3ZDIA

Glycogen synthase kinase 3 beta complexed with axin peptide and inhibitor 7d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
348
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title 3,6-Diamino-4-(2-Halophenyl)-2-Benzoylthieno(2,3-B) Pyridine-5-Carbonitriles are Selective Inhibitors of Plasmodium Falciparum Glycogen Synthase Kinase-3 (Pfgsk-3)
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 348
sequence length 349
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zdiA01
4Y85A 4IB5A 2QO2A 4EZ3A 3LXPA 3U9NA 4RMZA 1H08A 4JX3A 4AGUA 5IA4A 1LPUA 5HG9A 2YCQA 3OCGA 2WMTA 4MBJA 1R0EA 4MKCA 3PRFA 4B8MA 3CTJA 3AMBA 1BI8A 3NW7A 5J7BA 4QTDA 3MTFA 1U5RA 4FBXA 4BDHA 2GHMA 3RK9A 4EHZA 3HUCA 2ETRA 3VJNA 4C3RA 2AUHA 4QP1A 2UVYA 1IAJA 3ZOSA 2FUMA 4U3ZA 2VNWA 3EZVA 3F69A 2DS1A 3C0GA 4C59A 5CEKA 3PJ1A 4MXXA 3VQUA 1M17A 4FT7A 2YEXA 4LGHA 5M09A 2HZ4A 1BUHA 3BHHA 3E3BX 1TQPA 1WBTA 4J52A 4UMTA 2VWIA 4GV1A 3RCJA 3NVKI 3RGFA 2X8EA 4M0ZA 4NK9A 4M15A 3WZJA 2RG5A 3KF4A 3WZEA 4WG3A 4RX5A 2R64A 3ZFXA 5LOHA 5HD4A 2RG6A 1AD5A 1SNUA 4NW6A 5AAFA 4BZOA 4UYNA 1JLUE 4YSJA 2I1MA 4IB1A 4IJ9A 2J5FA 3LMHA 3DKGA 1VYWA 3REPA 5LXMA 3OCBA 2YDIA 2ITYA 3MB7A 3DNEA 3QTUA 4E4LA 3KULA 4FVQA 5AR8A 4GYIA 3ZZEA 5C9CA 4PTCA 4CKRA 5HORA 4QPAA 5IDNA 2UW9A 4WO5A 1UV5A 4PL4A 3PA3A 4W4VA 3ZLXA 4IE9A 5HKMA 2BVAA 2VNYA 2PVFA 4GMYA 4AWIA 4FIEA 4F7LA 2C5NA 4TYEA 3SLSA 1WBNA 4EJNA 2XB7A 2C5XA 4HZRA 4PPAA 5ANJA 1V0BA 3LFBA 4OUCA 4R3RA 5JFVA 4KKGA 3FQEA 4KB8A 3HLLA 3QA8A 1XR1A 2WQOA 3IK3A 3QCQA 3QHWA 5C8MA 1PKDA 5AR4A 4EKKA 2QR8A 1ZARA 2VWWA 3HNGA 5HG5A 3UMWA 2BTRA 1M2QA 2XK7A 5ANGA 3DTCA 5E8XA 3EMGA 4Q9SA 3RZFA 3ZFMA 2PE0A 4EL9A 3ZM4A 2BIYA 2JAVA 4O1OA 1XBCA 1OIRA 4DFXE 4MD9E 1YDRE 4NM7A 4GRBA 5CF4A 2X4ZA 4QMXA 4CRLA 3H30A 2RFNA 5KMNA 3BHUA 3COKA 1ZMVA 3T8OA 2JITA 5JFXA 4ZTQA 3POOA 3QCSA 4ZSLA 2YIQA 2UW6A 3NAXA 4D55A 2OGVA 4DE4A 3JY9A 4F0IA 5HESA 4HPTE 4QPSA 3ODZX 3BHYA 1Q5KA 1WZYA 4MXYA 3HV7A 3GT8A 3IOPA 4EWQA 2XJ2A 4EJ7A 4IFGA 3N51A 3C4WA 5HVJA 2G2IA 4M3QA 1UA2A 2HENA 3LJ0A 1OB3A 2I6LA 5L2QA 4BCGA 5KBQA 2X7GA 4FX3A 1KUTA 1RE8A 3WZKA 3ZYAA 4XG8A 1IEPA 2OIQA 3Q5IA 4GU9A 3UO6A 4DGMA 5BVKA 5GZ9A 4EH8A 4KUJA 4F7JA 1VEBA 1YOJA 3GQIA 3PSCA 5FQDC 3A8XA 4FKLA 5T68A 1ND4A 2GHGA 4KWPA 5FUTA 4L6QA 3PJ2A 3GB2A 4XHKB 2YJSA 4JDIA 4FV6A 5EI6A 4DFNA 3E7VA 5I3OA 4CKJA 2I0EA 3CJGA 5FTOA 4AW2A 4Y5HA 4BCIA 3HYHA 3DBQA 4JS8A 5FLFA 4ANMA 4ZJVA 3O0GA 4HYHA 4ZJIA 4C3PA 4DA5A 3QQHA 3UMXA 5J9YA 1GNGA 2JEDA 4MH7A 1IA9A 4E6QA 3H3CA 3U55A 5KO1A 4BWPA 1KV2A 3BU3A 5F95A 2RF9A 3RNIA 2YFXA 2C1AA 4HYUA 5C26A 3BHTA 4ZS4A 5HVYA 3QZIA 5JRSA 2X4FA 5IQBA 1PJKA 5JZNA 2VAGA 1ZLTA 4TWCA 2XNPA 3ORZA 3CY3A 2WMSA 4F09A 4GK4A 1CM8A 3MVJA 2OICA 4TTHB 2YERA 5KKRC 3I5NA 3AT2A 4C4FA 4CCUA 5FDPA 4RWJA 2JAMA 4O0UA 1XBAA 3SRVB 3VVHA 3GEQA 4XP2A 2WB8A 2QO9A 2GCDA 2X8DA 4AUAA 3R30A 2BKKA 3U54A 3LW0A 4FV8A 4D4RA 1KE6A 5CT0A 4BY9E 3PP0A 4S2ZA 4YPSA 4FV3A 4YZ9A 5C4KA 4MNEB 4Z16A 1CMKE 1ZYJA 3QYWA 4I24A 3KREA 5IQIA 3MB6A 1IG1A 3QZFA 5FEQA 4G3FA 2I0VA 2PZRA 4GFOA 4IMYA 5DVRA 5HD7A 4OT6A 3UO4A 4M68A 5J9LA 3DDPA 2BR1A 4O81A 3SXSA 4RIWA 2XK9A 3P7CA 4QPMA 3CKWA 4ZK5A 2CMWA 1L8TA 4XS2A 2EVAA 3LFFA 3R04A 3IDBA 4AFEA 3F3VA 4O7LA 2OXXA 5ANDA 4AAAA 4TKSA 4YC8A 3SDJA 1F3MC 4Q9ZA 2UVXA 3OC1A 4FEQA 5E8UA 5BUEA 4IWDA 2Z7RA 3OCSA 4X3FA 3BU5A 4UMQA 3COIA 2YM7A 3UG1A 2BFYA 3MFUA 3BYMA 3MIAA 3BLRA 5JZJA 3NUXA 5C4LA 3JYAA 3ORLA 4FT0A 4HNIA 1OGUA 4TYHB 2FYSA 3RK5A 2VV9A 4GSBA 1QPJA 4ZSJA 4YLKA 3TV6A 2P3GX 3U4WA 4D4VA 3GI3A 2OF2A 2QG5A 3E88A 4ONAA 1ZYCA 3PY3A 2WMUA 3C0HA 3KXNA 3R21A 5DA3A 4H3PA 4IBMA 4PTGA 3HECA 5HTCA 1F5QA 4N0SA 3NUAA 3KRLA 3DJ6A 5JGAA 5B2KA 3COMA 1Q4LA 5AP5A 3HA8A 2VD5A 1H8FA 3R73A 4LV5A 4QQCA 4CKIA 4W4WA 3H4JA 3D4QA 3DK3A 3FXZA 4EWHA 1FOTA 1ZXEA 3IGOA 4GL9A 5CSHA 1RJBA 2W05A 1H28A 3HV4A 2WO6A 4EUUA 3ZS5A 3ZUUA 4BF2A 4BDKA 5IH4A 3UPZA 2WMVA 5C8NA 3DKOA 2VTJA 1W8CA 4QMSA 5EG3A 3LCSA 4MF1A 4BIDA 4H3QA 1H07A 3P7AA 4S31A 5LWMA 1SZMA 3ZEPA 5L6OA 2O8YA 2VU3A 1S9IA 3P0MA 3GVUA 1XH8A 3MPTA 4EQMA 1Y91A 3HDNA 5GHVA 2H6DA 3QC4A 2VTAA 3OY1A 3MFTA 3FQSA 3BWJA 4H1JA 3TKHA 5FXRA 5C27A 5HTBA 2YWPA 3E62A 1FMOE 3EKNA 4U42A 4CLJA 3F5UA 1OL5A 3O7LB 5AM7A 2GFSA 3F9NA 4C2WA 1JBPE 4DEBA 4QMZA 3C5UA 2C1BA 5F1ZA 4C7TA 3GC9A 4FE2A 3O7LD 3WZUA 3QTIA 4IEBA 2PVMA 3A60A 4I3ZA 4OR5A 2UW0A 2QHNA 2YM5A 3D7TA 5KZIA 4FT3A 5AIRA 3RI1A 4S34A 4G3GA 4EH3A 1YWNA 5BUIA 2O3PA 4ZS0A 1UWJA 4D5HA 3PDTA 4F65A 4UZHA 3W55A 4EOSA 3COHA 4CD0A 4ORKA 5JK3A 1XH4A 4DEEA 3CQWA 4DGLC 3NYXA 2V0DA 3MN3A 3VUTA 4F08A 2BALA 3I0OA 3I4BA 4YTHA 3EWHA 4U97A 5JQ8A 2PZPA 5EW8A 3UVPA 4NJDA 3GCVA 4AT5A 3BGPA 3F88A 4W8EA 4CMTA 3RP9A 4Y5QA 4FA2A 2J51A 1XHAA 2Z2WA 3PPKA 2ESMA 4J8NA 3PXZA 2VTMA 3HKOA 4Y73A 4GUBA 3QGWA 3V04A 4FTOA 2OSCA 2ACXA 2VWZA 4KBKA 3CTHA 4OAUC 2OFVA 4O96A 2V55A 1RQQA 3MH2A 4L45A 4X2KA 4HCTA 4IM2A 1KE7A 2J7TA 1B38A 2W1IA 4FKRA 5DT3A 3S4QA 3TNPC 4DBXA 2ITZA 4MX9A 1U5QA 3DKFA 3GCPA 3QWKA 4BCFA 3L8PA 2QOIA 3QAME 2WTCA 2C5VA 2OH0E 2WTWA 4JRVA 4OTFA 4L3JA 4GG5A 4UX9A 1GZOA 