA 1GOLA 2Z7LA 3MW1A 4U40A 3VF8A 5CLPA 4K8AA 4I4EA 2YIWA 4HJOA 5CVGA 4EH2A 1ZYCA 5CAPA 4UMUA 4FKLA 4JDJA 4BTKA 4J7BA 3PYYA 2JDRA 4U43A 4BWPA 2CKOA 1Z9XA 1S9JA 4O0UA 4W8DA 5E1EA 4C59A 4CV9A 4WOVA 5JH6A 4IDVA 5DHJA 4CG8A 2YCFA 5IDNA 4QTEA 5IUGA 3QTIA 4YNEA 4BIBA 4GG7A 3ET7A 2NNWB 4G16A 3GC8A 2R64A 3KCKA 1H1PA 4OTFA 4QMWA 3SG9A 2QOIA 3D2IA 5IQCA 3TWJA 4KKHA 3PRFA 3TJDA 1JSVA 2Q83A 4ANOA 3QZGA 5DEYA 3HAVA 1ZWSA 4HYHA 4I0RA 4C2WA 2XJ0A 5D41A 3ZLYA 4CD0A 3FHRA 3NCZA 4YZBA 4F9BA 2R7IA 5HX6A 2V0DA 5C8NA 3C4ZA 4JQ7A 4BHZA 4L3JA 3EYHA 2RFSA 5E8YA 4F0FA 4M69A 2CNUA 1SVEA 4JG7A 2BHEA 4CGAA 4K0YA 2JFLA 1H4LA 3PXYA 3FLZA 1MRUA 3HMMA 3CY2A 4XOZA 4QRCA 3RAHA 5ITAA 4F6SA 1UU7A 4U9AA 4S33A 5CSPA 2PPQA 4FZDB 2IW9A 4QMXA 3DPKA 2C30A 2YIQA 5H8EA 1QPDA 2AYPA 4FNWA 3VUGA 3KULA 3LXLA 2F9GA 4KSQA 3VQHA 2R3PA 3QHWA 4XBUA 3QRTA 4DGOA 1ZMVA 5DLSA 5HIEA 5HZNA 3DJ5A 5LMKA 3D5XA 3HDNA 3UOHA 2C5XA 4FSMA 4BZDA 2WMTA 4FKVA 4FVRA 2C3KA 3ZSHA 5K0KA 3UVQA 3TUBA 2I6LA 4WO5A 1WBSA 4F09A 4RG0A 4YO6A 2J5FA 3PDTA 3DJ6A 1KOBA 1R1WA 3V6SA 2YM5A 3F3TA 3HLLA 3GQIA 3P1AA 4ZJVA 1OIUA 4QMMA 5ANGA 2JIVA 5IDPA 4D2WA 3FY2A 1F3MC 3W33A 4QQTA 4EEVA 1WVXA 3MS9A 3V3VA 4YLJA 3WF8A 3SG8A 4BHNA 4WNMA 2BR1A 2XNNA 4GJ3A 4I5HA 3ODZX 3LZBA 2XK3A 3LIJA 4U79A 5HVJA 3Q4CA 3G9NA 3SXRA 4QQJA 5CZIA 3RMFA 2OIQA 3CTHA 3BU5A 3FAAA 3A61A 3HX4A 5GJGA 3WF5A 4ZSAA 1R78A 2UZWE 3CP9A 4X2KA 5CSVA 4BTJA 4ZY5A 3DK3A 4P90A 4OTWA 5IA0A 3B8RA 3R9DA 2ITVA 3R02A 3C4FA 4AXAA 1FQ1B 2J90A 5CF6A 1XH7A 4FSTA 4E7WA 4TTHB 3UPXA 3A4OX 4ACCA 1H25A 3CBLA 3Q6UA 1GZKA 2A19B 4M69B 4Y8DA 4V04A 4CVAA 4GKIA 5EG3A 5FTGA 4D0XA 2UVXA 3I5ZA 4M0ZA 5LMBA 3OOMA 1YOLA 2QCSA 2G15A 2B1PA 1W7HA 1MP8A 4IAAA 3HA8A 5GHVA 4GG5A 5AP4A 3G90X 3KULB 4BKYA 3FZ1A 3QD3A 2ZB1A 3LCOA 4YZ9A 3BU6A 3D7TA 5M07A 4L8MA 5HU9A 5J95A 3UODA 4F0GA 5IA2A 2QHMA 5D12A 3PJ2A 3CD8A 4GK3A 1OPKA 3QQLA 4LQMA 5I9VA 3OVVA 2F7EE 4DFZE 2Z02A 3UE4A 3CC6A 3PIZA 3NIZA 5FTQA 4ASEA 4KIOA 4OW8A 5K4IA 4PL3A 4TWNA 3SGCA 4NYEA 4U42A 1GNGA 2UZLA 2WKMA 4O7YA 4FTOA 1IR3A 4TYEA 1G3NA 3OUNB 1Q62A 5E8VA 4FV4A 3NNWA 3HDMA 4XV3A 3TT0A 2GNGA 2IJMA 2ZMCA 3C1XA 5JN2A 2WOTA 2Z7RA 4JAJA 4FT7A 5JFXA 2EWAA 2X9FA 3OCBA 5EH0A 3R7IA 3A60A 4BCKA 1REJA 4JR7A 3VVHA 4I41A 3OEFX 4F6UA 3CKWA 3I7CA 4AE6A 5KMOA 2XH5A 5LVOA 4FIIA 4RLLA 4O21A 2X9EA 4GMYA 4OBQA 4IDTA 4PPAA 4X2NA 3I1AA 4QTDA 1YRPA 3FKNA 3WF7A 2A1AB 2LGCA 2R3KA 3C50A 3ZLWA 4BBMA 2R3RA 3VUMA 1TQPA 1IAHA 3U8WA 4I93A 3BGPA 2WTDA 5KBQA 4D58A 1HCKA 4AA0A 1O6KA 1ZZLA 2B9IA 3KF4A 5B2LA 1V1KA 2HELA 3HEGA 4D4YA 5HBJA 3ODYX 4JNWA 2VRXA 5CT7A 5CU2A 1Q8TA 3UGCA 4ALVA 3CJFA 2VTPA 4LRMA 1WCCA 5H8GA 3V01A 2PVYA 3D7TB 3UP7A 4UV0A 3MTLA 3OMVA 4HCUA 4QNAA 3EKNA 3FMJA 3QCQA 3QTZA 2C47A 1RDQE 1NXKA 4BI2A 3E8DA 4ASDA 3H10A 4FTNA 2UZTA 3TUCA 3G9LX 4EKLA 3QC9A 4ZSEA 4F9WA 4D4RA 5IQHA 2E2BA 4RZVA 3Q9ZA 4CCUA 3D94A 3ZTXA 4BCGA 3FZOA 1YKRA 1M7NA 4UB7A 3ZU7A 2YZLA 4YHJA 3V5TA 4HNIA 1M2RA 4WUAA 4L43A 2G2IA 4TRLA 3VS0A 4I92A 4PP7A 4O6LA 3AD4A 4PRJA 5EHOA 2GQRA 5J87A 3W2QA 1J3HA 5CY3A 2VUWA 4D0WA 1XH9A 5LVMA 1YOJA 2GNLA 1OL5A 4Q9SA 5AFVA 1YHSA 4QP3A 3W2PA 1JWHA 4BBFA 3QTSA 2XJ2A 4C02A 3QWJA 2GSFA 3LJ1A 4L3LA 2F4JA 3IG7A 2VGOA 4AW5A 3PJ1A 4FV7A 3V04A 5BYLA 3FC1X 5EOBA 5HI2A 5M4CA 3CPBA 1OL2A 3WZEA 4O0WA 4E73A 3RZBA 4AZEA 4D2SA 3KRJA 3R63A 5CAVA 4JLCA 3AT2A 3BEAA 3QD4A 1K2PA 2QG7A 1WVWA 3UYSA 4P5QA 5IA3A 3D2KA 2PUPA 2IZTA 2JKKA 5CF8A 3OCSA 4O7NA 5AR7A 3WOWA 3OXIA 5AR4A 4LOOA 1QMZA 5KMKA 3TTJA 4ZY4A 2PUUA 4G3GA 4BDDA 1FVTA 2G1TA 3TZ8A 4AT5A 2R3NA 4IAFA 4C37A 3NUNA 4UN0C 3BX5A 2WQNA 1Q99A 3C0HA 4G1WA 3QLGA 4M66A 4ZZMA 4AZSA 4HVSA 5M53A 5EQEA 2PWLA 4E93A 2RFNA 1O6YA 3EYGA 1OITA 1VR2A 1ZOEA 2WTKB 5G6VA 4ACHA 1SM2A 3UOKA 4MH7A 1RQQA 3DLZA 4FTRA 1BLXA 2P0CA 4FG7A 3MDYA 3VNTA 3DDQA 3GI3A 4USDA 3R1YA 3FXZA 3UJGA 3QA8A 2VTTA 3P86A 3GVUA 2C4GA 4WG5A 2BKZA 1OPJA 2WMQA 2XBAA 3OEZA 5IH5A 3VBTA 4LI5A 2XS0A 4PDOA 3RCDA 5EYMA 5CXZA 4RJ8A 