3ZDIA

Glycogen synthase kinase 3 beta complexed with axin peptide and inhibitor 7d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
348
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title 3,6-Diamino-4-(2-Halophenyl)-2-Benzoylthieno(2,3-B) Pyridine-5-Carbonitriles are Selective Inhibitors of Plasmodium Falciparum Glycogen Synthase Kinase-3 (Pfgsk-3)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 99
structure length 348
sequence length 349
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zdiA01
3GQIA 4QD6A 4DC2A 4EQMA 4FEWA 3CLYA 3AC4A 3IW6A 5HKMA 4S30A 4KRDA 3P0MA 5IDPA 1XBAA 5J87A 2CKEA 3GI3A 3WIKA 2E9OA 2Y4PA 3MFTA 1LPUA 2X2MA 3QCYA 5ETFA 4YGAA 5BVWA 3WIGA 1MRVA 4BZDA 4FTLA 3PXQA 3TTIA 3F2RA 3H9RA 3S0OA 2H96A 4AW1A 5BUEA 5I3RA 2VTOA 5CF6A 4DEIA 4UV0A 3TNHA 2OIQA 3F2NA 3TIYA 3FLZA 3RPRA 2BZIB 4BTJA 3UQCA 3HV3A 1G8AA 4K0YA 4UALA 1PXJA 4W8DA 3M11A 2V22A 3LCKA 1GIJA 1DI9A 2GNHA 4RVLA 3H10A 3KN6A 4EUTA 3UNJA 3IKAA 2G01A 1P4FA 3UZTA 4TYJA 3BPRA 3GCQA 5E7RA 3PY0A 4XMOA 4WT6A 3N4UA 4DCAA 4I1ZA 5C1QB 2B54A 2WTDA 5CTPA 3DB6A 5IH5A 2GQGA 4FSQA 5T6KA 5FXSA 2GTNA 2YISA 2JDOA 4DN5A 2W17A 3EKKA 3L8XA 1M14A 5DBXA 3T8OA 4F64A 3V51A 1Q4LA 3ZEWA 4DEHA 2EXEA 2YIXA 4PL4A 4BFMA 4MF1A 2BRMA 2XJ1A 1J7UA 2C0IA 4ZOGA 3U6IA 4I4FA 4KS8A 5CXHA 5HTIA 4C02A 4FC0A 3R9DA 2VWXA 2XK6A 2VTRA 4EH6A 3UP2A 4XBUA 2EB3A 4NK9A 4YBJA 4K6ZA 4CQEA 4L3JA 1K2PA 5IF1A 3RM6A 1H0WA 4FTOA 5GZ8A 3LXPA 3BGPA 4OTHA 4YSMA 4DBNA 4YZBA 5HVYA 4PP7A 4IWDA 4JG8A 4UY9A 3BYVA 3NUYA 5E8SA 2CKQA 4UXQA 4O1OA 5EYCA 5JZNA 4CTBA 2YCFA 3KVWA 3E8CA 2GNJA 2YIYA 1H0VA 4RJ7A 2WPAA 3S2PA 1PW2A 4YHFA 4IB1A 5BVOA 2P2IA 4L42A 1OPKA 4B9DA 4CSVA 2YAAA 1J1CA 4RA5A 4ZP5A 1YXXA 4U8ZA 4PDYA 3L9MA 5C8KA 3ZSHA 4EOJA 2W4JA 3OEFX 2XKDA 3FYJX 2PWLA 3SDJA 1VJYA 2I40A 2UW9A 4S32A 4F0FA 4H3QA 4XV3A 3MV5A 4O0YA 1IR3A 4IZ7A 4KB8A 5IQHA 3VS7A 3LMIA 4TZRA 3QXPA 3PXFA 2YM4A 3DXNA 2HAKA 3PWDA 3IW5A 2YCRA 2XIZA 4JNWA 5CF4A 3HZTA 1OL5A 4RGJA 5GIPE 4O0UA 4EHZA 5A4CA 2W7XA 3F7ZA 4JDHA 5M51A 4NL0A 2BHEA 1YOMA 2IZSA 2HW6A 3I79A 3LFSA 2ZB1A 1H1SA 4I5CA 4JXFA 3SD0A 3VW8A 3W55A 2J2IB 2RFSA 2J9MA 2XYUA 5FEDA 4M68A 5CU6A 4ZSGA 5AWMA 3ZDIA 3BLHA 3ZO3A 4AZFA 4BYJA 5IEYA 3HAVA 4BDAA 4RLKA 1X8BA 3MPTA 3QKKA 3QRUA 2QU6A 5FUTA 4X3FC 5JN2A 3MVHA 1OIUA 3O0GA 4KAOA 3ZZWA 2OZAA 4AOIA 3CR0A 3GC7A 1H27A 2X8IA 3FY2A 4G17A 3UIUA 5JGAA 1QCFA 3MVMA 3WILA 3FI8A 2ZV7A 4FIIA 4FSUA 3GCPA 5EW9A 4A4OA 4DA5A 4G3EA 2CNUA 4CKRA 2A4LA 5FXQA 1QPCA 4MVFA 2BIKB 1PF8A 1S9JA 4ZEGA 3DZOA 3FYKX 1LP4A 3GU6A 5IH6A 3AD6A 4JX7A 3WZJA 5CEPA 2BILB 3OWKA 3VBYA 4FV5A 3LFDA 1CKPA 4FSYA 4O0VA 2OFUA 1WBPA 3PVGA 4V0GA 3QTIA 4AF3A 3VUIA 2CGXA 3ZRLA 2I6LA 2VTNA 3ORKA 3ALOA 2PVRA 5DH3A 4BTKA 4ERWA 2QR8A 4I4EA 2Z7LA 3C4FA 4M3QA 2VTHA 5CS6A 4ENXA 2VTJA 4RZWA 3C4EA 4YC6A 2ESMA 3QKMA 2VO0A 5E8XA 4AWIA 4E4NA 2WHBA 3FI2A 3JS2A 3V5WA 1M7NA 4JS8A 5EOBA 3GBZA 3W10A 3PVWA 4JQEA 4XG3A 3CC6A 4F65A 3BHHA 4I5PA 2UZWE 4CFUA 5CF5A 3COIA 5EM7A 2HWPA 3D2IA 4IANA 3GEQA 4QYGA 2CLXA 3D5VA 4R5SA 5DOSA 4CFWA 4RVKA 3RP9A 1CKJA 5ETAA 3QLGA 5IQGA 3TKIA 1BI7A 4XLIA 2WMSA 3IDCA 2ZB0A 2HOGA 2IVSA 2XB7A 2XKEA 2YIRA 2VWIA 5J7HA 3Q6UA 4QPAA 1YHWA 4FTUA 4JBVA 4EOLA 3HRBA 2WKMA 4RRVA 5T3QA 3TV7A 3I5ZA 2XK4A 2W1CA 1ZYJA 1UV5A 4AZVA 5LWNA 2R7IA 3R7EA 1TKIA 3DNEA 2F7EE 4M12A 4YUQA 2PK9A 4FSZA 2RFNA 4NFNA 5F4NA 3Q9ZA 4RPVA 3NZ0A 4BCIA 2VZ6A 5BQ0A 3OWLA 3ORIA 5F95A 4CKIA 3NIEA 4BHZA 2ERZE 3G6GA 1T46A 1TQMA 2C3JA 4ACGA 4HYHA 3HMMA 5HX8A 3FUPA 2EXCX 4CG9A 4II5A 4QNAA 2CHLA 4EOKA 2VV9A 3O8TA 5DT4A 3DB8A 2GHMA 5HE0A 1G8SA 3KC3A 2ITPA 4YLKA 5DFPA 1CMKE 4D5KA 4A9TA 3ZC6A 4ANSA 4ANNA 5IUGA 4D4RA 2OO8X 1XQZA 3EJ1A 3P86A 4PY1A 4N6ZA 4KIQA 3VUHA 3Q52A 4GS6A 4ALVA 3LMHA 3TWJA 2UUEA 3AC2A 3JPVA 2ZV8A 5KBRA 4O7TA 3PXKA 4EOQA 3QZFA 3IK3A 5AUYA 3ZMMA 3KXXA 3QC4A 4GEOA 4HGTA 4ACCA 3FMDA 4ZSAA 3VQUA 4ASXA 2IZRA 4YO4A 5J9YA 1JSTA 4B7TA 2XMYA 4IDTA 4FNZA 3AD5A 3LZBA 4J8MA 4RA4A 2R7BA 5D7AA 5BVDA 2WIPA 5CSVA 5CQWA 5DHJA 3DJ5A 3ZONA 1I09A 2HYYA 2OJJA 3V5TA 3HMPA 3PZHA 1JKTA 3K5UA 3IW8A 4G6OA 2BZJA 3ENMA 2CKOA 4OTRA 1BI8A 2JIUA 3UC4A 4ZTHA 3ORLA 2PVLA 3HRFA 4DGNA 5CEKA 1U46A 3DCVA 4ZXTA 3QD3A 4ANOA 4BCQA 3TL8A 4QOXA 1ZYDA 2XK3A 4Z7GA 3D0EA 5DR2A 5HEZA 2O65A 4QPMA 5KUPA 3IECA 5HCYA 4O2ZA 2J0IA 3U8WA 3JVSA 2WOUA 2E9VA 2YCSA 3AMAA 5CNNA 2YJRA 4JIAA 5HD7A 4C35A 3Q4UA 1OKZA 4U5JA 1KE7A 5J1WA 3NUSA 1OBDA 3C13A 5CEQA 1XH9A 2B9FA 3NVKI 5EQPA 5IA0A 4AZTA 2IO6A 5HO7A 4WUAA 1JSVA 2O63A 3T3VA 5IZFA 1PYXA 3OROA 3D5WA 4TKSA 5HO8A 2XIRA 5I9YA 2QOHA 2VWZA 4RQVA 4MCVA 1MRYA 3LW0A 4FNXA 1NVQA 3LM5A 4L44A 5CAQA 2YDIA 3MA3A 4OTDA 4Y85A 2NRYA 3MB7A 3U6HA 3Q5ZA 4O38A 4QMPA 3SX9A 1U4DA 5J7BA 4KSPA 2WIHA 1NA7A 3MY1A 3P7AA 4UB7A 3PP0A 4FK3A 1M2QA 4YZNA 4FV3A 4BBFA 3GVUA 2OZOA 4F70A 3BBWA 5DE2A 5AR3A 5C27A 5IQDA 2E9UA 4TYGA 2BROA 2YITA 3BV2A 1SMHA 4R3CA 4C36A 3VN9A 4LG4A 3L1SA 1WBNA 1H01A 3CP9A 3DS6A 3ORZA 3R02A 4FZAB 4JAIA 4BCMA 2PVJA 3TKUA 2BALA 5E91A 3QCXA 4YURA 4BCNA 3PWYA 1OZ1A 2ZMDA 4RX8A 2VWVA 4DFBA 3LXKA 4AN2A 4CZYB 2J5EA 4I93A 