3FLSA

P38 kinase crystal structure in complex with 6-(2,4-difluoro-phenoxy)-2-((r)-2-methanesulfonyl-1-methyl-ethylamino)-8-methyl-8h-pyrido[2,3-d]pyrimidin-7-one
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 110
structure length 343
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flsA01
3RVGA 2C5OA 5HG9A 3ACJA 1GZ8A 3QCXA 4V05A 2JBPA 4I0TA 4D4VA 2X7FA 3NX8A 4J52A 4K18A 2FUMA 4P4CA 4RVTA 2I6LA 2C6TA 3JXWA 1URWA 4BTJA 2PE2A 3BZ3A 5TOZA 4PMTA 4RC4A 2W1HA 5E8VA 4JBVA 2P4IA 1PMNA 3BRBA 2W5HA 2R3MA 2HOGA 3CBLA 4KKHA 4BVUA 5CI6A 1PXMA 3D5UA 4AXAA 5JFSA 3KRWA 1ZMWA 4IVAA 4M84A 3VBVA 3D0EA 2OW3A 3OP5A 3A99A 4Q9SA 3QGWA 3HA6A 1PKDA 4OT6A 2JEDA 2CGXA 4R78A 3WYYA 4PL4A 1B39A 1W82A 4FSNA 3IS5A 3LXNA 3MWUA 4BGHA 2EXMA 3C4WA 2XP2A 5AEPA 2HXQA 2R3JA 2VNYA 4NFMA 4BWKA 3R1NA 4EHGA 5JGDA 4F7SA 3FY2A 3II5A 1XWSA 3B2WA 4W9WA 1VJYA 4FYNA 3BU6A 5CZHA 2GNIA 3GOKA 3HMIA 4XV2A 3R8PA 1YVJA 3C9WA 5AP4A 4C0TA 3U54A 5FWKK 2YJRA 3AT2A 3QWKA 3BE9A 4C8BA 3TV7A 1UKIA 3PLAE 3PVWA 4BDCA 1H28A 4P7EA 3NIEA 2GFCA 4PRJA 4TYIA 4ZMFA 3KRXA 4XG6A 5FDPA 2VX3A 4R3CA 1H08A 2Y7JA 5HOAA 4HCTA 1WBTA 5HCYA 4O83A 5G1XA 2XNEA 2W1DA 4FV4A 4PDSA 4KNBA 2VX0A 3W2SA 4F1TA 1UKHA 3T9TA 2W1ZA 5HO7A 4D2SA 4HGLA 5IQBA 3DAKA 3V5QA 3QYWA 3DJ5A 3M11A 4YBKA 4RPVA 1YRPA 2JGZA 4XYFA 2BTRA 4Y5HA 1OBDA 3QALE 3IO7A 4FKGA 3RPSA 5I9UA 5CQUA 2PUIA 2J5EA 4TWNA 4O6EA 2VWZA 4J7BA 2ZV7A 4KA3A 4L68A 2W4JA 4LOQA 5EYCA 4W4XA 4CV9A 3FMMA 4C4JA 2YCFA 2E9NA 4ZSJA 4F9YA 2ZM4A 3TUCA 2IPXA 1Y57A 4GG5A 4CKRA 4M15A 3ZXZA 4KRCA 5CAQA 4IVCA 1PW2A 3AQVA 3O17A 4IE9A 4FV6A 4K11A 4MBLA 5L6WL 3ZUUA 3S00A 5TE0A 5LMKC 4FG7A 4FV7A 4F9BA 3UZRA 5FXQA 3MW1A 3TKHA 2XUUA 3SXSA 3RWQA 4CFFA 4EQCA 3F82A 3ORKA 4C2VA 3PXFA 4FSQA 4LRJA 4TL0A 3UDBA 4NT4A 3CP9A 3QZGA 1WVYA 3CPBA 4EHVA 5CEKA 2PVJA 4B6LA 3ERKA 3FZRA 4GRBA 5CEIA 1H1SA 3V8WA 1VR2A 5K0XA 3LCDA 2WMSA 4M68A 4ARKA 2PUNA 4RIXA 4CGAA 2QNJA 4ITJA 1TKIA 2ONLA 1KV2A 3CTQA 2JIIA 3BBWA 3MGYA 4NW5A 4OBOA 1WAKA 2O64A 3Q3BA 3Q4CA 4FV5A 5BMMA 2XMYA 3TACA 4YP8A 3U4WA 3UNKA 3DAJA 1FINA 5AX3A 4XG3A 2Z60A 4EYJA 4S30A 4EH6A 3NYOA 3D5XA 3B2TA 4MWIA 3UZPA 1JKLA 2A4LA 3ZO3A 3LMHA 3QTZA 2Y6OA 4DGMA 5CI7A 1PKGA 3LCTA 5IDNA 4C3RA 1MRYA 4UMPA 4GJ3A 4O7NA 4KABA 3EYGA 1QMZA 5L2QA 3QF9A 4MD7E 3P1AA 3R9HA 3QKKA 1GIIA 3FI4A 5DNRA 5E8TA 4C3FA 4NZWB 2CKQA 2GS7A 2NRYA 3EQBA 3HV4A 4RFMA 5GZ9A 2PUUA 4IB1A 4IHPA 4C33A 5JMSA 4NSTA 4ANNA 2CHLA 3P23A 3BYOA 2F9GA 2W99B 3QTQA 2QOIA 4PMSA 4XX9A 3FC1X 4AX8A 3CSVA 4O7VA 2BZJA 2VV9A 5FTQA 5FP5A 4MCVA 5AM7A 2HAKA 5HESA 3ZRKA 2Y6MA 3G2FA 3Q4ZA 1OUYA 3KA0A 5AUWA 4PNKA 4YHTA 4U9AA 4ZOGA 3D7TB 4KIQA 5J87A 3RM7A 3PLSA 1OIRA 3L9MA 3BU5A 3LFQA 4CEGA 3BX5A 4JX3A 3VUHA 4YTHA 5AP2A 3PJ8A 5HO8A 3GP0A 2PMLX 3UPXA 2OIBA 2JKMA 2WELA 3TZMA 4Z7GA 5EKNA 4Y5QA 5IA5A 2C5VA 4EZ3A 2H96A 4NM3A 4AZFA 2C68A 1XH9A 1TQIA 4O22A 1TVOA 2PZIA 3QD3A 5CVHA 3U6JA 2HENA 4XRLA 3QBNA 2WHBA 4FEQA 2I1MA 2OU7A 1MRVA 5J7HA 5F95A 2PPQA 5FG8A 4F0GA 3EHAA 4HNIA 4O0WA 4D1SA 1KE7A 5HVKA 4MXAA 1RE8A 2J4ZA 4FV2A 4IH8A 3KXGA 1QPDA 5BPYA 2WIHA 4L8MA 3PA5A 2RGPA 4H3BA 4D2VA 2FVDA 3D2KA 4ZY6A 4I5MA 5ETAA 1M52A 3BIZA 1IR3A 4EZ7A 4ZEGA 3NUSA 4C2WA 5CANA 3OD6X 1PRYA 2BDFA 4YJPA 2F4JA 2FSLX 4A4XA 5EYMA 4B99A 4D2TA 2VNWA 4CFXA 5CU0A 3PPJA 5AR2A 4OTIA 3W1FA 1Q97A 2BAKA 4QTCA 4OTHA 1OPJA 2XIKA 1H00A 3KN6A 5JZJA 2W1GA 1KE5A 2BKZA 4V0GA 4EH5A 4CRLA 4PP7A 4BKJA 1JSVA 1JSTA 1TQPA 1UU9A 1E9HA 5CQWA 2P2HA 4ZSAA 5H2UA 5CSHA 3NR9A 2Q0NA 4G2FA 2KULA 3OCTA 1HCKA 3Q32A 3UOKA 1GIJA 2J9MA 3RP9A 2B4SB 4O7SA 2R3FA 2R7BA 4WHZA 5CSXA 2V22A 2YDJA 5E8WA 3SV0A 3VS1A 3MPMA 5ANIA 3QLGA 4WIHA 3ZS5A 4G34A 4HGEA 5CEMA 3OF0A 4Q5HA 2AUHA 2X0GA 1MQ4A 3P7BA 3VNTA 4CZUA 4TYHA 3VIDA 4HNFA 1CKIA 1JKSA 4JR3A 5HBHA 4ZSGA 3BELA 5IEXA 3GU5A 3QRTA 3PDTA 1PXLA 4HZRA 4IVBA 3P86A 5HHWA 4EK4A 5JGAA 3HZTA 2BFXA 1Q5KA 4L3JA 4YTCA 5CF5A 5CNOA 3SRVA 4PMPA 2PVHA 4KIKB 3ROCA 2C3KA 4IAIA 4C37A 4A9YA 4M0YA 5ICPA 1BLXA 2PZRA 4G3FA 4R7HA 3ELJA 4GFOA 3N4UA 3CKWA 5A6NA 5GZAA 3D5VA 3OBJA 3AMAA 5C8NA 3GB2A 2XBJA 4GT4A 3A7IA 4IM2A 4W8DA 3TV4A 4FVPA 2OSCA 4V01A 5KKRC 1WVXA 2FO0A 4UN0C 4DGLC 4C59A 5IA3A 4LGDA 4WBBB 3UTOA 2GQSA 2Y4IC 4L67A 1B38A 4QMWA 5EW8A 5J9ZA 2ZYBA 4IBMA 2QO2A 4ZJJA 3A2CA 5FGKA 3MS9A 5LVOA 2PVNA 2QOKA 4QYHA 2ERKA 1GZOA 2FB8A 1ZRZA 4MHAA 3R00A 2RSVA 3FI3A 1U59A 4E6CA 4NM7A 4F64A 3NVMB 2OXYA 3C4FA 2XIYA 3AD4A 2CCIA 4APCA 4MEDA 4WRSA 3WZEA 3ORIA 3ANRA 3KXXA 3IW5A 3QCYA 4N6ZA 4ZTLA 1FVTA 3FMJA 3U8WA 4MNEA 5CY3A 3R8LA 4FIFA 2F2UA 1H4LA 4FA2A 2ETMA 2OZAB 4JX7A 5J9YA 3LKMA 3NNXA 3OBGA 5CXZA 3COHA 4I20A 5HVYA 2EVAA 4WG3A 3AGMA 4G6OA 4GFGA 2HW7A 2QOOA 3QGYA 4K77A 3WZDA 3ZC6A 3I81A 1YXTA 3IGOA 4J8MA 2QCSA 3HUBA 1M7QA 4PTGA 5BYYA 3IPHA 4JXFA 5AV3A 5AX9A 4ANOA 3OWJA 5I9VA 4IX6A 4QMPA 