1JSUA 2WMSA 4IC8A 4LL0A 3TXOA 2PZPA 4U6RA 4LMUA 3SXSA 3ZCLA 4FSZA 1XH8A 4WSYA 3FEGA 3F2AA 2R0IA 3FLYA 1XHAA 1U59A 3EIDA 3IO7A 4JRVA 2E9VA 4TXCA 2E9OA 4WT6A 2XNOA 5DWRA 5EDQA 2AC3A 5BVWA 3SW4A 4CFNA 3VBYA 3DTWA 2F7ZE 1FGKA 5A46A 4EBWA 2XK8A 4RX9A 3DA6A 4MBLA 2BMCA 4XCUA 5E1SA 4TYJA 5AUZA 4D2PA 2CGUA 5EYKA 3WF9A 3C5IA 1W0XC 3ZO1A 4RQKA 5AP6A 4AZVA 4CSVA 3PIYA 1UWHA 5IUIA 3OFMA 4M15A 4V05A 4WA9A 3UTOA 2UUEA 2VWXA 3QRIA 5JFWA 2WMBA 2V7OA 3QX2A 3O17A 4GK4A 4F9CA 2VTRA 4EHVA 4G9RA 3ANRA 4ZY6A 3R1SA 4AW0A 2CCIA 4GL9A 2B7AA 3OTUA 4FNYA 2XP2A 3GC9A 3W8LA 4JBPA 3MFUA 4AZWA 4EZ5A 4DH5A 3GFWA 4C61A 5M4FA 3QLFA 3TN8A 4TYHA 4DFBA 4QNYA 5A54A 2W1ZA 4QP7A 4FTMA 2F2CB 2GHLA 2WTVA 2WMAA 4IZAA 4PV0A 1L8TA 3BYSA 2PZRA 3A7IA 4IJ9A 4E1ZA 5KMJA 4CFMA 3UIBA 2X8DA 3MA6A 5BVFA 5L2TA 2XCKA 4MWIA 3ANQA 4M68A 3R28A 4MHAA 4W9XA 3NRMA 2IZSA 5J9LA 4RMZA 2VTOA 1ZMWA 4V01A 3ALOA 3BHYA 5E90A 2GCDA 3ZS5A 3DXQA 2HWOA 4FTCA 3M2WA 4AS0A 5KUPA 3P7AA 5HQ0A 5A4TA 3QHRA 1PKDA 3FLSA 3FZTA 4XP3A 3MVLA 3AC3A 3QTXA 5FM2A 4NK9A 4NTSA 4IXPA 2VX0A 5F95A 2RIOA 3PJCA 3TEIA 3S0OA 4FNZA 4FVPA 5LMKC 3AG9A 4BDEA 2GFCA 4IBMA 4F9YA 1CM8A 3ORNA 5C1QB 1Z57A 5E8ZA 2OG8A 3FMLA 3DS6A 4CMUA 4O6EA 3POZA 2Q0NA 2ETKA 3LCKA 2PVRA 4FUXA 2WXVA 4LG4A 4GEOA 4OT6A 3S95A 5AA9A 4FX3A 2J0KA 4AP7A 3LXKA 2RFEA 3FXXA 3PUPA 3UZRA 5D11A 2ZV9A 2BUJA 1U4DA 1J7IA 1G8AA 4RVKA 5DT0A 1HOWA 3G15A 4Y5HA 4CNHA 3PXQA 3TG1A 4KKEA 5FDPA 2J0JA 4U45A 2XIRA 2I0EA 1RW8A 4ZTRA 3ZC5A 4BDKA 2CHLA 2BAKA 5HBHA 3HVCA 4RVMA 2C0OA 2IZUA 3OW4A 4RC4A 3ZYAA 4ACGA 4EOSA 3RI1A 4TYHB 3ZSIA 4EWQA 4RIWA 2GTMA 3TI1A 1Q41A 3M1SA 2WU6A 3F5PA 4FR4A 4EOPA 4NJDA 3KVXA 5D7VA 3S4QA 4E6DA 3CQUA 4FKIA 2ZVAA 4FIFA 4GVJA 4CLIA 2HYYA 3F69A 4XS2A 4EZ3A 3QGYA 4R3PA 4XEYA 3PA3A 4C4HA 4TYGA 4ANSA 1OKYA 2C0TA 2YIXA 3WYYA 3CJGA 3O50A 4ITIA 3VUIA 1H08A 3EJ1A 5L6PA 4DG2E 3EZVA 4CFWA 1PKGA 4GCJA 4FKWA 3GENA 3KFAA 4ZK5A 4ORKA 4J71A 3VRZA 4O7RA 3E64A 4BICA 3DAKA 1SVHA 1QPCA 4N70A 3OCGA 5FXSA 4NKAA 3V5QA 5E92A 2JDTA 5AAEA 3DXPA 4YHTA 1H0WA 1XBAA 4EK3A 4FE2A 1OUKA 1Z5MA 3B8QA 4G3FA 4QMPA 4L45A 4QYHA 5C26A 4MD9E 2PUNA 5CT0A 3GFEA 1PXOA 3VF9A 1QL6A 1WZYA 3L8PA 5JFSA 2BHHA 3NUAA 3U4WA 4AX8A 5TKDA 1UKHA 2F49A 3JY0A 1YVJA 4JQEA 3JXWA 2J50A 2PYWA 3TIYA 2PVLA 3GT8A 4IFGA 4LRKA 3RAKA 3WZKA 2XIKA 4AG8A 3RPOA 4ZMFA 1Q8ZA 4C35A 2Y4PA 3PSDA 1ZRZA 4FF8A 4G34A 2BKKA 4E3CA 3I0QA 5AM7A 4UBAA 2PMLX 3PE1A 4YSMA 5CAOA 2ETMA 2UW9A 3QA0A 4GKHA 5EM6A 5E91A 4U7ZA 4CQEA 3NPCA 3EN9A 4R7HA 2OF4A 3Q9WA 4U3ZA 4O2ZA 5KE0A 3G33A 3NW6A 4NUSA 5K5NA 4RSSA 5CWZA 5HVYA 4JL9A 4RIWB 3LFDA 3B2TA 4MF0A 3ZZWA 1A06A 1M52A 1ZLTA 5AM6A 5JFVA 5LVPA 4NTTA 2BFXA 1PXKA 5DOSA 5E8WA 5LOHA 2CN8A 2GNHA 4BDCA 2HWPA 4UEUA 2P2IA 4H3BA 1NVSA 4U81A 2C6KA 3QL8A 1Q24A 2XJ1A 3KXGA 3ZFXA 1BI7A 4AT3A 4CFUA 5JMSA 3LQ3A 4HW7A 5AMNA 3FWQA 3Q04A 3UC4A 4KNBA 4FV3A 4GU6A 3QXPA 2CNVA 3FUPA 1YHWA 2XCHA 3FLWA 3AGLA 5CX9A 4M67A 1P5EA 3IKAA 4YMJA 2PVKA 3ZUTA 2OXXA 1JBPE 5HLNA 4M7IA 3N9XA 4D55A 2QVSE 3FI4A 2WTKC 4GUBA 4FGRA 2IVVA 4NH1A 3P5KA 4E4MA 3F2RA 3Q6WA 4TWPA 5HNBA 5GNKA 1P2AA 3FMNA 3MFSA 5E9EA 2QNJA 4XX9A 1XR1A 3BELA 3CGOA 2Y8OA 3P79A 1QCFA 2VTQA 5CI7A 5G1XA 2DS1A 3S3IA 4HVIA 4UMPA 5HLPA 5B7VA 3V6RA 4ZTMA 2VX3A 3GQLA 3PY1A 3UQCA 3EOCA 3FE3A 5M09A 4FSWA 5CAUA 3SC1A 3HZTA 4A9UA 4EYJA 3OF0A 4GV1A 1AGWA 2BRBA 2GMXA 1RJBA 2CPKE 2R3OA 4C0TA 2YLFA 3GCVA 4ZJIA 1FBNA 2XIXA 3VS1A 4M97A 3KF7A 1UU8A 4QPAA 1Q4LA 3AT4A 1Y6AA 4F1OA 1BMKA 1MRYA 5L2QA 3W10A 4L42A 3RZFA 2WD1A 3L1SA 1ZAOA 3MVMA 3OZ6A 2C5VA 5DG5A 4FOCA 5FTOA 4TY1A 5BYYA 1YXXA 2O5KA 2XNGA 4J1RA 4QMVA 4DGGA 3AC1A 2PZ5A 3PP1A 3A2CA 4DH3A 5BX0A 2ERKA 3DKFA 4IHPA 3PSCA 4H3PA 4OTGA 5FUTA 3IW6A 5ANDA 3K54A 4WG3A 4B4LA 4DGNA 1ZYLA 2C0IA 1PXPA 3O7LD 2QONA 3BZ3A 4L6QA 3C4WA 3DB6A 4J95A 4M3QA 3AC2A 5A6NA 5DMZA 4ANQA 4EH7A 4QD6A 2B9HA 4K33A 3VN9A 2BIYA 4EHZA 5HIDA 5I9ZA 4DTBA 4NEUA 3LM5A 5CF4A 3NVKI 5EQYA 5L2IA 3RAIA 4RJ4A 5AR5A 4ZTSA 