1QPEA 1OITA 3G90X 3IQ7A 4EH2A 5CVHA 3AOXA 3L9NA 4HVDA 3P1AA 2ZMCA 5C8MA 4R7HA 3VQHA 3ULIA 2CGUA 4EH7A 3PIZA 5H3QA 3NW5A 5F9EA 3FXXA 4AGDA 2YDJA 3Q2MA 5LWMA 4PTGA 2R3FA 4WRGA 1Q62A 4W9XA 4PRJA 3SQQA 3MPAA 2O64A 5IMEA 4CZUA 1OKVA 4BCJA 4OTWA 2ITTA 4FKOA 4NEUA 5EK7A 2OF2A 3R7UA 4AGWA 5EQEA 3ORNA 1Q5KA 2XVDA 3BYMA 3L8VA 3IDBA 3QKLA 5JGBA 3VS6A 3ZUUA 5HESA 4D9TA 2HIWA 5GJFA 4GW8A 2J5FA 3C4CA 5TE0A 4U40A 4YNEA 1XO2B 1VYZA 2VO3A 4J98A 4O2PA 1OIYA 5EG3A 4BWXA 4FSMA 5EQYA 2C4GA 4BL1A 3P9JA 3RNYA 4PMMA 4MBJA 3W33A 4V04A 2PE2A 1FVTA 3EYGA 4EQUA 2EVAA 4QP4A 4XX9A 3MSSA 3SA0A 3ZSGA 3FKOA 2A2AA 1Z57A 4P2KA 5AR7A 4DFUA 2XM9A 3R1QA 1Q3DA 4BHNA 4G5PA 3PZEA 4BY9E 4EOPA 1ERKA 1YXUA 2X6DA 4QP9A 2IVUA 3RHKA 3HA6A 4WSQA 2BFXA 2IZTA 4GIHA 3ZH8A 4O7RA 2QD9A 2G2FA 3RGFA 2UZEA 3UBDA 5J9ZA 2YLEA 4N4SA 3DXPA 3LAUA 4G34A 1YWRA 5HQ0A 3KB7A 2PU8A 1QPJA 4R7IA 3JY9A 2X7OA 2XNEA 4M7IA 1TQIA 2QLQA 5KMMA 3UQFA 3R0TA 1KE9A 2G1TA 4ERKA 2GNLA 3ODZX 4K2RA 4ONAA 5AP6A 4AAAA 4YC3A 4CD0A 1W8CA 2J51A 4EQCA 3V5QA 2IG7A 3QTQA 3FDNA 3ZFXA 4FKWA 5IISA 4U79A 3O17A 1XBCA 4J71A 4JBOA 1MP8A 1FGKA 2VWBA 4I5HA 5AMNA 3OCBA 4H3PA 3UQGA 5HG8A 4BDEA 1JKKA 3RAKA 3LXLA 5I4NA 3E8NA 1DAYA 4DH1A 4YJUA 3ZS5A 4I6BA 2OJIA 3WARA 3DDPA 2IVTA 3CCNA 3EMGA 4DAWA 3UYTA 4FT0A 2B9HA 4LQMA 2KTYA 3BLRA 4FTMA 2QOQA 3Q4TA 4M13A 5TT7A 4DFLA 3NAYA 5JRSA 4CZTA 5IA1A 4O81A 1J91A 2Y4IC 1HOWA 5AFVA 2XBJA 3A8WA 3PIXA 3KXHA 4RX5A 3GC8A 4A07A 2FSOX 3G6HA 5E8ZA 4DEDA 5I0BA 3F5GA 1SYKA 4O86A 3FV8A 3K54A 3M42A 3EQPA 4GL9A 3UTOA 4ANQA 1PKDA 3GGFA 4F6WA 1W82A 4UWYA 4MNEA 2C6EA 4LV5A 4IM2A 3OCTA 3QQJA 4YJQA 3OC1A 2HW7A 1NT2A 3VC4A 4R1VA 5HE3A 4QMMA 4H05A 4XEYA 4D4YA 4ZLZA 1OL2A 4WG4A 5C4KA 4E5BA 2PMNX 4K1BA 5FG8A 4BDDA 2C30A 5CEOA 4IX3A 2C69A 1ZARA 3VBXA 4CTCA 1YHVA 1BX6A 4ZLYA 5L4QA 5J8IA 2E2BA 3MJ2A 4O21A 2WTJA 5M4UA 4O7YA 5CZHA 4LMNA 4RIWB 5EFQA 5E8TA 4DFZE 3OUKA 1YOJA 2ITXA 4O1PA 3LFEA 2JDTA 2VNWA 2C5YA 3FKLA 4JQ7A 4FEVA 2P33A 3EFWA 1XHAA 1P4OA 3WOWA 3KU2A 3OY3A 3ZUVA 4BB4A 3UIXA 2WO6A 1JKSA 4IAAA 3SXFA 4O83A 4FT7A 4DBXA 3R1NA 2HY81 4YSJA 3KMMA 3RALA 1ZYLA 4R7BA 2R0UA 2PZIA 2OWBA 2GS6A 2HCKA 5D41A 1JBPE 3R83A 3RPYA 3QTSA 5BPYA 3UVQA 4M15A 4F9BA 4XP2A 2FSTX 3R2YA 1FMOE 2KULA 4UXLA 4R8QA 5B2KA 4AN9A 1ND4A 4X6RA 2NPQA 3NUUA 2XEYA 3VS3A 5KMLA 3AC8A 3GXLA 3VUGA 2OFVA 5AV1A 1K3AA 2VNYA 4IX6A 2G2IA 3MVJA 3FE3A 4M67A 3MW1A 4I0SA 4MXYA 4KA3A 3SKCA 5L2QA 2Y0AA 3GU7A 5EKOA 2F7ZE 3Q3BA 3HV5A 5DR9A 1PXNA 5EHLA 5CSPA 2C5VA 3E64A 5C26A 2X2LA 3IG7A 3Q9WA 4FL3A 4DGGA 1OB3A 3OT3A 1M7QA 5IA4A 5M53A 4C57A 3BZ3A 3DKCA 3H3CA 2VU3A 3QYZA 3BGZA 3L8PA 4NZWB 4Z55A 4XUFA 3ZOSA 2E9NA 5HE1A 2YWVA 4IAKA 3HNGA 4EH3A 5I9VA 2CDZA 3R30A 5KX8A 4MKCA 4ZSEA 2ZDUA 1IASA 4GV1A 4F9CA 2VTQA 3FZPA 4NUSA 2GFSA 3VHKA 3EFJA 3FLQA 5IUIA 4AW0A 3R7VA 2V7OA 2YACA 5E92A 3U6JA 3DBCA 2WMQA 4QMOA 4FTJA 5E1EA 4D4VA 2EU9A 2YM5A 1U59A 2X9EA 3O71A 4HJOA 1RJBA 3FZSA 4Y5QA 5E8YA 3UJGA 3TUCA 4H1JA 4UX9A 5M07A 2WEIA 3GOPA 3NYOA 4J53A 4L46A 3BYOA 3WF8A 3OBJA 5FBNC 1WBWA 4ZMFA 2X7GA 3AG9A 3B2WA 3CTHA 2JFLA 4RQKA 5FTQA 5HG9A 3V5LA 3F69A 4FE2A 5JGDA 1FBNA 2HZNA 3VS5A 4JDJA 2QKRA 1ZMVA 3GENA 1XH5A 4E5AX 5D7VA 4DF3A 3LJ0A 2QOOA 2GTMA 4NTSA 2PVNA 4QP8A 3F3ZA 5CSXA 5AM7A 5K3YA 2XNBA 3HUCA 3LVPA 4CFNA 5IQCA 1KV2A 2JIVA 2LGCA 4FGBA 4RMZA 1SVEA 4GMYA 4I24A 4LYNA 2F9GA 3R22A 2WZJA 3U9NA 3WZUA 3D94A 3TZMA 4OTFA 4A9RA 4Y83A 4CFVA 2VTAA 5BYYA 5EDRA 1ZZLA 2OBJA 3EFLA 4JX3A 4TYHA 5HLPA 2J0MB 4ZS4A 3I0OA 1LEZA 3MGYA 3NNUA 3IOPA 4G6NA 4FTNA 4M66A 3EIDA 5EDQA 2PUNA 2R9SA 3R7GA 4FV9A 4GUBA 3HKOA 4FBXA 5HBEA 1PXOA 4OT6A 1YDTE 5AAFA 3QX2A 4TT7A 2VAGA 4LGHA 4RWIA 4O0WA 5AR4A 3LQ5A 4ZLOA 2HY0A 2ITVA 1F3MC 1K9AA 4GT3A 4IXPA 5AP3A 3P78A 4PMTA 3BYSA 3VBQA 2PULA 4IIRA 3PVBA 4TYEA 3FMHA 3TUBA 4OAVB 3QUDA 3DAJA 1KWPA 4ZS0A 4D2TA 4MWHA 1FQ1B 2ITQA 5LVMA 1GJOA 1PKGA 4CYJA 2F4JA 5FWKK 4U3YA 4D58A 2A0CX 4E26A 2WMXA 5AX9A 1YXSA 4Z7HA 4CGAA 2VTPA 2R3GA 2C6OA 2UW4A 1PMUA 4G6LA 3NUXA 3VBTA 5T68A 4YR8A 3HP2A 4JR3A 3H9OA 3NX8A 2A1AB 2JFMA 4C4IA 4C62A 1S9IA 3ACJA 1XWSA 3RHXA 5GINE 1WMKA 4X2JA 4F9WA 3MY5A 4X2GA 3ZU7A 1AGWA 3DOGA 4KIPA 3UE4A 3DBDA 4K18A 2W1ZA 4FMQA 3OXIA 4B8MA 3LCOA 3FBVA 3GT8A 3LCSA 2R3RA 5FM2A 5CLPA 5LCJA 2CKPA 5C01A 4ZJVA 3AT3A 5IKWA 4RSSA 2XUUA 2OG8A 5JH6A 1KUTA 5CAOA 3OOMA 3F5UA 3FMJA 3AC3A 2RKUA 2QOCA 3CPBA 3FZOA 3QF9A 4GJ2A 5CI7A 3KKVA 2WEVA 3B2TA 1YHSA 2A19B 4QMTA 5CT7A 2YFXA 4FK6A 3LJ1A 5IG1A 4YJNA 2HZ0A 5TOZA 5BVKA 3OXTA 3C5UA 4CNHA 1GZOA 3P79A 4HGLA 3TI1A 4NW6A 4ZY5A 5FTGA 1UU9A 4FKSA 4KSQA 4OBOA 2GQSA 4RBLA 2B52A 3BWJA 4USEA 3RAIA 2XNNA 4AXAA 2XIXA 4L52A 1STCE 2CPKE 1YW2A 2BFYA 3PPJA 4QPSA 3HDNA 3R1SA 4RLLA 4F1OA 3CGFA 4FKGA 4FTQA 3ROYA 4HVGA 3T3UA 1FINA 3VRZA 3ZFMA 4UYNA 4I22A 1R39A 3HDMA 1AQ1A 2QOFA 3I60A 3ZLYA 4FV4A 3V8WA 4UZHA 3JVRA 3TDWA 1Y6BA 3BBTB 4DEEA 3F61A 3HEGA 3KXNA 4K33A 4EK8A 4IM0A 1FVVA 1JQHA 3DLZA 5J79A 1KOAA 4WNMA 2BMCA 3C51A 3EOCA 4IC8A 5FM3A 4C0TA 5E9EA 4FKIA 4FV8A 4AZWA 5LOHA 4DG3E 3PRFA 4W8EA 3QRIA 4M8TA 4U7ZA 5AV3A 3GQLA 5JQ5A 4FV6A 4DH5A 1MQBA 2W05A 1E9HA 4FEXA 