2Q0BA 2XNBA 1PXLA 4FL1A 2R3JA 3PFQA 5JGDA 5L8JA 3Q5ZA 1YHWA 4WG5A 4IW0A 2R3NA 3FQHA 4EC8A 4C4HA 2YLEA 3GC8A 3CBLA 3BIZA 4XG6A 3NYOA 4QMTA 3UOLA 4FSNA 3PG3A 3NAYA 3Q53A 5KMKA 4KIPA 3DXQA 3F7WA 4FSWA 2EB2A 3W2CA 4XV1A 3NWWA 3DZOA 4BHZA 1WBOA 3KY2A 4WG4A 4JL9A 4FYOA 2X9EA 3NNXA 3OF0A 2W1DA 1FGIA 2H9VA 4W9WA 1QPEA 2QG7A 2ZOQA 3BLQA 4YZMA 5TOZA 4O7YA 4MD8E 4FSZA 3KMWA 3TV4A 4CFVA 5BUJA 1NT2A 2HAKA 3WZDA 3TZ7A 3EH9A 4K77A 4P4CA 2QO7A 4RA4A 3E64A 5IMXA 1XWSA 4FIHA 4QP7A 4XYFA 4I94A 4QTEA 4BI1A 2ZJWA 5DPVA 5AP7A 4R1YA 3DK7A 4HYIA 5HU9A 1M2RA 5GNKA 2C3JA 2ITNA 5IA3A 4U44A 1HOWA 1A06A 4ENYA 4OT5A 1Q97A 3PIZA 4ASDA 5EI2A 4KSQA 4W8DA 5LWNA 1ZMUA 4IZ5A 5H9BA 4D2WA 3NYNA 4B8LA 1JVPP 1URWA 1OI9A 2C6MA 3A4OX 3ITZA 2P2IA 4Y95A 5EYMA 2ERKA 1PHKA 4IM0A 2CLQA 4DGGA 3NMUF 4ACDA 5HCXA 3AC2A 5D1JA 5BX0A 5M07A 3Q6WA 4FKVA 3L1SA 4JJRA 3U51A 2R9SA 4BDFA 3WIGA 3R22A 3VS7A 4GK3A 4I5HA 4WNMA 4BR3A 2GS2A 4CGAA 2BMCA 4CZUA 2H34A 3E93A 2IPXA 3TZ8A 2VO0A 2Z02A 4GK2A 4QO9A 2OG8A 4WSYA 3DZQA 3N4UA 2IVVA 3MY5A 4FTIA 1DM2A 3BBWA 4LUEA 5EFQA 3R7GA 3VBTA 1NY3A 1TQMA 1Q99A 5FBOA 4FOBA 2DUVA 5HNBA 4RIYB 3RVGA 4LL5A 3EN5A 5CANA 3VS0A 2V62A 3CQEA 2PVKA 2VUWA 4C0TA 4FV9A 3I81A 4C4EA 4YUQA 5J79A 2WEVA 5TF9A 1OPLA 4DITA 3IW6A 1J91A 4E73A 3KCFA 3CXWA 3R02A 5L2SA 2W4JA 2UZDA 3DBFA 3GQLA 2QOKA 4FNZA 4F7NA 5I3RA 3LCTA 3QRTA 5BVFA 2OIBA 5AUWA 3W18A 1H24A 3R7VA 1OPJA 3JS2A 4B7TA 2EXMA 2JDTA 2QI8A 4H3BA 1YKRA 4CLIA 3R1QA 1MRYA 3KF7A 3KU2A 3KFAA 3KXGA 4P2KA 4U8ZA 5BYZA 5HNIX 1R3CA 3FL5A 5M56A 3UIMA 3POZA 3CE3A 3JVRA 3PIYA 2W96B 2BZKB 1TVOA 5CWZA 2GQSA 2XM9A 4MF0A 4ID7A 4XG7A 4E8AA 1JNKA 4KIKB 5EQEA 1PMVA 3K5UA 5CSXA 5E8ZA 1UU3A 4MAOA 3OWKA 5D9HA 3FI3A 1UNGA 4QMOA 4X0MA 5K0KA 5BVDA 1UU8A 3PXQA 2F9GA 3KA0A 4OGRA 3ZBFA 4IC7A 2YABA 5JQ5A 5GZAA 1HCLA 5GJDA 4BWXA 2HWPA 3V5LA 2VWXA 2C0OA 2HK5A 2PTKA 1PKGA 2VO7A 2VTOA 3PUPA 2GNJA 2J0LA 3MYGA 1OBGA 3PY0A 4K8AA 2HOGA 1Q3DA 2QOHA 4JNWA 4ALUA 3OWPA 4G34A 1CDKA 1H0WA 3UIBA 5A4QA 4FV7A 5CU6A 3FMKA 2YAKA 2GNFA 1MQBA 5ANIA 2VWYA 3P7BA 5I9VA 1PYXA 4EH5A 3K2LA 1FVTA 1ZZ2A 4G9RA 4D28A 5CI7A 2J0IA 2XMYA 3LCKA 4RWIA 5FEEA 3SA0A 2J0MB 4NIFB 4E6CA 3R2BA 2O5KA 4IAYA 2VTQA 3Q4UA 3RPSA 5JH6A 2WFYA 3FMJA 3ZLSA 5CS6A 5JN2A 3EQBA 3AT4A 3UJGA 4GJ3A 4IANA 1PXMA 1JPAA 3QCYA 3DXNA 5DBXA 4AZVA 5M57A 2CKPA 4I6BA 1JAMA 4UXLA 2OKRA 3HP5A 4MEDA 5ACBC 3CY2A 5DGZA 5EYCA 3TNWA 4CCBA 2YZLA 2XA4A 3A7HA 2R0UA 2F49A 4A7CA 4CT1A 3GUBA 3PPZA 4I93A 4CTCA 4HVSA 2CDZA 3VS1A 1J3HA 1UNHA 4V0GB 4FKJA 4TYGA 3OWJA 4KS7A 4XJ0A 2AC5A 4K1BA 4I5CA 2Y9QA 4AE6A 3PVWA 4H05A 4M69B 3ZMMA 4MYGA 3KVWA 5K3YA 5D10A 4MHAA 1R78A 2QOBA 3G33A 3CKXA 3R71A 4M67A 4XOZA 2R7BA 4ACCA 2HZNA 4RQKA 4L8MA 2R7IA 4CZTA 2CSNA 3QQLA 3DT1A 3CJFA 2IWIA 1H1QA 1Z57A 2O2UA 1MQ4A 2OJFE 3ZU7A 4DFUA 1PMEA 3EJ1A 4WBOA 4C35A 2EXEA 1UNLA 2YAAA 4KS8A 5H8BA 3VS2A 2GNGA 2XK4A 3PJ3A 4UMRA 4PDYA 1PXNA 2XJ0A 4KABA 3OWLA 1LR4A 2J9MA 2OO8X 2R5TA 2CGUA 3KKVA 1EH4A 1JSTA 1PMNA 3KMUA 4YLLA 2XIZA 5E91A 4HYSA 4B99A 4BRXA 2PYWA 5CU3A 1YQJA 4BBMA 3CR0A 4L42A 3F61A 3OXTA 4PY1A 2VO3A 5CEOA 4FTQA 4YJQA 2J6MA 4YJTA 3R1SA 1GIJA 4G9CA 4C62A 4UMUA 2XKCA 5CQWA 2NP8A 4H36A 4KIOA 4QP2A 5FP6A 3NUNA 4ZJJA 5DEWA 4C61A 2HXLA 3UPXA 5DN3A 3LFCA 3D2IA 4XV3A 4JDKA 4J99A 4X2GA 3SV0A 3P4KA 3ZCLA 5DR9A 3NX8A 4XG2A 1ZOGA 3FZPA 3QKLA 1Y8YA 1KE9A 2B0QA 3LVPA 4BCOA 3OT8A 4LYNA 4QMUA 5DG5A 3TEIA 3VF8A 2JKMA 3LPBA 5L2IA 5JGBA 5ETIA 3RHKA 5CU4A 1ZY4A 4O86A 4AZEA 5GIPE 4PQNA 1Y6AA 3PY1A 4FKIA 4NU1A 1LEZA 1AQ1A 3NLBA 4O7TA 5M4FA 4PV0A 3UVQA 4NT4A 2UW4A 5A4EA 2C3KA 1H1SA 2X7FA 1PXJA 3L8VA 2GNLA 4TYJA 5L6PA 4YTIA 3BRBA 2WTVA 3DB8A 4FZ6A 4LOPA 3VS4A 5J8IA 4WBBB 3UNZA 3O96A 4DN5A 3HAVA 3PVUA 3AQVA 3Q4ZA 1FBNA 2B54A 4AQCA 5KHXA 4NYEA 3BWFA 4IVCA 4RA5A 1A48A 2OI4X 3UOHA 1A9UA 5HE1A 4PUZA 3RNYA 3WYXA 3KGAA 4AS0A 3QRKA 4NH1A 5E4HA 2EXCX 2BIKB 5F9EA 2QOLA 1XQZA 3G6HA 4D1SA 2O63A 3W2RA 2DQ7X 3FZOA 4Z55A 3T9TA 4O91A 1BX6A 2IVTA 2B9HA 3QQKA 5L6WL 4BZDA 4GU6A 5EDRA 5I0BA 3ZTXA 3FBVA 3RCDA 2BUJA 4AGWA 2OZAB 3UC3A 3A7JA 4IX6A 1H4LA 4C4GA 2YM8A 4Z7GA 3NNUA 3D15A 2UW5A 4QMVA 4FK3A 2JGZA 3FKOA 3QQUA 3IOKA 3QHRA 4HPUE 3E92A 3OCTA 4EK6A 3WBLA 2F7ZE 4HVDA 2WGJA 3S0OA 3FAAA 3ZSHA 4OAVB 1Z9XA 2CKQA 5TT7A 4J53A 4BDDA 3WI6A 3ATSA 1YDSE 4EZ7A 3KEXA 5KHWA 3IKAA 4X2JA 5EH0A 4KD1A 5M4CA 2QU6A 2WU7A 5CXZA 1M7NA 4IVDA 1H0VA 3C1XA 1LP4A 3UOJA 3QKMA 4XP0A 3QQFA 4FVPA 5CAQA 4YO6A 2HYYA 2R3FA 2WMBA 5HIEA 4ZOGA 3KMMA 4KIQA 3AXWA 4HJOA 2WQBA 5EQYA 5CEMA 1JOWB 2RFDA 2ZAZA 3R8MA 4TL0A 3GU4A 3OBJA 3FSFA 2WTJA 3BHVA 5EDPA 4RFZA 2YWVA 2JKOA 5BNJA 2BRMA 4FTLA 2G2FA 2C6TA 3CIKA 3MW1A 5CVGA 5HZNA 5T6KA 3ZC5A 2Q83A 3HV5A 5HX6A 3EQCA 3NDMA 5CQUA 3EIDA 3HMIA 4FTAA 5BYYA 2QKWB 1PY5A 3GOPA 3V5QA 5EKOA 1XJDA 4U0IA 4R6VA 4F9CA 2Y4IC 3DAEA 2OJ9A 3ALNA 3B8RA 2X0GA 3CGOA 1P4OA 2JD5A 1O6LA 3QTZA 4ANBA 2CJMA 3BQCA 3ORMA 3AG9A 4J1RA 4M8TA 2P33A 4AW1A 4G16A 2VWVA 3MPMA 4UY9A 1NVSA 3CQUA 4USDA 3ENMA 1WMKA 4ARKA 4A9UA 4EK3A 4ZXTA 4QRCA 5KMOA 5ETFA 5IKWA 4IVBA 3FUPA 3KN6A 5TE0A 2BHEA 3KK8A 3MFSA 4L01A 5A3XA 3MDYA 5J5SA 2Y7JA 