5C4KA 2ZV2A 2UZOA 2VGPA 3R7VA 3EFJA 4JBVA 4TKSA 2YJRA 3LMGA 3Q9XA 2NO3A 3V5PA 3OG7A 2ITTA 3IW7A 3QTRA 4HZSA 4HGSA 1K9AA 2J5EA 4EH6A 2EU9A 2SRCA 4AF3A 4PQNA 2OF2A 5B2KA 4JAIA 4G2FA 5GZAA 3ZLXA 1PXIA 4QP4A 3TNWA 4DT8A 4C8BA 4QMZA 4IB1A 4ZOGA 5E7RA 5EHYA 3RK9A 4F7JA 5I0BA 3BGZA 3E62A 3VIDA 4FA2A 2JGZA 2OZOA 4IANA 5HG7A 1Y57A 3R8ZA 1XH5A 2W9FB 1FINA 1SVGA 4RFMA 5GJFA 3Q2JA 4BCFA 3R04A 4YPDA 4NL0A 3JVSA 3FYJX 3OP5A 3A8WA 3BV3A 4ANLA 1UU3A 3NUYA 5AV4A 3C5UA 1H1SA 2YM4A 3KK8A 4CQGA 4AA4A 4BKZA 3TNQB 2UW8A 3WARA 3F5GA 3D7ZA 3NS9A 4O82A 2Y0AA 1B39A 3NX8A 4MX9A 5BYZA 1BUHA 4IB0A 2W05A 3IOPA 2BRHA 2FSOX 2FYSA 3HRBA 4X2JA 2VO7A 1NW1A 3AC5A 5HOAA 3F82A 3RK5A 1QPJA 4CT2A 3E7VA 5I9XA 2ZM1A 2CGVA 2I0VA 4IB3A 3C4XA 4EWHA 1MUOA 5TE0A 4YR8A 5M44A 1ZOGA 4B8MA 2AC5A 4IH8A 2XKDA 4CLJA 3FZSA 4I23A 4I6HA 2WQOA 4K2RA 3OWJA 3SVVA 3UDBA 4YJTA 3UQFA 4WNOA 4OBPA 4XV2A 3HV3A 1K3AA 4RX8A 2HIWA 3FC2A 4G3CA 3WZUA 4BDGA 5DR2A 5AR2A 4EJNA 4TZRA 4B9DA 2XK4A 3LJ2A 4K6ZA 4MXXA 4G9CA 3PXRA 4U41A 2QLQA 2XKCA 1BL7A 2EXEA 3F6XA 3GP0A 3VJOA 2OXYA 1V0PA 4D9UA 4FC0A 3PJ3A 4G5JA 4YJNA 3PZHA 2OI4X 4A4OA 2C69A 2VWVA 4O0YA 3RALA 2H8HA 4Y72A 3ETAA 4RWKA 2QOBA 3EQFA 4XJ0A 3TV4A 4EC8A 3K3JA 3HA6A 2OKRA 3QQKA 3UC3A 4AWIA 4O2PA 2OLCA 2W17A 3QUDA 3Q4UA 2JIIA 3R00A 4PTEA 3LFCA 4FK3A 3A7FA 5LWNA 2P3GX 3EB0A 3H0ZA 3TZ9A 4BCIA 4K77A 5I4NA 3CQEA 5D10A 5JGBA 2Y6OA 4S34A 1M14A 4YC8A 2C6TA 1PW2A 2X2KA 4Q5EA 3QZHA 4R3CA 5M56A 4IW0A 4AW2A 3N4UA 5CU0A 3C0IA 4FKOA 3ZOSA 4JT3A 4F1TA 2WEVA 2WIHA 4H39A 3ATTA 3KMUA 3EN5A 4JX7A 4NSTA 5DT4A 3UNJA 5F20A 5CEQA 2VO6A 3MYGA 3ZBFA 4CYIA 2XRUA 4EK4A 4F6WA 2IW8A 2B54A 1PXMA 3Q9YA 4DH1A 3A7GA 4YJOA 3FQEA 3DBEA 4WBOA 4C57A 4D9TA 2HZ4A 1Q5KA 4A4XA 5B2MA 3W2RA 4AFJA 4H05A 3PSBA 2R3GA 3RKBA 1GIJA 4I5PA 4DEAA 3FLQA 4O7ZA 1YOMA 2WO6A 4NIFA 5GINE 3RJCA 4X6QC 4BCPA 1SNUA 2YAAA 4R5YA 2I0HA 3BYMA 3DBCA 2REIA 5FG8A 3R8VA 2VTJA 3PA5A 4E5AX 4J97A 1YWRA 1VEBA 3EFLA 3EFWA 1S9IA 2A27A 2CCHA 5HCZA 2GU8A 2NRUA 2Z2WA 3E3PA 2JAMA 2YDJA 2YCRA 3EMGA 1REKA 2UZVA 3EQGA 4UWYA 4DBXA 5ACKA 3TV7A 4W8EA 4F7LA 2XK6A 3KXNA 3RTPA 2W1DA 2R3QA 4RJ5A 2CGXA 3HRCA 2HY81 3MPTA 3MI9A 3RAWA 2VWIA 3E8CA 3R7OA 4O7SA 4E6CA 2JKQA 3UOJA 3NLBA 4U44A 5BPYA 4MK0A 4F70A 2R0UA 4IACA 4Q2AA 2R3IA 5AP1A 5AUTA 4R77A 5AP7A 4AGWA 2PK9A 5BVOA 4D4SA 3AC4A 3WF6A 5H2UA 3QCSA 3DAJA 3IDBA 4LGHA 1F5QA 3S2PA 2YN8A 3IDPA 2NRYA 1R3CA 2V62A 2J2IB 4FV0A 2FSMX 4J52A 3VW8A 1KE5A 2BDJA 2BFYA 3NR9A 3CCNA 1PF8A 2XBJA 3PA4A 3GB2A 4J8MA 4RA4A 3ZONA 5K9IA 2I0YA 4CKJA 2XUUA 3G6HA 4DAWA 4Z55A 4MD7E 3RP9A 4FG8A 5LCKA 2DQ7X 1KE9A 5HE2A 3DCVA 3DKOA 4DGLC 5JEBA 5M4IA 4BY9E 1H24A 2ITNA 3MY5A 4LGGA 4O7TA 3KC3A 3LVPA 5CU3A 4GFMA 1FVVA 3BQRA 5ANEA 3FZPA 1JNKA 3JS2A 4IWQA 4NIFB 5HG9A 4ARKA 2R3HA 4AZTA 4EYMA 4PDPA 3MH0A 4P5ZA 4UALA 3LXNA 3D5WA 5AJQA 2J0MB 4DINA 5L2WA 1OUYA 3FSKA 4YJSA 5E8UA 5FP5A 4PNIA 4RJ6A 4L7SA 5DGZA 4RIOA 3OWPA 3QU0A 4LOPA 2A2AA 3HV7A 1AQ1A 3W2OA 2BDWA 1V0OA 3Q3BA 5FXRA 4OLIA 2PUIA 3P9JA 3IW8A 4CEGA 2VV9A 1OKZA 3LFEA 4C4GA 4C3PA 4TT7A 3MH2A 5K0XA 4O96A 4JXFA 5K3YA 1XJDA 4K9YA 3SD0A 4BWKA 4ID7A 3OTVA 3U9NA 2ZAZA 4LRJA 1O9UA 3GU7A 3GU6A 3PE2A 3VUKA 4DHFA 4EONA 4ENXA 4EK5A 3VWAA 4GYGA 2WELA 3A8XA 2X6DA 5J9ZA 3BPRA 3CPCA 2XK7A 4HCVA 2RFDA 4ENYA 4FZFB 3EHAA 4FSNA 4CRSA 2BDFA 2FGIA 5KMNA 5B0XA 4DFYA 1OECA 1PYEA 4KA3A 5FXQA 3SW7A 4HVDA 3GUBA 3E88A 3NWWA 1DAWA 3O0GA 3SQQA 4B99A 4CTCA 4YJPA 2XRWA 3FSFA 3UO4A 4HVHA 5ANJA 4FTAA 4EH5A 2RGPA 3FMHA 4PF4A 2RF9A 3RPRA 2YAKA 5CVFA 5HU3A 4GU9A 5FEDA 5TF9A 1JKKA 3V8SA 4L9IA 5KKRB 5TR6A 3G51A 2BTRA 4X7QA 3A7HA 3ZM4A 4CFFA 4CKIA 5KHXA 5EM8A 1U5RA 3ITZA 5AIRA 3UBDA 1OB3A 5LWMA 3H9FA 4A07A 2GS2A 3NNXA 4OAVB 5IH6A 5DIAA 3C4EA 1CDKA 4L01A 3EN4A 4CFXA 3OUKA 4HYUA 4XHKB 3PJ8A 3Q4ZA 4G3DA 4BCQA 4EL9A 3IPHA 5AUYA 3VQUA 4EH9A 3F5XA 2QLUA 4CZTA 5ANKA 1J7LA 3OC1A 4DFXE 3HMNA 4QT1A 4USEA 2J9MA 3QRJA 3HP5A 4FKSA 5IKWA 2YEXA 4JDKA 3FKOA 4RT7A 5JKGA 