4OAUC 3NPCA 4RWLA 4YJPA 3OS3A 3BHVA 4G1WA 4L3LA 5AAEA 2JDRA 4B6LA 4Z16A 3T9TA 3MH3A 5BUJA 5IA2A 2RG6A 3OUNB 3AD4A 4NFMA 3W2SA 4HGEA 5KZIA 3FEGA 3VWAA 2OJFE 3AC5A 4FR4A 3ZLXA 3NR9A 3DA6A 3OEZA 4HNIA 3MIAA 3KRRA 2XZSA 3COKA 4ALWA 2WQEA 4J8NA 4D0XA 2AC5A 5IH4A 5JFWA 3FC1X 4B8LA 3CS9A 4E20A 3O23A 4L45A 4XV1A 3RI1A 3U9CA 2J90A 2YEXA 5JSMA 4LV8A 3RINA 3UPXA 1R0EA 3OG7A 2JKOA 2QI8A 3N9XA 1OIQA 3FZTA 4U6RA 4E4MA 3RNIA 2O5KA 1UKHA 2GPHA 3NYXA 2YDKA 4KABA 5DGZA 3ZCLA 5BX0A 1H25A 5DYJA 1Q8WA 5DMZA 5GJDA 4DT8A 2W5HA 2W1IA 2R0IA 5DWRA 3ZHPC 4M0YA 1WBSA 3R1YA 4C4JA 4EJNA 4O7VA 3R7IA 4RFYA 4UMUA 1NW1A 2OW3A 2V7AA 2UZVA 5D1JA 4WSYA 4JDIA 3TXOA 4F99A 1PXMA 4USDA 5HNGA 3IDPA 2VGOA 4O7NA 4P7EA 2IW9A 2C47A 2YJSA 3O51A 3NGAA 4U97A 4FEUA 2B1PA 5IQEA 4NU1A 5A14A 3I6WA 3PLSA 3EL8A 3TZ9A 5A4QA 5AA9A 2PE0A 3VS4A 3SG8A 2JDSA 4FT5A 3TJCA 5KNJA 1IAHA 3A7FA 4AW2A 3KK9A 4AA5A 3MBLA 4ZY4A 2Z02A 5HBJA 3P7BA 3U54A 2Z60A 3DPKA 4FNYA 1H1RA 2WMRA 1PMVA 4AOJA 2GDOA 3AXWA 5H8EA 4FG8A 4CCUA 3D5XA 4JRVA 4HYUA 4D0WA 2R3JA 3FMMA 3BWFA 2CGWA 4RC3A 2YIQA 3OW4A 3CY2A 4V05A 2WAJA 3VW6A 3FXWA 5K0KA 3LFQA 4O0XA 4BIEA 2OXDA 3FMKA 4ZZOA 1Q24A 5HX6A 4I21A 1YXVA 4Q5EA 3L9LA 2QOKA 1REKA 4G3GA 2OIBA 4C58A 1RDQE 3E92A 5DN3A 2XKFA 3PLAE 2YM8A 3ZC5A 2JKKA 3F7WA 4NJ3A 3OZ6A 4LL0A 5DPVA 4WA9A 4GH2A 3D7TB 4DGOA 4JIKA 4C3FA 3GU5A 4O84A 5GZ9A 4GK3A 3SOAA 2ZM1A 1YXTA 2YZAA 4WNOA 5GIOE 2C6IA 4RJ4A 3PE1A 4OT5A 4TWPA 3D2KA 3GC9A 3HV7A 4ANBA 2AUHA 3WYXA 3PJ3A 1GIIA 2XNMA 3VUKA 5FEEA 1U5RA 3ZZEA 3AQVA 3KL8A 3U51A 4HNFA 2W96B 3NYVA 4XV9A 4QMQA 3LQ3A 5M4IA 4AW5A 1FMKA 4D2SA 3QHWA 4TL0A 4ASDA 4E93A 4FUXA 4PPCA 5BUIA 4FKQA 1UU7A 3A7HA 3EQFA 3R73A 3BKBA 4O27B 2FO0A 3ORTA 2OJGA 5AIRA 1ZYCA 2QC6A 4I94A 2WTIA 4KNBA 4Y8DA 3IGGA 4ARKA 5DRDA 4E7WA 3BLQA 1Z5MA 2BHHA 2IJMA 4IX5A 4O6EA 3Q96A 1ZWSA 2H8HA 3N51A 3FMNA 1JKLA 4WNPA 4WO5A 4XS2A 5EM6A 3SV0A 4XBRA 4GT5A 2PPQA 1XBBA 3RZFA 3KFAA 3PXYA 3VS1A 2P2HA 2ZOQA 3KVXA 2UZDA 1YOLA 2CN8A 4WD5A 1G3NA 3W2CA 3P7CA 2I7QA 2H34A 5AA8A 4PP9A 2VWWA 3ENHA 3A7GA 5HOAA 5J5TA 1UU8A 4FL2A 4DH8A 4CLJA 1NVSA 2HZIA 5EOLA 3E3BX 4BBMA 4TW9A 2WELA 3RTPA 2ZDTA 3LPBA 3LE6A 2R3KA 1RW8A 4AE6A 4YPDA 1OI9A 5DEWA 2PVYA 3CPCA 5LMKA 4MHAA 4EJ7A 2W1FA 3ATTA 4F4PA 4C4FA 4FVQA 2QOBA 2P3GX 4OBPA 1L3RE 4EOIA 5F94A 3K3IA 4O0SA 2NRUA 2YA9A 2W5AA 3PA5A 4NW5A 3K2LA 3VS0A 4JL9A 2BRGA 5FXRA 4ENYA 4F1MA 3AC1A 4MEDA 4ASEA 4Q9SA 2XRWA 4GIIA 2X2KA 3QRKA 4BKJA 3K5VA 4JOAA 4DTKA 3PSBA 3TZ8A 1LR4A 1MUOA 2UZUE 3DV3A 4FOBA 4NCTA 4O7ZA 4KBCA 1ZAOA 2RSVA 3DQWA 3GB2A 3R9RA 5TO8A 2YIWA 2ITOA 4WOVA 3BIZA 5JT2A 3R7OA 3UMWA 2GHLA 3RMFA 2ZJWA 4FVRA 5AP7A 3CY3A 4RWJA 4EZ7A 3OMVA 3AMYA 4M0ZA 4MXZA 4ZTRA 4BDGA 2OICA 4QO9A 4MXOA 2X8EA 3PXRA 5AUXA 3PPZA 4IVAA 3DK6A 3EH9A 4LGGA 2VTMA 4WBOA 1PXPA 4BCFA 3QA0A 5D12A 4D1XA 4I20A 3CKWA 3I5NA 2Q0NA 4J52A 3VS2A 4BGQA 5K5XA 2VTIA 2Z2WA 2WFYA 3EWHA 4MX9A 5CAUA 5IQIA 4F9AA 3DTCA 2EWAA 3QQFA 4YC8A 5FP6A 3OF0A 3DAEA 4ZZMA 4AT3A 2BCJA 2RL5A 3WE8A 5AV4A 4C4EA 1UVRA 5JFSA 4FL1A 2NNWB 2X0GA 3BCEA 4QTDA 4YO6A 2RFEA 4EHGA 3NRMA 2VWUA 2VGPA 2QURA 3W2PA 3LQ8A 5ACBC 4ANMA 4AS0A 3MY0A 4BCKA 1PMNA 3NIZA 3PDTA 3W2RA 4AN3A 4GFOA 4L7SA 3ELJA 3O8UA 3HRCA 1R78A 5M06A 4H36A 5B2MA 5ANDA 1TQPA 4UMTA 1KE6A 2PMIA 5LJJA 3DU8A 3FSKA 2E9PA 1V1KA 3U4UA 3U55A 3DKOA 5FTOA 5K0XA 4AGUA 5JZJA 5EW8A 1H1QA 3R2BA 3S3IA 1KE5A 4PPBA 5L2WA 2XNPA 2WTKB 4TNDA 4GKHA 4QMYA 4HZRA 3D4QA 3E8DA 2P0CA 3Q04A 4BC6A 2QCSA 4CRLA 4A9UA 3DLSA 3OFMA 3II5A 3GFEA 4XH6A 3SVVA 3ZM4A 3TKHA 4J99A 2WQOA 4B99A 1Q99A 3C4WA 3R8MA 4E5WA 4EZ5A 2YZLA 1J7IA 2EB2A 3HV6A 3PJ1A 3LIJA 2GSFA 4HCTA 4CXAA 5KHWA 3L8SA 3ODYX 3P23A 3QZGA 5CU2A 3ZRMA 4RJ5A 3R8UA 4JI9A 1GAGA 4O22A 4AGCA 4AT5A 3QUPA 4FUYA 5KZ0A 3POOA 4Z3VA 5HU3A 5LXMA 2R4BA 2ZM3A 3FJQE 3QRJA 2UW0A 4ZMEA 4BBEA 5CU0A 1W98A 3FXZA 4E6DA 5CEIA 3V8SA 4DLIA 5F20A 5HHWA 2BKKA 1H1WA 4EUUA 5CALA 2ZYBA 1OBGA 2WMUA 4U3ZA 4LL5A 1ZMUA 3A7IA 2VTSA 4R3RA 4HOKA 2VRXA 3FI3A 4P5QA 3MH1A 1NXKA 4XG7A 4D4SA 2ETRA 3PJ2A 4ZTSA 3TNQB 3ETAA 3I81A 2WMWA 3O7LB 4ZTQA 1BL6A 4KWPA 5HG7A 2BVAA 3SXRA 1PY5A 3DNDA 3DK7A 2BTSA 3HUBA 3A4OX 2C1AA 3OY1A 3QTWA 3VJOA 4CG8A 3DBQA 3HECA 4YNOA 4D2VA 4EWHA 4BGHA 5LMKC 3UNKA 3UO5A 2UZOA 5HLWA 5AUTA 2PHKA 4JQ8A 4MBLA 4K77A 4RZVA 4H1MA 4EKLA 2OSCA 3DBFA 2QKWB 5KKRC 4UBAA 5A6NA 5AAGA 2DQ7X 4XP0A 2UZNA 3QRTA 2OGVA 5HE2A 3H0YA 2BAJA 3WBLA 4E6QA 4QP1A 4MXCA 2QONA 4XOYA 3ZM9A 1XH6A 3KULB 4KKHA 3RJCA 4B4LA 3W8LA 3QALE 1DI8A 5DG5A 5CEMA 1XH4A 3A61A 1AD5A 4DITA 5L2SA 4HCVA 4BDFA 3PXZA 4EBWA 2OU7A 2XBAA 3F2AA 5AUVA 2VO6A 1ZZ2A 3B8QA 5JFVA 3G2FA 1KOBA 1ZYSA 2BAKA 3QWKA 4HPTE 4QQCA 4BKYA 3UOKA 1IRKA 2J0JA 4GU6A 5AV0A 4NCTC 3EZVA 4F63A 4QP7A 4QP3A 1GZNA 1SZMA 1MQ4A 2I0HA 3F3WA 3KGAA 1BUHA 1H1PA 4IBMA 5DVRA 3UVRA 3FL5A 3C4XA 4HYSA 4FZDB 5FP5A 4A4LA 4FYNA 4BTMA 3ACKA 4QNYA 4P4CA 5IQBA 3IW4A 2FUMA 4PTCA 1WBTA 3FKNA 4H3BA 1Q3WA 4IE9A 3D15A 2PZRA 3ORMA 3LFBA 4L6QA 3OVVA 3SXSA 3GU4A 1IA9A 3G5DA 4P5ZA 2NO3A 3FC2A 3QYWA 3V5JA 3E7VA 5AX3A 1UNHA 3BGQA 4J7BA 4BYIA 5C9CA 4C59A 3VBVA 3RK9A 4CCBA 3DKFA 2XH5A 5D11A 