1Q8WA 3DJ7A 2R3LA 3I5ZA 2A19B 3FYJX 3PWYA 3A4PA 3PXRA 4OBQA 5H8GA 2IW9A 4UN0C 4DT9A 2EWAA 3UZTA 2ZV7A 2GSFA 3IW4A 4EK8A 2BZHB 3GFWA 4D2RA 3HMPA 1JKLA 3IS5A 2QLQA 2UZTA 3PJ8A 4YBKA 4ITIA 3ZBXA 4F6UA 3BI6A 4AN9A 2XNNA 2VX0A 4WUAA 1MP8A 1ZAOA 3Q52A 5AV2A 5EKNA 4U43A 4CV8A 4ITHA 4GVAA 5EI8A 3I6UA 2B9IA 3NYVA 2QLUA 5CVFA 5LQFA 3KK9A 2QODA 3SC1A 4L44A 3VUKA 1JKSA 4FYNA 1GJOA 2Z8CA 2J0JA 3ODYX 3QBNA 4RT7A 5HLNA 4Y72A 2NPQA 4BKJA 4FG8A 2Y6OA 5L8LA 3LKMA 4P7EA 5FG8A 2OJIA 3VRZA 3BGZA 2WMXA 3UQCA 2A4LA 2YHVA 2WTKB 3LZBA 4QMWA 4K6ZA 4D2PA 4KKEA 4RC3A 5CVHA 3VRYA 2W0JA 3O50A 4FGRA 4NL0A 4G3EA 2PUUA 3G90X 3A7IA 1LUFA 4GW8A 4M97A 4DHFA 4YJRA 4NKSA 4YGAA 5M08A 3EKKA 5GINE 3GOKA 4YZDA 3MA6A 4NTTA 3TUDA 2XKDA 3FJQE 2GNHA 4HGSA 4ZIMA 5HQ0A 4FV5A 4C36A 4XUFA 4OTHA 3O51A 3HVCA 4AU8A 4RJ3A 5GIOE 3PLAE 1Q24A 3EQHA 4G31A 5FGKA 4JDHA 4EOQA 3TJDA 2PMOX 4QTBA 1URCA 4BCHA 2OJJA 1I09A 5AP4A 4BYIA 5IUHA 2FGIA 4BCMA 4RIOA 2BRGA 3QX4A 4QYEA 2WMWA 3JPVA 4MXOA 1GZKA 2OXYA 5A4LA 1XH6A 4R7BA 3V5JA 5IH6A 3QQGA 3ZH8A 1W98A 2OW3A 4R3CA 2ZM3A 3Q96A 5AR5A 3QL8A 1H1WA 3OXIA 4DEHA 1FINA 5EDQA 2NO3A 4N70A 1YW2A 4IFCA 3RTPA 3D83A 5DRDA 2OZAA 4RLLA 1NVRA 1YWRA 2EB3A 4DFZE 3SW7A 3OD6X 1FGKA 4E5WA 4HCVA 4RWKA 3OEFX 3PE2A 4BTMA 1PXIA 3DB6A 5AA9A 2GU8A 2ZVAA 3R8ZA 1CSNA 5FXSA 3SVVA 3HMNA 4NFMA 4EOPA 4AOIA 4KNBA 4IH8A 5EM8A 3HUBA 5LVLA 4IVAA 5BVWA 2PE1A 3ACKA 4IWPA 3LLAA 3OMVA 5AP2A 3F7ZA 2F7EE 3CD8A 3PPJA 2YM6A 3FLQA 4L52A 4MTAA 5HCZA 5FP5A 4ZEGA 1OL7A 1ZOEA 2QU5A 4ZSGA 2XKEA 3VUGA 4BDEA 4FMQA 1OECA 4CYJA 1R0PA 5HHWA 2PVJA 5E8YA 3RAKA 4LOQA 2BDWA 2OH4A 4C4JA 2PMIA 3R8LA 3RHXA 4DH5A 3ORNA 3CCNA 4FV4A 3LQ5A 5AM6A 3L9PA 3IDPA 2VO6A 2C5YA 3LM5A 4EH2A 1MRVA 2A1AB 2FSTX 4YJPA 3W33A 1I44A 4PMPA 3MIYA 4PNIA 3TWJA 4A9RA 2OIDA 5HNGA 3A62A 3FMDA 3IECA 4DG2E 3WF8A 3R83A 2E9PA 4MXAA 1E1VA 4P5QA 1W83A 3VBQA 1G8SA 3T9IA 5HIDA 2ITXA 3QX2A 4O38A 4D4YA 2BDJA 2XM8A 1DAWA 2ITPA 2Q0NA 5F4NA 2XEYA 4RVMA 4ITJA 5BMMA 2UZEA 4ALVA 3HRCA 2VRXA 3EL8A 3KCKA 4MQ2A 1L3RE 5H8EA 4GG7A 2JDOA 3LFQA 5HG8A 4WRSA 4LOOA 4AW5A 3FI2A 3FC2A 4LGDA 5ITAA 2R2PA 4PMSA 3HL7A 4EBWA 5FBNC 5TKDA 5CASA 2WNTA 3BV2A 3QTWA 2X7OA 4G5JA 4UV0A 1YXUA 4II5A 3ZUTA 2ZYBA 5DR2A 3UOKA 4PPCA 2R3PA 3ORKA 4EK4A 4JDJA 3GGFA 4ANLA 4EHEA 4X3JA 3KXHA 3QU0A 3DLZA 4L9IA 4APCA 1J7LA 3DXPA 4LGGA 1CKPA 4UYAA 3DBCA 1GY3A 2QOOA 4RQVA 2Y0AA 4WIHA 3OT3A 4PF4A 5KMJA 3PVBA 3V6SA 4EHVA 4TT7A 3SXFA 3AOXA 3B2WA 3LM0A 4YJOA 4O7NA 2OXDA 3E63A 3SKCA 5B7VA 4ZMEA 1DI8A 2KULA 3BZ3A 5GJFA 4F99A 1M52A 3C4ZA 5E8TA 4EH7A 2W9FB 4CEGA 1YVJA 3KN5A 3EFLA 5AAGA 4BB4A 5CAUA 4TWOA 4DH1A 1JWHA 3RPRA 1O6YA 2EU9A 2WPAA 5K5NA 4U6RA 3NR9A 5A54A 5ANOA 3HP2A 1O9UA 5AP6A 4FC0A 4PNKA 5HCYA 2JDVA 2J5EA 4EORA 4F6WA 4L67A 4FSUA 3VS3A 4YO4A 1OUYA 4AZFA 5HE2A 2W1FA 4JBVA 4A9TA 4ENXA 2R3RA 4Q5HA 3RK7A 2ITUA 3KVXA 3ZDIA 4XEYA 3BYSA 2CPKE 2JIIA 2VX1A 4K18A 4FSMA 2F57A 4EOKA 2VTRA 3I7CA 3QD2B 3RJCA 3Q9WA 3S95A 5CAPA 1YHVA 1G3NA 4YR8A 4S32A 2FSLX 4FOCA 5DEYA 3C13A 2PY3A 4Z9LA 3RZBA 4ZLOA 4FK6A 4O2PA 3FMMA 4X2NA 4F9YA 5CENA 3RM7A 1P2AA 5KUPA 4FIIA 1VJYA 4FTMA 4NCTA 2WMRA 3H9FA 4XG3A 2IW6A 1FVRA 4RJ8A 4M66A 3UZPA 2NRUA 2XF0A 3ANRA 3EHAA 4AZSA 3N4TA 4ACMA 3HRBA 4GEOA 3P9JA 3UG2A 3FL4A 4TW9A 3HGKA 4FSRA 3SRVA 1YXSA 2LGCA 3OTUA 2WU6A 2ZMDA 4OW8A 3VWAA 4YJVA 5HLPA 4B6LA 5EM7A 2WOUA 2G01A 4CMOA 3VO3A 1PXPA 5DFPA 3QALE 3P08A 3ULIA 5I9XA 1YRPA 2WXVA 2YISA 4I6HA 3IO7A 1WBPA 3AGLA 3LFAA 4MNEA 4WT6A 4J96A 4NEUA 2P4IA 4FNYA 2WMAA 1WVYA 3FMHA 1BYGA 2XIXA 3RM6A 3ZLYA 3F3TA 3LFSA 3DFCB 5FD2A 2NRYA 3I7BA 3ORTA 4R8QA 2B7AA 4PL3A 3GCUA 3TIYA 4EYMA 4DCAA 3PRIA 3ELJA 4GIIA 3ZO2A 3PXYA 4EBVA 3OFMA 1K3AA 5IEVA 3VIDA 4Y8DA 2R4BA 4N4SA 4FKPA 4O21A 4JI9A 5TR6A 1KSWA 2HXQA 3OUNB 5HI2A 3E5AA 4AA5A 4TNDA 1QPCA 1MRUA 4ZMFA 2BROA 1OPKA 3PSDA 4C37A 4QTCA 4XRLA 3R9NA 4HOKA 2PE2A 2XCKA 4RJ6A 4FUXA 4IM3A 3Q9ZA 3TI1A 4EH4A 3F5XA 3LFEA 3PP1A 3QTXA 3WF9A 5LMBA 1TKIA 3NW5A 4TYHA 2HZIA 1DI9A 4E20A 2XJ1A 2QQ7A 3P79A 5D11A 4IX3A 1UU7A 4O1PA 4DBNA 5IA2A 3VJOA 1PYEA 4OTQA 3UNKA 5HOAA 3BEGA 4AE9A 4A4XA 3U4UA 5CNOA 3B2TA 4PMTA 2WMQA 4CYIA 1T45A 4WUNA 4FTRA 3TZMA 3ETAA 3IW7A 4RFMA 2VTIA 3LOKA 3P5KA 5DR6A 3VUDA 4CT2A 4L46A 4S30A 1U54B 5LMAA 5BQ0A 2G15A 3CPBA 4C33A 4UMPA 3F3ZA 3TKIA 4U80A 4NCTC 2BZIB 5HE3A 2B1PA 4BCPA 4BICA 4HVIA 5L4QA 1R39A 3GBZA 4UWCA 4FKSA 2V22A 2ZM4A 4WOVA 4X6QC 2AC3A 5DWRA 2VTNA 1DS5A 4XLVA 2W7XA 1OL6A 5AR3A 3IPHA 1PF8A 4R7HA 3W1FA 5HE0A 5IZFA 3TTIA 3GU8A 3KB7A 2V7OA 5CZIA 5FXQA 4D1ZA 5HGIA 4RIXB 3V8WA 4GKIA 4BN1A 4IAAA 1WVWA 5G1XA 5CSWA 3JXWA 3ORXA 2XRWA 4J97A 2XIYA 3AMAA 3FKNA 3K5VA 2OU7A 3G6GA 3VHKA 1BLXA 5HIBA 2XCHA 5AX9A 4DFYA 3ID6C 5IA1A 2ETKA 3QD3A 4J7BA 1JSVA 1WFCA 4BCJA 4BYJA 4O7RA 1IR3A 3OROA 3QZGA 4FKTA 2UZNA 4BDBA 4Z3VA 3TJCA 2RIOA 3D14A 3DA6A 3R7OA 3EZRA 2VN9A 2IG7A 2CLXA 3Q60A 4U81A 4IZYA 4IZAA 3FLWA 3EN4A 3EYHA 5M55A 4ASEA 3FDNA 3HEGA 1CKJA 2Z7LA 2IN6A 2VTLA 3HMMA 4QNYA 5CZHA 3RINA 4R7IA 3F5PA 2R3GA 4FKWA 2HWOA 4MK0A 3DY7A 3WE8A 3K3IA 4BFMA 4DLIA 5KE0A 1P14A 2XIRA 3D2KA 1OVEA 5EOLA 3OEZA 3R9RA 