5GJDA 2CSNA 2ITYA 3VUDA 4WBOA 2ZOQA 4D9UA 2XIRA 2W5AA 2B9HA 4F99A 4FNXA 3DNEA 4FNYA 3AOXA 3MYGA 4I6FA 4FKOA 4RWIA 2YWPA 4CG8A 4FTAA 4JG8A 4AN2A 3R28A 4BCPA 5F9EA 4PPCA 2CDZA 3DKCA 4QP3A 5C9CA 4PNIA 2HZNA 4P5QA 3NAYA 3PWYA 3V3VA 2VU3A 5FDXA 4OTPA 1IG1A 2YIXA 3EQHA 5EI8A 2IVSA 4LGGA 3OUKA 3MFUA 4FX3A 4CFVA 1P2AA 3HMPA 5M06A 1Y91A 3QD0A 3TNHA 1XH5A 4E3CA 3O51A 3BU3A 4M3QA 4F9AA 2AYPA 3UIXA 2VO6A 4GW8A 5TF9A 4U3YA 1QPJA 5CALA 3Q9YA 5GJFA 1YXVA 1H1RA 2QHMA 2QOHA 5BVKA 4BIDA 4EUTA 5KBQA 2I0YA 4D28A 1OZ1A 2JITA 3F5XA 4QMMA 3G6HA 1GAGA 4A9TA 1V0BA 5AA8A 3D2IA 3CCNA 4JIAA 4OUCA 3SW7A 2VD5A 2J0LA 3QTUA 3UPZA 5FRIA 1NVQA 3QYZA 3UIBA 3LMGA 2QONA 4I24A 3PZEA 3QC4A 3WZKA 3QU0A 3OMVA 3QUEA 3VHKA 4FT9A 4AOJA 5A9UA 5L6PA 4BYIA 3R04A 2V5QA 2GNFA 4MXOA 1Q61A 3U55A 3LMIA 4I6BA 3CE3A 4BZDA 4XG7A 3SX9A 5HTBA 3KMUA 5E7RA 4ANBA 2CNUA 3KCKA 2UVYA 3BCEA 5HNIX 4BDIA 3HL7A 5L2SA 2GPHA 3VS3A 3EZVA 3AC1A 3RWPA 1WMKA 4RZWA 3ZMMA 4DEHA 5CEQA 4CTCA 2ZMDA 4IMYA 3ZCLA 3RZFA 5FXRA 3CIKA 2YIRA 3Q5IA 2V62A 4ZAUA 2X2MA 4FUYA 2FH9A 4OTGA 4P2KA 5CTPA 1UU8A 3VRZA 4DBNA 5M4IA 1ZZ2A 1KE6A 3EB0A 5JFVA 4BI0A 4YJQA 3VAPA 4TYEA 5HG8A 4A06A 1PHKA 4DFLA 2O8YA 5K4IA 3WF7A 3EWHA 5HNGA 4J8NA 5AR3A 4L3PA 4FSTA 5HTCA 3IDPA 1I09A 4FEXA 5FXSA 3EOCA 2I40A 4LRMA 4EK8A 4F9CA 3R22A 4QTEA 4F7NA 3OY3A 3FLNC 4U42A 1W84A 5IEYA 2YAKA 4ALVA 2WMQA 3W2OA 1E1VA 1QL6A 4HPTE 3BI6A 4B7TA 4EOQA 3A7JA 3DS6A 3FLYA 4CT2A 3JPVA 5AR8A 3E92A 1NVRA 5HIEA 5J1WA 3R2YA 2DUVA 4YR8A 2EUFB 5AR5A 4AW2A 3ZM9A 4FSUA 2C30A 5FD2A 5DFPA 4E5BA 3PVUA 4O7TA 4GVJA 1X8BA 2YIYA 4IFCA 4FI1A 3N4TA 5DR9A 4HOKA 3TKIA 2ZV8A 4ZK5A 4FOBA 3GCSA 3TXOA 4DTKA 5BVOA 1OIUA 2VTSA 3F5UA 3FE3A 5BNJA 1BI7A 1FGKA 3C4CA 3HV3A 3N51A 3R21A 1YWRA 4WUAA 4ACHA 4WSQA 1OPLA 5DT0A 1R78A 3R02A 1YI3A 4QMSA 2W17A 1KUTA 3KY2A 3UVPA 4FTIA 3CJGA 3W33A 3A7GA 3UYSA 2W1CA 3G90X 3LOKA 1REJA 4O7RA 3OZ6A 4QP9A 4JVGA 4QYGA 2F2CB 1Q8ZA 5B2MA 2JKQA 1H1QA 3G6GA 1VYWA 4KAOA 4RJ3A 4KIOA 4ERWA 2UVZA 4MYGA 3DAEA 1H26A 2X1NA 4XOZA 2OXDA 4DA5A 1ZYSA 5HBEA 1YW2A 2X8IA 3HRFA 4H1JA 4X6RA 4YHFA 3VS2A 1PMUA 3MJ1A 4NKAA 4RIXB 5M4UA 3UC4A 5DOSA 2WU7A 3I60A 4IWPA 3F3WA 4L42A 4LUDA 4LMUA 3TG1A 5BVDA 3HNGA 4DH8A 2XNBA 3BHVA 3U6HA 2GU8A 2PVYA 3R71A 3DPKA 4NH1A 3NVKI 3PA3A 2WTJA 4R7IA 4N0SA 1CTPE 2XZSA 2AC5A 2YIWA 4HPUE 4LRKA 5KZIA 4D5KA 1ERKA 1NXKA 2QR8A 3R01A 4U45A 5FM2A 5KMKA 3H4JA 3QCQA 5CNNA 3D4QA 4LV8A 5DRBA 3QZFA 5DN3A 2ETKA 3ZXTA 1GJOA 4Y85A 1KSWA 3RI1A 1V0PA 2CLQA 4J99A 4ZLOA 3UVRA 4DH5A 3DQXA 5HKMA 3ENMA 4BYJA 5HE1A 3LFDA 2OKRA 4RQKA 4ZTNA 2XEYA 3QAME 4G6NA 4H39A 4CG9A 2REIA 2HK5A 3F3UA 4BTFA 3T9IA 4O2PA 4BCGA 2WGJA 4C4GA 2O65A 4EC8A 4X0MA 3VRYA 4I22A 3ZZWA 5EM5A 4XNEA 3ETAA 5L4QA 2ZM3A 3HX4A 1S9JA 2WEVA 1J7LA 4DEAA 3DK6A 3HEGA 3OW4A 4PTCA 5BQ0A 4FTCA 3LLAA 3MI9A 1ZOHA 5HI2A 2J5FA 5CSWA 1Z57A 2JKOA 3HVCA 4J1RA 5D12A 3ZO4A 3AD5A 4U6RA 3BQCA 4O0XA 3EFLA 5HZNA 5EQPA 1PMEA 4HYIA 4DCAA 2X8DA 3CD8A 4RMZA 4ZY4A 2X6DA 3UO4A 4E1ZA 2QU6A 5HU9A 5J9LA 4Q2AA 4AW5A 4LUEA 5J1VA 2UUEA 4QMNA 5E8ZA 1OECA 1WBWA 1UNLA 2EB2A 1CKPA 3ZEWA 3GC9A 3QQUA 3TKUA 5TKDA 2O2UA 3W8LA 3C50A 1JKKA 5C03A 3TEIA 2XKEA 4ZTHA 2G1TA 4BCQA 4DEBA 4RWKA 4CFUA 4IM0A 1F5QA 3TI1A 1OUKA 1OVEA 5AP0A 2V55A 3Q2JA 4ZS0A 5BVNA 2RL5A 4X21A 5L8LA 3FI8A 3OG7A 3LFNA 5ANEA 3H0ZA 1KE8A 5FEEA 3VWAA 3UYTA 1IAHA 1L8TA 1ZOEA 2J7TA 2CGVA 3QHWA 4V0GB 3HRBA 4AGWA 4CCUA 5BX0A 3QCSA 3GI3A 3A61A 4RWLA 3NUUA 4YZNA 1ZMVA 3I7BA 3F2AA 3P78A 5C4LA 2GNHA 4FNZA 4GK2A 1DS5A 1J7UA 2PVLA 1XHAA 4I5PA 3QTIA 1J1CA 2Y9QA 3Q4UA 2R2PA 4ZY5A 2WIPA 1BMKA 2WOUA 2OK1A 3BHTA 3R2BA 2YM8A 3F5GA 3LCOA 3V04A 2C6LA 2J90A 1DI8A 4RFZA 2GMXA 3N4VA 4PQNA 2BAJA 2C1AA 2CCHA 4E7WA 2HWOA 2JKKA 4JNWA 4O0VA 3R1SA 4FKIA 4O21A 4OT5A 1P5EA 5LMAA 3I0OA 2PZ5A 3G15A 3TJDA 1JAMA 4ZXTA 1ZAOA 4JG7A 3L1SA 4ZZMA 3FQEA 4HYUA 3RJCA 3MV5A 4ZTMA 4NKSA 5CS6A 5JFXA 2Z7LA 3LQ3A 3WF9A 3SRVB 4BDDA 4IIRA 3QKLA 3ZUVA 4EJ7A 3KK9A 3FZOA 5FBNC 2CN8A 4ZZOA 2W7XA 3GC0A 5FEDA 4QMQA 4GH2A 3QTWA 3A4PA 3C4EA 4AN3A 3L9PA 4IDTA 3RK5A 5DG5A 4FKRA 4YLLA 1OMWA 1SVEA 1SNUA 1SZMA 4B8MA 1FMOE 3ENHA 4E6DA 4BCKA 3BYVA 2B1PA 4FZFB 3HV7A 4L7SA 1DAYA 5EOLA 3E8NA 4M12A 4ZTQA 3JY9A 3PG1A 3A60A 1ZYJA 4GUEA 5JQ5A 3VUGA 4E4LA 1AGWA 2PTKA 3KVWA 2WMRA 5IA2A 5AUVA 5IQAA 4GG7A 1SM2A 3TNIA 5AM6A 4CMTA 4YJNA 3JUHA 1ZY5A 3LXPA 3ODZX 1KWPA 3FDNA 3LVPA 2XB7A 3OOGA 4O6LA 3COMA 2BPMA 3UQFA 4RG0A 3EQIA 1VYZA 4NTSA 2QLQA 2BTSA 3VQHA 4YSJA 1H24A 5CXHA 2G01A 4R5YA 4PMMA 3SKCA 3BEGA 3C7QA 4MNEB 3ET7A 4U81A 3EN6A 3GU8A 3MA3A 4FZ7A 5ITAA 3PJCA 2ZM1A 3L8VA 5CF8A 1MRUA 3O2MA 2C6IA 4ANLA 3NSZA 4RA5A 4IDVA 3FXZA 4FEVA 3DJ7A 3R9OA 2QVSE 4U44A 3HGKA 2QG5A 3UIUA 5IISA 4R7BA 1NW1A 1R3CA 2FSTX 2CMWA 4IX5A 1AD5A 1K9AA 1ND4A 3DDPA 5GINE 2Z8CA 4NCTA 1YWNA 4NFNA 2JIVA 3PRIA 3KB7A 