2BUJA 2I0VA 3MI9A 3PY3A 4TRLA 2XJ2A 4KS7A 4J97A 3N4TA 3NMUF 4RIXB 4CFFA 4I5MA 3SHEA 3UGCA 4P90A 4F6UA 3CKXA 4IFCA 5CASA 4N57A 3V6SA 4QRCA 2OF4A 3MWUA 5J9LA 3OW3A 2OLCA 4ZTNA 3CSVA 4EH5A 4HVSA 4YMJA 5AR8A 4I6QA 4EL9A 2JEDA 2X6EA 4ITIA 4CEGA 3JR1A 1URWA 5EHYA 4RJ8A 1V0OA 1WAKA 4C37A 5AP5A 1BMKA 4CFMA 3WZEA 5FDPA 3IW7A 4FV2A 5JK3A 4CV8A 2ONLA 5AIKA 3I7CA 5DLSA 3KREA 3ANRA 5CENA 5IEXA 1OIRA 2Z7SA 3QD4A 4J95A 4MQ1A 1OPJA 2R3IA 4IJ9A 4JBQA 5EDPA 5J95A 3SRVB 3VUMA 5J1VA 4FX3A 4XG9A 2WQBA 5GJGA 2W06A 1Q61A 4EEVA 4RIWA 4J96A 4DINA 5ANGA 1Q8UA 3R9NA 4XYFA 3COHA 3LFFA 3OT8A 3A2CA 5E1SA 4YJVA 3Q9YA 3REPA 3RAWA 4Q2AA 4ZZNA 2O0UA 5KMJA 4MF0A 4YLJA 4XNEA 4QMUA 3GOKA 4RWKA 2WOTA 4DCEA 1SNXA 3DTWA 3V6RA 4E3CA 2Q83A 5GNKA 5H8GA 1H08A 1PYEA 2FVDA 2ITWA 4S31A 2YERA 2HENA 3E8EA 4RIYB 4R78A 5DR6A 4FOCA 3IPHA 4FZFB 4BICA 1JWHA 3U87A 5JEBA 4NWMA 2HXQA 4GYIA 4JT3A 1JOWB 3LM0A 4Y72A 4IB0A 2QG5A 1URCA 4MXAA 4PDSA 5IPJA 3PSDA 2W1EA 1A06A 3EN4A 5ANOA 4RVTA 4QP2A 2CSNA 3TCPA 4QQ5A 2WB8A 4UWCA 2J50A 1M2RA 3PA4A 3W1FA 4BI0A 2R64A 4E8AA 2PUUA 5LARA 1W84A 2O2UA 4FV1A 4GVJA 2XA4A 2BRNA 4QMNA 3WZKA 3FWQA 2BAQA 4YJOA 3VF9A 2WTVA 5IEVA 4GJ3A 3RPVA 4IB3A 4AU8A 4C4HA 1A9UA 3KRJA 1Y8YA 4U45A 4O96A 5CT0A 3SOCA 5JQ8A 4A9YA 4F9YA 4YU2A 5M56A 4EC8A 3OWPA 3CQEA 3NW7A 3ZEPA 4MTAA 3QLFA 3W2OA 4DTAA 5B0XA 1GZKA 4TXCA 4FEQA 4EBVA 4MAOA 2OH0E 4AG8A 5DI1A 3TG1A 5AUUA 3ZO4A 1SVHA 1U54B 3CD8A 3QTRA 4I3ZA 4KKEA 3QCQA 4O7LA 1YKRA 2YCQA 3ZBFA 3KRWA 5EYMA 4R1YA 4DG0E 2OH4A 3NYNA 5HI2A 4XG6A 1TVOA 1U54A 4I92A 4IFGA 4FTKA 4QQTA 2EUFB 3EQIA 2OIDA 4U44A 4EOSA 1REJA 4FKUA 4GT4A 4IEBA 3ZLSA 5CX9A 4BDBA 4DTBA 4KIKB 2VX1A 3KMUA 2HWOA 2PZYA 5HO6A 3TJDA 1OKYA 2QVSE 4TWOA 3TNIA 3QD0A 3QL8A 1YI6A 3EHAA 5AADA 2XM8A 3C1XA 3MJ1A 2JAMA 3UP7A 3MVLA 5FBOA 4JG6A 1YVJA 3WE4A 3WI6A 2CCIA 4BDCA 1KV1A 4HVHA 1J7LA 5BMMA 1YWVA 4F7SA 4XG2A 2PVKA 2V0DA 4QP6A 1UA2A 3S1HA 3QTUA 5HD4A 3PP1A 3A8XA 5GHVA 4QYEA 4X2KA 4NT4A 3OOGA 4QMSA 3WF5A 3C4ZA 3BEAA 3UPZA 3FMLA 3OTVA 5A4EA 3PIYA 3F82A 4X3JA 4Y46A 5IA5A 2BRBA 4RJ3A 4AFEA 3B8RA 5G1XA 4QMWA 2J0KA 5ANJA 4RFZA 2GNGA 3A7JA 4W4YA 5ANKA 4FGRA 4LI5A 3ORPA 3UG2A 5E8UA 4WUNA 4FI1A 4XG4A 4KINA 4RT7A 5CNOA 4A06A 3UVPA 5D10A 5CWZA 2WU6A 3F5PA 4EWQA 1YWNA 4JRNA 4N70A 1XH7A 3T9IA 3M2WA 4NTTA 1V0BA 2YM7A 1GY3A 4I0TA 3VHEA 3ZO2A 4QTBA 4S34A 2JC6A 4CVAA 1GZ8A 2Q0BA 2QO7A 1P2AA 2XKCA 3FLNC 5DA3A 5HIDA 4DFNA 2QG7A 4FNWA 2BRHA 3H30A 2O3PA 4IB5A 1E1VA 3DKGA 1EH4A 1PHKA 2H6DA 3E88A 3JYAA 4M69B 4NKSA 4OW8A 3MFSA 2JBPA 3Q6WA 1Q41A 4OGRA 4BTFA 4C3RA 4CMOA 4FV0A 5CZIA 3OWJA 3PFQA 3R28A 4UMQA 4APPA 4DT9A 3NUNA 3NUAA 2P4IA 4O91A 3DT1A 3G33A 1XR1A 3MYGA 2IPXA 3I1AA 1MRUA 2W99B 1A48A 2PMLX 3W2QA 4L7FA 4NM7A 4X3FB 3F5XA 1WVXA 4BDIA 4GUEA 1YI3A 2ZV2A 3A62A 4RG0A 4USFA 3BU3A 3COMA 1HCKA 2F2CB 1F0QA 1VZOA 1SM2A 1HCLA 4X3FA 3RVGA 2W1HA 4ACMA 4FKVA 5B2LA 3N4VA 4LGDA 4X21A 4BDKA 4W9WA 5J5SA 4OR5A 3F66A 3LFCA 4WG3A 4FIHA 1O9UA 2PYWA 3DZQA 2VTTA 4FZ6A 4DG2E 3ZFYA 3DFCB 3FLSA 2ZV9A 4RIOA 4Y73A 4OLIA 3TZ7A 5I9UA 2JKMA 2P55A 5EYDA 5LVLA 4CV9A 2R5TA 2RF9A 3LJ2A 3R04A 4XJ0A 2WMBA 2UZBA 4EK6A 5HTCA 5KBQA 5KMKA 2B55A 4D1ZA 3NNVA 4DGLC 2OKRA 2QO2A 4IHPA 4BGGA 2VWYA 1CTPE 5A4TA 3ORXA 3HL7A 4EYJA 1W0XC 3VF8A 4GRBA 3TTJA 4EK5A 1T45A 3QGYA 3R8ZA 3RPSA 1OUKA 4GFMA 3ROCA 4JDKA 3TNPC 4PMPA 3M1SA 3L9PA 5CANA 5A4LA 3D9VA 3EN6A 4JJRA 5F1ZA 2HXLA 5AR2A 2V55A 3CE3A 4S2ZA 2GCDA 4DYMA 2Z8CA 2UZTA 4I23A 3FLYA 4YHTA 1UKIA 5ETIA 5AR5A 2FYSA 4LUEA 4DH3A 3TDVA 4MXXA 3ERKA 4MQ2A 1ZY4A 3QTXA 4R3PA 3F9NA 4Y5HA 5BVFA 5JFXA 2DYLA 3BQCA 3RZBA 2C6TA 2RG5A 5G6VA 1OVEA 4JR7A 2B53A 3E5AA 3KK8A 4AQCA 3R8PA 4IAYA 1ZMWA 2WGJA 4TY1A 4TNBA 4ZY6A 4FSWA 4FT3A 1BLXA 3QAME 3EQBA 3QWJA 2VTLA 5CXZA 4XP3A 4YTFA 4BI2A 5IQAA 2PSQA 5AP1A 1IAJA 3KA0A 4YBKA 3ZBXA 5A3XA 2Z7QA 4EOOA 1J3HA 3HGKA 1IA8A 4IACA 2JGZA 2V5QA 3GC0A 4PV0A 3Q4ZA 5CVFA 2XIYA 4MD9E 3MB6A 1OM1A 4YJRA 5DEYA 1VR2A 4YZ9A 3ID6C 1JVPP 4ZTMA 4MNFA 2FB8A 4D9UA 4YTIA 4K8AA 4AUAA 4X2NA 3FI4A 2XF0A 2XP2A 4ZSJA 4FIJA 4YZMA 2CLQA 3LCTA 4AA4A 5ETCA 4AZEA 2CMWA 3C7QA 2YM6A 4CQGA 4NKAA 3RK5A 4D55A 3F3VA 2PUIA 2X9FA 4QTCA 4G2FA 4YHJA 4ORKA 3WF7A 3KRXA 2I0EA 2XS0A 2UV2A 2Y6MA 3EN5A 3G0FA 3MS9A 4GG7A 4IJPA 3ZTXA 4RVMA 5BNJA 3FAAA 3RKBA 5K9IA 2YLFA 3VUDA 3UZRA 4C33A 3IGOA 2Z7RA 3O8PA 4IH8A 4W4VA 5CSWA 2X39A 3H9FA 4TWNA 5M08A 1WBOA 2IWIA 3MDYA 3TN8A 3D5UA 4G9CA 2YABA 3RWQA 3ZO1A 3POZA 3FZRA 4AFJA 3QZIA 1JLUE 3QQLA 3UOLA 4ANLA 3SAYA 3NWWA 1CSNA 2BTRA 3JUHA 3NUPA 1UNGA 2BR1A 2CJMA 2XIKA 2UW7A 4EORA 4CKJA 2DUVA 4QMZA 1M2PA 1ZOGA 1J1BA 4O0RA 4YPSA 1R3CA 4L68A 2FH9A 4MH7A 1LUFA 2DWBA 4C38A 3EL7A 4MYGA 3Q32A 2YAKA 4ZJIA 3R8VA 1Y6AA 1ZLTA 1BL7A 4IZAA 4ITHA 3KXZA 3PTGA 5EI6A 2OZAB 5M55A 4Q9ZA 1DAWA 4WHZA 1YDRE 3FHIA 4PL3A 2W4KA 4BDJA 1WFCA 2SRCA 2PL0A 5HBHA 1CDKA 5FDXA 3QZHA 3AMBA 4X0MA 2W0JA 3IONA 4YLLA 5E4HA 2UW8A 3MPMA 5KHXA 3P5KA 2C3KA 4PMSA 5AP4A 3LLAA 4RX7A 4ALUA 4C3PA 4GSBA 2YWPA 5HORA 2X81A 1JSUA 3W16A 3THBA 3HA8A 3NNXA 1R0PA 1ZY5A 1V0PA 2G9XA 3O7LD 4V0GB 5HG5A 2OK1A 3VNTA 4IAIA 4UMPA 2JKQA 3HP5A 5TKDA 