1VYZA 4QOXA 1TQIA 2C6LA 4JBPA 4TYIA 4F64A 3Q2MA 2WD1A 3A2CA 4KAOA 5CNNA 5GJGA 1GIHA 4JR3A 4BTFA 4FTNA 4ZTLA 4F70A 2DYLA 4F1OA 1KOAA 4RX7A 3QQJA 4MCVA 3QGYA 2GPHA 4L68A 4NM5A 4MWHA 4DH8A 2IZRA 1B6CB 4I0TA 3NPCA 5E9EA 3NEWA 2ZDUA 3ZRLA 3PXKA 4O6LA 4BKZA 5I5ZA 3V5TA 3FEGA 4QMLA 3FXWA 4CRSA 2C6KA 3G0EA 4EH9A 3BGQA 5DT0A 2XVDA 5ACKA 2VTPA 5KMLA 3F5GA 3IG7A 5J87A 3SXRA 2CGXA 4C58A 3GENA 4FIGA 5HU3A 3U8WA 1G5SA 5CF6A 5CSPA 3H0YA 2JBPA 1V0OA 2C0TA 2X8IA 3NRMA 4D2TA 2GQRA 2GDOA 1Q62A 3PVGA 2XRUA 4I1ZA 4AZWA 3F66A 3GNIB 3RMFA 3I6WA 3OW4A 4GT5A 1ATPE 4XRJA 3W32A 3QTRA 1H00A 2Y6MA 3ERKA 4D58A 1KWPA 5EYDA 3D5XA 1ERKA 2E9VA 4LRKA 5HO8A 2GHLA 5D7AA 1U46A 2C4GA 1IASA 4AF3A 2OWBA 1Q8YA 2CGWA 4O27B 4FTUA 3TTJA 5FRIA 3G9LX 5CEPA 4X21A 1SNXA 5ANKA 1OKYA 3SX9A 4V01A 2YCFA 2WTIA 4ZZOA 1ZY5A 2X39A 3DQWA 1YHSA 2XUUA 3TNHA 1SVHA 2J2IB 2W1EA 2VZ6A 3C9WA 5CX9A 3R9HA 4A07A 4O7SA 2XKFA 1GZNA 4RX8A 4YMJA 3UYTA 4EOOA 3FC1X 4B9DA 2A0CX 4I4EA 5E8SA 3OY3A 3EQFA 2QKRA 4DCEA 3ZXZA 1H26A 3DV3A 3WIKA 2B9FA 3TDWA 2UZWE 1IRKA 2A2AA 4NTSA 4ZP5A 2W5HA 3C50A 4AFJA 5A14A 1ZYDA 3EQGA 4FSQA 4G3DA 4PPBA 4E3CA 4CG9A 1YI4A 3FKLA 2HZ0A 5DNRA 3VW6A 3RAWA 4C38A 3D5WA 4IX4A 4U79A 5LCJA 2PK9A 2RKUA 4ZZNA 5B2LA 2BCJA 1KE5A 2CGVA 3FHRA 1FMKA 2IW8A 5CXHA 3WARA 3BU6A 1YI6A 3LHJA 3NNVA 3NUPA 2RFSA 1XBBA 4YJNA 5IQEA 4IIRA 3U87A 4U7ZA 4OTGA 2PULA 4XG4A 1Y6BA 1WBSA 1STCE 4FI1A 5K4IA 2IVUA 3PXFA 5JT2A 1GOLA 4AOJA 4GT4A 2ZM1A 5CEIA 3R9OA 5AEPA 5BMSA 3ZM9A 2R3KA 4LMUA 3O71A 4ZY6A 3V3VA 4FUYA 4YTCA 2BAKA 5LVMA 3KULB 4C4IA 1W82A 3TUBA 3QF9A 4L3LA 4NSTA 2XNEA 4OTWA 4AGDA 2GTNA 4X7QA 2JIUA 3MA3A 5IUIA 3IQ7A 4FSTA 4NW5A 4FT5A 2VX3A 1Y57A 3RPOA 4IDVA 3AMYA 3Q2JA 4JG8A 5AV3A 5C1QB 4UZDA 2OZOA 4U9AA 4OTDA 3CPCA 3EFKA 1Q8UA 4AG8A 5IQCA 4EQCA 4FIFA 4PMMA 2FVDA 4L53A 5FDXA 3C0IA 4F9WA 4XMOA 4YJSA 4RVKA 2FSOX 4P90A 4RIYA 4BZNA 2BILB 3GCSA 3BQRA 1YI3A 2PZIA 3EFJA 3PYYA 4RC2A 1H27A 1OKWA 3NIEA 3MVHA 3PE1A 4H39A 3M2WA 3P86A 3C4CA 3K3JA 5E90A 3WE4A 4DG3E 4EUTA 3LQ3A 4JXFA 4CMUA 4EONA 3JUHA 2B4SB 3TNQB 3V01A 4ZLYA 3I79A 5KKRB 5M51A 4FNWA 2OF4A 4GIHA 4JQEA 4IQ6A 4BIEA 2CNQA 5AA8A 2C47A 2BPMA 1PXKA 4WA9A 4FR4A 4FT9A 3VBYA 2X81A 5E1EA 4DEAA 3UZRA 4C8BA 4FTCA 2X2LA 1B39A 2E2BA 5CSVA 2KTYA 4Y46A 2CN8A 5JMSA 3C4XA 3VBWA 4G2FA 3Q4TA 4BL1A 5EYKA 3QFVA 5D12A 4BVUA 4O0XA 3NCGA 4BDGA 3HMOA 2GTMA 3CLYA 4JLCA 3VF9A 3K54A 3MPAA 5E1SA 3NSZA 5EW9A 4Q2AA 5I4NA 3MESA 3EN9A 4IZ7A 3ACJA 1H01A 4JBQA 4RVTA 4ZZMA 3WF5A 2Z60A 5IQGA 2XBJA 4JG7A 2UW8A 4KIKA 4MQ1A 4XV9A 4A9YA 4G6NA 2BZJA 4HNFA 3BKBA 2E9NA 2HY81 4L7FA 4YC3A 4BKYA 2YCRA 3SG9A 1YOLA 1DAYA 1UKIA 3GC0A 5EHYA 3NNWA 4WHZA 2X1NA 2XIKA 3E8NA 3I0QA 4YZBA 4BDCA 4IAFA 1LEWA 2R3MA 2CCIA 4JG6A 4CZYB 2VWUA 3L8SA 3ROYA 4CFMA 2JC6A 4KBCA 2WHBA 3CC6A 4YNOA 4FVRA 3MGYA 1OL1A 4I0SA 5K4JA 4X6RA 2ZDTA 3Q6UA 5CY3A 1ZZLA 4RG0A 5K0XA 5IA5A 4LV8A 1QCFA 4BTKA 5D41A 3EQIA 5EHLA 3HAMA 3PSBA 3FZSA 3HX4A 3O23A 5DH3A 3AD6A 4XH6A 1WBWA 2QOFA 4RJ7A 3QC9A 4G3CA 4MWIA 4TN6A 3D0EA 3Q4CA 1YOMA 3KQ7A 4NIFA 4RPVA 2PPQA 4QMQA 2QURA 3S1HA 5BVOA 2GS6A 2JDRA 4YPDA 3TKUA 5LARA 4O84A 2ETMA 4QYYA 3M11A 4QTAA 3TN8A 2QNJA 3A99A 3BYOA 4L43A 1IAHA 4HZSA 5CU2A 4JIAA 4FSYA 1J1CA 4J98A 4YHFA 3V8SA 1PMUA 3LLTA 3FPMA 2WELA 3CD3A 3LFDA 5AP3A 5LMKA 4RSSA 4DTAA 5J95A 1OMWA 2IJMA 4O6EA 5IQHA 1FVVA 4I4FA 4V0GA 4IXPA 4M0YA 1AGWA 3QRJA 4EH6A 2YIXA 4M69A 2F7XE 2CCHA 4IC8A 4TNBA 3R7UA 4K2RA 4U5JA 3UIXA 3ZUVA 2BFXA 4FEUA 4BDAA 5KCVA 2W99B 4YHJA 5LCKA 1OBDA 3UP7A 5B2MA 4RFYA 2QCSA 2EUFB 5EW3A 4FZDB 4TZRA 3WOWA 4A4OA 4ZTSA 4AGCA 4RIWB 3TXOA 3UDBA 4O83A 3V5PA 2VTTA 4LQMA 2BRNA 1V0PA 3ALOA 5HBHA 3SOAA 5M4IA 2PWLA 1Q41A 2W06A 4EOMA 5HTIA 3QTSA 1KE8A 1M14A 4K0YA 1QPDA 2BTSA 4BCQA 3Q3BA 2AYPA 1BKXA 4I21A 1ZYLA 4X3FB 2GS7A 1FPUA 1OIQA 2BHHA 1E9HA 2XNOA 3O8PA 3G51A 4FKOA 4JBOA 4EC9A 4M14A 3UGCA 1SVGA 4QMYA 3FMEA 3TG1A 4CQGA 4ZTHA 2C69A 4PRJA 3HA6A 3W2OA 3OG7A 4QQTA 4BWKA 4YTFA 5IQDA 3DAKA 2J50A 4D9TA 1BI7A 3NCZA 4CG8A 3G5DA 3KXXA 4QP6A 5D7VA 1K9AA 2ITTA 4F0GA 1JKTA 3E8EA 4I92A 1UWHA 4F9AA 3FYKX 2HW7A 5I9WA 4ANSA 3QUDA 1OIYA 4CQEA 2YLFA 5HO7A 2P55A 5DI1A 5DHJA 5AUTA 3OW3A 1VZOA 4QT1A 5A9UA 3C7QA 2ERZE 4QMMA 3ENHA 4NM3A 2XZSA 3NUYA 2J4ZA 5AP0A 3AC5A 4LM5A 4AA4A 2PVHA 3UBDA 3W8LA 2W4OA 3KRJA 4WNPA 2O65A 2OBJA 4YJUA 3OZ6A 2ZB0A 4DG0E 5J9ZA 4G6OA 1NVQA 4UWYA 3V8TA 5LMKC 4RGJA 4E1ZA 2JLDA 4QYFA 4AXAA 2GQGA 4CSVA 5KMIA 1M2PA 5IISA 3R28A 4DTBA 4JRNA 2QR7A 3VULA 4YU2A 3VN9A 5IMEA 2GMXA 2OJGA 4IAIA 4UWBA 3R2YA 1KOBA 3EB0A 2BRBA 2QOCA 4D5KA 2PVRA 3L9LA 3ZC6A 5CAVA 4EOJA 4FTKA 3LE6A 1OUKA 3OOMA 4L00A 2PHKA 4M13A 3RWQA 3VW8A 4BGQA 4O0WA 4PP7A 3R7EA 3EFWA 1JQHA 2ZMCA 4XV2A 3PA5A 5KBRA 4HGTA 3TM0A 3N4VA 2QHMA 4RLKA 4EK5A 4OBOA 4WSQA 4QNAA 4YNEA 5AAEA 5IA0A 5CT7A 1W7HA 1ZMWA 3AC4A 4NM0A 3UQGA 5A4TA 5H3QA 4WKQA 5ANEA 2JDSA 1BL7A 1O6KA 3OOGA 3AGMA 3HV3A 2OFUA 2UW7A 2FA2A 2QD9A 3FLNC 4IB3A 3BBTB 3DGKA 4C34A 3D7TB 5CLPA 3ATTA 1HCKA 2PVYA 2I0HA 1J7UA 3UODA 5HEZA 3SAYA 3TT0A 4ASZA 3V5WA 5IQAA 5I9YA 3DPKA 1VR2A 4JR7A 4IAZA 1NW1A 3LQ8A 2Y4PA 3A7FA 4GFMA 5EHOA 