5I3RA 4AAAA 1IAJA 5E4HA 4UV0A 3KRRA 3DK7A 4BIEA 5IH4A 4WD5A 2OLCA 3IOKA 4YUQA 2VWUA 4DFXE 3DBDA 2OICA 4WNOA 4IZYA 2OO8X 3UOLA 1U54B 3BHHA 4QMXA 1E1XA 2E9UA 3CLYA 1T45A 4FIGA 4JBQA 4QYFA 2X39A 3AMBA 4FSRA 5CYIA 3QUPA 4RJ7A 5AFVA 3FZPA 4AG8A 3T8OA 4DFYA 4FKVA 1OL7A 5LVNA 4WOVA 2ITZA 3A7FA 2ZDTA 3C4ZA 4KINA 4UWYA 5KMMA 2IZRA 4AQCA 2Z7QA 2ZJWA 4ZSLA 3ZLSA 2VTQA 1JBPE 2ETRA 1UNGA 1XH8A 3BE2A 3DGKA 4I5HA 4YC8A 5DWRA 3EKKA 4LM5A 3FZTA 2YACA 3VUMA 2VTOA 5IA4A 4QT1A 4O86A 3PE1A 3FL4A 4U8ZA 2J0IA 1DI9A 2J0JA 4V04A 5BYZA 4TTHB 2PULA 1YOMA 4F70A 2QOQA 4DCEA 1LPUA 2QLUA 5BUEA 4W4VA 4BBEA 3VS6A 3QQGA 4BTKA 3OS3A 4KKEA 3WF5A 4HVHA 4BZNA 3KCFA 2UW0A 2QODA 2QI8A 4FTLA 4A4OA 3LJ1A 2O3PA 3L9LA 4AS0A 2VTJA 3PUPA 4FSMA 2C47A 3ZYAA 5CSVA 4GT3A 4AZSA 3UC3A 3ZLWA 4ZTRA 2W1EA 2IW6A 4R3PA 3FEGA 4OTRA 5CEPA 2YHVA 2DWBA 2YERA 2B54A 4FV8A 1TQMA 5IQFA 2YFXA 3G0FA 5L3AA 2WFYA 5HCZA 3PPKA 2UZBA 4HGTA 2GTNA 3AT4A 5KBRA 4WUNA 4GK3A 2C1BA 1R39A 3GCQA 4E20A 3QRKA 3ACKA 4TT7A 4ITIA 4MXZA 5E92A 3R83A 5AIRA 4D1ZA 4EORA 4Z16A 4MAOA 3LFCA 4X2JA 3CC6A 1H25A 4G3DA 2LGCA 2IW9A 2ZB1A 4BHZA 4FL1A 4I1ZA 4F09A 2GHLA 4JJRA 1KOBA 2I0HA 2VTNA 5JT2A 1XH6A 3RGFA 1BKXA 4KSPA 3VULA 5CF6A 2UW3A 1VZOA 4J97A 4IADA 3REPA 3RMFA 4DITA 3PPZA 3Q4TA 4I4FA 4IAYA 3PRFA 3GBZA 4CKIA 4TYGA 4E6QA 3EL8A 3FLWA 3EKNA 3LJ0A 5M4FA 4KBCA 4NIFA 2PMIA 2EXCX 2CGUA 3ZTXA 4FMQA 3KQ7A 3DXQA 3LHJA 4FTMA 4QPAA 3BLHA 5D10A 3DFCB 4YJOA 3F7ZA 3PP1A 5T3QA 3FUPA 4K33A 5D41A 3F66A 4WKQA 4DF3A 3VC4A 4E5WA 3FQSA 4I92A 3S95A 4WO5A 4L52A 4B4LA 4I94A 1JPAA 5DR2A 4HYHA 2BDJA 3EN7A 2JLDA 2YITA 5K3YA 3W16A 1P4FA 4EOLA 2WMAA 3ZSIA 4C3PA 3NYNA 5EI6A 4EH8A 1G8AA 3P4KA 5J7BA 4MX9A 2VN9A 5TO8A 4AA5A 4F6SA 4TXCA 2E9PA 3UQGA 2R3HA 4TW9A 2XK7A 4AE6A 4YJSA 4BCFA 5J5TA 4PDYA 4BWXA 2ITWA 3M2WA 4GCJA 3DU8A 3ZBXA 3ATSA 3ANQA 2X2KA 3D15A 3DTWA 3MY1A 4F7LA 4GMYA 1Q4LA 4G3CA 4YLKA 4LQMA 2YM5A 3DJ6A 2VTLA 4ASZA 4H3QA 5A4QA 2JDTA 1YXUA 4IB0A 4YJVA 2XYNA 4L43A 3RK9A 4MBIA 3QC9A 5M44A 3TJCA 4CFMA 3P0MA 4IAZA 2BR1A 2J6MA 3FL5A 4QPMA 5HD7A 3TZ8A 3I6UA 3G9NA 4PDPA 2JC6A 4RGJA 2J50A 4ZP5A 1PXPA 2WTIA 4C35A 5K5XA 4II5A 4XG9A 3TUBA 4BDKA 2OGVA 2YEXA 4EH2A 4GKHA 1YDTE 1H27A 4G3GA 4EK6A 4K0YA 4IJ9A 2VWWA 2RFDA 3V6SA 4DLJA 2WB8A 2XIXA 3V5WA 2R4BA 4DEEA 3IW4A 3FMHA 2GHMA 4WA9A 4GJ2A 4C38A 3TNQB 5A14A 1BUHA 3CEKA 4FE2A 3D7ZA 5JRSA 5K5NA 5CAOA 1MUOA 4IAFA 4J71A 4X3FA 4YTIA 2X7GA 3AC3A 2E2BA 4ACCA 4JBOA 3KULA 5J8IA 3FBVA 3FYKX 3O8PA 2C4GA 4BCNA 4G16A 5F4NA 3NWWA 4QYEA 5E91A 3MVHA 1R1WA 3V51A 2FYSA 2UW9A 5HG5A 5LMBA 3MESA 2R3RA 2VTAA 5AP7A 3VBXA 3I6WA 5M09A 4DG2E 3Q6WA 2A1AB 2XJ2A 4DH3A 3WILA 5IA0A 4GL9A 4NYEA 4BB4A 3WI6A 3GCUA 3TZ9A 3LFSA 3WF8A 4JLCA 2V7AA 1W83A 4O0SA 3ALNA 3CQUA 3HV5A 1ZYLA 3QQHA 4DHFA 4UEUA 5CAPA 3UO5A 3OWKA 3OT3A 4RJ4A 5B0XA 2DS1A 3DLSA 3FLZA 4USDA 5HORA 1Q24A 4MH7A 1XO2B 4QP6A 1BX6A 4FTOA 1CKJA 5IQDA 3ZEPA 2VWXA 4YZCA 4CZTA 3FMNA 4JRVA 2VTIA 1O6YA 3ROYA 5D11A 2QOLA 4Y83A 4BICA 5AP5A 1REKA 5HO6A 1P4OA 4YTFA 3JS2A 5LOHA 3DZOA 3FXWA 2GSFA 3UP7A 3R7GA 4EOOA 1OI9A 5BVWA 3T3VA 4U3ZA 1LEWA 3CTJA 5LJJA 5LWNA 2JDOA 2A27A 3FKOA 1Q99A 2ZDUA 2ITTA 5LVPA 1I44A 4QPSA 3MVLA 4C4FA 4WT6A 4DG0E 4U0IA 4PV0A 3QRUA 1UWHA 2R3KA 3QA0A 4KSQA 5G6VA 4DFUA 4GYIA 4KRDA 4O82A 5FTGA 3GC7A 5HX8A 2ONLC 5ETCA 3RHXA 4TN6A 4X7QA 4Z3VA 3SOCA 2XA4A 1R0PA 2C0OA 4YSMA 3V5JA 2GQRA 4EYMA 1UU3A 2PMOX 3M1SA 3PG3A 4YHJA 2HZ4A 5DI1A 3G5DA 4O96A 4ZIMA 1WBSA 4FICA 2PY3A 2BIYA 3NUNA 3PVBA 4E26A 1NVSA 1CSNA 2V0DA 3GU7A 2WMBA 3DA6A 4FK3A 2ITPA 4BI2A 4IACA 5IH5A 2BKKA 4RJ6A 2I7QA 3NW6A 3I5NA 5DT4A 4YMJA 1JOWB 2OBJA 1V0OA 5AR7A 2C69A 3MH1A 3I7CA 4HZSA 5F20A 4OW8A 3O7LB 3R7OA 5C1QB 5HEZA 4ZLZA 3OWPA 4BN1A 5KX8A 2XM9A 1H8FA 4MQ1A 4QOXA 4DBXA 3R9DA 5GZ8A 4BBFA 5DMZA 2RG6A 5IH6A 5CU3A 3H9FA 1SYKA 5E8SA 3NLBA 4GFMA 3ZRLA 4FF8A 4IAKA 3OOMA 4DFNA 5A4CA 5AWMA 5CVGA 5A54A 3BKBA 4U43A 3MA6A 4MQ2A 4H3PA 2XIZA 1PY5A 2Y4PA 1OBGA 5IG1A 2EB3A 2G2FA 2P0CA 2BFYA 5IQGA 4EH4A 4RJ8A 3HECA 4X2KA 3MPAA 4F65A 4GSBA 2X4FA 1YOLA 4FIIA 3UMWA 4XG2A 5HU3A 3E88A 3GENA 4FTUA 4RT7A 5KCVA 4Y46A 1K2PA 4CNHA 5HICA 2R3IA 1G8SA 1WVWA 4AFEA 3GC8A 4AGCA 2H9VA 3FKNA 3MB7A 4ENYA 1YDRE 3FQHA 2PE0A 1GIHA 4AGUA 3NNWA 3NCGA 4E6AA 1YDSE 4FEUA 3MPTA 1JWHA 2W9FB 3KFAA 4XMOA 3Q9ZA 4ACGA 2A2AA 4QMLA 4YZ9A 4L3LA 2GTMA 1Q8WA 3OY1A 3QQKA 4N4SA 3RALA 4RJ5A 3POOA 4F08A 4BDGA 4UMRA 5EHYA 4MF1A 2WTCA 4FG9A 2PK9A 1ZYCA 2IG7A 2A0CX 1Q62A 4GVAA 4IC8A 5FQDC 2BRGA 5DRDA 3VVHA 3DTCA 2B53A 3UODA 2HCKA 1GZNA 1SNXA 4JQ7A 4PDOA 3LQ5A 2XF0A 2XKFA 4I4EA 3ZSGA 5H8EA 2Q83A 2WPAA 3WOWA 3PZHA 1GY3A 5EDRA 5AADA 4AT5A 2UZEA 5CU6A 4HVSA 1LR4A 2Z7RA 3FXXA 2ITNA 4FGRA 4FV9A 1M2PA 4ZTSA 1XQZA 3EL7A 3KEXA 3PXYA 4EWHA 4QMOA 3CTHA 4XP0A 3CD3A 3WE4A 5L8KA 3P9JA 2ZAZA 2WO6A 3MTLA 4D2RA 4Q9ZA 