4BF2A 4BL1A 3NGAA 2EUFB 3QYWA 4E4LA 5HTCA 1YXTA 4RC2A 4XNEA 2XIZA 2YM3A 3R9OA 5KX8A 4RIYB 2QKWB 2YWPA 4L44A 2QI8A 3I81A 3O2MA 3G5DA 5HGIA 1XO2B 1XQZA 1OI9A 2GS6A 2B55A 2XEZA 3NUXA 3QGWA 2YFXA 3IW5A 4F65A 2XIYA 3ELJA 4GFGA 3R7UA 4EOIA 4FIHA 4NCTA 2VWZA 3ACKA 4KS7A 2WQBA 2ITPA 5M51A 1OIQA 1A48A 3DZOA 1WVYA 4D2TA 3L8SA 4YTCA 4BWXA 1IA8A 5HVKA 5I5ZA 2CDZA 4I0SA 3U51A 2PMOX 2XYUA 2X2MA 1YW2A 4DG0E 4L52A 4EZ7A 1OVEA 3QQJA 4M14A 2CSNA 2ZV7A 3DJ7A 3Q4TA 4R7IA 5L6OA 2CLQA 4YZNA 2UZUE 2WGJA 5FQDC 5DYJA 3GBZA 2C1BA 4MBIA 4R1VA 1BL6A 5LJJA 2ZDUA 3HUBA 4ZP5A 3PXZA 3CXWA 4L46A 3BHVA 3RNYA 4BGGA 3VBVA 3U55A 2PVHA 3PVBA 3QKMA 4U97A 1JKLA 5HO7A 3KXMA 2XM9A 2JKMA 3ORPA 1UV5A 3MWUA 1NT2A 2YA9A 2WPAA 4FTLA 3LCDA 4HYIA 2HK5A 3LXPA 4Z16A 2XMYA 4J53A 1GZOA 2PVMA 4FIJA 4JBQA 3LMHA 3DT1A 3LOKA 3V8TA 1UKIA 3UO6A 1KE6A 3MY0A 4FGBA 2QQ7A 2VTLA 5EI8A 4FSYA 4ZTQA 2IG7A 3FXWA 3KXZA 5CSXA 2CLXA 1OKVA 1PY5A 2NPQA 4XRLA 4ITHA 1URCA 3CQWA 1GIIA 1CKJA 5I9UA 1KV1A 5KHWA 2JKOA 4GK2A 2ITOA 5AIKA 1TQIA 4AOTA 2O65A 2HW7A 3PIXA 4FMQA 2OJFE 1KE8A 3QTWA 3REPA 5HICA 3N51A 2WHBA 4IB5A 4JIAA 4O86A 4CMTA 5HE3A 4HCTA 5LMAA 5M55A 4DT9A 3V5WA 1T45A 2FVDA 3QKKA 2WAJA 2BZJA 2ZJWA 3QQUA 4FBXA 5A4LA 5J9YA 4NW5A 2UZEA 4UMRA 3LJ0A 4I21A 4GS6A 3FY0A 5CZHA 1IRKA 4BGQA 2ITZA 1PXJA 4I3ZA 1W98A 4KB8A 4A9SA 5LXMA 1X8BA 3UO5A 2OBJA 2CMWA 4CYJA 3QQFA 4WHZA 3ZDIA 3QTUA 3CTQA 3C13A 4AT4A 3LLAA 3B2WA 3VULA 4BKJA 4OTPA 4O7VA 4ZTLA 2ZMDA 3O71A 4N57A 4W4VA 3DLSA 4I24A 1Q8UA 4Y95A 4O7LA 4GIHA 3SXFA 5TOZA 3KRWA 4CFVA 1FGIA 1YI3A 1BI8A 4NU1A 2ITXA 5H8BA 4QQCA 5CF5A 2JDVA 1Q97A 4YU2A 5HBEA 5CASA 4H1JA 3W1FA 2RG5A 2Y4IB 4MQ1A 5A3XA 5AX9A 2C6IA 2Y7JA 5KZIA 4XRJA 3NDMA 4IVBA 5HKMA 3BHUA 2X0GA 3UMWA 3H4JA 4A7CA 4FI1A 4RBLA 4OTHA 4P4CA 4WG4A 3UP2A 4D1ZA 4B6LA 4BVUA 3ORXA 3BE9A 3EKKA 3KGAA 3FI8A 2OGVA 2UZBA 4RC3A 4CTBA 3COIA 3U4UA 2ITQA 1BKXA 2JDSA 3C4CA 1ZYSA 4XG6A 2XKFA 3R71A 3SV0A 5KMMA 2VN9A 3E92A 4S30A 3VS6A 4BC6A 4IAKA 4WD5A 4HGEA 2OJ9A 5DN3A 3BYVA 4E8AA 1H1RA 3HAMA 2X7OA 4Z3VA 4I22A 4ONAA 4JS8A 3HMOA 3AMAA 4YJRA 1LUFA 3W8QA 3PY3A 1WBTA 5C01A 4MQ2A 4FEXA 3W2SA 3W16A 3BWFA 4CZYB 5IZFA 4JDHA 3AD5A 4M13A 4WUNA 1YI4A 3DZQA 3FL5A 3R01A 4FVQA 4I5CA 4JVGA 4RFYA 5EQPA 3PLAE 1JLUE 1KUTA 4GT4A 2PZIA 3D15A 3F9NA 3LKMA 3FBVA 5EKOA 1WBOA 3RHXA 4O27B 4DH7A 1DM2A 2PMNX 5AR8A 3Q5IA 1P14A 4RZWA 1OL6A 4YZDA 1GZNA 4OBOA 3P78A 4BGHA 5A4EA 3G6GA 4AUAA 4IX6A 1KWPA 5JT2A 4D4VA 3PXKA 2H34A 3HRFA 4KUJA 3FHIA 5JQ5A 4J99A 2QO2A 4XG7A 3GNIB 3DFCB 3DK6A 1H1QA 3AMBA 5CAQA 3O8UA 4O84A 5KKRC 1U5QA 2VZ6A 2UVYA 4IAYA 4XLVA 1H07A 3WIGA 2I1MA 5DH3A 3VS2A 4QP9A 1GY3A 4FT5A 4XP0A 4YJUA 5ACBC 4DN5A 4IVAA 4BRXA 4DEEA 1ZOHA 3F3WA 4XP2A 4BZOA 4MYGA 3ZHPC 3BHTA 3FV8A 4ZS0A 3JUHA 3QRKA 4G17A 4PP9A 4RFZA 4RVLA 5CENA 4GIIA 4FV2A 4RWJA 2ITUA 2C6EA 2VWWA 2VNWA 2YCQA 4FYOA 3LCSA 5FBNC 4ANMA 4X3FA 2JLDA 2PVFA 3PY0A 3OWLA 5L6WL 2OFVA 3TNPC 3P4KA 3FQHA 3OW3A 2H9VA 5HTIA 3MGYA 5IA1A 4MTAA 4UZHA 3E8EA 1W82A 2PL0A 3MH3A 4DFLA 3G2FA 2FSLX 1WBWA 3OHTA 2OXDA 2RL5A 5H3QA 5HD4A 5AP2A 5J1VA 3F7WA 3QX4A 5DRBA 4ZSJA 4EJ7A 3O8TA 2E9PA 1PMVA 2H6DA 4PDYA 3UVRA 3UG1A 1I09A 2YERA 1MQBA 2YM6A 3G0FA 2YM8A 3Q52A 4YJQA 5GZ9A 4CRLA 4YSJA 5IEVA 2C3IB 4RX7A 3MESA 4RLKA 3AC8A 3CY3A 3KRLA 1DI9A 3BYOA 2XZSA 5EDPA 4BB4A 4DTKA 3FPQA 5HCXA 5AV3A 2W1IA 3FYKX 2ESMA 3QCXA 1CSNA 2WMXA 2FB8A 2GNIA 3NUPA 2UW7A 5EYDA 3ENHA 1KSWA 3POOA 4I94A 5AUVA 4C33A 2BZIB 4YGAA 3DQXA 5IA5A 4MXYA 4BCJA 4LFIA 4C3RA 3MB7A 2BAQA 5HO6A 1URWA 5IEYA 3QUEA 3VAPA 3LE6A 3TKIA 3ZO2A 5CEPA 4UWBA 2BIKB 3CSVA 3SKCA 4PX6A 5CALA 3NYVA 4W4WA 1BYGA 5KMIA 2PZYA 2BROA 3MH1A 4YO4A 3ZUUA 2X8EA 3C7QA 3Q53A 2EXCX 5L8LA 3MTFA 2I40A 2W0JA 4LL5A 4X3FB 1SMHA 4R7BA 4D5KA 4KINA 4C58A 1JQHA 2YACA 2X1NA 4F0IA 1H27A 5M06A 5I9WA 2B0QA 3WILA 5AAFA 1YXSA 2B52A 2WU7A 5GIPE 3HL7A 1UWJA 1YQJA 2UW3A 1J1CA 4K11A 3TKHA 2GDOA 4WRSA 3DAEA 4S32A 1DI8A 3COHA 2OJJA 3W2CA 4MXZA 3KN5A 1R0EA 