3ZDIA

Glycogen synthase kinase 3 beta complexed with axin peptide and inhibitor 7d
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
348
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3,6-Diamino-4-(2-Halophenyl)-2-Benzoylthieno(2,3-B) Pyridine-5-Carbonitriles are Selective Inhibitors of Plasmodium Falciparum Glycogen Synthase Kinase-3 (Pfgsk-3)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
total genus 99
structure length 348
sequence length 349
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zdiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zdiA01
4PX6A 1I44A 3QTZA 4IQ6A 3V01A 2YCQA 5CSPA 5E90A 3DBCA 3JVSA 2I1MA 3K3JA 1LUFA 2PVNA 4HGTA 5DR6A 4DH1A 5IH4A 1IR3A 2PVKA 2JDOA 2WTKB 4Y8DA 4QYGA 5AA8A 3BBTB 4HCVA 2PUNA 2R2PA 1OIYA 4HPTE 3R7OA 4BI0A 4BIBA 3FDNA 3ZSIA 3PJ3A 3ZSGA 3C13A 4O6EA 5HZNA 4JG6A 4CMOA 2QC6A 3PY0A 5FEQA 3ZZEA 2BR1A 3RPOA 5HD4A 4ZLYA 3H0ZA 2YWVA 4NYEA 3QUDA 2C0TA 3QZHA 4JS8A 4MF1A 3TIYA 1F3MC 3QC9A 3HV3A 4NJ3A 4PNKA 5L2WA 1GNGA 4NM0A 3NR9A 3U54A 3PA5A 3KN5A 3R1QA 1A06A 4DGGA 3ENMA 2WMQA 1MRUA 1Q61A 3DJ7A 2ITNA 3MY0A 3QRIA 3UNJA 3R8MA 3MH3A 4CXAA 5CNOA 1H28A 3QD0A 4IX6A 4P5ZA 4R3RA 2HWOA 3H9OA 4EQUA 1PXNA 1O6LA 2O0UA 2O5KA 3OUNB 4I1ZA 3WF6A 5E8YA 5BVNA 4BDCA 2HW6A 5EI6A 5CXZA 5JFSA 2Z7QA 4DE4A 5LWMA 3MB7A 1M2PA 4I6QA 2XK9A 4EI4A 4L53A 4NCTA 2WMTA 1JNKA 5KKRB 2P2HA 2VTTA 2P0CA 2BCJA 3VBWA 3HA6A 3LXPA 5HVJA 4DH3A 4FV1A 2OO8X 3G6GA 2OH4A 2WQEA 3VO3A 1FBNA 3AC3A 1JAMA 3FC1X 3UQFA 3LHJA 2XS0A 5M4UA 4V01A 3ZC5A 5CSXA 3LJ0A 3QKKA 4QMYA 5E1EA 4GH2A 5T6KA 4O0YA 3V04A 4IJ9A 3GU4A 4HPUE 3DXQA 1PY5A 2QOIA 4RVKA 2Y4PA 5B2MA 3IDBA 2QOKA 4IX4A 2W17A 1JOWB 2BAQA 2J2IB 4J1RA 3COMA 1OZ1A 2ZM1A 2CGUA 2Z60A 4MBJA 2CPKE 2C1BA 2C3KA 4IE9A 4XV9A 4EUUA 5DR2A 4CFNA 3WF8A 3R8VA 1Y6AA 2X8IA 1PXPA 3G0FA 4FX3A 3OFMA 4QP3A 3TNWA 3W2PA 3ZC6A 4BDBA 4EJ7A 4IFGA 1PXMA 3MA6A 2UW8A 1E1VA 3FC2A 2ITWA 3EQHA 3QBNA 1IA8A 1BX6A 4KBKA 3WF9A 3IECA 4EZ7A 1FMKA 4K6ZA 1TVOA 3CJGA 1M7NA 4ZS0A 3RP9A 1NT2A 3F88A 5K0KA 5EKNA 4QYFA 2BDJA 3EQDA 4O6LA 1YVJA 3ENHA 4Q2AA 3HMPA 2PUIA 1BL6A 3W2RA 4C3PA 4IVCA 4CMUA 5CEIA 1Q3DA 3HGKA 3QTSA 3DK6A 3WE4A 4RSSA 3HX4A 2PZIA 2WNTA 3IS5A 4YHTA 5IKWA 5JFVA 2F57A 1KUTA 2JKQA 4XNEA 4AT4A 2VO3A 3DDPA 1IG1A 4LUDA 4FTLA 1G3NA 2QOCA 3WIKA 4DH7A 5KMMA 4YJOA 2IVSA 4PPCA 3CXWA 4MYGA 3PSDA 1RJBA 1BI8A 3Q4TA 2BRGA 4PPAA 3IONA 3OWKA 4YJTA 5KHWA 2ITTA 5E91A 2BIKB 4F9AA 4IAFA 2WTWA 2H96A 4IZYA 3UMWA 1FVTA 4EORA 3Q32A 4L01A 3NZ0A 4GVJA 4MWHA 3SXFA 2WQNA 4CMTA 4QMOA 5A4QA 4NM3A 5LMAA 2QR8A 5AX9A 5C01A 3D5UA 4K77A 4G5PA 4YO4A 5IG1A 2ZOQA 5JKGA 5D7VA 1R1WA 3KGAA 5M55A 1VEBA 2W06A 3QKLA 4EBVA 3OG7A 4M12A 4OTFA 2BAJA 4PL4A 2WO6A 4L3JA 3D2KA 3OWJA 4IXPA 3S95A 3SKCA 5IQEA 3U4WA 4ACCA 3QRKA 1QPDA 3MI9A 5L2QA 4AFJA 3UOJA 3E8NA 2WAJA 4U42A 1OL1A 2DQ7X 3QTWA 3TZ7A 4AOJA 2ZV8A 4BBFA 2JGZA 2IVVA 2JKKA 2Y0AA 3AXWA 3C4EA 3Q5IA 4A06A 4GSBA 4E4XA 1P2AA 3IDPA 3PIZA 5AUYA 5CEPA 2ZV2A 3FQSA 4IB1A 4USFA 5LOHA 3R8ZA 3VBQA 4IDTA 2YCRA 2PL0A 3TNHA 4EKKA 1H0VA 4C4HA 5KMLA 2PY3A 3WILA 4U3ZA 2UZNA 3NYVA 5D1JA 5HESA 4U79A 4C37A 4UMQA 2GNIA 4EOOA 4ZTSA 4MBLA 1MRYA 5CEQA 5AEPA 1GIIA 1R0PA 2RFEA 3W32A 4CNHA 2WU6A 3R2BA 3N4UA 1JVPP 2G2FA 4FV7A 4I0SA 4O7VA 2DUVA 1KE5A 5I4NA 4QO9A 4ZLZA 4J95A 5CQWA 3AC4A 3F7WA 3K54A 1OUKA 1WVYA 1YOMA 5C03A 2B53A 4EBWA 4HVGA 2V55A 3TACA 5EFQA 1MRVA 5JGBA 3D5XA 3R04A 4L9IA 3DZQA 4JDJA 5IISA 3A7IA 4ANQA 4JRNA 2OK1A 3NMUF 4EOJA 5CQUA 3E63A 2BMCA 4XRJA 2X81A 4ZP5A 2J5FA 3UVQA 5IPJA 1JKKA 2XIZA 4I94A 2PU8A 3TJDA 3ZM4A 3NUPA 4CQGA 4XMOA 1U54A 4KKGA 1SZMA 3II5A 3ZYAA 4XG4A 2B4SB 3I79A 5FTQA 3COHA 1B6CB 1OVEA 4ASDA 5CAQA 5HLWA 5L4QA 3ATTA 4RWKA 5K5XA 3A61A 5B7VA 3S2PA 3KQ7A 4EYMA 5EM7A 4WSYA 1Q8UA 1M7QA 3QL8A 4FKGA 5D10A 2FO0A 4IM3A 5EOBA 3F3ZA 3EN7A 4KS7A 4UWBA 4E26A 2PMNX 4C4JA 5FXRA 3C5IA 5C8NA 2XKCA 2VTLA 4II5A 1K2PA 4FIHA 4W4WA 1AGWA 3AT4A 3PJ8A 1HOWA 1KSWA 1SM2A 5BVWA 3R7UA 4O7RA 4AUAA 3CY2A 3ZLXA 5AMNA 4G5JA 3ZTXA 2H8HA 5IMXA 3GC9A 5C26A 4JBOA 5KBRA 5J7BA 4NIFB 3MYGA 4BDHA 5JN2A 2EWAA 4GV1A 4RWLA 4X3FB 5CU3A 3ZUVA 5LMKA 4Y85A 2Y6OA 2EXCX 3E8DA 2UZEA 3BHHA 3E93A 4I24A 2Y6MA 3W2SA 5IDPA 3QCQA 1YWNA 3KN6A 4JJRA 4QRCA 5BVFA 3RMFA 3FY2A 2ITOA 4G17A 4YZ9A 1MQBA 1WMKA 4F64A 3DNEA 4E5WA 3R0TA 2JEDA 2V0DA 3EN5A 4YBKA 3A7GA 3LQ5A 2CSNA 4HYUA 3EFWA 4FOBA 4YJSA 4DN5A 3OW3A 4FYNA 5FM3A 4F99A 4LYNA 5C27A 4EH3A 4G6LA 4BBEA 2W99B 3ZUTA 4O81A 4Z7HA 2X2KA 3R7IA 3CSVA 3R7GA 4BBMA 5HQ0A 5IA0A 3DXPA 4FSQA 4FSWA 4R3CA 2C3JA 4IB0A 5GJDA 3A60A 4GFOA 4CLJA 4YTFA 3QA0A 2OFUA 3IW5A 4OW8A 4P5QA 5DIAA 4LV8A 5DEYA 3DGKA 4FK3A 3IW7A 4CT1A 5EQEA 4GJ2A 4MQ2A 5IH5A 5AUTA 2XKFA 4DT9A 4ANLA 3FQEA 3CC6A 2OXYA 4CZTA 1BMKA 3Q9WA 1IAJA 1IA9A 4X2NA 3I1AA 4P90A 4YC8A 5GIPE 4ZJJA 3ORPA 4ZTMA 4QP1A 2UZBA 4DTKA 5FDXA 3FMLA 5CALA 4TNDA 5HO8A 2F9GA 4BCQA 2J0JA 2O2UA 2XIRA 4UXQA 3K3IA 1XQZA 1VZOA 3MDYA 4HNFA 3R2YA 1S9IA 4TWOA 3RAWA 5LCJA 2PUPA 2XNMA 3C4CA 3MJ1A 2CMWA 4FTIA 4G6NA 3JYAA 3T8OA 3I5ZA 4BCFA 4BIEA 3VIDA 2HZ4A 3EMGA 4TWCA 4KWPA 3ZHPC 4BI1A 5HVKA 1H26A 3ZO1A 