2VTRA 2C6DA 2PVKA 2WMTA 1UU7A 3DDQA 3RAIA 4X6QC 4QP7A 1GOLA 4YO6A 4ZZNA 4M7IA 2QQ7A 5IUIA 3CPCA 4MVFA 2XK3A 2GHGA 3CGFA 4CRSA 5BVFA 3C5UA 3FJQE 4J98A 2JD5A 2ZMCA 4FTQA 2QO7A 4MTAA 2JFLA 1PXIA 4QNAA 3UOHA 3HKOA 5C27A 2PZYA 3ORPA 2G2IA 1PXJA 5C8KA 5CEOA 3CGOA 4W4WA 3QHRA 4E4XA 4BL1A 3TV6A 3RINA 4Y8DA 3UGCA 4I6QA 5IEVA 1FBNA 3FSFA 4FIHA 3DKOA 3BWJA 2O0UA 3DFAA 4O0RA 4XJ0A 4TWPA 5J95A 5DR6A 4RIYA 5GIPE 2HZ0A 2R0IA 4KBAA 4DEDA 4XV9A 4YPSA 5DIAA 4FTRA 2R64A 4GS6A 5BUIA 4QQ5A 5HLWA 3DB6A 3E3BX 3CQWA 2QR7A 4RVKA 4DGGA 1LEZA 1ZZLA 4J95A 2WTWA 5KMJA 3QX4A 5GIOE 3UG2A 3FSKA 1Y8GA 3ID6C 5HVJA 3EYHA 1ZLTA 2VTPA 2J0KA 3F88A 4ID7A 3Q04A 4FODA 3GGFA 2Y8OA 4FKPA 1G3NA 3W10A 3FHIA 4F0IA 2XK8A 3VJNA 2W1IA 4OTWA 3QQLA 5I0BA 2W0JA 4NU1A 3DBQA 4NJDA 1OL6A 4B0GA 3E5AA 3QTXA 4BGQA 4U79A 2X8EA 4RLLA 4TNDA 4AGDA 3COIA 4EOIA 5IMXA 4UALA 4L00A 3F7WA 3EQCA 3CQEA 4FGBA 3W32A 4BGGA 3OXIA 5E1EA 3KREA 2C0IA 3HAMA 2BILB 3FZ1A 2X2LA 3NUYA 2FGIA 4CMUA 5JEBA 5EK7A 2WNTA 3I0QA 3V8SA 2XJ0A 3H9RA 4A9RA 1PJKA 1DAWA 1NY3A 3BYSA 4FYOA 3ZM4A 2JDRA 3E62A 3FLQA 4DT9A 3FAAA 1F0QA 1OL1A 5EH0A 4BCMA 3A62A 1A48A 3OEFX 5JK3A 5M55A 3VUTA 4BBMA 3B8RA 1FMKA 2GNGA 1STCE 2BMCA 3C1XA 3PSDA 3QTRA 4FC0A 3UP2A 3ZFXA 4AW1A 3UBDA 4EEVA 2UW5A 3AC2A 3PSCA 2XNGA 4H1MA 5GJGA 1XBAA 3OTVA 4EUUA 3BBTB 3CY2A 5A46A 2XVDA 4DINA 4FNWA 3WIGA 4M97A 4NIFB 3WZUA 4FT3A 3SDJA 3AXWA 3KF4A 4M13A 2JIUA 3U4UA 4CD0A 5AUTA 2B0QA 3JR1A 4C57A 5L2TA 2YWVA 3K2LA 2OJFE 4I41A 3ORXA 4M66A 2QKWB 2WMVA 4AU8A 2UZLA 4G9CA 5HE2A 3KKVA 1CMKE 2ACXA 4AWIA 1WFCA 4MXXA 4ANMA 4ACDA 1APME 2GFSA 4K6ZA 2QG7A 4IZ5A 4PL5A 4C02A 3C13A 3F3ZA 3TT0A 5ACKA 3VUKA 1A06A 4EHZA 2OFUA 4F6WA 4BR3A 5AIKA 4FKJA 2FSOX 3NRMA 2H6DA 3VF9A 5HCXA 5EM7A 2BUJA 2IZTA 2XK6A 1QPCA 3LAUA 5FM3A 4APPA 3OEZA 4NK9A 5BUJA 1U5RA 1ATPE 4CFWA 1RJBA 2YAAA 3WARA 2VGOA 4YZDA 1PYXA 4AFJA 2RG5A 1YXXA 4FIEA 1J91A 4F1MA 3IDCA 3CY3A 2YM7A 3ZZEA 1H01A 3NUXA 4J53A 4EZ5A 3UIMA 2VWYA 3VBQA 1LUFA 1A9UA 3QFVA 4YC3A 4DE4A 2R0UA 3TNWA 4IW0A 4LFIA 3V6RA 4FT0A 3N9XA 3QUDA 1M7NA 4FT7A 3JY0A 4UB7A 4HVIA 4HGSA 3Q53A 3WE8A 3Q2MA 2NO3A 4A07A 3SHEA 2WQNA 3TZ7A 2BRMA 2B9FA 2BDWA 4QTDA 3QLFA 2YJSA 3E93A 4PY1A 3OCSA 5LQFA 3P7CA 3G51A 5KMIA 2BAQA 3HA8A 5A3XA 3I5ZA 1W8CA 3LJ2A 4FKSA 3P7AA 1WBPA 3L8XA 3PWDA 3K5UA 4TRLA 5HX6A 3GNIB 5JSMA 4UMQA 2ITOA 2XK9A 5GHVA 4CLJA 4I23A 1JNKA 4X3FB 3ITZA 3M42A 2BZKB 2YN8A 2WMWA 3KULB 4FKWA 4AOIA 4Y95A 1Q8TA 4O27B 5L6OA 2WXVA 3R6XA 4F7JA 4JDHA 3FC2A 3H9OA 3IOPA 1XBBA 5JGBA 2P33A 4UY9A 4RIWA 3IONA 3PIXA 4I93A 4PUZA 1YI6A 4O7ZA 4XBRA 3RPOA 2B9JA 2VZ6A 4MBJA 4O7YA 3EN5A 4BKZA 5M57A 4LI5A 4KS8A 4HJOA 4C36A 2ZB0A 2VTMA 3MB6A 3Q9XA 5IKWA 2UZDA 4RA4A 1HOWA 5LMKA 3Q5ZA 5T6KA 3QQFA 4Z9LA 2NP8A 4IWOA 4K9YA 4DH7A 1Q3DA 1QPEA 3DB8A 4TYHB 4UXQA 3TWJA 3DV3A 3ZFMA 4ZSEA 2R3OA 5BVEA 4CXAA 4N6YA 3VUIA 4FUXA 3LPBA 2WOTA 4D0XA 5DEWA 4UYNA 3ZSHA 2F7XE 2QD9A 4M8TA 1O6KA 3PIZA 4FIJA 3BGZA 4BFMA 5A4EA 5EQEA 3I79A 3R73A 3NIZA 4AW0A 3P08A 2JDSA 2ITQA 3KXHA 5EW9A 3GQIA 4FVRA 4EQUA 1PXOA 3C51A 1YWVA 1KV1A 4IJPA 3TIYA 4JQ8A 1UV5A 2VX1A 3RHKA 4DTBA 4D9TA 4A9UA 3FMDA 3QZIA 2OI4X 2X7OA 3UNZA 2C6MA 1PYEA 5ANKA 4F0FA 4BDBA 4F1OA 4CV8A 1Y6AA 3WF6A 4LV5A 4BDJA 2BZIB 5CSPA 4AN9A 5IMEA 5IZFA 1OIQA 2VO7A 5IQHA 2UZTA 1F3MC 4EHEA 4X2FA 3ALOA 3A8WA 2GNLA 5JKGA 3KRJA 1ZYDA 2ZV2A 5AAFA 3EQFA 4G17A 4UXLA 3R1YA 2WKMA 2PHKA 2FSMX 2W4OA 3HMNA 3R8ZA 3PXKA 4C7TA 3F2NA 3W8QA 3A8XA 3MSSA 4U97A 5DLSA 5J5SA 2XS0A 1XH7A 4BY9E 4IC7A 3SGCA 3IECA 3R8VA 3CKXA 4DN5A 3GOPA 3GVUA 2OWBA 3FMLA 4QTBA 1OPKA 2IZSA 4FK6A 4FV3A 5IU2A 4RC2A 4D4SA 3MTFA 3R1QA 5I9ZA 3CJFA 3QKMA 5E90A 3VW6A 4O84A 3SA0A 5DA3A 3Q60A 4LYNA 5D1JA 4L46A 1BL7A 1HCLA 3D94A 4M0ZA 5HNBA 4UX9A 3LFFA 2RIOA 4KWPA 3KXZA 3U9CA 2VWVA 5IQIA 3FPMA 3BGPA 3JYAA 2CKEA 3R63A 4NWMA 4R8QA 4FZ6A 5M53A 5C01A 5HTIA 5HG7A 4FTNA 4LOPA 4N70A 1PF8A 4S33A 2R3NA 4X3JA 4W8EA 3ZBFA 4PTEA 3IGGA 4ZLYA 5AUZA 4GT5A 3SC1A 3FLSA 2B7AA 3HRCA 4XLVA 1BL6A 3HP2A 5AUUA 1H0VA 4I21A 5CLPA 4RVLA 3Q96A 5BMSA 5KHWA 5AV2A 1ZMUA 2O5KA 4DLIA 1CDKA 2QHNA 1U46A 2I0VA 3K3JA 3K54A 3O71A 1YOJA 3E87A 2LAVA 2O63A 3AT3A 4FG8A 4O0TA 4YBJA 2YCRA 5M07A 3FY0A 3MH2A 5CU2A 2NRUA 4DEIA 1Q3WA 2WD1A 3E64A 3EN4A 4HVDA 3SG9A 2W9ZB 3BPRA 4IZAA 2C3JA 3OWLA 4FV1A 4WNMA 3ATTA 1IEPA 3KC3A 4JRNA 4W4YA 3VQUA 5C8MA 3ZHPC 4TZRA 1OKZA 2YM6A 3PFQA 4AUAA 1GNGA 3B8QA 5HE3A 1FOTA 3EFWA 4K1BA 4S32A 4EKLA 5KHXA 3PJ1A 4FT5A 4Y73A 1L3RE 3BLQA 3C0GA 3ORTA 4IXPA 5DT3A 4GEOA 4L7FA 4GU6A 5EFQA 3MH3A 2PYWA 5LVMA 3EIDA 3LIJA 5K0KA 4JT3A 4UMTA 3DKFA 4NEUA 4EOMA 3NYXA 2XNOA 3MFTA 4ANQA 5E8YA 3O7LD 4L45A 3ORNA 3VJOA 2HYYA 3NNVA 3KGAA 4GKIA 3FV8A 3L9NA 4FZDB 5DEYA 3DK3A 5AAEA 3BGQA 3KRLA 4EJNA 3TL8A 4EH7A 5KNJA 4BI1A 4KS7A 4JR7A 4ERKA 3RTPA 1WBNA 4G3EA 5B7VA 2XKCA 3HLLA 