3LQ8A 4QMUA 4RVTA 4X6RA 1WAKA 3P0MA 4NCTC 3PG3A 2A0CX 5ETIA 3TACA 3EL8A 1M7QA 3TZ7A 4AN9A 4DYMA 5I3RA 1VYWA 3FLNC 5CSHA 2C6DA 1MRVA 4HYSA 3NAYA 4KIPA 4QMYA 1PJKA 3GC7A 4H58A 4KWPA 3T9IA 4JI9A 4U5JA 4YTIA 4O0RA 3RINA 4IWOA 3UIXA 2E9UA 4EI4A 4MAOA 5IQAA 4LV8A 4QMNA 4G6NA 2A4LA 5CU6A 3EZRA 3UYTA 4B7TA 5ANIA 3EL7A 2IVTA 3WBLA 4C2VA 1M2PA 1G8SA 4APCA 4QMSA 2OFUA 2YWVA 2EXMA 4HGTA 3G0EA 4XG3A 4QMLA 3QC4A 2YHVA 3EQHA 3F3UA 3MIYA 2ZB0A 3RVGA 3ZH8A 3W32A 4BDHA 3IW4A 2CJMA 1Y6BA 2HZNA 3PXFA 2P4IA 3F3ZA 5CTPA 3K3IA 2G2HA 2UV2A 3R9RA 5A14A 4KBKA 2Y4IC 2C6OA 4Z7GA 5BMSA 5M57A 3FL4A 3MVJA 5AUXA 3HV6A 3MA3A 1NVRA 4M84A 5CU4A 5FWKK 3TUDA 2YIYA 3RHKA 4A9YA 2VO0A 3IS5A 1PMUA 2QC6A 2Y6MA 1J1BA 4X2GA 2ZM4A 1ZY5A 3I79A 3VBQA 4F99A 1R39A 1Y8YA 2QOOA 3BBTB 3FI3A 4TWOA 4QYEA 4LGDA 4ZTNA 1T46A 3ORIA 2Z8CA 5HLWA 2JAVA 4OTRA 4V0GB 4NFNA 3R8MA 1NVQA 4UY9A 1XH4A 4MXAA 1M17A 5HHWA 3RPSA 4ZLZA 4FZAB 4DCEA 3UMXA 4R78A 1NA7A 2X7GA 3K5VA 4F7NA 1H8FA 3KK9A 2WQEA 2QKRA 3I6UA 3PG1A 2UVZA 5JZNA 3E63A 1LPUA 3MB6A 5HE1A 4EHGA 4FT0A 5IEXA 1XBCA 2QOHA 3BEGA 3O51A 2Q0BA 5T6KA 4FV6A 3EH9A 4LUDA 3GCQA 3HMPA 3UNZA 4L7FA 4FZ6A 5EW3A 4EORA 5IMEA 5AV1A 2J7TA 2O3PA 4PMSA 2OK1A 5IQEA 4DCAA 4HPTE 3BBWA 4PPCA 1CKIA 2XNEA 3ORTA 4PTCA 4R3RA 3F88A 4FYNA 4WSQA 5D7AA 3MVHA 4WIHA 4PDSA 2W5HA 4G6OA 2C6MA 4D28A 1U54A 3EN6A 3LW0A 2BZHB 2FO0A 1JOWB 4USFA 5HNIX 3EN7A 5FDXA 4FKRA 3GCUA 3BLRA 2BRNA 3I6WA 3IK3A 3RCJA 4B8LA 4C34A 4PUZA 1H26A 5DR6A 1OBGA 2GQSA 3WZJA 2O64A 2OIBA 4LM5A 2F2UA 4IM3A 1OM1A 2V22A 1Q8WA 3QAME 4XG9A 3WE4A 2OH0E 2ETRA 3NMUF 2KTYA 3KY2A 1OBDA 2OU7A 3UPZA 4ALWA 2W96B 3FMKA 5EW8A 3V51A 2EVAA 1PYXA 4CZUA 4EHEA 3AXWA 3QD0A 3DB8A 5EKNA 4J8NA 4N4SA 3GOKA 2W1EA 4DC2A 5ETCA 4DEHA 4YBKA 3DNDA 4II5A 3LPBA 4XG8A 3PVWA 3AT3A 4WRGA 3UOLA 2HXLA 2FH9A 3KRRA 2PHKA 4FL2A 4NM5A 2X39A 2C5NA 3HGKA 2GHGA 3KKVA 3L9NA 4EBVA 4FTUA 5IUHA 4EH3A 1TQMA 4TNDA 1O6LA 3OOGA 3QQHA 5CS6A 3LHJA 3MJ1A 2EB3A 5ETAA 1JKTA 2W5BA 3TTIA 4QMQA 4O38A 3OY3A 5FBOA 3WIKA 4ZJJA 3MFTA 4Y5QA 3R9NA 3R1QA 5ICPA
chains in the Genus database with same CATH superfamily
3K2LA 3NYOA 4DBNA 4ZAUA 5HCYA 5LVLA 4GUEA 5TT7A 5AADA 4O1OA 4DFNA 5I9YA 4IE9A 5HIBA 3CIKA 3QALE 4PL5A 5AP3A 3U9CA 3KMWA 4X2FA 2QOLA 2AQXA 4FK6A 4X21A 3OY1A 5BMMA 3QYZA 1U54B 5EOLA 4BTFA 2GPHA 4TL0A 5FEEA 2UW6A 3WI6A 3ZXZA 4ZSLA 3GOPA 4EK8A 3R73A 5CSWA 3BRBA 4CXAA 3IGGA 2O63A 4IFCA 4EOQA 2VWBA 3D14A 2A98A 4FTQA 4XUFA 5D1JA 4AGUA 4QTBA 5F94A 4C7TA 4CV8A 5C9CA 5BVNA 5K4JA 3KRXA 3EWHA 3UDZA 4FSRA 2QU6A 5AWMA 2JBPA 3MIAA 4PY1A 3KREA 2IWIA 4X0MA 3LQ5A 2ITYA 4F9AA 3RK7A 4ACMA 4BI1A 1AD5A 3OS3A 5BUJA 2PMIA 3ORLA 5AV0A 2OSCA 4Q9ZA 1DAYA 3R7EA 3QZFA 4KRCA 3CEKA 4BBEA 5IQDA 2R3FA 3LFQA 5KO1A 4XYFA 4QTAA 5BVEA 3PZEA 3R2BA 4O83A 4I20A 1ERKA 1XMLA 4EOJA 2JFMA 4GJ2A 2XANA 5F4NA 2G01A 3VBXA 3A62A 2XEYA 4FKJA 4M12A 1DS5A 3VJNA 3I0OA 3SHEA 4ASZA 3BGQA 1FMKA 2QU5A 4X3FC 4D5HA 1YWNA 5GIOE 4OGRA 3ALNA 4G31A 2CKEA 2J0LA 1E1XA 2BZKB 3D5UA 2UZDA 4F63A 3F5UA 3JPVA 1ZXEA 4MNEA 4W9WA 1SZMA 3RPYA 4TN6A 2OW3A 3HYHA 4Y46A 3TDVA 4MEDA 4PWNA 3R8UA 3ZFYA 4FV9A 2BTSA 1B6CB 4O0VA 3FJQE 4E6QA 3EQPA 1ST4A 4TNBA 4YLKA 2VTIA 2OH4A 3H0YA 3HP2A 2Z60A 4G6LA 2ERZE 5IISA 3VUTA 3R2YA 4C4EA 1KOAA 4DLJA 4DHZA 3E3BX 2JIUA 1WBNA 1OIYA 4RX5A 1E1VA 4ALUA 4U80A 2YDKA 2WZJA 2W1HA 4QPSA 3P5JC 3I7BA 1H00A 4A9TA 5LCJA 5BUIA 5DRDA 1ND4A 3VUHA 3EFKA 2ITWA 3L9PA 4YBJA 2X4FA 4KIKA 2YIRA 3ULIA 4ZZNA 3N4VA 3UVPA 4A9RA 3RWPA 3QQGA 4GVAA 4QMOA 5EFQA 4FKQA 4C4IA 5DT3A 4C38A 4ZSGA 5AAGA 1ATPE 3VUDA 4PMPA 2VU3A 4BDBA 5IU2A 2X4ZA 4IIRA 4TW9A 3ZXTA 4O81A 4N6ZA 4JRNA 2UW0A 3SAYA 4O0XA 2H96A 4ERWA 4KSPA 5BNJA 5JK3A 2B9JA 2GQGA 1GAGA 5DFPA 4F7SA 3C0GA 2IN6A 3ROCA 3NSZA 4RIYA 4FOBA 3TDWA 1R0PA 4IWPA 2CKQA 3DOGA 3GU8A 4RJ7A 4MXOA 3LFAA 2QOCA 1YHVA 3EQDA 1ZYJA 5CNNA 3R1NA 3ZDUA 2C6LA 2YDIA 4EK6A 3S00A 4C62A 2GNFA 3OD6X 3OT3A 4NT4A 3LAUA 4YNOA 3AQVA 5JZJA 1H1WA 2J6MA 2OICA 4A4LA 