3NW7A 1GZNA 3E3BX 4FZ6A 4FV0A 3Q60A 1UVRA 3V5WA 1OL2A 5HU3A 4M15A 5CY3A 1QL6A 4CTBA 5JGAA 3QTUA 3RPSA 1Q4LA 2BUJA 3A4OX 4AW1A 4U97A 2YACA 4ONAA 5ANEA 3FMMA 3SOAA 3OP5A 5L8LA 2IPXA 5I9ZA 3OS3A 1DAYA 2R3JA 4XCUA 1ZY5A 2VTHA 3JS2A 4FTRA 5DRDA 1BI7A 4I41A 4EH7A 4M67A 4G2FA 1E1XA 4L67A 5DNRA 4J96A 3BV3A 3NIEA 2PE2A 3FL5A 4IAYA 1QCFA 3H9FA 3OXIA 5A4LA 1UU3A 2OIBA 4XV3A 1M17A 2W1IA 1OB3A 1R3CA 3VS7A 3VULA 5HCXA 5FEDA 4JX3A 5FP5A 4UV0A 4Q9ZA 4IBMA 4LGHA 4IAZA 4NWMA 4QQ5A 2C6MA 1WZYA 3ID6C 3NNXA 3TXOA 1H27A 5J9LA 2XNGA 3BWFA 1OPLA 3L8XA 4WHZA 3UC4A 4O0RA 3PPJA 4UWCA 4EYJA 4O84A 1YDRE 3UOKA 1OGUA 2ITXA 3E92A 4FGBA 4OAVB 1VYZA 1PMVA 2FSLX 4YGAA 2ZV7A 3QD4A 3QYWA 2IWIA 4D4VA 5HTCA 5DLSA 1YXUA 5HKMA 3U8WA 1PKGA 1ZWSA 3FMKA 3FMEA 4RIYB 5E8WA 3V8SA 4B6LA 3F3UA 5GZ9A 4F1OA 4FTMA 3KRXA 2QOFA 3EB0A 4Z7GA 3PA4A 3HMIA 4YJPA 4A9TA 1P5EA 4CKRA 4MD8E 4FIGA 3EFLA 3LXLA 2XJ1A 5TE0A 4BDIA 5CU4A 2R3RA 2BALA 4RX9A 5DPVA 4ZSGA 5ANIA 5FTOA 5HNBA 5AR2A 3PVWA 3MH0A 3FYKX 2ZMDA 2GNFA 2R5TA 2A2AA 4AG8A 5D11A 5JMSA 4BYJA 5H9BA 4YZMA 4MHAA 4DITA 5CASA 5FLFA 1CSNA 4AZFA 5F94A 3T3UA 2B7AA 2VTRA 3FMDA 2WU7A 3ET7A 3KF7A 4O0SA 2YIYA 4QMLA 4OBPA 2CNUA 2RIOA 4AZEA 3H30A 3JXWA 2UZTA 4FYOA 4U7ZA 3TZ8A 3CKWA 3S3IA 3LFFA 3PE2A 4RX5A 3OT8A 2WMBA 2J6MA 3NIZA 4J97A 2WQMA 2O3PA 3EL8A 3FLNC 2ITVA 5AV4A 3LJ2A 4MXZA 3CQUA 5AUXA 2YERA 4ZTLA 3NPCA 1KE6A 2C4GA 4FSNA 4KSPA 3WYYA 1OIQA 2XIXA 4GRBA 2UW7A 5AP0A 4F09A 4NJDA 4RZWA 4FSRA 5KBQA 3R1SA 4QPSA 4QD6A 4NIFA 5DOSA 2VN9A 2IW6A 2QNJA 2VU3A 4M68A 4YPSA 1LP4A 4CZYB 4M97A 4EJNA 3LFEA 1JKTA 3LFAA 4NKAA 2B0QA 2I0EA 3MIYA 4TN6A 5DT3A 1W83A 2UV2A 4V04A 3TV4A 3ZFYA 3CKXA 1CTPE 5IEVA 1UKHA 2B9JA 2C1AA 1V1KA 5FD2A 4A9YA 3DJ5A 3HZTA 2HWPA 4EK4A 3KA0A 5KNJA 3BIZA 4O21A 3TM0A 4R1VA 5TKDA 3RWQA 5JZNA 4J8MA 4O38A 1JWHA 1ZARA 1UKIA 2R4BA 4AP7A 3NW5A 3LFNA 4D5HA 1JSTA 2QR7A 4TKSA 1LEWA 3PXZA 3PLSA 5KMKA 1K9AA 2W1EA 1H1RA 2I0VA 4LGDA 2W96B 4QPMA 1M2RA 4FEWA 3DAKA 5CS6A 4FV4A 3VJOA 4E6DA 4QP8A 1JBPE 3ZZWA 3NUSA 4MD7E 4FI1A 4JQ7A 1W0XC 5HBHA 1CM8A 4EQCA 4YTCA 3Q4CA 3W33A 2AUHA 2JITA 3WARA 5F4NA 1YWVA 4Z16A 2C3LA 3DXNA 3F2NA 4C35A 1V0PA 2Y8OA 3OW4A 4O96A 4TRLA 3GI3A 4OR5A 5ANOA 3DBFA 2XK4A 4BWPA 5HORA 3CJFA 3DB6A 3G6HA 3TNIA 5CNNA 2QO9A 3QXPA 3VUMA 4BF2A 4MNEB 3R9HA 4FTAA 4QPAA 5B0XA 5HD7A 3ROCA 2CHLA 4DEDA 4E5AX 5IDNA 2UUEA 4H36A 3GU8A 2PPQA 2Z02A 4DFZE 4EK6A 2NO3A 3ZM9A 5I9YA 4BYIA 3U9NA 1HCKA 4O7SA 3JVRA 4W4VA 2PVRA 3BV2A 3QUEA 3Q53A 4UX9A 4YHJA 2VWYA 4Y46A 3D7TB 3HMOA 4O0WA 5LVMA 1YI4A 4MH7A 3V3VA 1KE7A 3PZHA 4H39A 2V7AA 1U59A 2PMOX 3PIXA 4XG8A 5EI2A 3BEAA 4IB3A 3O8TA 2Q83A 4ORKA 5KX8A 3COIA 2HZNA 5FUTA 4ZXTA 4RQVA 3GOPA 5H2UA 2XRUA 2Q0NA 4I6HA 1CDKA 2XRWA 4TT7A 4I3ZA 4EHGA 1Q8TA 4EWHA 4ZSAA 2WTDA 2W1FA 4AW5A 2KTYA 3EQBA 3OCBA 3O0GA 3DDQA 3P5KA 2C5XA 4C34A 2C6OA 3BU6A 3WYXA 3L8SA 4FVPA 5ETAA 1YKRA 2XBAA 2JAVA 2W4KA 4GG7A 4RJ6A 2VWIA 2YM4A 4C59A 4D2SA 3HLLA 5HOAA 4ZJVA 4RT7A 4PV0A 2OJFE 4FKWA 5IQBA 4QYHA 3BGPA 2YDJA 3DPKA 1UU8A 3NCGA 3AQVA 4BTFA 3TG1A 4CFUA 1H01A 4G3GA 3FXZA 2ONLC 3CIKA 4LOQA 5HO7A 3QZFA 3Q96A 4LGGA 4C7TA 3QCYA 4HGLA 2XCKA 1BL7A 3IGOA 2R64A 2H9VA 4DBXA 3P79A 1FGKA 3DOGA 4JDKA 4G3CA 4FKRA 3OY1A 5J1VA 4C36A 4TYIA 1PF8A 3SLSA 3ZLYA 4GEOA 2BHHA 4EH4A 2WTVA 3RPYA 1CKIA 2WIHA 3NUAA 4CRSA 5GHVA 3GC0A 4ERKA 2GQGA 5M57A 2YLEA 5CENA 2P55A 5AAFA 3GCPA 5DWRA 2X4ZA 4R7IA 2WEVA 2VAGA 2CKQA 1JSVA 2JBOA 4DLIA 2QO7A 3MFRA 2J0LA 4BCJA 2XM9A 3QTXA 5AP5A 3KC3A 5J8IA 4AU8A 3UO6A 4E93A 5GZ8A 4QYYA 4FMQA 5CXHA 1J7UA 4MXAA 4C61A 3W2OA 2GNHA 2C5OA 4C8BA 4JBPA 2VD5A 3E87A 4YLLA 3SRVB 4DH5A 4PL3A 5A46A 4B99A 4UWYA 5ACBC 2CKOA 3I81A 2XA4A 2R3KA 1MP8A 2JBPA 3QKMA 3RHXA 4C02A 2OLCA 5KO1A 4LMUA 4U6RA 2OF4A 3VUDA 3BLRA 4RPVA 3EL7A 4DTBA 4FIFA 3TIZA 2GDOA 3QFVA 2A27A 3HECA 2G15A 4GFMA 1YXVA 1WBNA 3V5PA 4TYHA 4H1JA 4FTJA 3CPBA 2BRBA 3FPMA 3RWPA 3BHUA 3QA8A 4YURA 2VTOA 5DT0A 4FKVA 4BDGA 1WBVA 3FZSA 4USEA 4NFMA 3K5VA 4DEEA 4FTOA 5AUVA 5FP6A 5K9IA 3WBLA 4IACA 4M7IA 1XO2B 5HE1A 4D1ZA 4BC6A 4HCTA 3EOCA 3FKOA 4PDOA 3LM0A 3R8PA 3I0QA 1WBTA 2JFLA 2X2MA 2YIRA 3BGQA 4Y5HA 4O27B 3IPHA 4AA4A 4AGUA 3EQRA 3MS9A 3C4FA 4GU9A 1VR2A 4EOSA 2PMIA 4GKHA 1LEZA 2WQBA 4I20A 4BHZA 3VF9A 2C6TA 3MPAA 4JDHA 4FE2A 3QX4A 4RVMA 3UGCA 4C57A 5LVNA 4BDEA 4FL3A 3D94A 3G15A 4BCNA 5K0XA 3ERKA 3RPRA 3AD6A 4CG9A 3OUKA 3QD2B 2NNWB 3CD3A 3MFTA 2YFXA 5HCYA 4FZ7A 4UXLA 3RK5A 3ZO4A 4H58A 1PMNA 4XHKB 4IADA 3B2TA 3CTJA 4IMYA 2ONLA 3ZBFA 2OKRA 4L00A 2BAKA 2H34A 3A7FA 3UQGA 4L7SA 3G9NA 1W82A 1H1SA 3MW1A 3V5JA 4AN3A 3PJ1A 2CNVA 4JI9A 5CF6A 3JPVA 4QTDA 5CF8A 4BWXA 2BZIB 4XBRA 5M08A 4BICA 4F0FA 4S34A 3I6UA 1H4LA 1H1WA 5HHWA 1A48A 2PYWA 3U4UA 3UJGA 3I5NA 1H00A 2C6EA 1CKPA 1XKKA 3EYHA 4FBXA 4E6AA 3G0EA 3VQUA 3ZSHA 2QOQA 4RIXA 4FL1A 4FODA 5HE0A 1O6KA 3ACKA 2F7ZE 3FWQA 2CDZA 4YC6A 2JDVA 2B9IA 2VTPA 5EYMA 3BE2A 4U3YA 4WNMA 2DWBA 4CD0A 3IGGA 1ZYCA 3FLSA 3ODYX 4YO6A 2JFMA 4ZTNA 5HE2A 2B52A 3M2WA 4R6VA 3UIMA 4C2WA 4JIKA 2R7IA 3TKUA 5G1XA 4BVUA 2QOBA 2W5BA 1SVEA 3COKA 2JC6A 4L3LA 2OJGA 4PNIA 4RJ8A 4FIEA 4YJVA 3GENA 2GMXA 4AZTA 