2W96B 4LMNA 1IRKA 3FYJX 4PF4A 4RX7A 3UG1A 4R77A 4NM5A 5LXMA 1IASA 2DQ7X 5DYJA 2BIKB 2YM3A 5AV1A 3T3UA 3KXNA 2JAMA 2VTHA 2UZVA 3O8TA 3PP0A 3QTSA 2C0TA 4M14A 2B9IA 4QP4A 3RM6A 4G1WA 2JBOA 3FHRA 2VO3A 3PVGA 2OFVA 3F2RA 4GIIA 5I4NA 4A7CA 3OUNB 2IO6A 4PL3A 3DLZA 2XH5A 5K4JA 2B55A 4EQMA 4IFGA 4MD8E 4DAWA 2WTKB 3COKA 1W0XC 4IX4A 3CS9A 4XG4A 3VS4A 3VHEA 1R0EA 4YU2A 3MVMA 4DYMA 5C4KA 2BHEA 4L6QA 5CVFA 3LM0A 3TTJA 3GT8A 2R3QA 4JS8A 1O6LA 2EXEA 2HWPA 3Q52A 1OKYA 1JSUA 3NUPA 1ZOGA 3VN9A 1OB3A 3S1HA 4H58A 3PXQA 4MF0A 3V01A 5JRQA 4E73A 2WTVA 3BYUA 5CT0A 3EH9A 4JQEA 4RIYB 3FMEA 4EBVA 3K3IA 4S34A 4XG8A 4K2RA 4WRGA 5DBXA 3LQ8A 3GCVA 2XEZA 5ACBC 3RBWA 3U87A 4NJ3A 4BF2A 3FMKA 1V1KA 2OJIA 3MH0A 2KTYA 2J2IB 4FEWA 1M17A 3HMOA 4XS2A 2P3GX 5AP6A 4O0YA 3NNUA 4A4LA 4E5AX 5DHJA 1WZYA 4QO9A 2VWBA 4IVDA 2OIQA 4USFA 3MY0A 4IB3A 4EH9A 5I9XA 3R30A 2UZUE 5D7AA 1IA8A 1Q41A 2CKPA 3L8SA 2ITUA 3BWFA 4EKKA 3QX2A 2UW4A 4R1VA 3NW7A 3C5IA 5LCKA 2UVXA 5HIDA 4BCOA 4D1XA 4KD1A 3VO3A 3PSBA 1SVGA 2F7EE 4O7LA 3QWJA 5B2LA 3E3PA 3LXLA 4C61A 4GUBA 3A7HA 2BROA 3NS9A 4M69A 4RRVA 3RAKA 3CR0A 4IANA 4AP7A 3IW6A 3DQWA 4XP2A 1Q8UA 3F5PA 2C3IB 5KUPA 4MK0A 4EC9A 3C0IA 3MIYA 4P90A 5CX9A 3UO6A 4D58A 4BDAA 1J7IA 3OT8A 5HD4A 1OM1A 4EOJA 3HV6A 4NCTC 3UMXA 3ZDUA 3U6IA 2HY0A 4FSWA 3ZO1A 4RX5A 2XCHA 2ZV9A 1YI4A 2F7ZE 4RC3A 4YJUA 5FTOA 4OTQA 2PZPA 4QQTA 4IZ7A 2P55A 3KF7A 2H34A 4TKSA 5AUYA 2NNWB 4AACA 4XEYA 4PP9A 3TDVA 3DBCA 3HDNA 4OTDA 4ZJIA 3EMGA 3R9NA 4FKLA 5IA1A 4UYAA 4DFBA 3LXKA 4JAJA 4UWBA 4X2NA 3UNJA 2E9VA 2BRNA 4R3RA 2Z02A 5EYKA 1OL5A 3LZBA 3UOJA 2VTTA 3JVSA 4HW7A 4O0UA 1YXSA 3HYHA 2YM4A 3NEWA 2VWIA 2YISA 3POZA 3PA4A 3RNYA 1YQJA 2W1FA 4RLKA 1VEBA 2BCJA 3D14A 4PPBA 2WMXA 3RK7A 5CAUA 5IUGA 5I9YA 4R1YA 3OFMA 3UJGA 2WMUA 4AZWA 4QD6A 4EOKA 4QMYA 3NYVA 4YGAA 2RKUA 5FUTA 4UZHA 5AMNA 3LCKA 3IW7A 2XNMA 2CGWA 4QQJA 4BCJA 5HLNA 5I9WA 5KZ0A 4D2PA 4RVMA 3SD0A 2Z2WA 2QOFA 3IQ7A 2OXXA 4O1OA 5LVLA 3R7YA 1UA2A 1ZWSA 4L9IA 4UZDA 1UNHA 4XUFA 2FA2A 1AQ1A 5L8JA 5EG3A 3QRIA 4M67A 3GQLA 4JAIA 3UE4A 5E9EA 3BLRA 1M2QA 4EWQA 5H8GA 4XRJA 2HIWA 3PYYA 4JDKA 2XK4A 4EONA 1P14A 3KU2A 4TPTA 3ZOSA 4AT4A 4F63A 4FZAB 3DBEA 4QP2A 2C5YA 1OKWA 3S0OA 1ZARA 4BDFA 4IM3A 3QD4A 2YLEA 3VW8A 4ASDA 2IVUA 2DYLA 3TTIA 4YNEA 3R8MA 2XM8A 2AC3A 2W06A 5JN2A 4KB8A 4R6VA 4S31A 4CTBA 2QURA 3S2PA 4AOTA 5HGIA 2C3LA 4WNKA 2C5NA 3SOAA 4GU9A 3BQRA 4AZTA 5EQYA 2ESMA 5I5ZA 4YURA 3IK3A 4MXCA 1U5QA 4MD9E 3ODYX 3LFAA 4XV1A 5M4CA 5IQEA 1NA7A 1S9IA 3SQQA 4U41A 1FVVA 5J79A 5L2IA 3SAYA 3TDWA 5TT7A 3LFBA 1XBCA 4MXYA 4AE9A 2OJJA 1NT2A 5CF4A 4XHKB 3F69A 2WU6A 2ZVAA 3CXWA 4OGRA 5EDPA 3PY3A 4CVAA 2GCDA 3D5WA 3LLTA 4IWQA 1YHWA 2B52A 1W98A 2Q0BA 4P5ZA 5CZIA 3BEAA 4IQ6A 5IQCA 4W9XA 3PJ2A 5DPVA 4AT3A 2WEIA 4QMUA 1RW8A 5CT7A 3Q6UA 1RQQA 4NM0A 2QO9A 5EW3A 3DY7A 2HY81 3FWQA 4EK3A 5A4TA 4PPAA 4C62A 4HVGA 2IW8A 3BV2A 5A4LA 2C6KA 3GFEA 4AF3A 5E1SA 3QRJA 5EI2A 5F94A 4RIWB 3RCDA 1T46A 3QQJA 4OAVB 2OH0E 5M08A 3MFRA 3OVVA 4TWCA 3ZFYA 2SRCA 3IG7A 2EWAA 3IKAA 5C26A 4EH3A 3G9LX 4ENXA 3VS7A 4N57A 4HCUA 4QNYA 4LG4A 4FKTA 4RX8A 4CCBA 4E93A 3F3TA 4LL0A 5DH3A 5HE0A 3KK8A 2OJGA 4YC6A 3SLSA 4RX9A 3PE2A 3QXOA 5AV0A 5DE2A 3HUCA 2BHHA 3MVJA 3NZ0A 5CENA 3I1AA 2CNVA 1KOAA 3THBA 3ZRMA 4LL5A 4GK4A 2OZOA 3E63A 3GEQA 3AC5A 3V8TA 3W18A 4ACMA 5TR6A 4DG3E 3JVRA 2RFNA 1W7HA 1YHVA 4FR4A 4NL0A 2ITXA 5HLPA 3MIAA 4LGHA 4OAUC 5AP3A 2HELA 2WZJA 3ZLXA 3DNDA 4OLIA 5I3OA 3EFKA 4QP8A 4PWNA 1ZXEA 2NPQA 4U80A 3SXRA 3RKBA 4C4IA 4FOCA 4F4PA 4BWPA 1RDQE 3F61A 2PSQA 2EU9A 2R7IA 1GZKA 1ZY4A 3SXFA 1U54A 2PMNX 3V5LA 2UW6A 2ITVA 1URCA 3GU6A 4J96A 2XJ1A 3E8CA 5FP6A 3ORMA 4Z55A 4S2ZA 1XKKA 4D4RA 3F6XA 3OW3A 4EBWA 1JKTA 1Y8YA 4O7WA 3G33A 4JG6A 3SG8A 5T68A 3C0HA 1H1WA 2X6EA 4OR5A 4ZS4A 3ULIA 4RSSA 3WZJA 3AG9A 4G6LA 5ANDA 1SVHA 1IA9A 3EN9A 4L44A 4MWHA 4RIOA 3NCZA 2YDKA 4X3FC 3V5PA 4RFYA 4BC6A 4D2WA 2WQBA 4YNOA 3UQCA 1KE9A 4UWCA 1OGUA 4FKQA 3SW4A 2UW7A 3E8DA 4XOYA 2HW6A 4G9RA 2GDOA 2OG8A 1YHSA 5HQ0A 2CKOA 3S3IA 2R5TA 3F3VA 4DTAA 2RFEA 1BYGA 1LP4A 4JL9A 4ANSA 1U4DA 4EK5A 3W2CA 1JLUE 2IZUA 3RAWA 4PX6A 2W5BA 4BCIA 3AGLA 4FKUA 4CMOA 4O1PA 4EOSA 3OXZA 3KVXA 4OTFA 3R7EA 4USEA 3R9RA 2J0MB 4I5CA 4YZBA 4FBXA 3KXMA 2XRWA 4FL2A 2F49A 3KL8A 5FLFA 3FKLA 2CLXA 2WQEA 3LE6A 3VBTA 2R3PA 3K5VA 3O96A 3DXNA 4JDIA 5EM8A 4GIHA 2BALA 5BYLA 1Z5MA 3MFSA 2UV2A 2OJ9A 5LARA 1JVPP 3KMWA 3MJ2A 5E8XA 4YJRA 4BIBA 2QOBA 4XCUA 3ZH8A 3SVVA 3OHTA 4E4MA 4U40A 1OKVA 2OF4A 5ETIA 1UWJA 4OBPA 4HYSA 3WIKA 4C58A 2E9OA 2JAVA 2VUWA 4L01A 4YO4A 3L8PA 4RZVA 1EH4A 3O23A 3W2QA 3R8UA 2W4KA 2WAJA 4JIKA 4ZJVA 4QQCA 4NTTA 3OCGA 3O8UA 3QXPA 5AP1A 2J51A 1PXKA 3D83A 4IB5A 5EYDA 3NPCA 4JDJA 2OIDA 5IUHA 3EQDA 4UBAA 2JDVA 2YA9A 4L53A 4C34A 4DH1A 1PMVA 1FPUA 4EOPA 4KUJA 3FZSA 2WTDA 5AAGA 2VGPA 2YZLA 2XCKA 