1APME 3Q96A 2OWBA 5IF1A 3P7BA 4MNEB 1E9HA 4UYAA 3SOCA 1W84A 2HOGA 5GZ8A 3S1HA 2P55A 3D83A 3KQ7A 4OTDA 4AGCA 5F1ZA 1IASA 4FT9A 5EM7A 4DE4A 2V55A 4HGLA 4QP2A 3DQWA 2FSTX 2QOQA 4JG6A 3GC0A 1UNHA 4O4FA 4K1BA 4FIGA 4IM0A 4O22A 1GJOA 4DEBA 4E5BA 4J98A 3V5JA 1YXUA 3COMA 4BYIA 1ZZ2A 4GSBA 2BAJA 4IM2A 4FEUA 5IQBA 3T9TA 2QHNA 4W4YA 1CTPE 4WBBB 5AEPA 5E4HA 3BV2A 3ZRKA 2YJSA 4S31A 4RJ3A 2O2UA 2HZIA 4EOKA 4ZLOA 4NJ3A 2G9XA 1JKSA 3COKA 5CANA 4KIKB 1QPEA 4E5WA 3PRIA 2J0IA 2ZYBA 1SNXA 4XV1A 4BDJA 4C4JA 3CTJA 3R8LA 3W18A 5AP0A 4R1YA 4ZXTA 2WIPA 2X8IA 3QUPA 4I0TA 5AP5A 4AOIA 4ZMEA 3NYNA 3KU2A 4RIXA 3NCGA 3NEWA 4R8QA 3NW5A 2XNBA 3QF9A 1JAMA 3TJCA 4BJJA 3LCTA 5CXHA 2YABA 5EHLA 5IH4A 3DFAA 4ZEGA 4U0IA 5EW9A 3UG2A 1W2CA 4CMOA 2PE0A 1PXLA 4Y73A 2B9FA 2QOFA 3HV5A 4L53A 5ANOA 4IWDA 2IW6A 4I1ZA 3RM7A 5J5SA 3MPAA 1XWSA 4O0TA 4Q5HA 3E7OA 2C1AA 3AMYA 4JG8A 5CEKA 3IONA 4LYNA 5C4LA 5FP6A 4ERKA 1WFCA 1SYKA 4XV9A 2VTAA 4DEIA 1KE7A 3MJ2A 2IF8A 5A6OA 3MPMA 3GGFA 2HW6A 3QWKA 4YTHA 4FV5A 1IG1A 2DYLA 4BDIA 5KMLA 4WKQA 3UQGA 3I60A 2G2FA 3BE2A 2UZNA 4JJRA 4YZCA 4N0SA 5L8JA 3CE3A 3H30A 5FLFA 4D2RA 2GFSA 2J51A 5JRQA 2WB8A 4NZWB 2X6EA 5JRSA 4IVDA 5HE0A 3K5UA 1Q3WA 3SLSA 3A7JA 3KEXA 4APPA 4M0YA 2CKPA 4W4XA 1H28A 4UZDA 4E4XA 3MN3A 5IQFA 2VO3A 2R3JA 2YCSA 4J96A 4CG9A 4QYYA 1YDSE 4F64A 4DF3A 3MSSA 4ZZOA 2QR8A 1OKWA 3FDNA 3DU8A 5HEZA 4ACDA 4DG3E 2B4SB 4IMYA 2C68A 3E8NA 4DTAA 3BHHA 3NW7A 5AX3A 2V7AA 4RIXB 2X7FA 3R7GA 5BUEA 3D0EA 1UVRA 1OIRA 4BJJB 5IPJA 2FUMA 2QR7A 4MF1A 4QMTA 4H36A 5CQWA 2HENA 3DY7A 2W4OA 1CKPA 2HXQA 4FODA 4Y85A 4CT1A 5DA3A 3QTQA 4IAZA 4X3JA 3VW6A 1Q61A 2E9NA 1PHKA 2BPMA 2XKEA 3DDPA 4AXFA 4ANBA 3DBFA 5KNJA 4KS8A 3KCFA 4FG9A 3PPKA 3EQIA 4IVCA 5AR3A 4D1SA 5C03A 4AXCA 4QP6A 4EQMA 5M4UA 1BX6A 3HUCA 4NKSA 3TCPA 4OT5A 3R21A 1ST0A 2NP8A 2W9ZB 3V8WA 2R4BA 4EUTA 5LVNA 1Y8GA 4AAAA 5AA8A 3DNEA 4F1MA 3ZBXA 4FSUA 5HG5A 3LFBA 4I4FA 3CD3A 3EQBA 1UU9A 4Y83A 2XM8A 4B0GA 1ZY4A 3FMEA 3F61A 1Q8YA 2RKUA 1J7UA 4O7WA 4U3YA 1UNGA 2WOUA 3D9VA 4QTCA 4YTFA 4BCHA 3TMOA 3OBGA 3BLHA 3OT8A 4JOAA 3CKXA 3MFRA 3RNIA 2YISA 1WBPA 4QP8A 4XMOA 1V0BA 2OJIA 4XG4A 4BFMA 4YHFA 3VS7A 4BCNA 1B38A 2Z7SA 1FPUA 3NUSA 1YXVA 4HPUE 4TWCA 4EH8A 5JGDA 5DI1A 3EQRA 4YUQA 2ZV8A 3ZUVA 2AUHA 2YM7A 5FRIA 1XKKA 4DHJA 3KB7A 2OIDA 3QBNA 4FRFA 5CEIA 3HMIA 5IMXA 4JDIA 3BKBA 3MBLA 4EOMA 4QP1A 4AU8A 2W4JA 5BVDA 3ATSA 3JYAA 1P4OA 5J1WA 3ZEWA 3GXLA 4IC7A 3P23A 1J91A 1PXNA 3BLQA 3BIZA 3ZO3A 4AACA 2OJGA 3PFYA 2PSQA 3M42A 2RG6A 5CEMA 1LEZA 2YZAA 3TV6A 2P33A 4GT5A 5J5TA 3F2NA 4GRBA 3ZMMA 2JEDA 3R30A 4YP8A 5A9UA 2WMRA 3O7LB 5M08A 4LOQA 3LFFA 4PPBA 4FKTA 2QG5A 4YZMA 4IZYA 3TL8A 2C3JA 1LP4A 5HG8A 3Q60A 4BIEA 5FM3A 5CQUA 4CKRA 4L68A 2O8YA 3IGOA 4IX5A 2QODA 3E93A 5DNRA 3DTCA 2ONLA 4MNFA 4QO9A 3VC4A 5I3OA 1GZ8A 4F4PA 5JSMA 3U6JA 3HV4A 3PPJA 5C8KA 2R5TA 4KIQA 2WTWA 4IADA 3W0RA 3ZM9A 2F7XE 3H9RA 2GTNA 4GFOA 4ZLYA 4PL4A 4DA5A 3FKLA 4TPTA 4UXQA 4IJPA 2XARA 4BCMA 1RE8A 1YI6A 4KAOA 4K18A 4FV8A 4M8TA 4RGJA 5DEWA 4PMTA 2RSVA 4RWLA 2W5AA 1L3RE 3NIEA 5CYIA 3ULZA 4DEGA 2PTKA 2R3LA 3PUFC 4KRDA 5DE2A 2C3LA 1W8CA 4AW1A 4FEWA 4FKPA 4FNXA 4FTIA 1VJYA 1NY3A 4WNPA 5FEQA 3RGFA 4O4CA 5J7BA 4U8ZA 1OMWA 3VO3A 3NVMB 3QZIA 3ORKA 2PU8A 4ITJA 4C3FA 3PWDA 4RRVA 3JY9A 5A4QA 1IA9A 2HCKA 5C27A 1YWVA 2W99B 3DKCA 3W0PA 2X0PA 2J4ZA 4BI0A 2R2PA 2BILB 5IA4A 3V5LA 3ENMA 2XK9A 2XYNA 4DITA 3GEQA 2UW4A 5ETFA 2VTNA 3W55A 4ANNA 3L9MA 4I6BA 4OTQA 2CN5A 2XVDA 3II5A 3LM0A 3NNVA 4L67A 4FT3A 5J8IA 3WE8A 1FOTA 4UX9A 3A4PA 4AZFA 4BN1A 4DHIB 3FMDA 1FMOE 2WEIA 3I5NA 3ZSGA 4DGMA 1TKIA 3JR1A 4H3QA 3ORMA 1OL7A 2P2HA 3ERKA 1H01A 4FKUA 4AE9A 3ROYA 3N4TA 3R83A 4GYIA 2Y9QA 3QCYA 3DV3A 4YURA 3ZC6A 4QPMA 1A9UA 4BIDA 3R0TA 3H9OA 4FEVA 3GCPA 3W0OA 4YLLA 2GNJA 2PVJA 4IEBA 1LEWA 2ACXA 3BCEA 3IQ7A 1VYZA 4G5PA 3UNKA 4MWHA 5DR9A 4JQ8A 4LMNA 4UMQA 4DFUA 2IPXA 3E5AA 5TO8A 2GS7A 3TM0A 1H0VA 3DBDA 3FI2A 1JSTA 4LUEA 3PVUA 4O1PA 2R9SA 2PVNA 3VBWA 