3W16A 4B7TA 4IVAA 5F9EA 4EONA 3EKKA 5HX6A 4N57A 2A19B 3QCXA 4G9CA 2VWBA 2QG7A 3FUPA 3F3WA 4NK9A 4QQCA 3EQFA 1Q8WA 5IA1A 1M2QA 4AZSA 1H08A 5CF5A 3S4QA 4QNYA 4UZDA 4FV8A 5EYKA 1NVRA 4GCJA 3DY7A 4U81A 4IZ7A 3PWYA 3BCEA 5DG5A 1O9UA 2PZ5A 5BVDA 4P4CA 4DCEA 4DEIA 4ACDA 4Z3VA 4FZFB 4JXFA 4L3PA 3LXKA 1PHKA 1VJYA 3KU2A 2BDWA 4ZK5A 4IX5A 4RMZA 4G3DA 1ZOHA 2WMRA 5CVGA 2AC3A 4NT4A 5FBOA 4E20A 4GKIA 2C30A 3GB2A 2ERZE 2UVZA 3Q6UA 4I4FA 1ZAOA 4IAKA 4X7QA 5I9UA 2UW0A 4BN1A 3SG8A 3K2LA 2E9NA 5E8XA 3LFSA 5IQGA 3KULA 3RAKA 3I60A 2RFSA 5CZHA 5FTGA 1H8FA 3ALOA 3VRZA 2XUUA 3GXLA 2FA2A 2G01A 4BDFA 3MV5A 3TCPA 1U54B 4RIOA 2WMAA 3R73A 3DK3A 2G1TA 3LCKA 2VZ6A 5HVYA 4AACA 3GU7A 2X0GA 5AR8A 3AC1A 3ULIA 5J5TA 3DKFA 5DEWA 4PF4A 4JQ8A 4KAOA 4U80A 5J9YA 3PUPA 4ZLOA 5JZJA 1REKA 3MVHA 3ORTA 2GTNA 3PZEA 2OI4X 4FGRA 3EFKA 3LFCA 2CLXA 3ULZA 2EB3A 3TI1A 4BFMA 4BCHA 3N51A 3OCGA 4CFWA 4EUTA 1Z9XA 4KBCA 4YNOA 4AE9A 4XG3A 3R71A 3KXGA 1UU7A 4W9XA 2BIYA 3VUHA 5K4JA 1PYXA 2YIWA 3DTWA 5J9ZA 2IJMA 2GHMA 3NUNA 1Z5MA 3R9DA 3KXMA 4ALVA 3GUBA 3NNWA 3HV6A 5HTBA 4OTDA 1XWSA 3DAJA 3G33A 4A7CA 3EQGA 2BRNA 4NM7A 1GIHA 4G16A 2R3NA 3KMUA 2YCFA 2P2IA 1Q3WA 3F5PA 3MVMA 4U5JA 1Q24A 2PHKA 5FWKK 4J8NA 4IWPA 4QYEA 2IZUA 5A4CA 2R3IA 5L6PA 3PG3A 4MK0A 4KBAA 2W9FB 5EYCA 4M0YA 3PVBA 3GFEA 1PXKA 4J71A 4ITHA 3WF7A 2UW6A 3OT3A 3ORZA 4CQEA 4KIOA 3LCSA 3KY2A 5HG8A 2BDFA 3NYOA 3SQQA 3UC3A 4FKLA 4MX9A 3R8UA 3O2MA 2PMLX 2V5QA 3NUUA 3T9TA 1QPEA 5ACKA 4HNIA 3VRYA 3FHIA 1GZ8A 3OTUA 4JIAA 2X6DA 3DTCA 5ETIA 3EQCA 3OVVA 2O64A 4A9SA 1WBSA 4R3PA 4WUAA 2HZIA 2HENA 2R3FA 5GJGA 4IWQA 4DTAA 4O91A 1H07A 2XJ2A 3GC7A 4BHNA 2ESMA 2IZSA 4FT7A 4BKJA 2WHBA 2BZHB 4QMVA 2VWVA 3IG7A 4E5BA 3N4TA 2WELA 4BZNA 5HU9A 3A99A 3RAIA 3PA3A 3SHEA 4H3BA 2BKKA 1YOJA 5L2TA 3QQHA 2C68A 3A62A 2XYNA 4TL0A 5GINE 3R9OA 4AX8A 3BYVA 4C62A 4PMPA 4CCBA 2NRYA 3L9MA 1AD5A 4TWPA 4AOTA 2W5HA 2IG7A 3UIUA 3HKOA 4PP7A 3CS9A 2R3MA 4KRDA 3VUTA 3WF5A 5L8JA 2C6DA 4GK4A 3LW0A 2JKMA 3O51A 1OIUA 4FV6A 2RSVA 4DGMA 3BE9A 3OWLA 4APPA 3HAMA 1GIJA 4NCTC 3QU0A 3HV7A 3PSBA 4IAAA 4GL9A 4OTQA 5CZIA 2QO2A 3QLGA 5DA3A 3IOKA 3KULB 4A07A 4EZ5A 5CEOA 4UZHA 3PE1A 2GS6A 5JFXA 3OOMA 4KSQA 3FLWA 3FEGA 2QLUA 4PUZA 3QXOA 3VS1A 3WI6A 3NVMB 4YSMA 4J7BA 4CEGA 2HAKA 2EXEA 3RCDA 4H3PA 2XCHA 3E88A 4I5HA 4MKCA 1G8AA 4YMJA 4D9TA 3HV5A 3KL8A 5AUWA 4XYFA 2VTSA 3CY3A 3FQHA 4JNWA 2UZDA 3C0IA 3O71A 3DA6A 4FT9A 4CTCA 4FTNA 4D28A 1ZOGA 3UZPA 5HNIX 5JFWA 3D7ZA 3PXRA 4FKJA 1Q62A 5HBJA 4NM5A 4YNEA 3W8QA 4FNWA 1PYEA 2JLDA 3FMHA 3NCZA 2WMSA 1OPKA 3DBQA 3B8QA 3CBLA 4LRKA 4BZOA 3VS4A 4D4YA 3BWJA 3VN9A 2X7GA 2OZOA 4KKHA 1QPJA 5A54A 4OTGA 3RNYA 4F1MA 1XBCA 2V22A 1SMHA 4ALUA 3K5UA 4L7FA 4FVQA 4M69B 4O0XA 4ACMA 3BHVA 5TT7A 2C5VA 4WIHA 5CU6A 3FL4A 4TW9A 2HXLA 3DZOA 4HJOA 5FQDC 4LMNA 5H8GA 3VW8A 1Q97A 2Z2WA 3LJ1A 1YXTA 3O23A 4RC3A 3QZGA 3IK3A 3H9RA 4GUEA 4DAWA 3AC2A 2WTJA 1OPJA 4OT5A 3L8PA 5EHYA 5AP1A 5KE0A 3ZO3A 4CV8A 2OZAA 3UP7A 1CMKE 4KNBA 3SW4A 4MVFA 5JT2A 5A6OA 2YA9A 5D9HA 4IVDA 1YDSE 1QMZA 3FZRA 4L6QA 4PY1A 5CWZA 3WIGA 3TKHA 2YZAA 1QPCA 4LRMA 4CT2A 4U45A 2OG8A 4DBNA 2FSMX 2NRUA 3I7CA 2UZUE 5LMBA 4BR3A 2VTIA 3VW6A 2XK8A 3GCQA 4GT3A 4YPDA 2IN6A 3BQCA 4CYIA 3UODA 3ITZA 3V5QA 3RCJA 2GSFA 4QQTA 5L6OA 3U87A 3UVPA 4IZ5A 4FKUA 2ZV9A 4C38A 1YDTE 5LVOA 2ZJWA 3SXRA 4IWDA 3DKOA 3PPZA 2YISA 2VGPA 1RW8A 3IO7A 3KK8A 3R30A 5FRIA 3RALA 3R28A 4E4NA 1XH5A 1ZMVA 3ZOSA 3HAVA 2XYUA 4LFIA 5AR3A 1J1CA 4FL2A 4RA4A 4Y5QA 5EW9A 3ZXTA 4ACGA 2QOOA 4D1SA 3ZUUA 1YHSA 2WMUA 3PWDA 5ETCA 4ZZOA 4K9YA 3UQCA 4B9DA 2OIDA 3GC8A 3BRBA 2GCDA 2R9SA 3Q9XA 2W1GA 2YWPA 4JG7A 3VHKA 2XNNA 4LL5A 4D2RA 2GNGA 4AGWA 1TQPA 4DG3E 5LMKC 4LV5A 2HZ0A 4UBAA 3UPZA 5C4KA 2PVHA 5IQFA 5E8TA 4M14A 5EKOA 4F4PA 4L52A 4UMUA 2OBJA 2OICA 1YHWA 3HV4A 3LFQA 4FKPA 2BRMA 5I9XA 4O83A 2GS7A 3GOKA 2W9ZB 1F5QA 3NLBA 4BDKA 1OKYA 2XMYA 3A8XA 2QU6A 4TZRA 4GUBA 4WKQA 3ROYA 3D4QA 4BCIA 4RFZA 1DI9A 4X3FC 1OKZA 5IA5A 5CU0A 3HMMA 3Q52A 4EOMA 3CQEA 2A4LA 2J0IA 4XUFA 5E8UA 4GYIA 1Y8GA 3PXQA 5H8BA 4FUXA 3ZCLA 4DYMA 4FKOA 3HVCA 5A6NA 3C0GA 2C6LA 3OEZA 3P0MA 4NW6A 4R8QA 3F61A 5CSWA 1IASA 4I92A 5HEZA 4QP2A 2VWXA 4PMTA 5HNGA 2PVYA 5FGKA 3RAHA 2YZLA 1OUYA 2OZAB 3AT3A 2HY0A 4I93A 4O7ZA 4O2ZA 5EQYA 4MBIA 3VVHA 2PVMA 3BEGA 5I9WA 5KMNA 5CAVA 3CE3A 4GVAA 3CTQA 2XP2A 4YBJA 4RJ7A 3LCDA 2PUUA 2WMWA 3IQ7A 2AC5A 3CCNA 3GQLA 3EJ1A 2QODA 3FAAA 3KKVA 4RWJA 4WG3A 4A4OA 4IFCA 4M66A 3SG9A 4GG5A 2Z8CA 2QU5A 1BYGA 3KXHA 4RJ5A 4ID7A 3P08A 3PFQA 4YJNA 1XH4A 4IHPA 5DH3A 1W7HA 4ZSJA 3VJNA 4G6OA 3MPTA 2OIQA 4I6FA 3ELJA 2F2CB 3QD3A 2BVAA 4U40A 3LM5A 3RPVA 2R3LA 3VS6A 3LQ3A 2C6IA 3FMNA 3P9JA 5AM6A 3S0OA 4I5MA 4L44A 3ZMMA 3MWUA 4DCAA 4AE6A 3NWWA 4LOPA 3AC5A 2XNEA 2FUMA 3FE3A 3UYSA 5L8KA 2YJSA 2GTMA 3MSSA 4F9CA 4AXAA 4EOKA 3QRTA 5ANJA 3G9LX 3E64A 3M11A 2BRHA 1J3HA 3Q3BA 3QWKA 4GIIA 4FSZA 2GNLA 4MXCA 2W0JA 1DAWA 2WMVA 4GS6A 4HYSA 4DGNA 3DB8A 4JR3A 4AN9A 4AGCA 3BHTA 4ZJIA 3SGCA 1M52A 5E4HA 2A0CX 2C0IA 1KV1A 1ZLTA 3LMGA 4EK5A 5CEMA 5D41A 1OL6A 4PPBA 4BCKA 4QTEA 3DK7A 3TTJA 4FA2A 3AGMA 2R0UA 4XLIA 4KS8A 3ZDIA 2OXDA 3KRWA 3RGFA 