1H4LA 5AP0A 4M84A 4OTPA 3KXGA 5LCKA 3TV6A 5C8NA 3D7TA 3VUTA 1H00A 2BDJA 4NSTA 3O50A 3OBGA 3C5IA 3NNWA 2G15A 4EZ3A 2C0TA 4LMUA 4DFYA 1WCCA 5KMIA 2C6KA 2X8DA 1Z9XA 3OCSA 3PPKA 3CTJA 3R63A 2PVMA 4IC7A 4AX8A 5HLNA 3TUDA 3F88A 4IVDA 4GYGA 4MD7E 4F1TA 4C7TA 5BVEA 5H8BA 5KMNA 2I1MA 3NAXA 3NW6A 2HK5A 4OBQA 4JVGA 4BWPA 3E93A 1Y8GA 3QGWA 5BMSA 4GG5A 4FTAA 4FIEA 3PE2A 2JIIA 2CNVA 3ATSA 4E6AA 3O96A 2GNIA 1E1XA 2GS7A 4M14A 4FSTA 3S4QA 2BKZA 1P5EA 3CXWA 4XRLA 3PA3A 2C6MA 3ZUTA 2GFCA 1UNLA 2OI4X 3K3JA 2GQRA 4EH9A 2C3IB 4FKRA 2ZAZA 3VIDA 3EZRA 3GU8A 4QYHA 3MIYA 1QMZA 1YI4A 4PNKA 3TV4A 4ZAUA 5A6OA 2ETKA 5JRQA 1O6KA 5LVNA 4IZYA 3HLLA 3NS9A 5CU4A 4HW7A 5KE0A 2R3PA 2XK9A 1PJKA 3F6XA 4YTCA 5IUHA 1XJDA 4DE4A 1O6YA 3VO3A 3NSZA 2YHVA 2CCHA 4FG9A 3OCGA 4BI1A 5L6PA 4NH1A 1KE8A 5AJQA 5EKNA 3AGLA 2GS2A 2X7FA 5EHOA 1FOTA 2GU8A 2F49A 4FKJA 4IW0A 4HZSA 5ICPA 4KBKA 4XLVA 3PY1A 5FGKA 2I0YA 4EKKA 3MH2A 4D2RA 4TN6A 3BU5A 1RE8A 3CQUA 2G2HA 3CBLA 1B39A 2R3LA 2C5XA 4CT2A 5I5ZA 5KKRB 1GOLA 4B0GA 4HVIA 1PXKA 3NLBA 3UODA 4BF2A 2IN6A 3TEIA 3S95A 4EC9A 3AT4A 5HZNA 3WZDA 2C3LA 1B38A 4JBPA 5DIAA 3G9LX 3QQHA 3Q4CA 3FSFA 1ZOEA 4BIBA 4EONA 3LFNA 1OUYA 5TF9A 3CJGA 4FIGA 4DFXE 2FSMX 4AZSA 3GUBA 5K4JA 4K11A 2X4FA 3R8LA 3R71A 1Q8ZA 1IEPA 2QU5A 5A9UA 2C0OA 5A54A 4AP7A 3QUEA 1ATPE 3BHYA 4UWBA 5L8JA 1SVGA 4I6FA 4QMLA 1ZOHA 2C6LA 3RPOA 3TACA 3JXWA 4L53A 3LXNA 4TYIA 1NVRA 3KXMA 2QHMA 4BKZA 4E4LA 3LCDA 3OHTA 2JLDA 5H2UA 5EW3A 4EYMA 4EOMA 4EHEA 4BZNA 3EQHA 2EXMA 4NM3A 3I0QA 3G15A 3EB0A 5KCVA 4BCHA 5LVPA 2RIOA 3O2MA 4QYFA 4UN0C 3QXOA 3SC1A 2Y4IB 4DGMA 5C4LA 2AYPA 5DNRA 4O7SA 2UVYA 1P14A 4FSRA 3PJCA 3RWPA 2A27A 4O6LA 2JITA 5CAPA 3RCDA 2B9JA 2QQ7A 3BHUA 4L01A 1YQJA 3ET7A 5CF8A 3BQRA 3HV4A 3KF4A 4FODA 4ID7A 3GNIB 4BCGA 3PG1A 5FEQA 4KBAA 5BYZA 4D2PA 3FY0A 2WQNA 3PSCA 4MBIA 3DGKA 3BHTA 4NYEA 4CLIA 4PX6A 4Q5HA 2R3HA 3HX4A 2O8YA 4FF8A 3SG9A 4UZDA 2IW6A 2XK8A 4WG5A 1OPLA 2QNJA 3LOKA 2XRUA 3MTFA 4GU9A 2FSLX 2WTWA 1VEBA 2FA2A 2QLUA 3EQGA 4FTIA 5FRIA 4F08A 1O6LA 3QQKA 5CSHA 4CT1A 1H24A 3RCJA 4F09A 2CN5A 4NJDA 2LAVA 5HIEA 4APCA 2XCHA 4O0TA 2VN9A 3Q53A 4C2VA 2WTCA 4MK0A 3ZYAA 5EI8A 4IAFA 2PY3A 4U81A 4PF4A 2Y8OA 4IVBA 4L9IA 3PVUA 1OL6A 2C5OA 2Y6OA 3OTUA 2XCKA 5L6WL 4R6VA 2OXYA 4NIFB 3UIMA 3E62A 3R01A 4FTTA 5EYKA 1PXIA 3KEXA 1FPUA 2VO7A 3VJNA 2UVXA 3WF6A 4LRJA 5EM8A 4BCOA 4OTQA 3R9OA 4L67A 1GIHA 2R3NA 4FSNA 5AUZA 3SGCA 4NIFA 2B7AA 3QHRA 3HAMA 4HYIA 4TTHB 1F5QA 2F7XE 3WYYA 3NEWA 4BRXA 3V3VA 5I9ZA 5CY3A 3CJFA 3LMGA 3MN3A 4QTEA 4K9YA 4ACDA 4DEAA 4XV2A 4W4WA 1Y57A 3BE2A 1DM2A 4FKTA 4PDPA 3ANQA 1UWHA 5FLFA 2W9FB 3A99A 4G31A 1FVRA 5TR6A 5LMBA 5IA3A 4TPTA 5GZAA 1PMEA 2X4ZA 5L8KA 3VVHA 3AGMA 2OJ9A 4PTEA 3ZLWA 4EH4A 2IVVA 3FLWA 3PYYA 4L8MA 2CNQA 3QCSA 2YM3A 3OP5A 5L8LA 4N0SA 4U0IA 4TWCA 2IW8A 5BVNA 2PZ5A 3W8QA 4RJ6A 2UVZA 3DFAA 3G51A 5LQFA 3EN9A 4GFGA 4FV7A 4C4GA 2JDVA 4KD1A 3G9NA 5HCZA 3DXQA 4U42A 3QC9A 1JNKA 3QU0A 4XHKB 3FHRA 4Z9LA 4UMRA 5HVKA 3ZDUA 3F3UA 4MD8E 5AV2A 5K4IA 4HCUA 4S33A 3PG3A 1WVWA 2BDWA 1UU3A 2W1DA 5BYLA 4PNIA 3LHJA 2JBOA 4WBBB 3UDBA 4D1SA 4YP8A 3ZSIA 4QYYA 3KULA 3LLTA 3FPMA 4J1RA 4U80A 4XRJA 4D2WA 2PUPA 4ZIMA 4GKIA 3V04A 4X2FA 4C34A 2XJ0A 4W4XA 1NY3A 2RFDA 3E87A 2WMVA 2J0LA 5FQDC 4E73A 4IADA 4LRKA 3DBEA 4XCUA 2H9VA 3DDQA 5H9BA 4ZJJA 5IU2A 1QL6A 3D83A 3DY7A 2HELA 3H0ZA 3HVCA 4YTHA 3ZXTA 4M97A 5C03A 3SW7A 4FTRA 5LMAA 4E4XA 3CGOA 1OMWA 5LVOA 4NM5A 5L2IA 1H8FA 2BIYA 3A60A 5M4CA 3R7YA 3UO6A 3FQSA 4WRSA 4DLJA 5DT3A 5CQUA 4D28A 3C50A 4IM3A 4IZ5A 3UIBA 5HTBA 3AT2A 2F57A 2R3OA 4N6YA 5ACKA 2GHGA 3NCZA 1Q8YA 4AE9A 4O82A 3DJ7A 2NP8A 2WXVA 5ITAA 5DT0A 4BWKA 5HIBA 2R3MA 5CAVA 3TIZA 4IX4A 2WMTA 4Y95A 3BV3A 3V8TA 3R6XA 4KIOA 3DQXA 3I6UA 4GK2A 3FQEA 4F0IA 3EQCA 4V01A 3KMWA 5E8VA 3QQGA 4FICA 4H39A 5L2TA 3VBWA 5IDNA 2J4ZA 3A4PA 3RK7A 3W18A 3I4BA 3MFRA 3IS5A 4F7NA 3EYHA 2ERKA 3KF7A 4CYIA 3D14A 1GNGA 3R00A 4H58A 4U41A 4WKQA 4AOTA 3UOJA 4QMVA 4I0RA 1WBVA 2UW6A 4RIXA 3UYSA 4MWIA 3Q60A 4WIHA 1R1WA 3ITZA 3NDMA 4L43A 3Q9XA 4NM0A 4QQJA 3UNZA 4CFXA 2BZHB 3CTQA 3C9WA 4FVPA 4KUJA 4CRSA 3JY0A 4I41A 4MNEB 3UMXA 4DEBA 2CGVA 3PJ8A 1CKIA 4JG7A 4XOZA 4WNKA 3ALNA 1W83A 3C0GA 4LRMA 3H4JA 1Y91A 4RC4A 3ZRKA 4U9AA 4GVAA 4PPAA 4QTAA 1DS5A 3OD6X 2QOIA 2QOLA 2WQMA 4F7LA 5HNBA 2HZ4A 4DH7A 4EK3A 2WTKC 2QHNA 4FG7A 4C61A 1RQQA 3MFUA 2B4SB 2X1NA 3KN5A 4AA0A 5I9WA 4DHFA 3SRVA 3S00A 3KRLA 4QMXA 3SW4A 1OECA 4GK4A 4U43A 3LFAA 2Y7JA 4G3DA 3QD2B 4UEUA 3ZXZA 5CVGA 3C0IA 3IO7A 4JLCA 3UOHA 1BYGA 4FA2A 4CMUA 1QPDA 4L00A 4UYAA 1G5SA 2V62A 1YDSE 4F0GA 4E6CA 3CD3A 4LOPA 1M17A 4PUZA 4ZK5A 4PQNA 3R9HA 4IVCA 4IMYA 5E8WA 3LKMA 5IMXA 3CQWA 4ZTLA 1OKWA 3EFKA 4RC2A 4RIYA 3V01A 3P4KA 5HGIA 5B7VA 4RX9A 2QO9A 3MA6A 4G16A 4G3FA 5M57A 2IZUA 4EHVA 5JKGA 1VYWA 3Q2JA 3E3PA 5EM5A 3PRIA 2ETMA 4IWQA 2REIA 1U5QA 5M44A 5M4FA 4FZ7A 5A46A 4PL5A 3WF9A 2C6DA 5CI6A 4D5HA 2XEZA 4AACA 4G3CA 3QFVA 3R21A 3PUPA 1XH8A 3GP0A 4YJTA 1UWJA 3VAPA 3EN7A 2WNTA 2XK7A 1KSWA 1M52A 4ITJA 3V5PA 3GFWA 4IDVA 3TT0A 5K5NA 3FZ1A 4KRCA 4PDOA 2PMOX 4L3PA 1OGUA 1YRPA 2YN8A 2PE1A 4E1ZA 3GCUA 3HMOA 