4YJTA 4AA4A 4WG5A 3RAHA 1M2RA 2OH4A 3RPRA 3OTUA 3W55A 4A9SA 3DCVA 4O2ZA 3S4QA 2YLFA 3LFEA 3PIYA 3DOGA 2YCSA 5LCJA 3I4BA 4EI4A 2YDIA 4H36A 3BHUA 3MDYA 4TNBA 3RNIA 2IJMA 4IX3A 4E4NA 3HDMA 4QMVA 3R7IA 3ZO2A 3U9NA 1SMHA 4WNPA 4BRXA 2PU8A 2HZIA 2QOCA 3ZU7A 2GNJA 3H10A 4IEBA 4FTJA 5HBJA 2UZOA 1XH4A 5ETFA 5M56A 2YABA 4TY1A 3NUAA 3D7TA 5H9BA 1H0WA 1O9UA 4Q5EA 4XP3A 4ASEA 3BV3A 5CWZA 4LOOA 3ULZA 2QU5A 5L2WA 2GS6A 4QRCA 4YLJA 3PTGA 2XNNA 2X81A 3DZQA 4YZMA 2QC6A 3EQGA 4QMZA 3UVQA 3PY0A 2XKDA 4FTKA 4O81A 3GU4A 2PVFA 3VS5A 2PVRA 2A19B 2YZAA 3R7UA 1OIYA 3O50A 3GCPA 2F57A 3E7VA 3NAXA 5H3QA 4AZEA 3HP5A 3VS0A 4DEGA 3P5KA 1OL2A 4B9DA 5FEQA 3C4XA 1YKRA 1MQBA 1G5SA 2VO0A 5DVRA 3ZDIA 4ITHA 4BCHA 2R3LA 4IAAA 3AC8A 5GNKA 3RZBA 4AZVA 5KKRB 4UMUA 5IDPA 2Y4IB 2PWLA 5AV4A 3R0TA 4ZMEA 3EQPA 4TWOA 4XV3A 3VBYA 4DFZE 2CN5A 3H30A 4AA0A 5LWMA 5B2KA 3ZLYA 3IDBA 2XBAA 4XLIA 3BYMA 4ONAA 3O0GA 3QL8A 3ZC5A 3TM0A 3TUDA 2G9XA 3RPYA 5JZNA 4Y72A 5JQ8A 4CSVA 3ZONA 2ERZE 4ALUA 2IVVA 5HIBA 3D9VA 2X4ZA 3TN8A 4D5HA 3PY1A 3PJ3A 5EM6A 2CPKE 2IWIA 4NUSA 3EFJA 3TIZA 4Z7HA 5F1ZA 3EJ1A 3ZUTA 5CAVA 4G5PA 2BZHB 4FSZA 2C6OA 4D0WA 5IF1A 3AC4A 5K9IA 5KMNA 5CASA 4RQVA 4BDEA 4QP1A 4CYJA 4BZOA 5ANJA 4CT1A 2UZWE 5JH6A 2Y0AA 4I6HA 4F9WA 3BHYA 5A6OA 2C6EA 1K3AA 3H3CA 3HMMA 4ORKA 4JI9A 4DGOA 2CJMA 2QKRA 3MBLA 4KIPA 5ANGA 3LW0A 2Z7SA 3ORZA 4XBUA 5EHLA 1WBVA 2V7OA 4U5JA 2G2HA 1Z9XA 4M69B 2BRBA 1FGIA 2PVMA 3DT1A 3H0YA 2WQMA 3NGAA 2XYUA 5KO1A 1UVRA 4KIKA 4BKYA 4CKJA 3PXZA 3NDMA 2X9FA 5D9HA 3TCPA 2IN6A 3PXRA 3WBLA 3E8EA 1CM8A 3IW8A 2G15A 2UW8A 4FL3A 4G31A 4I0RA 4CQGA 2PL0A 2VRXA 3R7VA 2R3GA 4CQEA 4YPDA 3OC1A 2WTKC 3ORLA 4FVQA 1XR1A 3G0EA 4I3ZA 1M14A 3QA8A 4HCVA 4OBQA 3RPVA 5IPJA 3EZRA 4CLIA 1PXNA 3DKGA 3OXTA 1Q8YA 3Q9WA 1WBOA 5AJQA 5EDQA 5EHOA 4F6UA 2BVAA 1B6CB 2PUPA 4KBKA 4ASXA 3WYXA 5KMOA 1J3HA 3DXPA 3AMYA 4D55A 2UZNA 1Y6BA 4NW6A 3TNPC 4DT8A 4ALWA 2XRUA 4GV1A 2C5XA 2YIQA 3GUBA 2X9EA 4FV0A 4QYYA 4RWJA 1OITA 4D4YA 3VBWA 3QZHA 3VF8A 3LM5A 2I0EA 4KKGA 4WSYA 5AA9A 3GXLA 3OCBA 2OF2A 2WQOA 3A4OX 4TYJA 5KE0A 4O38A 1DM2A 3NW5A 4IWDA 3KN5A 4JBPA 4BDHA 4E8AA 3RCJA 3DBFA 4BHNA 4BTMA 4C4EA 1BI8A 2GQGA 1WCCA 2OZAA 3MY5A 5ANOA 3V5TA 3FPQA 3LCSA 2VAGA 3UZTA 2GS2A 4GYGA 3W2RA 5CU4A 3KMMA 4EL9A 5AUXA 3QD2B 4G5JA 4C4HA 2PE1A 5EOBA 1H07A 4I0SA 4DGNA 3U51A 5H8BA 2P2IA 1J1BA 5M51A 3E7OA 5EKOA 4X2GA 4FTTA 4WG4A 4CFNA 3OROA 4U7ZA 1FQ1B 4MKCA 5E8UA 5JFWA 2HXLA 4QTAA 4R5SA 2W05A 4FSYA 4JOAA 1H1PA 4MNFA 5DGZA 5FBOA 4CZYB 3HAVA 1XJDA 1FVRA 5D7VA 3NMUF 1JQHA 2YCQA 4CYIA 2CNQA 3MN3A 4K8AA 3W2PA 1MP8A 2IVTA 4O91A 4DC2A 2BRHA 2H8HA 3GFWA 4RBLA 3F9NA 3FI2A 2RF9A 3P79A 5KMLA 4H05A 2XNPA 1QCFA 2JFMA 4QMTA 5AR4A 2RFSA 2R9SA 3AD6A 4B8LA 4XH6A 3EQRA
chains in the Genus database with same CATH superfamily
3RVGA 2C5OA 5HG9A 3ACJA 1GZ8A 3QCXA 4V05A 2JBPA 4I0TA 4D4VA 2X7FA 3NX8A 4J52A 4K18A 2FUMA 1W2DA 4P4CA 4RVTA 2I6LA 2C6TA 3JXWA 1URWA 4BTJA 2PE2A 3BZ3A 5TOZA 4PMTA 4RC4A 2W1HA 5E8VA 4JBVA 2P4IA 1PMNA 3BRBA 2W5HA 2R3MA 2HOGA 3CBLA 4KKHA 4BVUA 5CI6A 1PXMA 3D5UA 4AXAA 5JFSA 3KRWA 1ZMWA 4IVAA 4M84A 3VBVA 3D0EA 2OW3A 3OP5A 3A99A 4Q9SA 3QGWA 3HA6A 1PKDA 4OT6A 2JEDA 2CGXA 4R78A 3WYYA 4PL4A 1B39A 1W82A 4FSNA 3IS5A 3LXNA 3MWUA 4BGHA 2EXMA 3C4WA 2XP2A 5AEPA 2HXQA 2R3JA 2VNYA 4AXEA 4NFMA 4BWKA 3R1NA 4EHGA 5JGDA 4F7SA 3FY2A 3II5A 1XWSA 3B2WA 4W9WA 1VJYA 4FRFA 3BU6A 4FYNA 5CZHA 2GNIA 3GOKA 3HMIA 4XV2A 3R8PA 1YVJA 3C9WA 5AP4A 4C0TA 3U54A 5FWKK 2YJRA 3AT2A 3QWKA 3BE9A 4C8BA 3TV7A 1UKIA 3PLAE 3PVWA 4BDCA 1H28A 4P7EA 3NIEA 2GFCA 4PRJA 4TYIA 3W0RA 3KRXA 4ZMFA 4XG6A 5FDPA 2VX3A 4R3CA 1H08A 2Y7JA 5HOAA 4HCTA 1WBTA 5HCYA 4O83A 5G1XA 2XNEA 2W1DA 4FV4A 4PDSA 4KNBA 2VX0A 3W2SA 4F1TA 1UKHA 3T9TA 2W1ZA 5HO7A 4QDEA 4D2SA 4HGLA 5IQBA 3DAKA 2AQXA 3V5QA 3QYWA 3P5JC 3DJ5A 3M11A 4YBKA 4RPVA 1YRPA 2JGZA 4XYFA 2BTRA 4Y5HA 1OBDA 3QALE 3IO7A 4FKGA 3RPSA 5I9UA 5CQUA 2PUIA 2J5EA 4TWNA 4O6EA 2VWZA 4J7BA 2ZV7A 4KA3A 4L68A 2W4JA 4LOQA 5EYCA 4W4XA 4CV9A 3FMMA 4C4JA 2YCFA 2E9NA 4ZSJA 4F9YA 2ZM4A 3TUCA 2IPXA 1Y57A 4GG5A 4CKRA 4M15A 3ZXZA 4KRCA 5CAQA 4IVCA 1PW2A 3AQVA 3O17A 4IE9A 4FV6A 4K11A 4MBLA 5L6WL 3ZUUA 3S00A 5TE0A 5LMKC 4FG7A 4FV7A 4F9BA 3UZRA 5FXQA 3MW1A 3TKHA 2XUUA 3SXSA 3RWQA 4CFFA 4EQCA 3F82A 3ORKA 4C2VA 3PXFA 4FSQA 4LRJA 4TL0A 2XAMA 3UDBA 4NT4A 3CP9A 3QZGA 1WVYA 3CPBA 4EHVA 5CEKA 2PVJA 4B6LA 3ERKA 3FZRA 4GRBA 5CEIA 1H1SA 3V8WA 1VR2A 5K0XA 3LCDA 2WMSA 4M68A 4ARKA 2PUNA 4RIXA 4CGAA 2QNJA 4ITJA 1TKIA 2ONLA 1KV2A 3BBWA 2JIIA 3CTQA 3MGYA 4NW5A 4OBOA 1WAKA 2O64A 3Q3BA 3Q4CA 4FV5A 5BMMA 2XMYA 3TACA 4YP8A 3U4WA 3UNKA 3DAJA 1FINA 5AX3A 4XG3A 2Z60A 4EYJA 4MUQA 4S30A 4EH6A 3NYOA 3ML1A 3D5XA 3B2TA 4MWIA 3UZPA 1JKLA 2A4LA 3ZO3A 3LMHA 3QTZA 4JMQA 2Y6OA 4DGMA 5CI7A 1PKGA 3LCTA 5IDNA 4C3RA 1MRYA 4UMPA 4GJ3A 