5CTPA 3RJCA 5HLNA 3VUIA 3ODZX 3QQGA 3W1FA 3R83A 3TEIA 3FSKA 4YLJA 5J5SA 2CN5A 4WD5A 4FT0A 3LZBA 5LJJA 4PDPA 3QQFA 5ETFA 5IQCA 2Y9QA 4WNOA 2W7XA 3AT2A 2VO0A 3UG1A 4BWKA 1ZRZA 5FXQA 3RKBA 4ZMEA 4XG9A 1J7IA 4NKSA 2X7FA 5EM8A 2I7QA 1REJA 3KXNA 1KOBA 2WPAA 4QP7A 2O8YA 2OW3A 4D58A 5BUIA 4RRVA 3RK9A 3O8PA 1WBPA 2JDTA 3VS5A 4FKIA 3MN3A 3P4KA 4GFGA 4RGJA 4I6BA 3S00A 2Y7JA 4BB4A 3UIXA 3OF0A 4A4LA 2QOHA 4G9RA 4JLCA 4HVSA 4OBOA 5JRQA 3HEGA 1ZY4A 2W1HA 2UVYA 1FGIA 3PXFA 3QCSA 4AN2A 2R3OA 2FSOX 1JQHA 5ITAA 4F7NA 3GNIB 3MY1A 4KA3A 2YEXA 4DFXE 2ZDUA 5A4EA 4RIWB 3RM6A 2RFNA 1PKDA 1U5RA 3P7CA 4ARKA 1OBDA 4ACHA 3OY3A 3TV6A 2WZJA 5AAGA 3TZMA 2BILB 3D9VA 4IM2A 3BU3A 5C8KA 3B8RA 4D0WA 3B2WA 1NVSA 1XH9A 4FSUA 4U43A 5AX3A 4GJ3A 5J79A 2JDSA 2C0OA 4MNEA 5E92A 2G2IA 5EG3A 4I5CA 1XBAA 4RFYA 4U41A 3BI6A 3NEWA 3JR1A 2WEIA 4YC3A 4YR8A 4E4MA 3FJQE 3MIAA 2EB2A 3FXWA 4RBLA 5I0BA 3S1HA 4DFYA 3P7AA 4XOZA 3QGYA 1SVHA 3QHWA 4NSTA 2UW4A 4GU6A 5CANA 1ZZ2A 3KB7A 3CPCA 3PP0A 4EKLA 3FI4A 3D2IA 1PRYA 3DBEA 4ZY4A 3O8UA 4RQKA 5EH0A 3AOXA 4FSMA 3W55A 5CAOA 2XNBA 2QCSA 4JVGA 4AAAA 4G1WA 4HVIA 3EQPA 3EH9A 1K3AA 4HGEA 3PJ2A 4JT3A 5EDRA 5EYDA 1H24A 3VUGA 3Q6WA 2V7OA 5KUPA 1YQJA 2CGWA 2IO6A 3Q04A 4MQ1A 3DKGA 3OBGA 2GHLA 3GT8A 3P7BA 1FOTA 1KWPA 4K18A 5CT7A 3HYHA 5F95A 3O96A 2VWZA 2ITQA 3FXXA 2J50A 3RBWA 4BKZA 3QQKA 2B1PA 4FV5A 5A9UA 2WOUA 4FTKA 4ANNA 1L8TA 2QD9A 3A7HA 5BVOA 4CSVA 4D1XA 5M44A 5D12A 5DFPA 2R3QA 3TV7A 4KINA 2YM8A 2C3IB 4FNXA 4O7TA 2VV9A 3LFBA 4RFMA 5GIOE 4Y72A 3TDVA 4DEGA 3SVVA 2QKRA 4DF3A 3EKNA 4O1OA 3MPMA 3VBXA 3FHRA 1OIRA 2UW3A 1YW2A 4FTUA 3QGWA 3GU6A 1W98A 4TWNA 3NNUA 4AA0A 4OGRA 3AGLA 3BBWA 5FG8A 4CYJA 1B39A 1GZOA 4RC2A 4ZSEA 1XH8A 3VAPA 2XIKA 1PXLA 2QLQA 3TN8A 5AFVA 4E4LA 3ORNA 2V62A 4EHEA 4D9UA 5I5ZA 2FSTX 2VTAA 4QP6A 4H3QA 1X8BA 5TO8A 3FI3A 4IC7A 2AYPA 2WTKC 4JL9A 4PL5A 4WNPA 1SNUA 3QAME 1OL5A 2RG6A 3PXKA 3UBDA 4ANOA 5M4FA 2QONA 3LOKA 3OEFX 4XV1A 3JY9A 3UDBA 3R9RA 4RVLA 3GCUA 3DS6A 1TKIA 3BYSA 4N0SA 4USDA 4N4SA 3W18A 4D2VA 4UB7A 1ZYJA 5CVHA 2X6EA 5B2LA 2VX3A 4RIXB 4WO5A 4NL0A 3PTGA 4RZVA 4QMWA 2XB7A 4NTSA 3Q5ZA 4N6ZA 5DRBA 4R1YA 2IW8A 5E1SA 4ZEGA 3R21A 4L68A 3SXSA 3R1NA 1R78A 4QP4A 4KD1A 2HCKA 5BQ0A 4EQMA 5IA3A 4RX8A 1DS5A 4NEUA 4RVTA 4DEBA 3N4VA 1FVRA 4D4RA 4XEYA 5A14A 5KHXA 4FG8A 2PZYA 5EDQA 4UALA 4EH9A 4YJRA 4NTTA 3OTVA 4HVDA 1T45A 3T3VA 4YU2A 4RJ3A 4DLJA 3CEKA 3POZA 2OU7A 3CGOA 5FEEA 4UN0C 3WE8A 2B55A 2YM7A 3NSZA 4FT3A 4FICA 4OTHA 4IJPA 3DKCA 4X6QC 3MH2A 5BNJA 2QURA 1JKSA 2RG5A 2UZOA 3E5AA 5IQIA 2I6LA 3IW8A 3N9XA 2GFCA 4E73A 4DT8A 4PRJA 3FBVA 1J91A 3JY0A 2VGOA 3R02A 4U44A 5CI7A 1XHAA 2XEZA 4AZWA 3LCTA 3SOCA 4O7NA 5C8MA 3RHKA 3DLZA 1UWHA 4EH5A 4RG0A 3OHTA 2W1CA 4GK2A 2FH9A 3C4XA 3LFDA 5GNKA 3R1YA 4XX9A 3RI1A 2Z7SA 4LG4A 3DQXA 4FTQA 3RINA 5CAUA 2WD1A 3ORKA 5KZIA 2X2LA 1IEPA 2VO6A 1OMWA 3OOGA 4KIPA 2ITYA 3M1SA 3KRRA 5EM5A 3LVPA 3OBJA 2EUFB 2QHNA 1SYKA 3BZ3A 5I3RA 2P4IA 3ANQA 5LXMA 5IMEA 3C7QA 3FY0A 4EOPA 2XZSA 4LOOA 1DM2A 1WVWA 5I9VA 5J95A 5CSHA 5JGDA 4MNFA 5EHLA 1WFCA 4GMYA 4XH6A 3MFUA 2GQRA 4I23A 4FEVA 3FI8A 2VUWA 2WTCA 3RVGA 3E8EA 2R0IA 3QQUA 1URCA 5AV0A 3ZXZA 2LAVA 2QI8A 2Q0BA 3HL7A 3HP2A 3TNPC 5K5NA 3AMBA 4DG0E 4O0VA 4X3JA 2PZRA 1L3RE 1W8CA 3R00A 4BTMA 4H05A 3OCTA 4Q5HA 4JRVA 5IUGA 2CCHA 3BKBA 5IQHA 3Q4UA 2E2BA 3U9CA 4KRCA 3ZS5A 3ORMA 3NYXA 5HCZA 4DA5A 2REIA 3F5XA 5BX0A 2YM6A 3IKAA 4X21A 1IRKA 1TQMA 3DU8A 3HNGA 4MEDA 3PJCA 3F7ZA 1STCE 4QP9A 2X9EA 3DFCB 4WA9A 3MBLA 1YXXA 4V05A 4ZMFA 2ZM3A 5AIKA 4BRXA 4BL1A 3E8CA 5HO6A 4BGQA 2XVDA 5DVRA 3TL8A 4J52A 4BIDA 2IVUA 2XBJA 2ZDTA 4S2ZA 3V6RA 3ANRA 4K2RA 1R39A 4S30A 4KIQA 3BLQA 3GBZA 4FV2A 4HZSA 2W4OA 4Q9SA 5C4LA 5TOZA 3KXZA 5BMSA 5HIEA 4PQNA 3FZTA 2YN8A 3O50A 3AMYA 4D2TA 1MUOA 2ETRA 3R9NA 4CRLA 4B8MA 3ORLA 5IQDA 5G6VA 3R8LA 2YIQA 2XNOA 4XLVA 2O63A 5AR7A 3CLYA 3WZKA 2PTKA 2RGPA 2A1AB 2EXMA 1OITA 3R7YA 4XJ0A 5IZFA 4ANSA 2QKWB 4EEVA 5L6WL 4C3RA 4FNYA 3UTOA 4FNZA 4F9BA 2BTSA 4WRSA 3F9NA 5KMIA 2BKZA 3U6HA 4BKYA 3JUHA 2E9OA 5K4IA 4QMSA 5GJFA 1UU9A 2VTQA 1H1QA 3PIYA 5J1WA 4X2KA 3VS2A 3AD4A 4R77A 1JKLA 4WNKA 4KIKB 4XV2A 2JKOA 3V8TA 5GZAA 2VRXA 2ZM4A 2J51A 2VWUA 3UOHA 4DFNA 4NZWB 3RM7A 4WRGA 2IZTA 2YAKA 1CKJA 2DYLA 5KMJA 1PJKA 3C5UA 4NW5A 4F0GA 3G2FA 2XK6A 3ZRKA 2CKPA 1WBWA 2OXXA 4F08A 3MVJA 4XG7A 4IIRA 4JOAA 5B2KA 3NNVA 5HIBA 4ZZNA 2W1ZA 2ZMCA 2JDRA 3MB6A 3MGYA 5EI8A 4ZIMA 3V8WA 3W10A 4EC8A 1UNHA 4DFUA 4G3FA 2QHMA 5HE3A 4DH8A 4CLIA 1V0OA 4U9AA 4O7LA 3MTLA 2E9PA 4ENXA 3D14A 3QC4A 4O86A 4CZUA 4E3CA 4UEUA 3QLFA 2C5NA 3KEXA 2GS2A 1ZMUA 2XK3A 4C4FA 4F65A 2ITUA 4FV3A 2RF9A 4XS2A 4DG2E 2G2HA 3OXTA 4PP9A 3LLAA 4R7HA 5BYLA 4BDAA 1P4OA 1HCLA 3AD5A 4J98A 5LCKA 3SV0A 3D5WA 4TTHB 4CKJA 5JSMA 3LMIA 3NRMA 1BKXA 4RX7A 4V0GB 2ERKA 2GPHA 4HYIA 5M56A 3TWJA 3GGFA 3L9LA 5DGZA 5AR5A 5CX9A 5BVKA 4JG8A 4QNAA 3UE4A 3PY1A 2CGVA 2OJJA 1UA2A 3PVUA 3QTQA 2GQSA 4R7BA 5IUIA 4YSJA 3E7VA 1Y91A 2WXVA 2P33A 4MXYA 2R3PA 2J5EA 3H0YA 4GK3A 3FLYA 5CF4A 3PPKA 4DGOA 2ACXA 4I4EA 4HZRA 5AJQA 5L3AA 4GT4A 4K8AA 4IB5A 4QMXA 4ANMA 4F7SA 2VTNA 2RFDA 3OMVA 1FQ1B 2PSQA 