4A9SA 5FD2A 5M09A 2Y9QA 2ZVAA 3QTZA 5ANIA 5HICA 2ITYA 1H26A 3BE9A 4IAZA 1W7HA 4BDHA 2R3QA 3NVMB 2VX0A 2VD5A 5HNIX 4YJSA 2GMXA 4R77A 4LUDA 5KMOA 3E7OA 3MTLA 4FT9A 1L8TA 1ZRZA 4FTCA 3KCKA 1I44A 1SNUA 3QX4A 5HCXA 1JAMA 3W32A 3EQDA 4LOQA 2BPMA 4HGSA 1CM8A 2OXXA 2BZKB 4FKPA 2B9IA 2UW3A 4GCJA 3HMIA 3VULA 3IOKA 5DRBA 4EI4A 5KO1A 4LM5A 3VRYA 4FKLA 2W9ZB 4R5YA 3BI6A 4KIKA 3BELA 4X7QA 3FPQA 5HU9A 2GNFA 3RBWA 4OUCA 3BX5A 2ITUA 3KCFA 4IWOA 4ASZA 4G9RA 2UZLA 3I7BA 1OL7A 4JAJA 4DEGA 4ACHA 2C1BA 2W5BA 3HMNA 2XNGA 4IQ6A 3NCGA 4C8BA 3G0EA 1FGIA 3KQ7A 4A7CA 4F6SA 1Q97A 4LFIA 2AC3A 5HVJA 1PRYA 3BU6A 3TM0A 2J7TA 4XG8A 4BZOA 2XYNA 3TNWA 2JD5A 3CIKA 5E90A 4KKGA 2W4OA 3SLSA 4BN1A 3GCSA 4AT4A 3KY2A 4BR3A 1H07A 2WD1A 3BEGA 5JMSA 4A4XA 1H28A 4BVUA 2B0QA 1XKKA 1LEWA 4YZCA 2PZPA 3MESA 4CMTA 3QQUA 1JPAA 2JAVA 2UW5A 2VUWA 3DK3A 2ITZA 3GCVA 3P08A 5AM6A 5AP2A 2XNOA 2F2UA 4LOOA 3QBNA 4TYHB 4X6QC 5AUWA 3U4WA 2VX3A 4FIFA 3D7ZA 2QODA 1Q8TA 5CYIA 3EKNA 1PXLA 3FL4A 3EQRA 3HYHA 3F3TA 4OTIA 4BIDA 5L6OA 5CU3A 1WZYA 2W1GA 3UO4A 4RFMA 5I3OA 1WVYA 5L3AA 4FYOA 4YZDA 2ZM4A 3RAHA 4QT1A 4EK4A 3FQHA 3UZPA 2ONLC 5I9XA 2RGPA 3BYUA 5EI2A 2WU7A 4HPUE 3E63A 1B6CB 3C0HA 2PVHA 4I6HA 4M69A 5D9HA 4ZSLA 2FGIA 4F7JA 3QA8A 1IG1A 2ITNA 3RM7A 3BRBA 2PTKA 3MH0A 2BDFA 2C5NA 3UC3A 1OL1A 5EH0A 2ACXA 4EH8A 1BKXA 2J6MA 2DS1A 1ZXEA 3OXZA 4OTGA 4PWNA 2QR7A 3DJ6A 4BCPA 5AEPA 3ULZA 4G5JA 3FMEA 1APME 2R2PA 4C2WA 2C68A 4IWPA 3CEKA 5IQFA 4O7WA 3UG1A 2WMAA 3Q5IA 5ANEA 2PVFA 3DAKA
chains in the Genus database with same CATH superfamily
3GQIA 4QD6A 4DC2A 4EQMA 4FEWA 3CLYA 3AC4A 3IW6A 5HKMA 4S30A 4KRDA 3P0MA 5IDPA 1XBAA 5J87A 2CKEA 3GI3A 3WIKA 2E9OA 2Y4PA 3MFTA 1LPUA 2X2MA 3QCYA 5ETFA 4YGAA 5BVWA 3WIGA 1MRVA 4BZDA 4FTLA 3PXQA 3TTIA 3F2RA 3H9RA 3S0OA 2H96A 4AW1A 5BUEA 5I3RA 2VTOA 5CF6A 4DEIA 4UV0A 3TNHA 2OIQA 3F2NA 3TIYA 3FLZA 3RPRA 2BZIB 4BTJA 3UQCA 3HV3A 1G8AA 4K0YA 4UALA 1PXJA 4W8DA 3M11A 2V22A 3LCKA 1GIJA 1DI9A 2GNHA 4RVLA 3H10A 3KN6A 4EUTA 3UNJA 3IKAA 2G01A 1P4FA 3UZTA 4TYJA 3BPRA 3GCQA 5E7RA 3PY0A 4XMOA 4WT6A 3N4UA 4DCAA 4I1ZA 5C1QB 4AXEA 2B54A 2WTDA 5CTPA 3DB6A 5IH5A 2GQGA 4FSQA 5T6KA 5FXSA 2GTNA 2YISA 2JDOA 4DN5A 2W17A 3EKKA 3L8XA 1M14A 5DBXA 3T8OA 4F64A 3V51A 1Q4LA 3ZEWA 4DEHA 2EXEA 2YIXA 4PL4A 4BFMA 4MF1A 2BRMA 2XJ1A 1J7UA 2C0IA 4ZOGA 3U6IA 4I4FA 4KS8A 5CXHA 5HTIA 4C02A 4FC0A 3R9DA 2VWXA 2XK6A 2VTRA 4EH6A 3UP2A 4XBUA 2EB3A 4NK9A 4YBJA 4K6ZA 4CQEA 4L3JA 1K2PA 5IF1A 3RM6A 1H0WA 4FTOA 5GZ8A 3LXPA 3BGPA 4OTHA 4YSMA 4DBNA 4YZBA 5HVYA 4PP7A 4IWDA 4JG8A 4UY9A 3BYVA 3NUYA 5E8SA 2CKQA 4UXQA 4O1OA 5EYCA 5JZNA 4CTBA 2YCFA 3KVWA 3E8CA 2GNJA 2YIYA 1H0VA 4RJ7A 2WPAA 3S2PA 1PW2A 4YHFA 4IB1A 5BVOA 2P2IA 4L42A 1G8JA 1OPKA 4B9DA 4CSVA 2YAAA 1J1CA 4RA5A 4ZP5A 1YXXA 4U8ZA 4O4DA 4PDYA 3L9MA 5C8KA 2X0PA 3ZSHA 4EOJA 2W4JA 3OEFX 2XKDA 3FYJX 2PWLA 3SDJA 4AAYA 1VJYA 2I40A 2UW9A 4S32A 4F0FA 4H3QA 4XV3A 3MV5A 4O0YA 1IR3A 4IZ7A 4KB8A 5IQHA 3VS7A 3LMIA 4TZRA 3QXPA 3PXFA 2YM4A 3DXNA 2HAKA 3PWDA 3IW5A 2YCRA 2XIZA 4JNWA 5CF4A 3HZTA 1OL5A 4RGJA 5GIPE 4O0UA 4EHZA 5A4CA 2W7XA 3F7ZA 4JDHA 5M51A 4NL0A 2BHEA 1YOMA 2IZSA 2HW6A 3I79A 3LFSA 2ZB1A 1H1SA 4I5CA 4JXFA 3SD0A 3VW8A 3W55A 2J2IB 2RFSA 2J9MA 2XYUA 5FEDA 4M68A 4O4BB 5CU6A 4ZSGA 5AWMA 3BLHA 3ZDIA 3ZO3A 4AZFA 4BYJA 5IEYA 3HAVA 4BDAA 4RLKA 1X8BA 3MPTA 3QKKA 3QRUA 2QU6A 5FUTA 4X3FC 5JN2A 3MVHA 1OIUA 3O0GA 4KAOA 3ZZWA 2OZAA 4AOIA 3CR0A 3GC7A 1H27A 2X8IA 3FY2A 4G17A 3UIUA 5JGAA 1QCFA 3MVMA 3WILA 3FI8A 2ZV7A 4FIIA 4FSUA 3GCPA 5EW9A 4A4OA 4DA5A 4G3EA 2CNUA 4CKRA 2A4LA 5FXQA 1QPCA 4MVFA 2BIKB 1PF8A 1S9JA 4ZEGA 3DZOA 3FYKX 1LP4A 3GU6A 5IH6A 3AD6A 4JX7A 3WZJA 5CEPA 4FJVA 2BILB 3OWKA 3VBYA 4FV5A 3LFDA 1CKPA 4FSYA 1G8KA 4O0VA 2OFUA 1WBPA 3PVGA 4V0GA 3QTIA 4AF3A 3VUIA 2CGXA 4FRFA 2I6LA 2VTNA 3ORKA 3ZRLA 3ALOA 2PVRA 5DH3A 4BTKA 4ERWA 2QR8A 4I4EA 2Z7LA 3C4FA 4M3QA 2VTHA 5CS6A 4ENXA 2VTJA 4RZWA 3C4EA 4YC6A 2ESMA 3QKMA 2VO0A 5E8XA 4AWIA 4E4NA 2WHBA 3FI2A 3JS2A 3V5WA 1M7NA 4JS8A 5EOBA 3GBZA 3W10A 3PVWA 4JQEA 4XG3A 4DDGA 3CC6A 4F65A 3BHHA 4I5PA 2UZWE 4CFUA 5CF5A 3COIA 5EM7A 2HWPA 3D2IA 4IANA 3GEQA 4QYGA 2CLXA 3D5VA 4R5SA 5DOSA 4CFWA 4RVKA 3RP9A 1CKJA 5ETAA 3QLGA 5IQGA 3TKIA 1BI7A 4XLIA 2WMSA 3IDCA 2ZB0A 2HOGA 2IVSA 2XB7A 2XKEA 2YIRA 2VWIA 5J7HA 3Q6UA 4QPAA 1YHWA 4FTUA 4JBVA 4EOLA 3HRBA 2WKMA 4RRVA 5T3QA 3TV7A 3I5ZA 2XK4A 2W1CA 1ZYJA 1UV5A 4AZVA 5LWNA 2R7IA 3R7EA 1TKIA 3DNEA 2F7EE 4M12A 4YUQA 2PK9A 4FSZA 2RFNA 4NFNA 5F4NA 3Q9ZA 4RPVA 3NZ0A 4BCIA 2VZ6A 5BQ0A 3OWLA 3ORIA 5F95A 4CKIA 3NIEA 4BHZA 2ERZE 3G6GA 1T46A 1TQMA 2C3JA 4ACGA 4HYHA 3HMMA 5HX8A 3FUPA 2EXCX 4CG9A 4II5A 4QNAA 2CHLA 4EOKA 2VV9A 3O8TA 5DT4A 3DB8A 2GHMA 5HE0A 1G8SA 3KC3A 2ITPA 4YLKA 5DFPA 1CMKE 4D5KA 4A9TA 3ZC6A 4ANSA 4ANNA 5IUGA 4D4RA 2OO8X 1XQZA 3EJ1A 3P86A 5BV3A 4PY1A 4N6ZA 4KIQA 3VUHA 3Q52A 4GS6A 4ALVA 3LMHA 3TWJA 2UUEA 3AC2A 3JPVA 2ZV8A 5KBRA 4O7TA 3PXKA 4EOQA 3QZFA 3IK3A 5AUYA 3ZMMA 3KXXA 3QC4A 4GEOA 4HGTA 4ACCA 3FMDA 4ZSAA 3VQUA 4ASXA 2IZRA 4YO4A 5J9YA 1JSTA 4B7TA 2XMYA 2NYAA 4IDTA 4FNZA 3AD5A 3LZBA 4J8MA 4RA4A 2R7BA 5D7AA 5BVDA 