3CSVA 3E8CA 3P1AA 3EQDA 4ZLZA 2C6OA 4PDSA 2YDKA 2GFCA 2IVSA 3GU6A 2C30A 2XEZA 4JAIA 3W8QA 5HVKA 5J1VA 3G15A 4DGNA 3THBA 4S33A 2ZB1A 5EM5A 4KSPA 2WTDA 4FTJA 1FQ1B 4F4PA 2YM4A 3O2MA 5I9UA 4O82A 1Q8ZA 2YJRA 4YHTA 5IF1A 3OXZA 3ZO4A 3MSSA 2QC6A 3DTWA 3ULZA 4OLIA 3UTOA 4XNEA 2ONLA 2ZV9A 5M53A 4FL3A 5AUVA 5DT4A 3BYUA 2G9XA 5IDPA 3TDVA 5BVNA 3FSKA 4QP9A 4C02A 1PW2A 4Y83A 2DWBA 3UC4A 4UB7A 2R3QA 4B0GA 2PU8A 2UV2A 4ERWA 5IG1A 1H1RA 3O17A 3VNTA 4JX7A 4E5BA 4XX9A 5CALA 5LJJA 3G2FA 4GS6A 2YITA 4GH2A 3MVMA 2SRCA 5EK7A 4R5YA 3ZEWA 2XP2A 4RBLA 2C3LA 4DT8A 3QUEA 2Z7QA 5AR7A 3AT3A 2WQEA 3V51A 4GJ2A 2B52A 2VGOA 3MBLA 5HLWA 4WNOA 4LFIA 2P2HA 2PMLX 2UZUE 3R9DA 3QZHA 3QRIA 4RZVA 4QMNA 4JVGA 4O22A 3BPRA 3I60A 3TUCA 2XBAA 4K33A 3F6XA 1S9JA 4GKHA 5GZ8A 4OTPA 4RZWA 4TXCA 3FE3A 3DAJA 3NUSA 4DFBA 4WRGA 3DKCA 1CTPE 3G0FA 4KKHA 4WNKA 4FV1A 5G6VA 3ZZWA 4O7VA 1V1KA 1OITA 1E1XA 5T3QA 3MH3A 2PUNA 3EL7A 1Q61A 3ANQA 4CVAA 4DC2A 2I40A 2ITOA 3FLZA 4YBJA 3LJ1A 2LAVA 1KV1A 4GT3A 4TWNA 4NKAA 3W10A 2C3IB 1GIIA 3LXLA 4FF8A 3L9MA 3RAIA 4G17A 1YDTE 3EYGA 3QYZA 3GU5A 5CTPA 4D9UA 3R7YA 5LVOA 3D5UA 3R63A 2CN5A 3LXKA 5E8VA 5KNJA 3HZTA 3AC8A 5L8KA 3QKKA 2PL0A 4ASXA 3C5IA 1SYKA 2X6DA 2BKZA 4XOYA 5C01A 3TZ9A 3KRRA 2UZLA 2ONLC 3D94A 3UYSA 3LJ2A 4NWMA 2CKOA 5AWMA 4IDTA 2WIPA 5EM6A 2PZ5A 3S00A 3AC3A 3LCDA 2YM3A 4IX5A 2IZUA 4BDIA 3IDCA 4R3PA 4NJ3A 4O7ZA 5CF8A 2PSQA 3Q04A 4PDPA 5AUZA 3ZRKA 2QVSE 4E5AX 5AJQA 3SW4A 4HVHA 4MBIA 2W5BA 2Z7SA 4LG4A 4EQUA 4DGOA 3NS9A 4ERKA 5DLSA 1Y8GA 4ZAUA 4F1MA 2F4JA 5HX8A 5H2UA 4GVJA 5JSMA 4HVGA 3DS6A 3EQRA 1W84A 4RWLA 3FY2A 4N6ZA 5AUXA 3PG1A 5FEDA 2C5OA 5J5TA 5HICA 1J1BA 3D9VA 3UP2A 4UALA 4CFNA 4X3FC 3KC3A 1WAKA 3EOCA 3U9CA 4TWPA 4YSMA 3WF7A 1Q3WA 1Q8TA 2YIRA 3CS9A 5BVEA 3I1AA 2PZYA 4O0VA 4LMNA 3CTQA 4UXQA 2C6DA 4DAWA 5CU0A 1SM2A 1U4DA 3GU7A 3G9NA 3MWUA 3MJ1A 3QA0A 4OTIA 2REIA 4YC6A 4H1MA 4TRLA 3RPYA 3ZRMA 2FSMX 3F2AA 5A6OA 1XKKA 3LXNA 2X2MA 2VTHA 5TO8A 3GC7A 4R5SA 4DLJA 1SVEA 3W2QA 2E9OA 4ZY5A 2W9ZB 4XBUA 1SMHA 5K5XA 3RWPA 2UZOA 2VGPA 3PJCA 3R6XA 3T3VA 5HBJA 4GFGA 2RFEA 1T46A 2WKMA 3VC4A 4D0XA 4YP8A 5FWKK 4AX8A 4G5PA 4E93A 3R0TA 1PXOA 3E3PA 3PIXA 2E9UA 4PWNA 5JEBA 3QLFA 4PX6A 4BDJA 4Z7HA 4HCUA 3FXXA 4IWQA 2WTKC 5CF5A 4DH7A 2RL5A 4ANOA 2FH9A 4F9BA 3DQXA 1APME 2F2CB 4A9SA 2JKQA 3BEAA 1YWVA 4AZTA 4C2VA 2RSVA 4OBPA 4USEA 1RDQE 1P5EA 4FV0A 3DLSA 3QLGA 4FNXA 4IACA 5A46A 2H96A 2H8HA 3OP5A 3SG8A 5A6NA 3ZSIA 2WQMA 2G2HA 3DU8A 4M12A 5M44A 3ZO1A 3QXPA 3HV6A 3PA4A 5DOSA 4RX9A 4EYJA 2W4KA 3NVMB 4MD7E 2UZVA 4ANNA 3MH1A 3QTQA 2GNIA 1QMZA 3BLHA 4KBAA 4EOLA 2ZV2A 3H9RA 4I23A 2YIWA 3PTGA 5AX3A 4YZCA 2X9FA 3LMIA 5FTQA 3QRUA 2YACA 3FWQA 1REKA 3EN6A 4QD6A 3T3UA 4CFUA 2ZV8A 1GZ8A 3QWJA 4QQJA 3DFAA 5E8WA 4J8MA 4FZ7A 4NUSA 3F3WA 4CV9A 3UVRA 4E7WA 4R77A 3NW6A 5EQPA 1GAGA 4O2ZA 4IAKA 4YURA 1K2PA 5BYLA 2F2UA 4AN3A 3GCQA 2RGPA 4R1VA 5ETCA 4F0FA 3R8UA 1OKVA 3JVSA 4RJ5A 5AV4A 4AOTA 4RRVA 2W5AA 4QP4A 4U40A 4BGGA 4APPA 3LCOA 4CFFA 4CXAA 2FB8A 4FL2A 4L3PA 3F82A 4LRJA 4O0YA 4PP9A 4ZSAA 5KX8A 4FEVA 4BCKA 2PVNA 4V05A 2OK1A 4QYGA 3E87A 2CHLA 3MJ2A 3U6HA 2PUIA 2HY0A 2V5QA 3DOGA 2XS0A 2I0YA 3P23A 3MFRA 5KZ0A 3OVVA 4GCJA 3NUUA 4D1XA 4UEUA 4EKLA 2O0UA 2XH5A 5FM2A 4J95A 4KINA 4BCNA 3R1YA 4G6LA 4MVFA 4K11A 4XP3A 2PUPA 5M4UA 4J71A 3ORPA 3H9OA 3R1NA 5JFSA 4DTKA 4I5PA 3L8XA 2O64A 4I22A 4MXZA 5HBEA 2Y8OA 3TV7A 4A4LA 4NZWB 4ZY4A 2JFMA 5BPYA 3TNIA 4E26A 5AMNA 4E4NA 5JRQA 3DDQA 1CKIA 2XYUA 4Q5EA 3A7GA 3VUHA 1XO2B 4MXCA 3WF6A 3FZRA 3Q9XA 3KXMA 3ROCA 5C03A 1OIUA 2IZTA 3U6IA 2IO6A 2WZJA 4JIKA 4U41A 3JR1A 4I41A 4ACGA 3WYYA 3LAUA 5ETAA 3TL8A 2J0KA 5DMZA 3FI4A 2X6EA 3AC1A 4L7SA 3W16A 5C8KA 2UUEA 1BL6A 4TPTA 3ZO3A 2XYNA 4K9YA 4IWOA 4IJPA 3LIJA 3N9XA 4W4YA 2B53A 4X2FA 3RPVA 3UNJA 4M84A 4ZSEA 3E7OA 3ET7A 2JKKA 4FZAB 1XH7A 3H10A 5CEQA 3O8TA 4NFNA 1J7IA 4O0TA 4R78A 4W4XA 2WEIA 5JFWA 2A27A 4H58A 2YIYA 1XH9A 4HGEA 5AIKA 3FPQA 3UE4A 2V7AA 4FIJA 4ZTMA 3ZHPC 1WCCA 4AW0A 1QL6A 2B55A 3KRWA 4F1TA 5FM3A 3FZ1A 4RVLA 3F2NA 4FODA 5ICPA 4IHPA 4XCUA 4E4XA 4QP8A 1NXKA 1OZ1A 3QD0A 4EEVA 4XBRA 4CFWA 2HW6A 4DEGA 4D2VA 2W1ZA 2QONA 4LRMA 4FG7A 4PDOA 4ZTRA 5F94A 4BIBA 4CFXA 4D4SA 1UVRA 3BCEA 4I6QA 5F20A 4FKUA 3KRXA 3D7ZA 3B8QA 1ZWSA 1XH5A 5EOBA 4EOIA 3BX5A 2I7QA 2W1CA 3FMNA 5DRBA 3RKBA 2Y4IB 3JY0A 3VHEA 3ORIA 3DBEA 3DCVA 4P5ZA 3H0ZA 2B9JA 3QD4A 4QYHA 4ZTNA 4E6DA 3FY0A 4FTTA 1OM1A 3BE9A 4BTJA 4LUDA 5I9ZA 1X8BA 1OKZA 3RALA 4O0RA 2FO0A 1UKHA 2WQNA 2JIVA 2X2KA 3W2SA 4ACHA 3PZEA 3VS6A 3O8UA 1W0XC 3TACA 2XK8A 5IH5A 3DNDA 4DINA 3RAHA 4JQ7A 4FEWA 4QQ5A 4I20A 5IUGA 5E92A 3Q32A 1H1PA 4BI0A 3VQHA 2C0IA 3U6JA 1F0QA 3BE2A 1P4FA 2HELA 3MS9A 3R8PA 3V6RA 4BBEA 5DE2A 2PMNX 3S3IA 4DF3A 2JFLA 4F6SA 2VTSA 1U59A 2WIHA 4FZFB 2BRHA 1UU9A 3IONA 4AP7A 3HRFA 4DYMA 3AD4A 3VBXA 4OTRA 3OUKA 3FLSA 3GP0A 4UBAA 5AV1A 3E8DA 4C3FA 2CNVA 1NA7A 2UW3A 3C4EA 4I0RA 3NZ0A 4YZNA 2C6EA 4ALWA 4AA0A 1YXVA 1RW8A 5L2WA 4BHNA 1U54A 1M7QA 2HCKA 3CEKA 3P78A 2ITVA 3NIZA 5FTGA 3ZLWA 3Q9YA 2CKEA 4PTEA 3FZTA 3TCPA 4N6YA 2G1TA 2IZSA 3IW8A 4F63A 3VUIA 4BBFA 3LFNA 2NNWB 2C68A 