3A2CA 2YHVA 4KABA 4AA5A 2YLFA 5ICPA 3SA0A 1APME 4MD9E 3ZU7A 4D5KA 4EH2A 2WOTA 4O7WA 2ETKA 1PXIA 5KZ0A 4EZ3A 2VTMA 4BTKA 1WCCA 4FEXA 4O1PA 2UW5A 2VX0A 3DAEA 4CFXA 3EIDA 4O22A 5AV2A 3R7EA 5ANDA 4PTEA 4IEBA 3UYTA 2PULA 3AC8A 3FKNA 4ITIA 3H10A 4LRJA 4OTPA 3ZEPA 4D2WA 1OBGA 4EC9A 3MVLA 2OSCA 4I0RA 2YCSA 4WBBB 3QQLA 3TNQB 3GCVA 2XM8A 3FYJX 1GY3A 3W2QA 2HELA 3SW7A 4XP2A 3UOLA 4BCPA 4C3FA 3GQIA 5IA4A 2NPQA 3D5VA 3KF4A 1GZKA 3OD6X 4ZS4A 5L2SA 3U6IA 2WKMA 3UPXA 3O7LB 4D55A 3BELA 5HX8A 3IW4A 1GJOA 3Q4ZA 1RE8A 2X8EA 4F70A 4NH1A 5IA2A 2UZWE 4OTRA 4TYEA 4W9WA 5BUJA 3QWJA 2X4FA 4XP3A 1ZZLA 3WZDA 3CGFA 3IOPA 4OT6A 5HI2A 4BDDA 4D4SA 4DFBA 4N6YA 3UO5A 3LPBA 4YZNA 3W8LA 2PE1A 3F3TA 4EOLA 4GYGA 4JAIA 3L9PA 4PMSA 2VTJA 5F20A 5LVPA 3OWPA 2ITZA 3SC1A 4AWIA 2OGVA 4APCA 4V0GA 3RNIA 1PXJA 2BFYA 3R7VA 3POOA 4FC0A 5H3QA 3BQRA 4FT5A 4EH6A 5EQPA 3RTPA 1Y6BA 2ZVAA 4EK3A 4RIWA 4A9UA 3TUCA 2YAAA 3BU5A 4MF0A 3WZJA 1YI6A 4WG4A 4CFFA 3PG1A 4FSTA 3U6JA 1URWA 3F66A 2KULA 4IVBA 2QQ7A 5EDPA 3P78A 3P86A 4IX3A 4ENYA 5C9CA 2UW9A 2WQOA 4HVHA 3TDWA 5AR4A 4AF3A 1OI9A 3GEQA 5H8EA 4LM5A 3LQ8A 4CKIA 2HIWA 4X6RA 5EHOA 2HK5A 5TR6A 4O2PA 2H6DA 3NW6A 1E9HA 3ATSA 5M09A 4FZDB 5EM6A 5LQFA 3EWHA 2HXQA 4IAIA 4WBOA 2GU8A 4KIKA 1YHVA 4FG9A 2O65A 1ZXEA 1JLUE 4TYJA 4FZAB 2WGJA 4Z9LA 2BTRA 1EH4A 2XH5A 4XP0A 4BI2A 4L46A 2X9FA 3TT0A 5JEBA 3Q2MA 5AP3A 5IEYA 1Q99A 1ZYLA 2ITPA 4WT6A 3Q9ZA 5BPYA 2GFSA 3KK9A 3F2AA 3TUBA 1KE8A 1H0WA 2R3HA 4GW8A 4A9RA 3UNKA 2XIYA 3EN4A 5FDPA 3NYNA 2C69A 2BZJA 4U0IA 5K3YA 4ASEA 1FINA 1YOLA 2NP8A 4ZTQA 5DT4A 5M07A 2XKEA 4G31A 3VS3A 1PW2A 3TJCA 4BY9E 1WBOA 1RDQE 5ANGA 2F7EE 3BHYA 1KV2A 4RJ4A 5E7RA 5EK7A 3LAUA 4WUNA 3SD0A 4OAUC 5LARA 3ZBXA 3ZFXA 3AMAA 3ZRLA 4ASXA 5HBEA 4OLIA 5JK3A 1KOAA 2XF0A 3NX8A 3A7JA 5AUZA 5CAPA 3RZFA 5M06A 5AM7A 5M51A 3RZBA 5AP2A 4X2GA 5JRSA 3VF8A 4FEQA 3UO4A 3BPRA 2I0YA 3MFSA 3C50A 3CTHA 4O7YA 2OFVA 5E9EA 1R0EA 2QOLA 4YTIA 5C1QB 4FK6A 3SX9A 5HIDA 2VO7A 4TNBA 1U4DA 3KRLA 1W84A 3R01A 1ZYSA 1XH7A 4ZZMA 2DS1A 3LLTA 5F1ZA 3C9WA 3G90X 3A8WA 4BCOA 3KFAA 2FVDA 5CVFA 3FLQA 3LMHA 3DNDA 5HGIA 4CV9A 4PTGA 3F6XA 4Y83A 3THBA 5CSVA 4GT5A 4YHFA 5A3XA 2C5YA 4AOIA 4TY1A 4ZTHA 4Q5EA 4BCGA 4WOVA 5TF9A 3V6SA 3I0OA 3PVGA 3QQJA 3UP2A 1A9UA 2QG5A 4JX7A 1NY3A 3ZONA 4PDYA 2JIIA 2J0KA 1Q41A 4UY9A 5AP6A 2LGCA 3FZ1A 4C4EA 5IQAA 3KMWA 3HRFA 3F2RA 1P14A 1I09A 2IVTA 4K33A 4XG6A 4AFEA 1BLXA 4F9WA 3KMMA 2YM5A 2CNQA 4I22A 5DHJA 2WIPA 3HRCA 4E1ZA 1S9JA 4BGGA 3L8VA 4G34A 3BLHA 4DGLC 3GVUA 3NAXA 4F7JA 2PVLA 4EH8A 4YUQA 5M4IA 4UMTA 4B0GA 3R22A 5KMOA 4W8DA 5LWNA 2E9VA 3BX5A 4ZY5A 3TZ9A 4PMMA 4F6UA 3DV3A 4QMNA 3KXXA 2BFXA 2BPMA 2R7BA 3HUBA 4S33A 2G9XA 3QYZA 4TXCA 4DINA 1Y57A 5DYJA 3H4JA 3ALNA 1ND4A 3NVKI 2VNYA 3C4WA 4Y95A 3LIJA 4FG7A 4QT1A 5T68A 3FPQA 3PLAE 4LI5A 4ALWA 4ZTRA 2JIUA 4BGHA 4UMPA 2BHEA 4QMUA 2B9HA 4ZAUA 2GHGA 3D83A 3I4BA 5BYZA 1H1PA 1Y8YA 4QMQA 3C1XA 4EK8A 2E9UA 3TTIA 4W8EA 4C4IA 4CGAA 5DI1A 4YP8A 5HLPA 3ORXA 5AWMA 5CT0A 1LPUA 4WSQA 4G3EA 5I3OA 3MA3A 5IUHA 2CKEA 4ZOGA 4KKEA 2VNWA 4JAJA 4F9YA 2Z7RA 1OKVA 3FMJA 4HGSA 1Q5KA 4I0TA 4IC8A 3OCSA 1P4FA 3EHAA 4IH8A 3V51A 5HTIA 5DN3A 3BYOA 4MTAA 3HMNA 5FBNC 4F6SA 4J99A 5E8SA 3OROA 2XK7A 1TQIA 2YDIA 5AUUA 2X7OA 4ASZA 4GIHA 5AAEA 3G51A 3ZRMA 4DFLA 3OC1A 3V5TA 4IANA 4IZAA 2B54A 3NUYA 3OXZA 5EW8A 4FUYA 4UYAA 4AGDA 3UZTA 2XEYA 1Q8ZA 2J0MB 5CEKA 3CP9A 3D0EA 2XKDA 4M84A 4I5PA 3DJ6A 4CG8A 1H25A 1OM1A 2W1DA 2YJRA 1XR1A 3EN9A 5E8ZA 3T9IA 5BUEA 2UVXA 4ZSLA 5IEXA 2ZYBA 5E8VA 2HYYA 4M0ZA 4M69A 3ETAA 5CYIA 3L9NA 4M8TA 4D2PA 3KREA 1GOLA 4BZDA 4JBVA 5FXSA 3PXYA 4YZCA 3VBTA 4NFNA 4JDIA 3U51A 4QMTA 4MAOA 1LR4A 2IW9A 4RLLA 4F63A 4Z55A 4OBQA 1U46A 2P3GX 2OJIA 3V5LA 3DCVA 3O7LD 2HY81 4DEHA 4JBQA 4FOCA 4C58A 4A4XA 5AP7A 3QUPA 5M53A 3OZ6A 2F4JA 1G8SA 4AT5A 4XRLA 4UYNA 4DHFA 4YJUA 5HICA 2F49A 2IZRA 3VQHA 2RL5A 2W4JA 4P7EA 3UMXA 4RLKA 3C4ZA 4XOYA 5BVEA 4DEAA 4C2VA 4X2FA 4FIJA 5CU2A 4FV9A 1PMUA 1Z57A 4FKTA 1FMOE 4TYHB 4E7WA 5JQ8A 4ERWA 1G5SA 3GFWA 4LQMA 4IW0A 3D15A 3NAYA 5JH6A 1J1BA 4KUJA 3W2CA 3WZUA 5FM2A 2J90A 5J87A 2WFYA 3P1AA 4PDSA 4H1MA 4DC2A 5J7HA 3DFAA 3QRUA 4WG5A 1KE9A 2PWLA 2XJ0A 4XG2A 1PXOA 2UZLA 2CGXA 2WMXA 3CR0A 4OTIA 1O6YA 3UZRA 4TYGA 3SRVA 4IM0A 4LUEA 4CCUA 4FEUA 2JAMA 2X1NA 3BGZA 3QRJA 5D7AA 3ZLSA 5M4CA 3ACJA 1GAGA 3MY5A 4LL0A 5DMZA 4OUCA 2YDKA 4C33A 5LVLA 4FSYA 5HG9A 3GCSA 3FZOA 4O0TA 1WVXA 4FF8A 2F2UA 3FLZA 1Q8YA 4F0IA 4F7LA 5BYYA 4YJQA 1XJDA 3FSFA 4QOXA 4K11A 5AA9A 4KB8A 1YWRA 1RQQA 3DLSA 4QTCA 5EOLA 1YRPA 3FV8A 4BTJA 4CFVA 3MESA 3HDMA 3MJ2A 5AIRA 1ATPE 3LCOA 2PZPA 3L1SA 2ZB0A 2EU9A 1UNGA 3F82A 3KCKA 4YTHA 3CQWA 1T46A 3ZFMA 1IAHA 2FB8A 3EFJA 4L45A 5HG7A 1NVQA 3AG9A 3HA8A 2B9FA 5EW3A 4AQCA 4RA5A 3GU5A 1AQ1A 4BDJA 1XBBA 2XNPA 2OWBA 4RIYA 5AADA 3IDCA 4FTTA 4AZVA 3FKLA 3MTFA 4JQEA 4MXOA 2ZB1A 3QF9A 4L42A 4ZY6A 5L2IA 4X3FA 4RWIA 3R63A 2YIXA 2X8DA 4PTCA 5HG5A 2Z7LA 4C4GA 3EN6A 1UWJA 4YZDA 2UZVA 4L43A 2YABA 3KRJA 3VS0A 3UNZA 4UMRA 5KKRC 3QZIA 4YZBA 4CFMA 3O17A 3UIBA 1FVVA 2J7TA 2VWWA 1YXSA 3PY3A 2BROA 4MCVA 5AV1A 3VBYA 2WB8A 2X39A 3SDJA 5IH6A 3VUKA 