4O7NA 4KABA 3EYGA 1QMZA 5L2QA 3QF9A 4MD7E 3P1AA 3R9HA 3QKKA 1GIIA 3FI4A 5DNRA 5E8TA 4C3FA 4NZWB 2CKQA 2GS7A 2NRYA 3EQBA 3HV4A 4RFMA 5GZ9A 2PUUA 4IB1A 4IHPA 4C33A 5JMSA 4NSTA 4ANNA 2CHLA 3P23A 3BYOA 2F9GA 2W99B 3QTQA 2QOIA 4PMSA 4XX9A 3FC1X 4AX8A 3CSVA 4O7VA 2BZJA 2VV9A 5FTQA 5FP5A 4MCVA 5AM7A 2HAKA 5HESA 3ZRKA 2Y6MA 3G2FA 3Q4ZA 1OUYA 3KA0A 5AUWA 4PNKA 4YHTA 4U9AA 4ZOGA 3D7TB 4KIQA 5J87A 3RM7A 3PLSA 1OIRA 3L9MA 3BU5A 3LFQA 4CEGA 3BX5A 4JX3A 3VUHA 4YTHA 5AP2A 3PJ8A 5HO8A 3GP0A 2PMLX 3UPXA 2OIBA 2JKMA 2WELA 3TZMA 4Z7GA 3NFFB 5EKNA 4Y5QA 5IA5A 3W0NA 2C5VA 4EZ3A 2H96A 4NM3A 4AZFA 2X0OA 2C68A 1XH9A 1TQIA 4O22A 1TVOA 2PZIA 3QD3A 5CVHA 3U6JA 2HENA 4XRLA 3QBNA 2WHBA 4FEQA 2I1MA 2OU7A 1MRVA 5J7HA 5F95A 2PPQA 5FG8A 4F0GA 3EHAA 4HNIA 4O0WA 4D1SA 1KE7A 5HVKA 4MXAA 1RE8A 2J4ZA 4FV2A 4IH8A 3KXGA 1QPDA 5BPYA 2WIHA 4L8MA 3PA5A 2RGPA 4H3BA 4D2VA 2FVDA 3D2KA 4ZY6A 4I5MA 5ETAA 1M52A 3BIZA 1IR3A 4EZ7A 4ZEGA 3NUSA 4C2WA 5CANA 3OD6X 1PRYA 2BDFA 4YJPA 2F4JA 2FSLX 4A4XA 5EYMA 4B99A 4D2TA 2VNWA 4CFXA 5CU0A 3PPJA 5AR2A 4OTIA 3W1FA 1Q97A 2BAKA 4QTCA 4OTHA 1OPJA 2XIKA 1H00A 3KN6A 5JZJA 2W1GA 1KE5A 2BKZA 4V0GA 4EH5A 4CRLA 4PP7A 4BKJA 1JSVA 1JSTA 1TQPA 1UU9A 1E9HA 5CQWA 2P2HA 4ZSAA 5H2UA 5CSHA 3NR9A 2Q0NA 4G2FA 2KULA 3OCTA 1HCKA 3Q32A 3UOKA 1GIJA 2J9MA 3RP9A 1XMLA 2B4SB 4O7SA 2R3FA 2R7BA 4WHZA 5CSXA 2V22A 2YDJA 5E8WA 3SV0A 3VS1A 3MPMA 5ANIA 3QLGA 4WIHA 3ZS5A 4G34A 4HGEA 5CEMA 3OF0A 4Q5HA 2AUHA 2X0GA 1MQ4A 3P7BA 3VNTA 4CZUA 4TYHA 3VIDA 2IF8A 4HNFA 1CKIA 1JKSA 4JR3A 5HBHA 4ZSGA 3BELA 5IEXA 3GU5A 3QRTA 3PDTA 1PXLA 4HZRA 4IVBA 3P86A 5HHWA 4EK4A 5JGAA 3HZTA 2BFXA 1Q5KA 4L3JA 4YTCA 5CF5A 5CNOA 3SRVA 4PMPA 2PVHA 4KIKB 3ROCA 2C3KA 4IAIA 4C37A 4A9YA 4M0YA 5ICPA 1BLXA 2PZRA 4G3FA 4R7HA 3ELJA 4GFOA 3N4UA 3CKWA 5A6NA 5GZAA 3D5VA 3OBJA 3AMAA 5C8NA 2AEGA 3GB2A 2XBJA 4GT4A 3A7IA 4IM2A 4W8DA 3TV4A 4FVPA 2OSCA 4V01A 5KKRC 1WVXA 2FO0A 4UN0C 4DGLC 4C59A 5IA3A 4LGDA 4WBBB 3UTOA 2GQSA 2Y4IC 4L67A 1B38A 4QMWA 5EW8A 5J9ZA 2ZYBA 4IBMA 2QO2A 4ZJJA 3A2CA 5FGKA 3MS9A 5LVOA 2PVNA 2QOKA 4QYHA 2ERKA 1GZOA 2FB8A 1ZRZA 4MHAA 1XMMA 3R00A 2RSVA 3FI3A 1U59A 4E6CA 4NM7A 4F64A 3NVMB 2OXYA 3C4FA 2XIYA 3AD4A 2CCIA 4APCA 4MEDA 4WRSA 3WZEA 3ORIA 3ANRA 3KXXA 3IW5A 3QCYA 4N6ZA 4ZTLA 1FVTA 3FMJA 3U8WA 4LV7A 4MNEA 5CY3A 3R8LA 4FIFA 2F2UA 2XARA 1H4LA 1ST0A 4FA2A 2ETMA 2OZAB 4JX7A 5J9YA 3LKMA 3NNXA 3OBGA 5CXZA 3COHA 4I20A 5HVYA 2EVAA 4WG3A 3AGMA 4G6OA 4GFGA 2HW7A 2QOOA 3QGYA 4K77A 4O4BB 3WZDA 3I81A 3ZC6A 1YXTA 3IGOA 4J8MA 2QCSA 3HUBA 1M7QA 4PTGA 5BYYA 3IPHA 4JXFA 5AV3A 5AX9A 4ANOA 3OWJA 5I9VA 4IX6A 4QMPA 5GJDA 2CSNA 2ITYA 3VUDA 4WBOA 2ZOQA 4D9UA 2XIRA 2W5AA 2B9HA 4F99A 4FNXA 3DNEA 4FNYA 3AOXA 3MYGA 4I6FA 4FKOA 4RWIA 2YWPA 4CG8A 4FTAA 4JG8A 4AN2A 4AXCA 3R28A 4BCPA 5F9EA 4PPCA 2CDZA 3DKCA 4QP3A 5C9CA 4PNIA 2HZNA 4P5QA 3NAYA 3PWYA 3V3VA 2VU3A 5FDXA 4OTPA 1IG1A 2YIXA 4O4FA 3EQHA 5EI8A 2IVSA 4AAYA 4LGGA 3OUKA 3MFUA 4FX3A 4CFVA 1P2AA 3HMPA 5M06A 1Y91A 3QD0A 3TNHA 1XH5A 4E3CA 3O51A 3BU3A 4M3QA 4F9AA 2AYPA 3UIXA 2VO6A 4GW8A 5TF9A 4U3YA 1QPJA 5CALA 3Q9YA 5GJFA 1YXVA 1H1RA 2QHMA 2QOHA 5BVKA 4BIDA 4EUTA 5KBQA 2I0YA 4D28A 1OZ1A 2JITA 3F5XA 4QMMA 3G6HA 1GAGA 4A9TA 1V0BA 5AA8A 3D2IA 3CCNA 4JIAA 4OUCA 3SW7A 2VD5A 2J0LA 3QTUA 3UPZA 5FRIA 1NVQA 3QYZA 3UIBA 3LMGA 2QONA 4I24A 3PZEA 3QC4A 3WZKA 3QU0A 3OMVA 3QUEA 3VHKA 4FT9A 4AOJA 5A9UA 5L6PA 4BYIA 2ZFYA 3R04A 2V5QA 2GNFA 4MXOA 1Q61A 3U55A 3LMIA 4I6BA 3CE3A 4BZDA 4XG7A 3SX9A 5HTBA 3KMUA 5E7RA 4ANBA 3VONA 2CNUA 3KCKA 2UVYA 3BCEA 5HNIX 4BDIA 3HL7A 5L2SA 2GPHA 3VS3A 3EZVA 3AC1A 3RWPA 1WMKA 4RZWA 3ZMMA 4DEHA 5CEQA 4CTCA 2ZMDA 4IMYA 3ZCLA 3RZFA 5FXRA 3CIKA 2YIRA 3Q5IA 2V62A 4ZAUA 2X2MA 4FUYA 2FH9A 4OTGA 4P2KA 5CTPA 1UU8A 3VRZA 4DBNA 5M4IA 1ZZ2A 1KE6A 3EB0A 5JFVA 4BI0A 4YJQA 3VAPA 4TYEA 5HG8A 4A06A 1PHKA 4DFLA 2O8YA 5K4IA 3WF7A 3NFGB 3EWHA 5HNGA 4J8NA 5AR3A 4L3PA 4FSTA 5HTCA 3IDPA 1I09A 4FEXA 5FXSA 3EOCA 2I40A 4LRMA 4EK8A 4F9CA 3R22A 4QTEA 4F7NA 3OY3A 3FLNC 4U42A 1W84A 5IEYA 2YAKA 4ALVA 2WMQA 3W2OA 1E1VA 1QL6A 4HPTE 3BI6A 4B7TA 4EOQA 3A7JA 3DS6A 3FLYA 4CT2A 3JPVA 5AR8A 3E92A 1NVRA 5HIEA 5J1WA 3R2YA 2DUVA 4YR8A 2EUFB 5AR5A 4AW2A 3ZM9A 4FSUA 2C30A 5FD2A 5DFPA 4E5BA 3PVUA 4O7TA 4GVJA 1X8BA 2YIYA 4IFCA 4FI1A 3N4TA 5DR9A 4HOKA 3TKIA 2ZV8A 4ZK5A 4FOBA 3GCSA 3TXOA 4DTKA 5BVOA 4DHIB 1OIUA 2VTSA 3F5UA 3FE3A 5BNJA 1BI7A 4I6LA 1FGKA 3C4CA 3HV3A 3N51A 3R21A 1YWRA 4WUAA 4ACHA 4WSQA 1OPLA 5DT0A 1R78A 3R02A 1YI3A 4QMSA 2W17A 1KUTA 3KY2A 3UVPA 4FTIA 3CJGA 3W33A 3A7GA 3UYSA 2W1CA 3G90X 3LOKA 1REJA 4O7RA 3OZ6A 4QP9A 4JVGA 4QYGA 2F2CB 1Q8ZA 5B2MA 2JKQA 1H1QA 3G6GA 1VYWA 4KAOA 4RJ3A 4KIOA 4ERWA 2UVZA 4MYGA 3DAEA 1H26A 2X1NA 4XOZA 2OXDA 4DA5A 1ZYSA 5HBEA 1YW2A 2X8IA 3HRFA 4H1JA 4X6RA 4YHFA 3VS2A 1PMUA 3MJ1A 4NKAA 4RIXB 5M4UA 