3FMLA 1Z5MA 4U3YA 1IA8A 2UZBA 4W9XA 2W17A 3VS5A 3PZHA 3QUPA 4CNHA 3EQPA 3FV8A 4JQ8A 3NGAA 4RJ4A 3MH0A 4E6AA 4F7SA 3DBDA 3MY1A 4FGBA 3VBVA 4RIXA 5J7HA 3SQQA 3BV3A 3FLYA 4JOAA 3QXOA 5AADA 3CGFA 3M42A 4M7IA 3FHIA 4A06A 4JT3A 3ZDUA 5B0XA 5IEYA 4D0WA 4EHGA 3ZFYA 3FI8A 3F3UA 4ANQA 3SHEA 1JKKA 4TY1A 2XK6A 3EN7A 4N57A 4B4LA 3IGGA 5L2TA 3SD0A 3F2RA 3C4FA 3MVLA 3GFEA 3PLSA 4XG9A 4YLJA 4KRDA 4BI2A 3W2PA 4FEXA 4BGHA 3BELA 4CTBA 3OS3A 1ZRZA 2ITQA 3BYVA 4AACA 4O7WA 5AV0A 5HO6A 2ITWA 5CI6A 5JKGA 1YXXA 3SOCA 4QMPA 4FG9A 3UO5A 4E4MA 5AR2A 2HIWA 1H25A 5M06A 5K9IA 3AD5A 1WBVA 4D2SA 5L3AA 2VWBA 5HG7A 3WILA 4FKQA 5AFVA 3DK6A 3KXZA 4HGLA 3VAPA 1REJA 4V04A 4C57A 2BAJA 4KRCA 2R3OA 2YCSA 3R8VA 2XNGA 1R1WA 2WOTA 4QP3A 3VUMA 3ZSGA 3MTLA 2C6IA 2JBOA 2W1GA 1G8AA 4EI4A 5CYIA 4IB0A 3MI9A 5E7RA 4LI5A 1WVXA 3A61A 4IADA 5IPJA 3QCXA 5J1WA 5LVNA 3OHTA 4USFA 5A4CA 4MNFA 5AUUA 4JAJA 2BDFA 3IW5A 1MUOA 4FICA 5CAOA 3OBGA 3R7IA 4FKGA 5AP1A 4PL5A 4MBLA 4DEIA 3II5A 2WAJA 2YZAA 4AN2A 4GUEA 4O0SA 3ZONA 4RC4A 4BC6A 3R01A 5AUYA 2R3IA 4KA3A 3UIUA 5KMMA 2YA9A 4AT4A 1PRYA 3M1SA 4HW7A 5DYJA 3MY0A 2J90A 3MV5A 3TIZA 5IU2A 3KL8A 3RBWA 3SGCA 4DFLA 2OLCA 3PWDA 3GXLA 3L9NA 4I6FA 2QOQA 2W1HA 1OL2A 2XK3A 3DJ5A 4GYGA 4WD5A 3CP9A 1YXTA 3S2PA 4G1WA 3ZXTA 3LMGA 5IQFA 2YN8A 5DIAA 2PVLA 4DEDA 5LVPA 3C51A 2R3HA 4DH3A 2YDJA 3D5VA 1BMKA 2CNUA 4AT3A 3HDMA 1ZYSA 1JSUA 2R0IA 2UVZA 3OTVA 1ZOHA 5IEXA 3R00A 4FV2A 2BAQA 2P0CA 3UQFA 4XLIA 4LL0A 2XNMA 4U45A 4EZ5A 3A8WA 4I5MA
chains in the Genus database with same CATH superfamily
4Y85A 4IB5A 2QO2A 4EZ3A 3LXPA 3U9NA 4RMZA 1H08A 4JX3A 4AGUA 5IA4A 1LPUA 5HG9A 2YCQA 3OCGA 2WMTA 4MBJA 1R0EA 4MKCA 3PRFA 4B8MA 3CTJA 3AMBA 1BI8A 3NW7A 5J7BA 4QTDA 3MTFA 1U5RA 4FBXA 4BDHA 2GHMA 3RK9A 4EHZA 3HUCA 2ETRA 3VJNA 4C3RA 2AUHA 4QP1A 2UVYA 1IAJA 3ZOSA 2FUMA 4U3ZA 2VNWA 3EZVA 3F69A 2DS1A 3C0GA 4C59A 5CEKA 3O5AA 3PJ1A 4MXXA 3VQUA 1M17A 4FT7A 2YEXA 4LGHA 5M09A 2HZ4A 1BUHA 3BHHA 3E3BX 1TQPA 1WBTA 4J52A 4UMTA 2VWIA 4GV1A 3RCJA 3NVKI 3RGFA 1TFFA 2X8EA 4M0ZA 4NK9A 4M15A 3WZJA 2RG5A 3KF4A 3WZEA 4WG3A 4RX5A 2R64A 3ZFXA 5LOHA 5HD4A 2RG6A 1AD5A 1SNUA 4NW6A 5AAFA 4BZOA 4UYNA 1JLUE 4YSJA 2I1MA 4IB1A 4IJ9A 2J5FA 3LMHA 3DKGA 1VYWA 3REPA 5LXMA 3OCBA 2YDIA 2ITYA 3MB7A 3DNEA 3QTUA 4E4LA 3KULA 4FVQA 5AR8A 4GYIA 3ZZEA 5C9CA 4PTCA 4CKRA 5HORA 4QPAA 5IDNA 2UW9A 4WO5A 1UV5A 4PL4A 3PA3A 4W4VA 3ZLXA 4IE9A 5HKMA 2BVAA 2VNYA 2PVFA 4GMYA 4AWIA 4FIEA 4F7LA 2C5NA 4TYEA 3SLSA 1WBNA 4EJNA 2XB7A 2C5XA 4HZRA 4PPAA 5ANJA 1V0BA 3LFBA 4OUCA 3W0SA 4R3RA 5JFVA 4KKGA 3FQEA 4KB8A 3HLLA 3QA8A 1XR1A 2WQOA 3IK3A 3QCQA 3QHWA 5C8MA 1PKDA 5AR4A 4EKKA 2QR8A 1ZARA 2VWWA 3HNGA 5HG5A 3UMWA 2BTRA 1M2QA 2XK7A 5ANGA 3DTCA 5E8XA 3EMGA 4Q9SA 3RZFA 3ZFMA 2PE0A 4EL9A 3ZM4A 2BIYA 2JAVA 4O1OA 1XBCA 1OIRA 4DFXE 4MD9E 1YDRE 4NM7A 4GRBA 5CF4A 2X4ZA 4QMXA 4CRLA 3H30A 2RFNA 5KMNA 3BHUA 3COKA 1ZMVA 3T8OA 2JITA 5JFXA 4ZTQA 3POOA 3QCSA 4ZSLA 2YIQA 2UW6A 3NAXA 4D55A 2OGVA 4DE4A 3JY9A 4F0IA 5HESA 4HPTE 4QPSA 3ODZX 3BHYA 1Q5KA 1WZYA 4MXYA 3HV7A 3GT8A 3IOPA 4EWQA 2XJ2A 4EJ7A 4IFGA 3N51A 3C4WA 5HVJA 2G2IA 4M3QA 1UA2A 2HENA 3LJ0A 1OB3A 2I6LA 5L2QA 4BCGA 5KBQA 2X7GA 4FX3A 1KUTA 1RE8A 3WZKA 3ZYAA 4XG8A 1IEPA 2OIQA 3Q5IA 4GU9A 3UO6A 4DGMA 5BVKA 5GZ9A 4EH8A 4KUJA 4F7JA 1VEBA 1YOJA 3GQIA 3PSCA 5FQDC 3A8XA 4FKLA 5T68A 3UDSA 1ND4A 2GHGA 4KWPA 5FUTA 4L6QA 3PJ2A 3GB2A 4XHKB 2YJSA 4JDIA 4FV6A 5EI6A 4DFNA 3E7VA 5I3OA 4CKJA 2I0EA 3CJGA 5FTOA 4AW2A 2ZFYA 4Y5HA 4BCIA 3HYHA 3DBQA 4JS8A 5FLFA 4ANMA 4ZJVA 3O0GA 4HYHA 4ZJIA 4C3PA 4DA5A 3QQHA 3UMXA 5J9YA 1GNGA 2JEDA 4MH7A 1IA9A 4E6QA 3H3CA 3U55A 5KO1A 4BWPA 1KV2A 3BU3A 5F95A 2RF9A 3RNIA 2YFXA 2C1AA 4HYUA 5C26A 3BHTA 4ZS4A 5HVYA 3ML1A 3QZIA 5JRSA 2X4FA 5IQBA 1PJKA 5JZNA 2VAGA 1ZLTA 4TWCA 2XNPA 3ORZA 3CY3A 2WMSA 4F09A 4GK4A 1CM8A 3MVJA 2OICA 4TTHB 2YERA 5KKRC 3I5NA 3AT2A 4C4FA 4CCUA 5FDPA 4RWJA 2JAMA 4O0UA 1XBAA 3SRVB 3VVHA 3GEQA 4XP2A 2WB8A 2QO9A 2GCDA 2X8DA 4AUAA 3R30A 2BKKA 3U54A 3LW0A 4FV8A 4D4RA 1KE6A 5CT0A 4BY9E 3PP0A 4S2ZA 4YPSA 4FV3A 4YZ9A 5C4KA 2AQXA 4MNEB 4Z16A 1CMKE 1ZYJA 3QYWA 4I24A 3KREA 5IQIA 3MB6A 1IG1A 3QZFA 5FEQA 4G3FA 2I0VA 2PZRA 4GFOA 4IMYA 5DVRA 5HD7A 4OT6A 3UO4A 4M68A 5J9LA 3DDPA 2BR1A 4O81A 3SXSA 4RIWA 2XK9A 3P7CA 4QPMA 3CKWA 4ZK5A 2CMWA 1L8TA 4XS2A 2EVAA 3LFFA 3R04A 3IDBA 4AFEA 3F3VA 4O7LA 2OXXA 5ANDA 4AAAA 4TKSA 4YC8A 3SDJA 1F3MC 4Q9ZA 2UVXA 3OC1A 4FEQA 5E8UA 5BUEA 4IWDA 2Z7RA 3OCSA 4X3FA 3BU5A 4UMQA 3COIA 2YM7A 3UG1A 2BFYA 3MFUA 3BYMA 3MIAA 3BLRA 5JZJA 3NUXA 5C4LA 3JYAA 3ORLA 4FT0A 4HNIA 1OGUA 4TYHB 2FYSA 3RK5A 2VV9A 4GSBA 1QPJA 4ZSJA 4YLKA 3TV6A 2P3GX 3U4WA 4D4VA 4LV7A 4FJVA 3GI3A 2OF2A 2QG5A 3E88A 4ONAA 1ZYCA 3PY3A 2WMUA 3C0HA 3KXNA 3R21A 5DA3A 4H3PA 4IBMA 4PTGA 3HECA 5HTCA 1F5QA 4N0SA 3NUAA 3KRLA 3DJ6A 5JGAA 5B2KA 3COMA 1Q4LA 5AP5A 3HA8A 2VD5A 1H8FA 3R73A 4LV5A 4QQCA 4CKIA 4W4WA 3H4JA 3D4QA 3DK3A 3FXZA 4EWHA 1FOTA 1ZXEA 3IGOA 4GL9A 5CSHA 1RJBA 2W05A 1H28A 3HV4A 2WO6A 4EUUA 3ZS5A 3ZUUA 4BF2A 4BDKA 5IH4A 3UPZA 2WMVA 5C8NA 3DKOA 2VTJA 1W8CA 4QMSA 5EG3A 3LCSA 4MF1A 4BIDA 4H3QA 1H07A 3P7AA 