4L8MA 3NGAA 4E6QA 4FR4A 4PWNA 3TKIA 5DR9A 3PRIA 4HW7A 2JIVA 4BCMA 2F7XE 4I21A 1YI3A 4J53A 1FPUA 1ZOEA 3PRFA 5T3QA 3UG2A 3F69A 3PDTA 2OH0E 1SVGA 4YLKA 3P23A 3R6XA 4M3QA 3DQWA 1XH6A 4MXXA 1NA7A 4S31A 4FKSA 3E3PA 3H3CA 2C6KA 3D7TA 4ANBA 4E8AA 4R78A 4OTWA 4E6CA 2OJ9A 1F0QA 4S32A 3KCFA 3E62A 2WTIA 5IF1A 2W5AA 1UNLA 3UVRA 5BMMA 3KVXA 4MWIA 2Y4IC 1BUHA 2GNJA 5A4TA 3HUCA 3REPA 3EZRA 1OL7A 4IDVA 3TUDA 4O0UA 3NUXA 5KCVA 3F5UA 1V0BA 4M13A 2CLQA 3VNTA 4R5YA 4NU1A 1J7LA 3LXNA 4F1TA 1JSUA 3EQIA 3WZEA 3LKMA 3EYGA 5AV3A 5CLPA 3VHEA 2PE0A 3HDNA 3KVWA 4N70A 4HCUA 4R5SA 3A4PA 3ZDUA 4XBUA 5DBXA 4AS0A 3U55A 1MQ4A 1NXKA 3HP5A 2VX1A 4K0YA 3CD8A 3PP1A 1PMEA 2CJMA 2FGIA 3QHRA 3M42A 4FKQA 4EWQA 2YITA 3PSCA 4AT3A 5DE2A 3QTIA 4EHZA 3Q9YA 5JQ5A 1OECA 4EOIA 5ANKA 4QTAA 3G5DA 2C47A 3BYMA 2PVFA 3Q2JA 2I0HA 2PVJA 3GP0A 2SRCA 4FTCA 4C0TA 4Y73A 1OKWA 3ZO2A 2FYSA 3FI2A 4QMMA 5CI6A 2ZAZA 4RC4A 2OF2A 3FZPA 3SAYA 3I6WA 4W4YA 2CN8A 2PK9A 3LE6A 4FIIA 1B38A 4EL9A 3C51A 3I7BA 3IW6A 1NW1A 4D0XA 2W05A 4QMPA 1U5QA 3VWAA 3ZH8A 4U8ZA 3RK7A 4AW2A 1DI8A 4HYHA 2R3GA 2QVSE 2BZKB 2CCIA 4TPTA 3DBDA 1M14A 3C0HA 2I40A 4JR7A 4W4XA 3VBVA 3ZEWA 2J9MA 4P2KA 2YM3A 3EZVA 3QTRA 5AP4A 4ITJA 3BYUA 1WAKA 4QQJA 1UV5A 4IWOA 1JPAA 2HW7A 3F3VA 3VC4A 2HOGA 4F6WA 4EHVA 2EVAA 3PYYA 3MH1A 3QX2A 3HRBA 4FVRA 4K1BA 3WOWA 2J4ZA 3NS9A 3ORIA 4O82A 2JD5A 4NUSA 3E7OA 4X0MA 4B4LA 3ZLWA 3NDMA 2RKUA 1VYWA 1ZMWA 1ZYDA 4EOQA 3DT1A 4CVAA 3QALE 1ERKA 4QMZA 4AW0A 4HOKA 5IU2A 1SNXA 2Y4IB 4X2JA 2ETMA 3F5GA 4B8LA 4QTBA
chains in the Genus database with same CATH superfamily
4PX6A 1I44A 3QTZA 4IQ6A 3V01A 2YCQA 5CSPA 5E90A 3DBCA 3JVSA 2I1MA 3K3JA 1LUFA 2PVNA 4HGTA 5DR6A 4DH1A 5IH4A 1IR3A 2PVKA 2JDOA 2WTKB 4Y8DA 4QYGA 5AA8A 3BBTB 4HCVA 2PUNA 2R2PA 1OIYA 4HPTE 3R7OA 4BI0A 4BIBA 3FDNA 3ZSIA 3PJ3A 3ZSGA 3C13A 4O6EA 5HZNA 4JG6A 4CMOA 2QC6A 3PY0A 5FEQA 3ZZEA 2BR1A 3RPOA 5HD4A 4ZLYA 3H0ZA 2YWVA 4NYEA 3QUDA 2C0TA 3QZHA 4JS8A 4MF1A 3TIYA 1F3MC 3QC9A 3HV3A 4NJ3A 4PNKA 5L2WA 1GNGA 4NM0A 3NR9A 3U54A 3PA5A 3KN5A 3R1QA 1A06A 4DGGA 3ENMA 2WMQA 1MRUA 1Q61A 3DJ7A 2ITNA 3MY0A 3QRIA 3UNJA 3R8MA 3MH3A 4CXAA 5CNOA 1H28A 3QD0A 4IX6A 4P5ZA 4R3RA 2HWOA 3H9OA 4EQUA 1PXNA 1O6LA 2O0UA 2O5KA 3OUNB 4I1ZA 3WF6A 5E8YA 5BVNA 4BDCA 2HW6A 5EI6A 5CXZA 5JFSA 2Z7QA 4DE4A 5LWMA 3MB7A 1M2PA 4I6QA 2XK9A 4EI4A 4L53A 3BL7A 4NCTA 2WMTA 1JNKA 5KKRB 2P2HA 2VTTA 2P0CA 2BCJA 1OGYA 3VBWA 3HA6A 3LXPA 5HVJA 4DH3A 4FV1A 2OO8X 3P5JC 3G6GA 2OH4A 2WQEA 3VO3A 1FBNA 3AC3A 1JAMA 3FC1X 3UQFA 3LHJA 2XS0A 5M4UA 4V01A 2AEGA 3ZC5A 5CSXA 4MUQA 3LJ0A 3QKKA 4QMYA 5E1EA 4GH2A 5T6KA 4O0YA 3V04A 4IJ9A 3GU4A 4HPUE 3DXQA 1PY5A 2QOIA 4RVKA 2Y4PA 5B2MA 3IDBA 2QOKA 4IX4A 2W17A 1JOWB 2BAQA 2J2IB 4J1RA 3COMA 1OZ1A 2ZM1A 4BJJA 2CGUA 2Z60A 4MBJA 2CPKE 2C1BA 2C3KA 4IE9A 4XV9A 4EUUA 5DR2A 4CFNA 3WF8A 3R8VA 1Y6AA 2X8IA 1PXPA 3G0FA 4FX3A 3OFMA 4QP3A 3TNWA 3W2PA 3ZC6A 4BDBA 4EJ7A 4IFGA 1PXMA 3MA6A 2UW8A 1E1VA 3FC2A 2ITWA 3EQHA 3QBNA 1IA8A 1BX6A 4KBKA 3WF9A 3IECA 4EZ7A 1FMKA 4K6ZA 1TVOA 3CJGA 1M7NA 4ZS0A 3RP9A 1NT2A 3F88A 5K0KA 5EKNA 4QYFA 2BDJA 3EQDA 4O6LA 1YVJA 3ENHA 4Q2AA 3HMPA 2PUIA 1BL6A 3W2RA 4C3PA 4IVCA 4CMUA 5CEIA 1Q3DA 3HGKA 3QTSA 3DK6A 3WE4A 4RSSA 3HX4A 2PZIA 2WNTA 3IS5A 4YHTA 5IKWA 5JFVA 2F57A 1KUTA 2JKQA 4XNEA 4AT4A 2VO3A 3DDPA 1IG1A 4LUDA 4FTLA 1G3NA 2QOCA 3WIKA 4DH7A 5KMMA 4YJOA 2IVSA 4PPCA 3CXWA 4MYGA 3PSDA 1RJBA 1BI8A 3Q4TA 2BRGA 4PPAA 3IONA 3OWKA 4YJTA 5KHWA 2ITTA 5E91A 2BIKB 4F9AA 4IAFA 2WTWA 2H96A 4IZYA 3UMWA 1FVTA 4EORA 3Q32A 4L01A 3NZ0A 4GVJA 4MWHA 3SXFA 2WQNA 4CMTA 4QMOA 5A4QA 4NM3A 5LMAA 2QR8A 5AX9A 5C01A 3D5UA 4K77A 4G5PA 4YO4A 5IG1A 2ZOQA 5JKGA 5D7VA 1R1WA 3KGAA 5M55A 1VEBA 2W06A 3QKLA 4EBVA 3OG7A 4M12A 4OTFA 2BAJA 4PL4A 2WO6A 4L3JA 3D2KA 3OWJA 4IXPA 3S95A 3SKCA 5IQEA 3U4WA 4ACCA 3QRKA 1QPDA 3MI9A 5L2QA 4AFJA 3UOJA 3E8NA 2WAJA 4U42A 1OL1A 2DQ7X 3QTWA 3TZ7A 4AOJA 2ZV8A 4BBFA 2JGZA 2IVVA 2JKKA 2Y0AA 3AXWA 3C4EA 3Q5IA 4A06A 4QDVA 4GSBA 4E4XA 1P2AA 3IDPA 3PIZA 5AUYA 5CEPA 2ZV2A 3FQSA 4IB1A 4USFA 5LOHA 3R8ZA 3VBQA 4IDTA 2YCRA 2PL0A 3TNHA 4EKKA 1H0VA 4C4HA 5KMLA 2PY3A 3WILA 4U3ZA 2UZNA 3NYVA 5D1JA 5HESA 4U79A 4C37A 4UMQA 2GNIA 4EOOA 4ZTSA 4MBLA 1MRYA 5CEQA 5AEPA 1GIIA 1R0PA 2RFEA 3W32A 4CNHA 2WU6A 3R2BA 3N4UA 1JVPP 2G2FA 4FV7A 4I0SA 4O7VA 2DUVA 1KE5A 5I4NA 4QO9A 4ZLZA 4J95A 5CQWA 3AC4A 3F7WA 3K54A 1OUKA 1WVYA 1YOMA 5C03A 2B53A 4EBWA 4HVGA 2V55A 3TACA 5EFQA 1MRVA 5JGBA 3D5XA 3R04A 4L9IA 3DZQA 4JDJA 5IISA 3A7IA 4ANQA 4JRNA 2OK1A 3NMUF 4EOJA 5CQUA 3E63A 2BMCA 4XRJA 2X81A 4ZP5A 2J5FA 3UVQA 5IPJA 1JKKA 2XIZA 4I94A 2PU8A 3TJDA 3ZM4A 3NUPA 4CQGA 4XMOA 1U54A 4KKGA 1SZMA 4JMQA 3II5A 3ZYAA 4XG4A 2B4SB 3I79A 5FTQA 3COHA 1B6CB 1OVEA 4ASDA 5CAQA 5HLWA 5L4QA 3ATTA 4RWKA 5K5XA 3A61A 5B7VA 3S2PA 3KQ7A 4EYMA 5EM7A 4WSYA 1Q8UA 1M7QA 3QL8A 4FKGA 5D10A 2FO0A 4IM3A 5EOBA 3F3ZA 3EN7A 4KS7A 4UWBA 4E26A 2PMNX 4C4JA 5FXRA 3C5IA 5C8NA 2XKCA 2VTLA 4II5A 1K2PA 4FIHA 4W4WA 1AGWA 3AT4A 3PJ8A 1HOWA 1KSWA 1SM2A 5BVWA 3R7UA 4O7RA 4AUAA 3CY2A 3ZLXA 5AMNA 4G5JA 3ZTXA 2H8HA 5IMXA 3GC9A 5C26A 4JBOA 5KBRA 5J7BA 4NIFB 3MYGA 