3M11A 2WQMA 4AOJA 5HESA 4GT3A 4IZ7A 1IEPA 4YJVA 1G5SA 3Q32A 4PMMA 3TZMA 3AOXA 3ZRLA 2UW5A 1GIHA 3FMMA 4UMTA 3TNHA 4OUCA 2QO7A 4AN3A 5L3AA 5J79A 2X81A 3FZRA 5HO8A 5CEOA 4QYGA 3O23A 1P4FA 4E4NA 3E87A 3A99A 2VD5A 3SX9A 4JBOA 3UIMA 1KV2A 1UNLA 5D9HA 3OWKA 4MBJA 5EI2A 4FSQA 1Q3DA 2B53A 4I6FA 3H3CA 4IX4A 4HNFA 5H9BA 4BYJA 1STCE 2HZ0A 2R3MA 2VAGA 4EOOA 4IZ5A 5HNGA 3ZRMA 4DLIA 4Z7HA 5IG1A 4PNKA 3SA0A 3NZ0A 3O8PA 4EUUA 5HX8A 1OGUA 4AFEA 2W4KA 3VHEA 3BYUA 1PRYA 4Z9LA 3ZFMA 5E8XA 4ASXA 4WNKA 3KN6A 3T3VA 4NM3A 3IOKA 3KA0A 5LARA 3MY1A 5GJDA 3Q2MA 3F3VA 2OO8X 4D2VA 3O96A 5T68A 3SRVA 4JX3A 4EH4A 3BWJA 4AQCA 3KMMA 4MD8E 2R7BA 2KULA 5DVRA 4BTMA 3RWQA 4D1XA 3CLYA 2O0UA 2YITA 3MV5A 4HVGA 4UWCA 2GHMA 1ZYDA 4MKCA 4FV1A 2WTCA 4FKGA 4AA5A 2PE1A 4FL3A 4AAYA 4BDAA 2ZM3A 4MVFA 3R7YA 5L2SA 1M2QA 3VONA 4KD1A 3KXXA 4KBCA 2C5OA 4FIEA 2VTSA 4O91A 3C9WA 3HNGA 3KXHA 3LMIA 1VZOA 2EB2A 3QD2B 3WZDA 2QO9A 3OXZA 4KBAA 4V0GA 3DKGA 4XH6A 3LFNA 5HORA 4PTGA 2HY0A 1ZMUA 4DEDA 5KZ0A 2X2LA 3D4QA 3R9HA 3U6IA 1U46A 4NWMA 3QFVA 4F08A 5FD2A 5JGAA 1EH4A 2XNMA 3GCSA 3GU4A 5CNOA 4JIKA 3L8VA 3NYXA 2BALA 3QKLA 4NM7A 5E8TA 1OPLA 4FTKA 4S2ZA 4OAUC 2ZDTA 3THBA 4I5MA 4E20A 3AD6A 1HCLA 4P2KA 1Y91A 2WNTA 1IAJA 4G3EA 4A06A 2XB7A 1WBVA 3CGFA 3R22A 4QOXA 3BLAA 4GW8A 1OL1A 4EKKA 5T3QA 4FZ7A 4OTIA 2WMVA 5EI6A 2W06A 4FL1A 3KL8A 4FICA 3SRVB 2VTMA 5K5XA 1LR4A 3RBWA 3TIZA 4EOLA 4DDIA 5FGKA 4UYNA 2JBOA 3DK7A 4KABA 3UZPA 3WYXA 3UZTA 3GU5A 3NAXA 3BI6A 5A4CA 3U6HA 2V5QA 3ZEPA 4AN2A 4O0SA 3SOAA 2HAKA 3R6XA 2IZRA 2WTJA 4FEQA 4UXLA 1F0QA 2OZAA 2QURA 3R8PA 4L00A 4RQVA 2LAVA 3PLSA 4ZTHA 3VS3A 2IVSA 4E6AA 2VX1A 2XA4A 2WMWA 2DUVA 3NUUA 4NM0A 5AUUA 1PMNA 1YDTE 2ZOQA 3NNUA 3OCTA 4BR3A 2FA2A 3LFSA 3OBJA 4XG2A 3PTGA 3F66A 4ZIMA 5KBRA 4YPSA 3IDCA 1UA2A 3PPZA 4XBRA 2W1CA 2WMUA 4FUYA 4AGDA 4L3PA 4XOYA 3DXNA 4MXCA 4BCOA 1FVRA 1ZARA 2YLEA 5HD7A 5DPVA 3OXTA 4YC6A 3DBQA 4RWIA 5DBXA 3T3UA 5CI6A 3ORZA 2W1FA 4GH2A 4P7EA 3SDJA 4MCVA 4EQUA 4XLIA 5BQ0A 3PP0A 3BQCA 4FTTA 1I44A 3T8OA 4RA5A 5AV2A 2VTHA 5EM5A 3QRUA 3PWYA 4R6VA 3HKOA 3VS5A 3C51A 2VWUA 2QOKA 3U54A 2W7XA 3KVWA 2BRGA 2WFYA 3P7CA 2BVAA 2PE2A 3RPVA 2JDOA 4I6QA 3AGMA 3OROA 4EQCA 5C8MA 5F9EA 2F57A 4KKGA 1W83A 4QQ5A 4JR3A 4E26A 4BDFA 4LV5A 2Z7QA 4QYFA 3ZZEA 4R5SA 3VRYA 1MQ4A 1TVOA 1XBBA 2XNPA 5EDRA 4OR5A 4C4FA 5IQIA 4IAIA 4IQ6A 3ZO4A 2WTIA 1OZ1A 1XH6A 2VNYA 2JITA 3PVGA 2JD5A 3TKUA 3VS4A 4HOKA 3HECA 5JQ8A 3VHKA 3UIUA 2C5YA 2OZAB 3PFQA 3EQCA 5BVKA 2CNQA 5L8KA 2BRMA 2JC6A 3CS9A 4NW6A 2QD9A 5E8SA 1JVPP 5EK7A 4EC9A 5KCVA 4NFMA 3FQSA 2PY3A 3TNIA 3FPMA 2CGWA 3QXOA 2PULA 1YDRE 2IVUA 4H1MA 4O4DA 4DH8A 3IECA 3JVRA 3I4BA 5LQFA 1JPAA 5L4QA 1VLRA 3RM6A 3ACJA 3ZLSA 2AEGA 5IQGA 4FTJA 4N6YA 5J7HA 2DWBA 5AUWA 3CR0A 5HTBA 4IX3A 3DGKA 2BCJA 2W1GA 3BU3A 3LLTA 4YC3A 4TYIA 3P08A 1CMKE 3D5VA 1PMEA 4CCBA 1WMKA 3L8XA 4HZRA 2XF0A 4RPVA 2IO6A 2ONLC 2VWYA 4C36A 3ID6C 5CVHA 3Q5ZA 4BZNA 2I7QA 3F7ZA 3L9LA 5EYCA 1GOLA 2Z7LA 3MW1A 4U40A 3VF8A 5CLPA 4K8AA 4I4EA 2YIWA 4HJOA 5CVGA 4EH2A 1ZYCA 5CAPA 4UMUA 4FKLA 4JDJA 4BTKA 4J7BA 3PYYA 2JDRA 4U43A 4BWPA 2CKOA 1Z9XA 1S9JA 4O0UA 4W8DA 5E1EA 4C59A 4CV9A 4WOVA 5JH6A 4IDVA 5DHJA 4CG8A 2YCFA 5IDNA 4QTEA 5IUGA 3QTIA 4YNEA 4BIBA 4GG7A 3ET7A 2NNWB 4G16A 3GC8A 2R64A 3KCKA 1H1PA 4OTFA 4QMWA 3SG9A 2QOIA 3D2IA 5IQCA 3TWJA 4KKHA 3PRFA 3TJDA 1JSVA 2Q83A 4ANOA 3QZGA 5DEYA 3HAVA 1ZWSA 4HYHA 4I0RA 4C2WA 2XJ0A 5D41A 3ZLYA 4CD0A 3FHRA 3NCZA 4YZBA 4F9BA 2R7IA 5HX6A 2V0DA 5C8NA 3C4ZA 4JQ7A 4BHZA 4L3JA 3EYHA 2RFSA 5E8YA 4F0FA 4M69A 2CNUA 1SVEA 4JG7A 2BHEA 4CGAA 4K0YA 2JFLA 1H4LA 3PXYA 3FLZA 1MRUA 3HMMA 3CY2A 4XOZA 4QRCA 3RAHA 5ITAA 4F6SA 1UU7A 4U9AA 4S33A 5CSPA 2PPQA 4FZDB 2IW9A 4QMXA 3DPKA 2C30A 2YIQA 5H8EA 1QPDA 2AYPA 4FNWA 3VUGA 3KULA 3LXLA 2F9GA 4KSQA 3VQHA 2R3PA 3QHWA 4XBUA 3QRTA 4DGOA 1ZMVA 5DLSA 5HIEA 5HZNA 3DJ5A 5LMKA 3D5XA 3HDNA 3UOHA 2C5XA 4FSMA 4BZDA 2WMTA 4FKVA 4FVRA 2C3KA 3ZSHA 5K0KA 3UVQA 3TUBA 2I6LA 4WO5A 1WBSA 