4S31A 5LWMA 1SZMA 3ZEPA 5L6OA 2O8YA 2VU3A 1S9IA 3P0MA 3GVUA 1XH8A 3MPTA 4EQMA 1Y91A 3HDNA 5GHVA 2H6DA 3QC4A 2VTAA 3OY1A 3MFTA 3FQSA 3BWJA 4H1JA 3TKHA 5FXRA 5C27A 5HTBA 2YWPA 3E62A 1FMOE 3EKNA 4U42A 4CLJA 3F5UA 1OL5A 3O7LB 5AM7A 2GFSA 3F9NA 4C2WA 1JBPE 4DEBA 4QMZA 3C5UA 2C1BA 5F1ZA 4C7TA 3GC9A 4FE2A 3O7LD 3WZUA 3QTIA 4IEBA 2PVMA 3A60A 4I3ZA 4OR5A 2UW0A 2QHNA 2YM5A 3D7TA 5KZIA 4FT3A 5AIRA 3RI1A 4S34A 4G3GA 4EH3A 1YWNA 5BUIA 2O3PA 4ZS0A 1UWJA 4D5HA 3PDTA 4F65A 4UZHA 3W55A 4EOSA 3COHA 4CD0A 4ORKA 5JK3A 1XH4A 4DEEA 3CQWA 4DGLC 3NYXA 2V0DA 3MN3A 3VUTA 4F08A 2BALA 3I0OA 3I4BA 4YTHA 3EWHA 4U97A 5JQ8A 2PZPA 5EW8A 3UVPA 4NJDA 3GCVA 4AT5A 3BGPA 3F88A 4W8EA 4CMTA 3RP9A 4Y5QA 4FA2A 2J51A 1XHAA 2Z2WA 3PPKA 2ESMA 4J8NA 3PXZA 2VTMA 3HKOA 4Y73A 4GUBA 3QGWA 3V04A 4FTOA 2OSCA 2ACXA 2VWZA 4KBKA 3CTHA 4OAUC 2OFVA 4O96A 2V55A 1RQQA 3MH2A 4L45A 4X2KA 4HCTA 4IM2A 1KE7A 2J7TA 1B38A 2W1IA 4FKRA 5DT3A 3S4QA 3TNPC 4DBXA 2ITZA 4MX9A 1U5QA 3DKFA 3GCPA 3QWKA 4BCFA 3L8PA 2QOIA 3QAME 2WTCA 2C5VA 2OH0E 2WTWA 4JRVA 4OTFA 4L3JA 4GG5A 4UX9A 1GZOA 2Q0BA 2XNBA 1PXLA 4FL1A 2R3JA 3PFQA 5JGDA 5L8JA 3Q5ZA 1YHWA 4WG5A 4IW0A 2R3NA 3FQHA 4EC8A 4C4HA 2YLEA 3GC8A 3CBLA 3BIZA 4XG6A 3NYOA 4QMTA 3UOLA 4FSNA 3PG3A 3NAYA 3Q53A 5KMKA 4KIPA 3DXQA 3F7WA 4FSWA 2EB2A 3W2CA 4XV1A 3NWWA 3DZOA 4BHZA 1WBOA 3KY2A 4WG4A 3AKJA 4JL9A 4FYOA 2X9EA 3NNXA 3OF0A 2W1DA 1FGIA 2H9VA 4W9WA 1QPEA 2QG7A 2ZOQA 3BLQA 4YZMA 5TOZA 4O7YA 4MD8E 4FSZA 3KMWA 3TV4A 4CFVA 5BUJA 1NT2A 2HAKA 3WZDA 3TZ7A 3EH9A 4K77A 4P4CA 2QO7A 4RA4A 3E64A 5IMXA 1XWSA 4FIHA 4QP7A 4XYFA 4I94A 4QTEA 4BI1A 2ZJWA 5DPVA 5AP7A 4R1YA 3DK7A 4HYIA 5HU9A 1M2RA 5GNKA 2C3JA 2ITNA 5IA3A 4U44A 1HOWA 1A06A 4ENYA 4OT5A 1Q97A 3PIZA 4ASDA 5EI2A 4KSQA 4W8DA 5LWNA 1ZMUA 4IZ5A 5H9BA 4D2WA 3NYNA 4B8LA 1JVPP 1URWA 1OI9A 2C6MA 3A4OX 3ITZA 2P2IA 4Y95A 5EYMA 2ERKA 4AXFA 1PHKA 4IM0A 2CLQA 4DGGA 3NMUF 4ACDA 5HCXA 3AC2A 5D1JA 5BX0A 5M07A 3Q6WA 4FKVA 3L1SA 4JJRA 1OGYA 3U51A 2R9SA 4BDFA 3WIGA 3R22A 3VS7A 4GK3A 4I5HA 4WNMA 4BR3A 2GS2A 4CGAA 2BMCA 4CZUA 2H34A 3E93A 2IPXA 3TZ8A 2VO0A 2Z02A 4GK2A 4QO9A 2OG8A 4WSYA 3DZQA 3N4UA 2IVVA 3MY5A 1G8KA 4FTIA 1DM2A 3BBWA 4LUEA 5EFQA 3R7GA 3VBTA 1NY3A 1TQMA 1Q99A 5FBOA 4FOBA 2DUVA 5HNBA 4RIYB 3RVGA 4LL5A 3EN5A 5CANA 3VS0A 2V62A 3CQEA 2PVKA 2VUWA 4C0TA 4FV9A 3I81A 4C4EA 4YUQA 5J79A 2WEVA 5TF9A 1OPLA 4DITA 3IW6A 1J91A 4E73A 3KCFA 3CXWA 3R02A 5L2SA 2W4JA 2UZDA 3AKKA 3DBFA 3GQLA 2QOKA 4FNZA 4F7NA 5I3RA 3LCTA 3QRTA 5BVFA 2OIBA 5AUWA 3W18A 1H24A 3R7VA 1OPJA 3JS2A 4B7TA 2EXMA 2JDTA 4DHIB 2QI8A 4H3BA 1YKRA 4CLIA 3R1QA 1MRYA 3KF7A 3KU2A 3KFAA 3KXGA 4P2KA 4U8ZA 5BYZA 5HNIX 1R3CA 3FL5A 5M56A 3UIMA 3POZA 3CE3A 3JVRA 3PIYA 2W96B 2BZKB 1TVOA 5CWZA 2GQSA 2XM9A 4MF0A 4ID7A 4XG7A 4E8AA 1JNKA 4KIKB 5EQEA 1PMVA 3K5UA 5CSXA 5E8ZA 1UU3A 4MAOA 3OWKA 5D9HA 3FI3A 1UNGA 4LDTA 4QMOA 4X0MA 5K0KA 5BVDA 1UU8A 3PXQA 2F9GA 3KA0A 4OGRA 3ZBFA 4IC7A 2YABA 5JQ5A 5GZAA 1HCLA 5GJDA 4BWXA 2HWPA 3V5LA 2VWXA 2C0OA 2HK5A 2PTKA 1PKGA 2VO7A 2VTOA 3PUPA 2GNJA 2J0LA 3MYGA 1OBGA 3PY0A 4K8AA 2HOGA 1Q3DA 2QOHA 4JNWA 4ALUA 3OWPA 4G34A 1CDKA 1H0WA 3UIBA 5A4QA 4FV7A 2XALA 5CU6A 3FMKA 2YAKA 2GNFA 4AQKA 1MQBA 5ANIA 2VWYA 3P7BA 5I9VA 1PYXA 4EH5A 3K2LA 1FVTA 1ZZ2A 4G9RA 4D28A 2AEGA 5CI7A 2J0IA 2XMYA 3LCKA 4RWIA 5FEEA 3SA0A 2J0MB 4NIFB 4E6CA 3R2BA 2O5KA 4IAYA 2VTQA 3Q4UA 3RPSA 5JH6A 2WFYA 3FMJA 3ZLSA 5CS6A 5JN2A 3EQBA 3AT4A 3UJGA 4GJ3A 4IANA 1PXMA 4AXDA 1JPAA 3QCYA 3DXNA 5DBXA 4AZVA 5M57A 2CKPA 4I6BA 1JAMA 4UXLA 2OKRA 3HP5A 4MEDA 5ACBC 3CY2A 5DGZA 5EYCA 3TNWA 4CCBA 2YZLA 2XA4A 3A7HA 2R0UA 2F49A 4A7CA 4CT1A 3GUBA 3PPZA 4I93A 4CTCA 4HVSA 2CDZA 3VS1A 1J3HA 1UNHA 4V0GB 4FKJA 4TYGA 3OWJA 4KS7A 4XJ0A 2AC5A 4K1BA 4I5CA 2Y9QA 4AE6A 3PVWA 4H05A 4M69B 3ZMMA 4MYGA 3KVWA 5K3YA 5D10A 4MHAA 1R78A 2QOBA 3G33A 3CKXA 3R71A 4M67A 4XOZA 2R7BA 4ACCA 2HZNA 4RQKA 4L8MA 2R7IA 4CZTA 2CSNA 3QQLA 3DT1A 3CJFA 2IWIA 1H1QA 1Z57A 2O2UA 1MQ4A 2OJFE 3ZU7A 4DFUA 1PMEA 3EJ1A 4WBOA 4C35A 2EXEA 1UNLA 2YAAA 4KS8A 5H8BA 3VS2A 2GNGA 2XK4A 3PJ3A 4UMRA 4PDYA 1PXNA 4QDEA 2XJ0A 4KABA 3OWLA 1LR4A 2J9MA 2OO8X 2R5TA 2CGUA 3KKVA 1EH4A 1JSTA 1PMNA 3KMUA 4YLLA 2XIZA 5E91A 4HYSA 4B99A 4BRXA 2PYWA 5CU3A 1YQJA 4BBMA 3CR0A 4L42A 4DDIA 3F61A 3OXTA 4PY1A 2VO3A 5CEOA 4FTQA 4YJQA 2J6MA 4YJTA 3R1SA 1GIJA 4G9CA 4C62A 4UMUA 2XKCA 5CQWA 2NP8A 4H36A 4KIOA 4QP2A 5FP6A 3NUNA 4ZJJA 5DEWA 4C61A 2HXLA 3UPXA 5DN3A 3LFCA 3D2IA 4XV3A 4JDKA 4J99A 4X2GA 3SV0A 3P4KA 3ZCLA 5DR9A 3NX8A 4XG2A 1ZOGA 3FZPA 3QKLA 1Y8YA 1KE9A 2B0QA 3LVPA 2IF8A 4BCOA 3OT8A 4LYNA 4QMUA 5DG5A 3TEIA 3VF8A 2JKMA 3LPBA 5L2IA 5JGBA 5ETIA 3RHKA 5CU4A 1ZY4A 4O86A 4AZEA 5GIPE 4PQNA 1Y6AA 3PY1A 4FKIA 4NU1A 1LEZA 1AQ1A 3NLBA 4O7TA 5M4FA 4PV0A 3UVQA 4NT4A 3AKLA 2UW4A 5A4EA 2C3KA 1H1SA 2X7FA 1PXJA 3L8VA 2GNLA 4TYJA 5L6PA 4YTIA 3BRBA 2WTVA 3DB8A 5BV3A 4FZ6A 4LOPA 3VS4A 5J8IA 4WBBB 3UNZA 3O96A 4DN5A 3HAVA 3PVUA 3AQVA 3Q4ZA 1FBNA 2B54A 4AQCA 5KHXA 4NYEA 3BWFA 4IVCA 4RA5A 1A48A 2OI4X 3UOHA 1A9UA 5HE1A 4PUZA 3RNYA 3WYXA 3KGAA 4AS0A 3QRKA 4NH1A 5E4HA 2EXCX 2BIKB 5F9EA 2QOLA 1XQZA 3G6HA 