2WIPA 5CSVA 5CQWA 5DHJA 3DJ5A 3ZONA 1I09A 2HYYA 2OJJA 3V5TA 3HMPA 3PZHA 1JKTA 3K5UA 3IW8A 4G6OA 2BZJA 3ENMA 2CKOA 4OTRA 1BI8A 2JIUA 3UC4A 4ZTHA 3ORLA 2PVLA 3HRFA 4DGNA 5CEKA 1U46A 3DCVA 4ZXTA 3QD3A 4ANOA 4BCQA 3TL8A 4QOXA 1ZYDA 2XK3A 4Z7GA 3D0EA 5DR2A 5HEZA 2O65A 4QPMA 5KUPA 3IECA 5HCYA 1ST4A 4O2ZA 2J0IA 3U8WA 3JVSA 2WOUA 2E9VA 2YCSA 3AMAA 5CNNA 2YJRA 4JIAA 5HD7A 4C35A 3Q4UA 1OKZA 4O4CA 4U5JA 1KE7A 5J1WA 3NUSA 1OBDA 3C13A 5CEQA 1XH9A 2B9FA 3NVKI 5EQPA 5IA0A 4AZTA 2IO6A 5HO7A 4WUAA 1JSVA 2O63A 3T3VA 5IZFA 1PYXA 3OROA 3D5WA 4TKSA 5HO8A 2XIRA 5I9YA 2QOHA 2VWZA 4RQVA 4MCVA 1MRYA 3LW0A 4FNXA 1NVQA 3LM5A 4L44A 5CAQA 2YDIA 3MA3A 4OTDA 4Y85A 2NRYA 3MB7A 3U6HA 3Q5ZA 4I6LA 4O38A 4QMPA 3SX9A 1U4DA 5J7BA 4KSPA 4O4EA 2WIHA 1NA7A 3MY1A 3P7AA 4UB7A 3PP0A 4FK3A 1M2QA 4YZNA 4FV3A 4BBFA 3GVUA 2OZOA 4F70A 3BBWA 5DE2A 5AR3A 5C27A 2XAMA 5IQDA 2E9UA 4TYGA 2BROA 2YITA 3BV2A 1SMHA 4R3CA 4C36A 3VN9A 4LG4A 3L1SA 1WBNA 1H01A 3CP9A 3DS6A 3ORZA 3R02A 4FZAB 4JAIA 4BCMA 2PVJA 3TKUA 2BALA 5E91A 3QCXA 4YURA 4BCNA 3PWYA 1OZ1A 2ZMDA 4RX8A 2VWVA 4DFBA 3LXKA 4AN2A 4CZYB 2J5EA 4I93A 1QPEA 1OITA 3G90X 3IQ7A 4EH2A 5CVHA 3AOXA 3L9NA 4HVDA 3P1AA 2ZMCA 5C8MA 4R7HA 3VQHA 3ULIA 2CGUA 4EH7A 3PIZA 5H3QA 3NW5A 5F9EA 3FXXA 4AGDA 3W0RA 2YDJA 3Q2MA 5LWMA 4PTGA 2R3FA 4WRGA 1Q62A 4W9XA 4PRJA 3SQQA 3MPAA 2O64A 5IMEA 4CZUA 1OKVA 4BCJA 4OTWA 2ITTA 4FKOA 4NEUA 5EK7A 2OF2A 3R7UA 4AGWA 5EQEA 3ORNA 1Q5KA 2XVDA 3BYMA 3L8VA 3IDBA 3QKLA 5JGBA 3VS6A 3ZUUA 5HESA 4D9TA 2HIWA 5GJFA 4GW8A 2J5FA 3C4CA 5TE0A 4U40A 4YNEA 1XO2B 1VYZA 2VO3A 4J98A 4O2PA 1OIYA 5EG3A 4BWXA 4FSMA 5EQYA 2C4GA 4BL1A 3P9JA 3RNYA 4PMMA 4MBJA 3W33A 4V04A 2PE2A 3O5AA 1FVTA 3EYGA 4EQUA 2EVAA 4QP4A 4XX9A 3MSSA 4QDVA 3SA0A 3ZSGA 3FKOA 2A2AA 1Z57A 4P2KA 5AR7A 4DFUA 2XM9A 3PFYA 3R1QA 1Q3DA 4BHNA 4G5PA 3PZEA 4BY9E 4EOPA 1ERKA 1YXUA 2X6DA 4QP9A 2IVUA 3RHKA 3HA6A 4WSQA 2BFXA 2IZTA 4GIHA 3ZH8A 4O7RA 2QD9A 2G2FA 3RGFA 2UZEA 3UBDA 5J9ZA 2YLEA 4N4SA 3DXPA 3LAUA 4G34A 1YWRA 5HQ0A 3KB7A 2PU8A 1QPJA 4R7IA 3JY9A 2X7OA 2XNEA 4M7IA 1TQIA 2QLQA 5KMMA 3UQFA 3R0TA 4DDIA 1KE9A 2G1TA 4ERKA 2GNLA 3ODZX 4K2RA 4ONAA 5AP6A 4AAAA 4YC3A 4CD0A 1W8CA 2J51A 4EQCA 3V5QA 2IG7A 3QTQA 3FDNA 3ZFXA 4FKWA 5IISA 4U79A 3O17A 1XBCA 4J71A 4JBOA 1MP8A 4F78A 1FGKA 2VWBA 4I5HA 5AMNA 3OCBA 4H3PA 3UQGA 5HG8A 4BDEA 1JKKA 3RAKA 3LXLA 5I4NA 3E8NA 1DAYA 4DH1A 4YJUA 3ZS5A 4I6BA 2OJIA 3WARA 3DDPA 2IVTA 3CCNA 3EMGA 4DAWA 3UYTA 4FT0A 2B9HA 4LQMA 2KTYA 3BLRA 4FTMA 2QOQA 3Q4TA 4M13A 5TT7A 4DFLA 3NAYA 5JRSA 4CZTA 5IA1A 4O81A 1J91A 2Y4IC 1HOWA 5AFVA 2XBJA 3A8WA 3PIXA 3KXHA 4RX5A 3GC8A 4A07A 2FSOX 3G6HA 5E8ZA 4DEDA 5I0BA 3F5GA 1SYKA 4O86A 3FV8A 3K54A 3M42A 3EQPA 4GL9A 3UTOA 4ANQA 1PKDA 3GGFA 4F6WA 1W82A 4UWYA 3W0SA 4MNEA 2C6EA 4LV5A 4IM2A 3OCTA 3QQJA 4YJQA 3OC1A 2HW7A 1NT2A 3VC4A 4R1VA 5HE3A 4QMMA 4H05A 4XEYA 4D4YA 4ZLZA 1OL2A 4WG4A 5C4KA 4E5BA 2PMNX 4K1BA 5FG8A 4BDDA 2C30A 5CEOA 4IX3A 2C69A 1ZARA 3VBXA 4CTCA 1YHVA 1BX6A 4ZLYA 5L4QA 5J8IA 2E2BA 3MJ2A 4O21A 2WTJA 5M4UA 4O7YA 5CZHA 4LMNA 4RIWB 5EFQA 5E8TA 4DFZE 1TFFA 3OUKA 1YOJA 2ITXA 4O1PA 3LFEA 2JDTA 2VNWA 1ST0A 2C5YA 3FKLA 4JQ7A 4FEVA 2P33A 3EFWA 1XHAA 1P4OA 3WOWA 3KU2A 3OY3A 3ZUVA 4BB4A 3UIXA 2WO6A 1JKSA 4IAAA 3SXFA 4O83A 4FT7A 4DBXA 3R1NA 2HY81 4YSJA 3KMMA 3RALA 1ZYLA 4R7BA 2R0UA 2PZIA 2OWBA 2GS6A 2HCKA 5D41A 1JBPE 3R83A 3RPYA 3QTSA 5BPYA 3UVQA 4M15A 4F9BA 4XP2A 2FSTX 3R2YA 1FMOE 2KULA 4UXLA 4R8QA 5B2KA 4AN9A 1ND4A 4DHIB 4X6RA 2NPQA 3NUUA 2XEYA 3VS3A 5KMLA 3AC8A 3GXLA 3VUGA 2OFVA 5AV1A 1K3AA 2VNYA 4IX6A 2G2IA 3MVJA 3FE3A 4M67A 3MW1A 4I0SA 4MXYA 4KA3A 3SKCA 5L2QA 2Y0AA 3GU7A 5EKOA 2F7ZE 3Q3BA 3HV5A 5DR9A 1PXNA 5EHLA 5CSPA 2C5VA 3E64A 5C26A 2X2LA 3IG7A 3Q9WA 4FL3A 4DGGA 1OB3A 3OT3A 1M7QA 5IA4A 5M53A 4C57A 3BZ3A 3DKCA 3H3CA 2VU3A 3QYZA 3BGZA 3L8PA 4NZWB 4Z55A 4XUFA 3ZOSA 2E9NA 5HE1A 2YWVA 4IAKA 3HNGA 4EH3A 5I9VA 2CDZA 3R30A 5KX8A 4MKCA 4ZSEA 2ZDUA 1IASA 4GV1A 4F9CA 2VTQA 3FZPA 4NUSA 2GFSA 3VHKA 3EFJA 3FLQA 5IUIA 4AW0A 3R7VA 2V7OA 2YACA 5E92A 3U6JA 3DBCA 2WMQA 4QMOA 4FTJA 5E1EA 4D4VA 2XAOA 2EU9A 2YM5A 1U59A 2X9EA 3O71A 4HJOA 1RJBA 3FZSA 4Y5QA 5E8YA 3UJGA 3TUCA 4H1JA 4UX9A 5M07A 2WEIA 3GOPA 3NYOA 4J53A 4L46A 3BYOA 3WF8A 3OBJA 5FBNC 1WBWA 4ZMFA 2X7GA 3AG9A 3B2WA 3CTHA 2JFLA 4RQKA 5FTQA 5HG9A 3V5LA 3F69A 4FE2A 5JGDA 1FBNA 2HZNA 3VS5A 4JDJA 2QKRA 1ZMVA 3GENA 1XH5A 4E5AX 5D7VA 4DF3A 3LJ0A 2QOOA 2GTMA 4NTSA 2PVNA 4QP8A 3F3ZA 5CSXA 5AM7A 5K3YA 2XNBA 3HUCA 3LVPA 4CFNA 5IQCA 1KV2A 2JIVA 2LGCA 4FGBA 4RMZA 1SVEA 4GMYA 4I24A 4LYNA 2F9GA 3R22A 2WZJA 3U9NA 3WZUA 3D94A 3TZMA 4OTFA 4A9RA 4Y83A 4CFVA 2VTAA 5BYYA 5EDRA 1ZZLA 3BL7A 2OBJA 3EFLA 4JX3A 4TYHA 5HLPA 2J0MB 4ZS4A 3I0OA 1LEZA 3MGYA 3NNUA 3IOPA 4G6NA 4FTNA 4M66A 3EIDA 5EDQA 2PUNA 2R9SA 3R7GA 4FV9A 4GUBA 3HKOA 4FBXA 5HBEA 1PXOA 4OT6A 1YDTE 5AAFA 3QX2A 4TT7A 2VAGA 4LGHA 4RWIA 4O0WA 5AR4A 3LQ5A 4ZLOA 2HY0A 2ITVA 1F3MC 1K9AA 4GT3A 4IXPA 5AP3A 3P78A 4PMTA 3BYSA 3VBQA 2PULA 4IIRA 3PVBA 4TYEA 3FMHA 3TUBA 4OAVB 3QUDA 3DAJA 1KWPA 4ZS0A 4D2TA 4MWHA 1FQ1B 2ITQA 5LVMA 1GJOA 1PKGA 4CYJA 2F4JA 5FWKK 4U3YA 