4F09A 4RG0A 4YO6A 2J5FA 3PDTA 3DJ6A 1KOBA 1R1WA 3V6SA 2YM5A 3F3TA 3HLLA 3GQIA 3P1AA 4ZJVA 1OIUA 4QMMA 5ANGA 2JIVA 5IDPA 4D2WA 3FY2A 1F3MC 3W33A 4QQTA 4EEVA 1WVXA 3MS9A 3V3VA 4YLJA 3WF8A 3SG8A 4BHNA 4WNMA 2BR1A 2XNNA 4GJ3A 4I5HA 3ODZX 3LZBA 2XK3A 3LIJA 4U79A 5HVJA 3Q4CA 3G9NA 3SXRA 4QQJA 5CZIA 3RMFA 2OIQA 3CTHA 3BU5A 3FAAA 3A61A 3HX4A 5GJGA 3WF5A 4ZSAA 1R78A 2UZWE 3CP9A 4X2KA 5CSVA 4BTJA 4ZY5A 3AKJA 3DK3A 4P90A 4OTWA 5IA0A 3B8RA 3R9DA 2ITVA 3R02A 3BL7A 3C4FA 4AXAA 1FQ1B 1TZDA 2J90A 5CF6A 1XH7A 4FSTA 4E7WA 4TTHB 3UPXA 3A4OX 4ACCA 1H25A 3CBLA 3Q6UA 1GZKA 2A19B 4M69B 4Y8DA 4V04A 4CVAA 4GKIA 5EG3A 5FTGA 4D0XA 2UVXA 3I5ZA 4M0ZA 5LMBA 3OOMA 1YOLA 2QCSA 2G15A 2B1PA 1W7HA 1MP8A 4IAAA 3HA8A 5GHVA 3NFGB 4GG5A 5AP4A 3G90X 4AXEA 3KULB 4BKYA 3FZ1A 3QD3A 2ZB1A 3LCOA 4YZ9A 3BU6A 3D7TA 5M07A 3ML1A 4L8MA 5HU9A 5J95A 3UODA 4F0GA 5IA2A 4QDVA 2QHMA 5D12A 3PJ2A 3CD8A 4GK3A 1OPKA 3QQLA 4LQMA 5I9VA 3OVVA 2F7EE 4DFZE 2Z02A 3UE4A 3CC6A 3PIZA 3NIZA 5FTQA 4ASEA 4KIOA 4OW8A 5K4IA 4PL3A 4TWNA 3SGCA 4NYEA 4U42A 1GNGA 2UZLA 2WKMA 4O7YA 4FTOA 1IR3A 4TYEA 1G3NA 3OUNB 1Q62A 5E8VA 4FV4A 3NNWA 1G8KA 3HDMA 4XV3A 3TT0A 2GNGA 2IJMA 2ZMCA 3C1XA 5JN2A 2WOTA 2Z7RA 4JAJA 3AKKA 4FT7A 5JFXA 2EWAA 2X9FA 3OCBA 5EH0A 3R7IA 3A60A 4BCKA 1REJA 4JR7A 3VVHA 4I41A 3OEFX 4F6UA 3CKWA 3I7CA 4AE6A 5KMOA 2XH5A 5LVOA 4FIIA 4RLLA 4O21A 2X9EA 4GMYA 4OBQA 4IDTA 4PPAA 4X2NA 3I1AA 4QTDA 1YRPA 3FKNA 3WF7A 2A1AB 2LGCA 2R3KA 3C50A 3ZLWA 4BBMA 2R3RA 3VUMA 1TQPA 1IAHA 3U8WA 4I93A 3BGPA 2WTDA 5KBQA 4D58A 1HCKA 4AA0A 1O6KA 1ZZLA 2B9IA 3KF4A 5B2LA 1V1KA 2HELA 3HEGA 3U87A 4D4YA 3ODYX 4JNWA 2VRXA 5CT7A 5CU2A 1Q8TA 3UGCA 4ALVA 3CJFA 2VTPA 4LRMA 1WCCA 5H8GA 3V01A 2PVYA 3D7TB 3UP7A 4UV0A 3MTLA 3OMVA 4HCUA 4QNAA 3EKNA 3FMJA 3QCQA 3QTZA 2C47A 1RDQE 1NXKA 4BI2A 2IEWA 3E8DA 4ASDA 3H10A 4FTNA 2UZTA 3TUCA 3G9LX 4EKLA 3QC9A 4ZSEA 4F9WA 4D4RA 5IQHA 2E2BA 4RZVA 3Q9ZA 4CCUA 3D94A 3ZTXA 4BCGA 3FZOA 1YKRA 1M7NA 4UB7A 3ZU7A 2YZLA 4YHJA 3V5TA 4HNIA 1M2RA 4WUAA 4L43A 2G2IA 4TRLA 3VS0A 4I92A 4PP7A 4O6LA 3AD4A 4PRJA 5EHOA 2GQRA 5J87A 3W2QA 1J3HA 5CY3A 2VUWA 4D0WA 1XH9A 5LVMA 1YOJA 2GNLA 1OL5A 4Q9SA 5AFVA 1YHSA 4QP3A 3W2PA 1JWHA 4BBFA 3QTSA 2XJ2A 4C02A 3QWJA 2GSFA 3LJ1A 4L3LA 2F4JA 3IG7A 2VGOA 4AW5A 3PJ1A 4FV7A 3V04A 5BYLA 3FC1X 5EOBA 5HI2A 5M4CA 3CPBA 1OL2A 3WZEA 4O0WA 4E73A 3RZBA 4AZEA 4D2SA 3KRJA 3R63A 5CAVA 4JLCA 1XMMA 3AT2A 3BEAA 3QD4A 1K2PA 2QG7A 1WVWA 3UYSA 4P5QA 1OGYA 5IA3A 3D2KA 2PUPA 2IZTA 2JKKA 5CF8A 3OCSA 4O7NA 5AR7A 3WOWA 3OXIA 5AR4A 4LOOA 1QMZA 5KMKA 3TTJA 4ZY4A 2PUUA 4G3GA 4BDDA 1FVTA 2G1TA 3TZ8A 4AT5A 2R3NA 4IAFA 4C37A 3NUNA 4UN0C 3BX5A 2WQNA 1Q99A 3C0HA 4G1WA 3QLGA 4M66A 4ZZMA 4AZSA 4HVSA 5M53A 5EQEA 2PWLA 4E93A 2RFNA 1O6YA 3EYGA 1OITA 1VR2A 1ZOEA 2WTKB 5G6VA 4ACHA 1SM2A 3UOKA 4MH7A 1RQQA 3DLZA 4FTRA 1BLXA 2P0CA 4FG7A 3MDYA 3VNTA 3DDQA 3GI3A 4USDA 3R1YA 3FXZA 3UJGA 3QA8A 2VTTA 3P86A 4LDTA 3GVUA 2C4GA 4WG5A 2BKZA 1OPJA 2WMQA 2XBAA 3OEZA 5IH5A 3VBTA 4LI5A 2XS0A 4PDOA 3RCDA 5EYMA 2ZFYA 5CXZA 4RJ8A 1JSUA 2WMSA 4IC8A 4LL0A 3TXOA 2PZPA 4U6RA 4LMUA 3SXSA 3ZCLA 4FSZA 1XH8A 4WSYA 3FEGA 3F2AA 2R0IA 3FLYA 1XHAA 1U59A 3EIDA 3IO7A 4JRVA 2E9VA 4TXCA 2E9OA 4WT6A 2XNOA 5DWRA 5EDQA 2AC3A 5BVWA 3SW4A 4CFNA 3VBYA 3DTWA 2F7ZE 1FGKA 5A46A 4EBWA 2XK8A 4RX9A 3DA6A 4MBLA 2BMCA 4XCUA 5E1SA 4TYJA 5AUZA 4D2PA 2CGUA 5EYKA 4ZS4A 3WF9A 3C5IA 1W0XC 3ZO1A 4RQKA 5AP6A 4AZVA 4CSVA 3PIYA 1UWHA 5IUIA 3OFMA 4M15A 4V05A 4WA9A 3UTOA 2UUEA 2VWXA 3QRIA 5JFWA 2WMBA 2V7OA 3QX2A 3O17A 4GK4A 4F9CA 2VTRA 4EHVA 4G9RA 3ANRA 4ZY6A 3R1SA 4AW0A 2CCIA 4GL9A 2B7AA 3OTUA 4FNYA 2XP2A 3GC9A 3W8LA 4JBPA 3MFUA 4AZWA 4EZ5A 4DH5A 3GFWA 4C61A 5M4FA 3QLFA 3TN8A 4TYHA 4DFBA 4QNYA 5A54A 2W1ZA 4QP7A 4FTMA 2F2CB 2GHLA 2WTVA 2WMAA 4IZAA 4PV0A 1L8TA 3BYSA 2PZRA 3A7IA 4IJ9A 4E1ZA 5KMJA 4CFMA 3UIBA 2X8DA 3MA6A 5BVFA 5L2TA 2XCKA 4MWIA 3ANQA 4M68A 3R28A 4MHAA 4W9XA 3NRMA 2IZSA 5J9LA 4RMZA 2VTOA 1ZMWA 4V01A 3ALOA 3BHYA