4D1SA 2O63A 3W2RA 2DQ7X 3FZOA 4Z55A 3T9TA 4O91A 1BX6A 2IVTA 2B9HA 3QQKA 5L6WL 4BZDA 4GU6A 5EDRA 5I0BA 3ZTXA 3FBVA 3RCDA 2BUJA 4AGWA 2OZAB 3UC3A 3A7JA 4IX6A 1H4LA 4C4GA 2YM8A 4Z7GA 3NNUA 3D15A 2UW5A 4QMVA 4FK3A 2JGZA 3FKOA 3QQUA 3IOKA 3QHRA 4HPUE 3E92A 3OCTA 4EK6A 3WBLA 2F7ZE 4HVDA 2WGJA 3S0OA 3FAAA 3ZSHA 4OAVB 1Z9XA 2CKQA 5TT7A 4J53A 4BDDA 3WI6A 3ATSA 1YDSE 4EZ7A 3KEXA 5KHWA 3IKAA 4X2JA 5EH0A 4KD1A 5M4CA 2QU6A 2WU7A 5CXZA 1M7NA 4IVDA 1H0VA 3C1XA 1LP4A 3UOJA 3QKMA 4XP0A 3QQFA 4FVPA 5CAQA 4YO6A 2HYYA 2R3FA 2WMBA 5HIEA 4ZOGA 3KMMA 4KIQA 3AXWA 4HJOA 2WQBA 5EQYA 5CEMA 1JOWB 2RFDA 2ZAZA 3R8MA 4TL0A 3GU4A 3OBJA 3FSFA 2WTJA 3BHVA 5EDPA 4RFZA 2YWVA 2JKOA 5BNJA 2BRMA 4FTLA 2G2FA 2C6TA 3CIKA 3W0MA 3MW1A 5CVGA 5HZNA 5T6KA 3ZC5A 2Q83A 3HV5A 5HX6A 3EQCA 3NDMA 5CQUA 3EIDA 3HMIA 4FTAA 5BYYA 2QKWB 1PY5A 3GOPA 3V5QA 5EKOA 1XJDA 4U0IA 4R6VA 4F9CA 2Y4IC 3DAEA 2OJ9A 3ALNA 3B8RA 2X0GA 3CGOA 1P4OA 2JD5A 1O6LA 3QTZA 4ANBA 2CJMA 3BQCA 3ORMA 3AG9A 4J1RA 4M8TA 2P33A 4AW1A 4G16A 2VWVA 3MPMA 4UY9A 1NVSA 3CQUA 4USDA 3ENMA 1WMKA 4ARKA 4A9UA 4EK3A 4ZXTA 4QRCA 5KMOA 5ETFA 5IKWA 4IVBA 3FUPA 3KN6A 5TE0A 2BHEA 3KK8A 3MFSA 4L01A 5A3XA 3MDYA 5J5SA 2Y7JA 1Q8WA 3DJ7A 2R3LA 3I5ZA 2A19B 3FYJX 3PWYA 3A4PA 3PXRA 4OBQA 5H8GA 2IW9A 4UN0C 4DT9A 2EWAA 3UZTA 2ZV7A 2GSFA 3IW4A 4EK8A 2BZHB 3GFWA 4D2RA 3HMPA 1JKLA 3IS5A 2QLQA 2UZTA 3PJ8A 4DDGA 4YBKA 4ITIA 3ZBXA 4F6UA 3BI6A 4AN9A 2XNNA 2VX0A 4WUAA 1MP8A 1ZAOA 3Q52A 5AV2A 5EKNA 4U43A 4CV8A 4ITHA 4GVAA 5EI8A 3I6UA 2B9IA 4DHJA 3NYVA 2QLUA 5CVFA 5LQFA 3KK9A 2QODA 3SC1A 4L44A 3VUKA 1JKSA 4FYNA 1GJOA 2Z8CA 2J0JA 3ODYX 3QBNA 4RT7A 5HLNA 4Y72A 2NPQA 4BKJA 4FG8A 2Y6OA 5L8LA 3LKMA 4P7EA 5FG8A 2OJIA 3VRZA 3BGZA 2WMXA 3UQCA 2A4LA 2YHVA 2WTKB 3LZBA 4QMWA 4K6ZA 2X0OA 4D2PA 4KKEA 4RC3A 5CVHA 3VRYA 2W0JA 3O50A 4FGRA 4NL0A 4G3EA 2PUUA 3G90X 3A7IA 1LUFA 4GW8A 4M97A 4DHFA 4YJRA 4NKSA 4YGAA 5M08A 3EKKA 5GINE 3GOKA 4YZDA 3MA6A 4NTTA 3TUDA 2XKDA 3FJQE 2GNHA 4HGSA 4ZIMA 5HQ0A 4FV5A 4C36A 4XUFA 4OTHA 3O51A 4JMQA 3HVCA 4AU8A 4RJ3A 5GIOE 3PLAE 1Q24A 3EQHA 4G31A 5FGKA 4JDHA 4EOQA 3TJDA 2PMOX 4QTBA 1URCA 4BCHA 2OJJA 1I09A 5AP4A 4BYIA 5IUHA 2FGIA 4BCMA 4RIOA 2BRGA 3QX4A 4QYEA 2WMWA 3JPVA 4MXOA 1GZKA 2OXYA 5A4LA 1XH6A 4R7BA 3V5JA 5IH6A 3QQGA 3ZH8A 1W98A 2OW3A 4R3CA 2ZM3A 3Q96A 5AR5A 3QL8A 1H1WA 3OXIA 4DEHA 1FINA 5EDQA 2NO3A 4N70A 1YW2A 4IFCA 3RTPA 3D83A 3KIOC 5DRDA 2OZAA 4RLLA 1NVRA 1YWRA 2EB3A 4DFZE 3SW7A 3OD6X 1FGKA 4E5WA 4HCVA 4RWKA 3OEFX 3PE2A 4BTMA 1PXIA 3DB6A 5AA9A 2GU8A 2ZVAA 3R8ZA 1CSNA 5FXSA 3SVVA 3HMNA 4NFMA 4EOPA 4AOIA 4KNBA 4IH8A 5EM8A 3HUBA 5LVLA 4IVAA 5BVWA 2PE1A 3ACKA 4IWPA 3LLAA 3OMVA 5AP2A 3F7ZA 2F7EE 3CD8A 3PPJA 2YM6A 3FLQA 4L52A 4MTAA 5HCZA 5FP5A 4ZEGA 1OL7A 1ZOEA 2QU5A 4BJJB 4ZSGA 2XKEA 3VUGA 4BDEA 4FMQA 1OECA 4CYJA 1R0PA 5HHWA 2PVJA 5E8YA 3RAKA 4LOQA 2BDWA 4I6LA 2OH4A 4C4JA 2PMIA 3R8LA 3RHXA 4DH5A 3ORNA 3CCNA 4FV4A 3LQ5A 5AM6A 3L9PA 1W2DA 2VO6A 2C5YA 3IDPA 3LM5A 4EH2A 1MRVA 2A1AB 2FSTX 4YJPA 3W33A 1I44A 4PMPA 3MIYA 4PNIA 3TWJA 4A9RA 2OIDA 5HNGA 3A62A 3FMDA 3IECA 4DG2E 3WF8A 3R83A 2E9PA 4MXAA 1E1VA 4P5QA 1W83A 3VBQA 1G8SA 4AXEA 3T9IA 5HIDA 2ITXA 3QX2A 4O38A 4D4YA 2BDJA 2XM8A 1DAWA 2ITPA 2Q0NA 5F4NA 2XEYA 4RVMA 4ITJA 5BMMA 2UZEA 4ALVA 3HRCA 2VRXA 3EL8A 3KCKA 4MQ2A 1L3RE 5H8EA 4GG7A 2JDOA 3LFQA 5HG8A 4WRSA 4LOOA 4AW5A 3FI2A 3FC2A 4LGDA 5ITAA 2R2PA 4PMSA 3HL7A 4EBWA 5FBNC 5TKDA 3PFYA 5CASA 2WNTA 3BV2A 3QTWA 2X7OA 4G5JA 4UV0A 1YXUA 4II5A 3ZUTA 2ZYBA 5DR2A 3UOKA 4PPCA 2R3PA 3ORKA 4EK4A 4JDJA 3GGFA 4ANLA 4EHEA 4X3JA 3KXHA 3QU0A 3DLZA 4L9IA 4APCA 1J7LA 3DXPA 4LGGA 1CKPA 4UYAA 3DBCA 1GY3A 2QOOA 4RQVA 2Y0AA 4WIHA 3OT3A 2A98A 4PF4A 5KMJA 3PVBA 3V6SA 4EHVA 4TT7A 3SXFA 3AOXA 3B2WA 3LM0A 4O4DA 4YJOA 2OXDA 4O7NA 3E63A 3SKCA 5B7VA 4ZMEA 1DI8A 3TYKA 2KULA 3BZ3A 5GJFA 4F99A 1M52A 3C4ZA 5E8TA 4EH7A 2W9FB 2NYAA 4CEGA 1YVJA 3KN5A 3EFLA 5AAGA 4BB4A 5CAUA 3BL7A 4TWOA 4DH1A 1JWHA 3RPRA 1O6YA 2EU9A 2WPAA 5K5NA 4U6RA 3NR9A 5A54A 5ANOA 3HP2A 1O9UA 5AP6A 4FC0A 4PNKA 5HCYA 2JDVA 2J5EA 4EORA 4F6WA 4L67A 4FSUA 3VS3A 4YO4A 1OUYA 4AZFA 5HE2A 2W1FA 4JBVA 4A9TA 4ENXA 2R3RA 4Q5HA 3RK7A 2ITUA 3KVXA 3ZDIA 4XEYA 3BYSA 2CPKE 2JIIA 3P5JC 2VX1A 4K18A 4FSMA 2F57A 4EOKA 2VTRA 3I7CA 3QD2B 3RJCA 3Q9WA 3S95A 5CAPA 1YHVA 1G3NA 4YR8A 4S32A 2FSLX 4FOCA 5DEYA 3C13A 2PY3A 4Z9LA 3RZBA 4ZLOA 4FK6A 2X0PA 3FMMA 4O2PA 4X2NA 4F9YA 5CENA 3RM7A 1ST4A 3UDZA 1P2AA 5KUPA 4FIIA 1VJYA 4FTMA 4NCTA 2WMRA 3H9FA 4XG3A 2IW6A 1FVRA 4RJ8A 4M66A 3UZPA 2NRUA 2XF0A 3ANRA 3EHAA 4AZSA 1G8JA 3N4TA 4ACMA 3W0OA 3HRBA 4FRFA 3P9JA 4GEOA 3UG2A 3FL4A 4TW9A 3HGKA 2XANA 4FSRA 3SRVA 1YXSA 2LGCA 3OTUA 2WU6A 2ZMDA 4OW8A 3VWAA 4YJVA 5HLPA 4B6LA 5EM7A 2WOUA 2G01A 4CMOA 3VO3A 1PXPA 5DFPA 3QALE 3P08A 3ULIA 5I9XA 1YRPA 2WXVA 2YISA 4I6HA 3IO7A 1WBPA 3AGLA 3LFAA 4MNEA 2IEWA 4J96A 4NEUA 2P4IA 4WT6A 4FNYA 1VLRA 2WMAA 1WVYA 3FMHA 1BYGA 2XIXA 3RM6A 3ZLYA 3F3TA 3LFSA 3DFCB 5FD2A 2NRYA 3I7BA 3ORTA 4R8QA 2B7AA 4PL3A 3GCUA 3TIYA 4EYMA 4DCAA 3PRIA 3ELJA 4GIIA 3ZO2A 3PXYA 4EBVA 3OFMA 1K3AA 5IEVA 3VIDA 4Y8DA 2R4BA 4N4SA 4FKPA 4O21A 4JI9A