4BDHA 5JN2A 2EWAA 4GV1A 4RWLA 4X3FB 5CU3A 3ZUVA 5LMKA 4Y85A 2Y6OA 2EXCX 3E8DA 2UZEA 3BHHA 3E93A 4I24A 2Y6MA 3W2SA 5IDPA 3QCQA 1YWNA 3KN6A 4JJRA 4QRCA 5BVFA 3RMFA 3FY2A 2ITOA 4G17A 4YZ9A 1MQBA 1WMKA 4F64A 3DNEA 4E5WA 3R0TA 2JEDA 2V0DA 3EN5A 4YBKA 3A7GA 3LQ5A 2CSNA 4HYUA 3EFWA 4FOBA 4YJSA 4DN5A 3OW3A 4FYNA 5FM3A 4F99A 4LYNA 5C27A 4EH3A 4G6LA 4BBEA 2W99B 3ZUTA 4O81A 4Z7HA 2X2KA 3R7IA 3CSVA 3R7GA 4BBMA 5HQ0A 5IA0A 3DXPA 4FSQA 4FSWA 4R3CA 2C3JA 4IB0A 5GJDA 3A60A 4GFOA 4CLJA 4YTFA 3QA0A 2OFUA 3IW5A 4OW8A 4P5QA 5DIAA 4LV8A 5DEYA 3DGKA 4FK3A 3IW7A 4CT1A 5EQEA 4GJ2A 4MQ2A 5IH5A 5AUTA 2XKFA 4DT9A 4ANLA 3FQEA 3CC6A 2OXYA 4CZTA 1BMKA 3Q9WA 1IAJA 1IA9A 4X2NA 3I1AA 4P90A 4YC8A 5GIPE 4ZJJA 3ORPA 4ZTMA 4QP1A 2UZBA 4DTKA 1TFFA 5FDXA 3FMLA 5CALA 4TNDA 5HO8A 2F9GA 4BCQA 4DHJA 2J0JA 2O2UA 2XIRA 4UXQA 3K3IA 1XQZA 1VZOA 3MDYA 4HNFA 3R2YA 1S9IA 4TWOA 3RAWA 5LCJA 2PUPA 2XNMA 3C4CA 3MJ1A 2CMWA 4FTIA 4G6NA 3JYAA 3T8OA 3I5ZA 4BCFA 4BIEA 3VIDA 2HZ4A 3EMGA 4TWCA 4KWPA 3ZHPC 4BI1A 5HVKA 1H26A 3ZO1A 3NW7A 1GZNA 3E3BX 4FZ6A 4FV0A 3Q60A 1UVRA 3V5WA 1OL2A 5HU3A 4M15A 5CY3A 1QL6A 4CTBA 5JGAA 3QTUA 3RPSA 1Q4LA 2BUJA 3A4OX 4AW1A 4U97A 2YACA 4ONAA 5ANEA 3FMMA 3SOAA 3OP5A 5L8LA 2IPXA 5I9ZA 3OS3A 1DAYA 2R3JA 4XCUA 1ZY5A 2VTHA 3JS2A 4FTRA 5DRDA 1BI7A 4I41A 4EH7A 2NYAA 4M67A 4G2FA 1E1XA 4L67A 5DNRA 4J96A 3BV3A 3NIEA 2PE2A 3FL5A 4IAYA 1QCFA 3H9FA 3OXIA 5A4LA 1UU3A 2OIBA 4AQKA 4XV3A 1M17A 2W1IA 1OB3A 1R3CA 3VS7A 3VULA 5HCXA 5FEDA 4JX3A 5FP5A 4UV0A 4Q9ZA 4IBMA 4LGHA 4IAZA 4NWMA 4QQ5A 2C6MA 1WZYA 3ID6C 3NNXA 3TXOA 1H27A 5J9LA 2XNGA 3BWFA 1OPLA 3L8XA 4WHZA 3UC4A 4O0RA 3PPJA 4UWCA 4EYJA 4O84A 1YDRE 3UOKA 1OGUA 2ITXA 3E92A 4FGBA 4OAVB 1VYZA 1PMVA 2FSLX 4YGAA 2ZV7A 3QD4A 3QYWA 2IWIA 4D4VA 5HTCA 2XANA 5DLSA 1YXUA 5HKMA 3BLAA 3U8WA 1PKGA 1ZWSA 3FMKA 3FMEA 4RIYB 5E8WA 3V8SA 4B6LA 3F3UA 5GZ9A 4F1OA 4FTMA 3KRXA 2QOFA 3EB0A 4Z7GA 3PA4A 3HMIA 4YJPA 4A9TA 1P5EA 4CKRA 4MD8E 4FIGA 3EFLA 3LXLA 2XJ1A 5TE0A 4BDIA 5CU4A 2R3RA 2BALA 4RX9A 5DPVA 4ZSGA 5ANIA 5FTOA 5HNBA 5AR2A 3PVWA 3MH0A 3FYKX 2ZMDA 2GNFA 2R5TA 2A2AA 4AG8A 5D11A 5JMSA 1VLRA 4BYJA 5H9BA 4YZMA 4MHAA 4DITA 5CASA 5FLFA 1CSNA 4AZFA 5F94A 3T3UA 2B7AA 2VTRA 3FMDA 2WU7A 3ET7A 3KF7A 4O0SA 2YIYA 4QMLA 4OBPA 2CNUA 2RIOA 4AZEA 3H30A 3JXWA 4LDTA 2UZTA 4FYOA 4U7ZA 3TZ8A 3CKWA 3S3IA 3TYKA 3LFFA 3PE2A 4RX5A 3OT8A 2WMBA 2J6MA 3NIZA 4J97A 2WQMA 2O3PA 3EL8A 3FLNC 2ITVA 5AV4A 3LJ2A 4MXZA 3CQUA 5AUXA 2YERA 4ZTLA 3NPCA 1KE6A 2C4GA 4FSNA 4KSPA 3WYYA 1OIQA 2XIXA 4GRBA 2UW7A 5AP0A 4F09A 4NJDA 4RZWA 4FSRA 5KBQA 3R1SA 4QPSA 4QD6A 4NIFA 5DOSA 2VN9A 2IW6A 2QNJA 2VU3A 4M68A 4YPSA 1LP4A 4CZYB 4M97A 4EJNA 3LFEA 1JKTA 3LFAA 4NKAA 2B0QA 2I0EA 3MIYA 2X0PA 4TN6A 5DT3A 1W83A 2UV2A 4V04A 3TV4A 3ZFYA 3CKXA 1CTPE 5IEVA 1UKHA 2B9JA 2C1AA 1V1KA 5FD2A 4A9YA 3DJ5A 3HZTA 2HWPA 4EK4A 3KA0A 5KNJA 3BIZA 4O21A 3TM0A 4R1VA 5TKDA 3RWQA 5JZNA 4J8MA 4O38A 1JWHA 1ZARA 1UKIA 2R4BA 4AP7A 3NW5A 3LFNA 4D5HA 1JSTA 2QR7A 4TKSA 1LEWA 3PXZA 3PLSA 5KMKA 1K9AA 2W1EA 1H1RA 1W2DA 2I0VA 4LGDA 2W96B 4QPMA 1M2RA 4FEWA 3DAKA 5CS6A 4FV4A 3VJOA 4E6DA 4QP8A 1JBPE 3ZZWA 3NUSA 4MD7E 4FI1A 4JQ7A 1W0XC 5HBHA 1CM8A 4EQCA 4YTCA 3Q4CA 3W33A 2AUHA 2JITA 3WARA 3UDSA 5F4NA 1YWVA 4Z16A 2C3LA 3DXNA 3F2NA 4C35A 1V0PA 2Y8OA 3OW4A 4O96A 4TRLA 3GI3A 4OR5A 5ANOA 3DBFA 2XK4A 4BWPA 5HORA 3CJFA 3DB6A 3G6HA 3TNIA 5CNNA 2QO9A 3QXPA 3VUMA 4BF2A 4MNEB 3R9HA 4FTAA 4QPAA 5B0XA 5HD7A 3ROCA 2CHLA 4DEDA 4E5AX 5IDNA 2UUEA 4H36A 3GU8A 2PPQA 2Z02A 4DFZE 4EK6A 2NO3A 3ZM9A 5I9YA 4BYIA 3U9NA 1HCKA 4O7SA 3JVRA 4W4VA 2PVRA 3BV2A 3QUEA 3Q53A 4UX9A 4YHJA 2VWYA 4Y46A 3D7TB 3HMOA 4O0WA 5LVMA 1YI4A 4MH7A 3V3VA 1KE7A 3PZHA 4H39A 2V7AA 1U59A 2PMOX 3PIXA 4XG8A 5EI2A 3BEAA 4IB3A 3O8TA 2Q83A 4ORKA 5KX8A 3COIA 2HZNA 5FUTA 4ZXTA 4RQVA 3GOPA 5H2UA 2XRUA 2Q0NA 4I6HA 1CDKA 2XRWA 4TT7A 4I3ZA 4EHGA 1Q8TA 4EWHA 4ZSAA 2WTDA 2W1FA 4AW5A 2KTYA 3EQBA 3OCBA 3O0GA 3DDQA 3P5KA 2C5XA 1TZDA 4C34A 2C6OA 3BU6A 3WYXA 3L8SA 4FVPA 5ETAA 1YKRA 2XBAA 2JAVA 2W4KA 4GG7A 4RJ6A 2VWIA 2YM4A 4C59A 4D2SA 1ST0A 3HLLA 5HOAA 4O4DA 4ZJVA 4RT7A 4PV0A 2OJFE 4FKWA 5IQBA 4QYHA 3BGPA 2YDJA 3DPKA 1UU8A 3NCGA 3AQVA 4BTFA 3TG1A 4CFUA 1H01A 4G3GA 3FXZA 2ONLC 3CIKA 4LOQA 5HO7A 3QZFA 3Q96A 4LGGA 4C7TA 3QCYA 4HGLA 2XCKA 1BL7A 3IGOA 2R64A 2H9VA 4DBXA 3P79A 1FGKA 3DOGA 4JDKA 4G3CA 4FKRA 3OY1A 5J1VA 4C36A 4TYIA 1PF8A 3SLSA 3ZLYA 4GEOA 2BHHA 4EH4A 2WTVA 3RPYA 1CKIA 2WIHA 3NUAA 4CRSA 5GHVA 3GC0A 4ERKA 2GQGA 5M57A 2YLEA 5CENA 2P55A 5AAFA 3GCPA 5DWRA 2X4ZA 4R7IA 2WEVA 2VAGA 2CKQA 1JSVA 2JBOA 4DLIA 2QO7A 3MFRA 2J0LA 4BCJA 2XM9A 3QTXA 5AP5A 3KC3A 5J8IA 4AU8A 3UO6A 4E93A 5GZ8A 4QYYA 4FMQA 5CXHA 1J7UA 4MXAA 4C61A 3W0NA 3W2OA 2GNHA 2C5OA 4C8BA 4JBPA 2VD5A 3E87A 4YLLA 3SRVB 4DH5A 4PL3A 5A46A 4B99A 4UWYA 5ACBC 2CKOA 3I81A 2XA4A 2R3KA 1MP8A 2JBPA 3QKMA 3RHXA 4C02A 2OLCA 5KO1A 4LMUA 4U6RA 2OF4A 3VUDA 3BLRA 4RPVA 3EL7A 4DTBA 4FIFA 3TIZA 2GDOA 2XALA 3QFVA 2A27A 3HECA 2G15A 4GFMA 1YXVA 1WBNA 3V5PA 4TYHA 4H1JA 4FTJA 3CPBA 2BRBA 3FPMA 3RWPA 3BHUA 3QA8A 4YURA 2VTOA 5DT0A 4FKVA 4BDGA 1WBVA 3FZSA 4USEA 4NFMA 3K5VA 4DEEA 