4D58A 2A0CX 4E26A 2WMXA 5AX9A 1YXSA 4Z7HA 4CGAA 2VTPA 2R3GA 2C6OA 2UW4A 1PMUA 4G6LA 3NUXA 3VBTA 5T68A 4YR8A 3HP2A 4JR3A 3H9OA 3NX8A 2A1AB 2JFMA 4C4IA 4C62A 1S9IA 3ACJA 1XWSA 3RHXA 5GINE 1WMKA 4X2JA 4F9WA 3MY5A 4X2GA 3ZU7A 1AGWA 3DOGA 4KIPA 3UE4A 3DBDA 4K18A 2W1ZA 4FMQA 3OXIA 4B8MA 3LCOA 3FBVA 3GT8A 3LCSA 2R3RA 5FM2A 5CLPA 5LCJA 2CKPA 5C01A 4ZJVA 2XARA 3AT3A 5IKWA 4RSSA 2XUUA 2OG8A 5JH6A 1KUTA 5CAOA 3OOMA 3F5UA 3FMJA 3AC3A 2RKUA 2QOCA 3CPBA 3FZOA 3QF9A 4GJ2A 5CI7A 3KKVA 2WEVA 3B2TA 1YHSA 2A19B 4QMTA 5CT7A 2YFXA 4FK6A 3LJ1A 5IG1A 4YJNA 2HZ0A 5TOZA 5BVKA 3OXTA 3C5UA 4CNHA 1GZOA 3P79A 4HGLA 3TI1A 4NW6A 4ZY5A 5FTGA 1UU9A 4LDTA 4FKSA 4KSQA 4OBOA 2GQSA 4RBLA 2B52A 3BWJA 4USEA 3RAIA 2XNNA 4AXAA 2XIXA 4L52A 1STCE 2CPKE 1YW2A 2BFYA 3PPJA 4QPSA 3HDNA 3R1SA 4RLLA 4F1OA 3CGFA 4FKGA 4FTQA 3ROYA 4HVGA 3T3UA 1FINA 3VRZA 3ZFMA 4UYNA 4I22A 1R39A 3HDMA 1AQ1A 2QOFA 3I60A 3ZLYA 4FV4A 3V8WA 4UZHA 3JVRA 3TDWA 1Y6BA 3BBTB 4DEEA 3F61A 3HEGA 3KXNA 4K33A 4EK8A 4IM0A 1FVVA 1JQHA 3DLZA 5J79A 1KOAA 4WNMA 2BMCA 3C51A 3EOCA 4IC8A 5FM3A 4C0TA 5E9EA 4FKIA 4FV8A 4AZWA 5LOHA 4DG3E 3PRFA 4W8EA 3QRIA 4M8TA 4U7ZA 5AV3A 3GQLA 5JQ5A 4FV6A 4DH5A 1MQBA 2W05A 1E9HA 4FEXA 4OAUC 3NPCA 4RWLA 4YJPA 3OS3A 3BHVA 4G1WA 4L3LA 5AAEA 2JDRA 4B6LA 4Z16A 3T9TA 3MH3A 5BUJA 5IA2A 2RG6A 3OUNB 3AD4A 4NFMA 3W2SA 4HGEA 5KZIA 3FEGA 3VWAA 2OJFE 3AC5A 4FR4A 3ZLXA 3NR9A 3DA6A 3OEZA 4HNIA 3MIAA 3KRRA 2XZSA 3COKA 4ALWA 2WQEA 4J8NA 4D0XA 2AC5A 5IH4A 5JFWA 3FC1X 4B8LA 3CS9A 4E20A 3O23A 4L45A 4XV1A 3RI1A 3U9CA 2J90A 2YEXA 5JSMA 4LV8A 3RINA 3UPXA 1R0EA 3OG7A 2JKOA 2QI8A 3N9XA 1OIQA 1W2CA 3FZTA 4U6RA 4E4MA 3RNIA 2O5KA 1UKHA 2GPHA 3NYXA 2YDKA 4KABA 5DGZA 3ZCLA 5BX0A 1H25A 5DYJA 1Q8WA 5DMZA 5GJDA 4DT8A 2W5HA 2W1IA 2R0IA 5DWRA 3ZHPC 4M0YA 1WBSA 3R1YA 4C4JA 4EJNA 4O7VA 3R7IA 4RFYA 4UMUA 1NW1A 2OW3A 2V7AA 2UZVA 5D1JA 4WSYA 4JDIA 3TXOA 4F99A 1PXMA 4USDA 5HNGA 3IDPA 2VGOA 4O7NA 4P7EA 2IW9A 2C47A 2YJSA 3O51A 3NGAA 4U97A 4FEUA 2B1PA 5IQEA 4NU1A 5A14A 3I6WA 3PLSA 3EL8A 3TZ9A 5A4QA 5AA9A 2PE0A 3VS4A 3SG8A 2JDSA 4FT5A 3TJCA 5KNJA 1IAHA 3A7FA 4AW2A 3KK9A 4AA5A 3MBLA 4ZY4A 2Z02A 5HBJA 3P7BA 3U54A 2Z60A 3DPKA 4FNYA 1H1RA 2WMRA 1PMVA 4AOJA 2GDOA 3AXWA 5H8EA 4FG8A 4CCUA 3D5XA 4JRVA 4HYUA 4D0WA 2R3JA 3FMMA 3BWFA 2CGWA 4RC3A 2YIQA 3OW4A 3CY2A 4V05A 2WAJA 3VW6A 3FXWA 5K0KA 3LFQA 4O0XA 4BIEA 2OXDA 3FMKA 4ZZOA 1Q24A 5HX6A 4I21A 1YXVA 4Q5EA 3L9LA 2QOKA 1REKA 4G3GA 2OIBA 4C58A 1RDQE 3E92A 5DN3A 2XKFA 3PLAE 2YM8A 3ZC5A 2JKKA 3F7WA 4NJ3A 3OZ6A 4LL0A 5DPVA 4WA9A 4GH2A 3D7TB 4DGOA 4JIKA 4C3FA 3GU5A 4O84A 5GZ9A 4GK3A 3SOAA 2ZM1A 1YXTA 2YZAA 4WNOA 5GIOE 2C6IA 4RJ4A 3PE1A 4OT5A 4TWPA 3D2KA 3GC9A 3HV7A 4ANBA 2AUHA 3WYXA 3PJ3A 1GIIA 2XNMA 3VUKA 5FEEA 1U5RA 3BL9A 3ZZEA 3AQVA 3KL8A 3U51A 4HNFA 2W96B 3NYVA 4XV9A 4QMQA 4AXCA 1VLRA 3LQ3A 5M4IA 4AW5A 1FMKA 4D2SA 3QHWA 4TL0A 4ASDA 4E93A 4FUXA 4PPCA 5BUIA 4FKQA 1UU7A 3A7HA 3EQFA 3R73A 3BKBA 4O27B 2FO0A 3ORTA 2OJGA 5AIRA 1ZYCA 2QC6A 4I94A 2WTIA 4KNBA 4Y8DA 3IGGA 4ARKA 5DRDA 4E7WA 3BLQA 1Z5MA 2BHHA 2IJMA 4IX5A 4O6EA 3Q96A 1ZWSA 2H8HA 3N51A 3FMNA 1JKLA 4WNPA 4WO5A 4XS2A 5EM6A 3SV0A 4XBRA 4GT5A 2PPQA 1XBBA 3RZFA 3KFAA 3PXYA 3VS1A 2P2HA 2ZOQA 2X0QA 2UZDA 1YOLA 2CN8A 3KVXA 1G3NA 4WD5A 3W2CA 3P7CA 2I7QA 2H34A 5AA8A 4PP9A 4BJJB 2VWWA 3ENHA 3A7GA 5HOAA 5J5TA 1UU8A 4FL2A 4DH8A 4CLJA 1NVSA 2HZIA 5EOLA 3E3BX 4BBMA 4TW9A 2WELA 3RTPA 2ZDTA 3LPBA 3LE6A 2R3KA 1RW8A 4AE6A 4YPDA 1OI9A 5DEWA 2PVYA 3CPCA 5LMKA 4MHAA 4EJ7A 2W1FA 3ATTA 4F4PA 4C4FA 4FVQA 2QOBA 2P3GX 4OBPA 1L3RE 4EOIA 5F94A 3K3IA 4O0SA 2NRUA 2YA9A 2W5AA 3PA5A 4NW5A 3K2LA 3VS0A 4JL9A 2BRGA 5FXRA 4AXFA 4ENYA 4F1MA 3AC1A 4MEDA 4ASEA 4Q9SA 3P5JC 2XRWA 4GIIA 2X2KA 3QRKA 4BKJA 3K5VA 4JOAA 4DTKA 3PSBA 3TZ8A 1LR4A 1MUOA 2UZUE 3DV3A 4FOBA 4NCTA 4O7ZA 4KBCA 1ZAOA 2RSVA 3DQWA 3GB2A 3R9RA 5TO8A 2YIWA 2ITOA 4WOVA 3BIZA 5JT2A 3R7OA 3UMWA 2GHLA 3RMFA 2ZJWA 4FVRA 5AP7A 3CY3A 4RWJA 4EZ7A 3OMVA 3AMYA 4M0ZA 4MXZA 4ZTRA 4BDGA 2OICA 2A98A 4QO9A 4MXOA 2X8EA 3PXRA 5AUXA 3PPZA 4IVAA 3DK6A 3EH9A 4LGGA 2VTMA 4WBOA 1PXPA 4BCFA 3QA0A 5D12A 4D1XA 4I20A 3CKWA 3I5NA 2Q0NA 4J52A 3VS2A 4BGQA 5K5XA 2VTIA 2Z2WA 2WFYA 3EWHA 4MX9A 5CAUA 5IQIA 4F9AA 3DTCA 2EWAA 3QQFA 4YC8A 5FP6A 3OF0A 3DAEA 4ZZMA 4AT3A 2BCJA 2RL5A 3WE8A 5AV4A 4C4EA 1UVRA 5JFSA 4FL1A 2NNWB 2X0GA 3BCEA 4QTDA 4YO6A 2RFEA 4EHGA 3NRMA 2VWUA 2VGPA 2QURA 3W2PA 3LQ8A 5ACBC 4ANMA 4AS0A 3MY0A 4BCKA 1PMNA 3NIZA 3PDTA 3W2RA 4AN3A 4GFOA 4L7SA 3ELJA 3W0QA 3O8UA 3HRCA 1R78A 5M06A 4H36A 5B2MA 5ANDA 1TQPA 4UMTA 1KE6A 2PMIA 5LJJA 3DU8A 3FSKA 2E9PA 1V1KA 3U4UA 3U55A 3DKOA 5FTOA 5K0XA 4AGUA 5JZJA 5EW8A 1H1QA 3R2BA 3S3IA 1KE5A 4PPBA 5L2WA 2XNPA 2WTKB 4TNDA 4GKHA 4QMYA 4HZRA 3D4QA 3E8DA 2P0CA 3Q04A 4BC6A 2QCSA 4CRLA 4A9UA 3DLSA 3OFMA 3II5A 3GFEA 4XH6A 3SVVA 3ZM4A 3TKHA 4J99A 2WQOA 4B99A 1Q99A 3C4WA 3R8MA 4E5WA 4EZ5A 2YZLA 1J7IA 2EB2A 3HV6A 3PJ1A 3LIJA 2GSFA 4HCTA 4CXAA 5KHWA 3L8SA 3ODYX 3P23A 3QZGA 5CU2A 3ZRMA 4RJ5A 3R8UA 4JI9A 1GAGA 4O22A 4AGCA 4AT5A 3QUPA 4FUYA 5KZ0A 3POOA 4Z3VA 5HU3A 5LXMA 2R4BA 2ZM3A 3FJQE 3QRJA 2UW0A 4ZMEA 4BBEA