4FTOA 5AUVA 5FP6A 5K9IA 3WBLA 4IACA 4M7IA 1XO2B 5HE1A 4D1ZA 4BC6A 4HCTA 3EOCA 3FKOA 4PDOA 3LM0A 3R8PA 3I0QA 1WBTA 2JFLA 2X2MA 2YIRA 3BGQA 4Y5HA 4O27B 3IPHA 4AA4A 4AGUA 3EQRA 3MS9A 3C4FA 4GU9A 1VR2A 4EOSA 2PMIA 4GKHA 1LEZA 2WQBA 4I20A 4O4FA 4BHZA 3VF9A 2C6TA 3MPAA 4JDHA 4FE2A 3QX4A 4RVMA 3UGCA 4C57A 5LVNA 4BDEA 4FL3A 3D94A 3G15A 4BCNA 5K0XA 3ERKA 3RPRA 3AD6A 4CG9A 3OUKA 3QD2B 2NNWB 3CD3A 3MFTA 2YFXA 5HCYA 4FZ7A 4UXLA 3RK5A 3ZO4A 4H58A 1PMNA 4XHKB 4IADA 3B2TA 3O5AA 3CTJA 4IMYA 2ONLA 3ZBFA 2OKRA 4L00A 2BAKA 2H34A 2X0QA 3A7FA 3UQGA 4L7SA 3G9NA 1W82A 1H1SA 3MW1A 3V5JA 4AN3A 3PJ1A 2CNVA 4JI9A 5CF6A 3JPVA 4QTDA 5CF8A 4BWXA 2BZIB 4XBRA 5M08A 4BICA 4F0FA 4S34A 3I6UA 1H4LA 1H1WA 5HHWA 1A48A 2PYWA 3U4UA 3UJGA 3I5NA 1H00A 2C6EA 1CKPA 1XKKA 3EYHA 4FBXA 4E6AA 3G0EA 3VQUA 3ZSHA 2QOQA 4RIXA 4FL1A 4O4BB 4FODA 5HE0A 1O6KA 3ACKA 3W0OA 2F7ZE 3FWQA 2CDZA 4YC6A 2JDVA 2B9IA 2VTPA 5EYMA 3BE2A 4U3YA 4WNMA 4FRFA 2DWBA 4CD0A 3IGGA 1ZYCA 3FLSA 3ODYX 4YO6A 2JFMA 4ZTNA 5HE2A 2B52A 3M2WA 4R6VA 3UIMA 4C2WA 4JIKA 2R7IA 3TKUA 5G1XA 4BVUA 2QOBA 2W5BA 1SVEA 3COKA 2JC6A 4L3LA 2IF8A 2OJGA 4PNIA 4FIEA 4RJ8A 3GENA 4YJVA 2GMXA 4AZTA 3W16A 4B7TA 4IVAA 5F9EA 4EONA 3EKKA 5HX6A 4N57A 2A19B 3QCXA 4G9CA 2VWBA 2QG7A 3FUPA 3F3WA 4NK9A 4QQCA 3EQFA 1Q8WA 5IA1A 1M2QA 4AZSA 1H08A 5CF5A 3S4QA 4QNYA 4UZDA 4FV8A 5EYKA 1NVRA 4GCJA 3DY7A 4U81A 4IZ7A 3PWYA 1G8JA 3BCEA 5DG5A 1O9UA 2PZ5A 5BVDA 4P4CA 4DCEA 4DEIA 4ACDA 4Z3VA 4FZFB 4JXFA 4L3PA 3LXKA 1PHKA 1VJYA 3KU2A 4DHZA 2BDWA 4ZK5A 4IX5A 4RMZA 4G3DA 1ZOHA 2WMRA 5CVGA 2AC3A 4NT4A 5FBOA 4E20A 4GKIA 2C30A 3GB2A 2ERZE 2UVZA 3Q6UA 4I4FA 1ZAOA 4IAKA 4X7QA 5I9UA 2UW0A 4BN1A 2X0OA 3SG8A 3K2LA 2E9NA 5E8XA 3LFSA 5IQGA 3KULA 3RAKA 3I60A 2RFSA 5CZHA 5FTGA 1H8FA 3ALOA 3VRZA 1ST4A 2XUUA 3GXLA 2FA2A 2G01A 4BDFA 3MV5A 3TCPA 1U54B 4RIOA 2WMAA 3R73A 3DK3A 2G1TA 3LCKA 2VZ6A 5HVYA 4AACA 3GU7A 2X0GA 5AR8A 3AC1A 3ULIA 5J5TA 3DKFA 5DEWA 4PF4A 4JQ8A 4KAOA 4U80A 5J9YA 3PUPA 4ZLOA 5JZJA 1REKA 3MVHA 3ORTA 2GTNA 3PZEA 2OI4X 4FGRA 3EFKA 3LFCA 2CLXA 3ULZA 2EB3A 3TI1A 4BFMA 4BCHA 3N51A 3OCGA 4CFWA 4EUTA 1Z9XA 4KBCA 4YNOA 4AE9A 4XG3A 4QEBA 3R71A 3KXGA 1UU7A 4W9XA 2BIYA 3VUHA 5K4JA 1PYXA 2YIWA 3DTWA 5J9ZA 2IJMA 2GHMA 3NUNA 1Z5MA 3R9DA 3KXMA 4ALVA 3GUBA 3NNWA 3HV6A 5HTBA 4OTDA 1XWSA 3DAJA 3G33A 4A7CA 3EQGA 2BRNA 4NM7A 1GIHA 4G16A 2R3NA 3KMUA 2YCFA 2P2IA 1Q3WA 3F5PA 3MVMA 4U5JA 1Q24A 2PHKA 5FWKK 4J8NA 4IWPA 4QYEA 2IZUA 5A4CA 2R3IA 5L6PA 3PG3A 4MK0A 4KBAA 2W9FB 5EYCA 4M0YA 3PVBA 3GFEA 1PXKA 4J71A 4ITHA 3WF7A 2UW6A 3OT3A 3ORZA 4CQEA 4KIOA 3LCSA 3KY2A 5HG8A 2BDFA 3NYOA 3SQQA 3UC3A 4FKLA 4MX9A 3R8UA 3O2MA 2PMLX 2V5QA 3NUUA 3T9TA 1QPEA 5ACKA 4HNIA 3VRYA 3FHIA 1GZ8A 3OTUA 4JIAA 2X6DA 3DTCA 5ETIA 3EQCA 3OVVA 2O64A 4A9SA 1WBSA 4R3PA 4WUAA 2HZIA 2HENA 2R3FA 5GJGA 4IWQA 4DTAA 4O91A 1H07A 2XJ2A 3GC7A 4BHNA 2ESMA 2IZSA 4FT7A 4BKJA 2WHBA 2BZHB 4QMVA 2VWVA 3IG7A 4E5BA 3N4TA 2WELA 4BZNA 5HU9A 3A99A 3RAIA 3PA3A 3SHEA 4H3BA 2BKKA 1YOJA 5L2TA 3QQHA 2C68A 3A62A 2XYNA 4TL0A 5GINE 3R9OA 4AX8A 3BYVA 4C62A 4PMPA 4CCBA 2NRYA 3L9MA 1AD5A 4TWPA 4AOTA 2W5HA 2IG7A 3UIUA 3HKOA 4PP7A 3CS9A 2R3MA 4KRDA 3VUTA 3WF5A 5L8JA 2C6DA 4GK4A 3LW0A 2JKMA 3O51A 1OIUA 4FV6A 2RSVA 4DGMA 3BE9A 3OWLA 4APPA 3HAMA 1GIJA 4NCTC 3QU0A 3HV7A 3PSBA 4IAAA 4GL9A 4OTQA 5CZIA 2QO2A 3QLGA 5DA3A 3IOKA 3KULB 4A07A 4EZ5A 5CEOA 4UZHA 3PE1A 2GS6A 5JFXA 3OOMA 4KSQA 3FLWA 3FEGA 2QLUA 4PUZA 3QXOA 3VS1A 3WI6A 3NVMB 4YSMA 4J7BA 4CEGA 2HAKA 2EXEA 3RCDA 4H3PA 2XCHA 3E88A 4I5HA 4MKCA 1G8AA 4YMJA 4D9TA 3HV5A 3KL8A 5AUWA 4XYFA 2VTSA 3CY3A 3FQHA 4JNWA 2UZDA 3C0IA 3O71A 3DA6A 4FT9A 4CTCA 4FTNA 4D28A 1ZOGA 3UZPA 5HNIX 5JFWA 3D7ZA 3PXRA 4FKJA 1Q62A 5HBJA 4NM5A 4YNEA 3W8QA 4FNWA 1PYEA 2JLDA 4LV7A 3FMHA 3NCZA 2WMSA 1OPKA 3DBQA 3B8QA 3CBLA 4LRKA 4BZOA 3VS4A 4D4YA 3BWJA 3VN9A 2X7GA 2OZOA 4KKHA 1QPJA 5A54A 4OTGA 3RNYA 1W2FA 4F1MA 1XBCA 5BV3A 2V22A 1SMHA 4ALUA 3K5UA 4L7FA 4FVQA 4M69B 4O0XA 4ACMA 3BHVA 5TT7A 2C5VA 4WIHA 5CU6A 3FL4A 4TW9A 2HXLA 3DZOA 4HJOA 5FQDC 4LMNA 5H8GA 3VW8A 1Q97A 2Z2WA 3LJ1A 1XMLA 1YXTA 3O23A 4RC3A 3QZGA 3IK3A 3H9RA 4GUEA 4DAWA 3AC2A 2WTJA 1OPJA 4OT5A 3L8PA 5EHYA 5AP1A 5KE0A 4O4CA 3ZO3A 4CV8A 2OZAA 3UP7A 1CMKE 4KNBA 3SW4A 4MVFA 5JT2A 5A6OA 2YA9A 5D9HA 4IVDA 1YDSE 1QMZA 3FZRA 4L6QA 4PY1A 5CWZA 3WIGA 3TKHA 2YZAA 1QPCA 4LRMA 4CT2A 4U45A 2OG8A 4DBNA 2FSMX 2NRUA 3I7CA 2UZUE 5LMBA 4BR3A 2VTIA 3VW6A 2XK8A 3GCQA 4GT3A 4YPDA 2IN6A 3BQCA 4CYIA 3UODA 3ITZA 3V5QA 3RCJA 2GSFA 4QQTA 5L6OA 3U87A 3UVPA 4IZ5A 4FKUA 2ZV9A 4C38A 1YDTE 5LVOA 2ZJWA 3SXRA 4IWDA 3DKOA 3PPZA 2YISA 2VGPA 1RW8A 3IO7A 3KK8A 3R30A 5FRIA 3RALA 3R28A 4E4NA 1XH5A 1ZMVA 3ZOSA 3HAVA 2XYUA 4LFIA 5AR3A 1J1CA 4FL2A 4O4EA 4RA4A 4Y5QA 5EW9A 3ZXTA 4ACGA 2QOOA 4D1SA 3ZUUA 1YHSA 2WMUA 3PWDA 5ETCA 4ZZOA 4K9YA 3UQCA 4B9DA 2OIDA 3GC8A 3BRBA 2GCDA 2R9SA 3Q9XA 2W1GA 2YWPA 4JG7A 3VHKA 2XNNA 4LL5A 4D2RA 2GNGA 4AGWA 1TQPA 4DG3E 5LMKC 4LV5A 2HZ0A 4UBAA 3UPZA 5C4KA 2PVHA 3W0SA 5E8TA 5IQFA 4M14A 5EKOA 4F4PA 4L52A 4UMUA 2OBJA 2OICA 1YHWA 3HV4A 3LFQA 4FKPA 2BRMA 5I9XA 4O83A 2GS7A 3GOKA 2W9ZB 1F5QA 3NLBA