3UC4A 5DOSA 2WU7A 3I60A 4IWPA 3F3WA 4L42A 4LUDA 4LMUA 2NYAA 3TG1A 5BVDA 3HNGA 4DH8A 2XNBA 3BHVA 3U6HA 2GU8A 2PVYA 3R71A 3DPKA 4NH1A 3NVKI 3PA3A 2WTJA 4R7IA 4N0SA 1CTPE 2XZSA 2AC5A 2YIWA 4HPUE 4LRKA 5KZIA 4D5KA 1ERKA 1NXKA 2QR8A 3R01A 4U45A 5FM2A 5KMKA 3H4JA 3QCQA 5CNNA 3D4QA 4LV8A 5DRBA 3QZFA 5DN3A 2ETKA 3ZXTA 1GJOA 4Y85A 1KSWA 3RI1A 3W0MA 1V0PA 2CLQA 4J99A 4ZLOA 3UVRA 4DH5A 3DQXA 5HKMA 3ENMA 4BYJA 5HE1A 3LFDA 4O4DA 2OKRA 4RQKA 4ZTNA 2XEYA 3QAME 4G6NA 4H39A 4CG9A 2REIA 2HK5A 3F3UA 4BTFA 3T9IA 4O2PA 4BCGA 2WGJA 4C4GA 2O65A 4EC8A 4X0MA 3VRYA 4I22A 3ZZWA 5EM5A 4XNEA 3ETAA 5L4QA 2ZM3A 3HX4A 1S9JA 2WEVA 1J7LA 4DEAA 3DK6A 3HEGA 3OW4A 4PTCA 5BQ0A 4FTCA 3LLAA 3MI9A 1ZOHA 5HI2A 2J5FA 5CSWA 1Z57A 2JKOA 3HVCA 4J1RA 5D12A 3ZO4A 3AD5A 4U6RA 3BQCA 4O0XA 3EFLA 5HZNA 5EQPA 1PMEA 4HYIA 4DCAA 2X8DA 3CD8A 4RMZA 4ZY4A 2X6DA 3UO4A 4E1ZA 2QU6A 5HU9A 5J9LA 3W0SA 4Q2AA 4AW5A 4LUEA 5J1VA 2UUEA 4QMNA 5E8ZA 1OECA 1WBWA 1UNLA 2EB2A 1CKPA 3ZEWA 3GC9A 3QQUA 3TKUA 5TKDA 2O2UA 3W8LA 3C50A 1JKKA 5C03A 3TEIA 2XKEA 4ZTHA 2G1TA 4BCQA 4DEBA 4RWKA 4CFUA 4IM0A 1F5QA 3TI1A 1OUKA 1OVEA 5AP0A 2V55A 3Q2JA 4ZS0A 5BVNA 2RL5A 4X21A 5L8LA 3FI8A 3OG7A 3LFNA 5ANEA 3H0ZA 1KE8A 5FEEA 3VWAA 3UYTA 1IAHA 1L8TA 1ZOEA 2J7TA 2CGVA 3QHWA 4V0GB 3HRBA 4AGWA 4CCUA 5BX0A 3QCSA 3GI3A 3A61A 4RWLA 3NUUA 4YZNA 1ZMVA 3I7BA 3F2AA 3P78A 5C4LA 2GNHA 4FNZA 4GK2A 1DS5A 1J7UA 2PVLA 1XHAA 4I5PA 3QTIA 1J1CA 2Y9QA 3Q4UA 2R2PA 4ZY5A 2WIPA 1BMKA 2WOUA 2OK1A 3BHTA 3R2BA 2YM8A 3F5GA 3LCOA 3V04A 2C6LA 2J90A 1DI8A 4RFZA 2GMXA 3N4VA 4PQNA 2BAJA 2C1AA 2CCHA 4E7WA 2HWOA 2JKKA 4JNWA 4O0VA 3R1SA 4FKIA 4O21A 4OT5A 1P5EA 5LMAA 3TMOA 3I0OA 2PZ5A 3G15A 4LDTA 3TJDA 1JAMA 4ZXTA 1ZAOA 4JG7A 3L1SA 4ZZMA 3FQEA 4HYUA 3RJCA 3MV5A 4ZTMA 4NKSA 5CS6A 5JFXA 2Z7LA 3LQ3A 3WF9A 3SRVB 4BDDA 4IIRA 3QKLA 3ZUVA 4EJ7A 3KK9A 3FZOA 5FBNC 2CN8A 4ZZOA 2W7XA 3GC0A 5FEDA 4QMQA 4GH2A 3QTWA 3A4PA 3C4EA 4AN3A 3L9PA 4IDTA 3RK5A 3BL9A 5DG5A 4DHZA 4FKRA 4YLLA 1OMWA 1SVEA 1SNUA 1SZMA 4B8MA 1FMOE 3ENHA 4E6DA 4BCKA 3BYVA 2B1PA 4FZFB 3HV7A 4L7SA 1DAYA 5EOLA 3E8NA 4M12A 4ZTQA 3JY9A 3PG1A 3A60A 1ZYJA 4GUEA 5JQ5A 3VUGA 4E4LA 4QEBA 1AGWA 2PTKA 3KVWA 2WMRA 5IA2A 5AUVA 5IQAA 4GG7A 1SM2A 3TNIA 5AM6A 4CMTA 4YJNA 3JUHA 1ZY5A 3LXPA 3ODZX 1KWPA 3FDNA 3LVPA 2XB7A 3OOGA 4O6LA 3COMA 2BPMA 3UQFA 2X0PA 4RG0A 3EQIA 1VYZA 4NTSA 2QLQA 2BTSA 3VQHA 4YSJA 1H24A 5CXHA 2G01A 4R5YA 4PMMA 3SKCA 3BEGA 3C7QA 4MNEB 3ET7A 4U81A 3EN6A 3GU8A 3MA3A 4FZ7A 5ITAA 3PJCA 2ZM1A 3L8VA 5CF8A 1MRUA 3O2MA 2C6IA 4ANLA 3NSZA 4DHJA 4RA5A 4IDVA 3FXZA 4FEVA 3DJ7A 3R9OA 2QVSE 4U44A 3HGKA 2QG5A 3UIUA 5IISA 4R7BA 1NW1A 1R3CA 2FSTX 2CMWA 4IX5A 1AD5A 1K9AA 1ND4A 3DDPA 5GINE 2Z8CA 4NCTA 1YWNA 4NFNA 2JIVA 3PRIA 3KB7A 5I3RA 4AAAA 1IAJA 5E4HA 4UV0A 3KRRA 3DK7A 4BIEA 5IH4A 4WD5A 2OLCA 3IOKA 4YUQA 2VWUA 4DFXE 3DBDA 2OICA 4WNOA 4IZYA 2OO8X 3UOLA 1U54B 4BJJB 3BHHA 3KIOC 4QMXA 1E1XA 2E9UA 3CLYA 1T45A 4FIGA 4JBQA 4QYFA 2X39A 3AMBA 4FSRA 5CYIA 3QUPA 4RJ7A 5AFVA 3FZPA 4AG8A 3T8OA 4DFYA 4FKVA 1OL7A 5LVNA 4WOVA 2ITZA 3A7FA 2ZDTA 3C4ZA 4KINA 4UWYA 5KMMA 2IZRA 4AQCA 2Z7QA 2ZJWA 4ZSLA 3ZLSA 2VTQA 1JBPE 2ETRA 1UNGA 1XH8A 3BE2A 3DGKA 4I5HA 4YC8A 5DWRA 3EKKA 4LM5A 3FZTA 2YACA 3VUMA 2VTOA 5IA4A 4QT1A 4O86A 3PE1A 3FL4A 4U8ZA 3PFYA 2J0IA 1DI9A 2J0JA 4V04A 5BYZA 4TTHB 2PULA 1YOMA 4F70A 2QOQA 4DCEA 1LPUA 2QLUA 5BUEA 4W4VA 4BBEA 3VS6A 3QQGA 4BTKA 3OS3A 4KKEA 3WF5A 4HVHA 4BZNA 3KCFA 2UW0A 2QODA 2QI8A 4FTLA 4A4OA 3LJ1A 2O3PA 3L9LA 4AS0A 2VTJA 3PUPA 4FSMA 2C47A 3ZYAA 5CSVA 4GT3A 4AZSA 3UC3A 3ZLWA 4ZTRA 2W1EA 2IW6A 4R3PA 3FEGA 4OTRA 5CEPA 2YHVA 2DWBA 2YERA 2B54A 4FV8A 1TQMA 5IQFA 2YFXA 3G0FA 5L3AA 2WFYA 5HCZA 3PPKA 2UZBA 4HGTA 2GTNA 3AT4A 5KBRA 4WUNA 4GK3A 2C1BA 1R39A 3GCQA 4E20A 3QRKA 3ACKA 4TT7A 4ITIA 4MXZA 5E92A 3R83A 5AIRA 4D1ZA 4EORA 4Z16A 4MAOA 3LFCA 4X2JA 3CC6A 1H25A 4G3DA 2LGCA 2IW9A 2ZB1A 4BHZA 4FL1A 4I1ZA 4F09A 2GHLA 4JJRA 1KOBA 2I0HA 2VTNA 5JT2A 1XH6A 3RGFA 1BKXA 5BV3A 4KSPA 3VULA 5CF6A 2UW3A 1VZOA 4DDGA 4J97A 4IADA 3REPA 3RMFA 4DITA 3PPZA 3Q4TA 4I4FA 4IAYA 3PRFA 3GBZA 4FJVA 4CKIA 4TYGA 4E6QA 3EL8A 3FLWA 3EKNA 3LJ0A 5M4FA 4KBCA 4NIFA 2PMIA 2EXCX 2CGUA 3ZTXA 4FMQA 3KQ7A 3DXQA 3LHJA 4FTMA 4QPAA 3BLHA 5D10A 3DFCB 4YJOA 3F7ZA 3PP1A 5T3QA 3FUPA 4K33A 5D41A 3F66A 4WKQA 4DF3A 3VC4A 4E5WA 3FQSA 4I92A 3S95A 4WO5A 4L52A 4B4LA 4I94A 1JPAA 5DR2A 4HYHA 2BDJA 3EN7A 2JLDA 2YITA 5K3YA 3W16A 1P4FA 4EOLA 2WMAA 3ZSIA 4C3PA 3NYNA 5EI6A 4EH8A 1G8AA 3P4KA 5J7BA 4MX9A 2VN9A 5TO8A 4AA5A 4F6SA 4TXCA 2E9PA 3UQGA 2R3HA 4TW9A 2XK7A 4AE6A 4YJSA 4BCFA 5J5TA 4PDYA 4BWXA 2ITWA 3M2WA 4GCJA 3DU8A 3ZBXA 3ATSA 3ANQA 2X2KA 3D15A 3DTWA 3MY1A 4F7LA 4GMYA 1Q4LA 4G3CA 4YLKA 4LQMA 2YM5A 3DJ6A 2VTLA 4ASZA 4H3QA 5A4QA 2JDTA 1YXUA 4IB0A 4YJVA 2XYNA 4L43A 3RK9A 4MBIA 3QC9A 5M44A 3TJCA 4CFMA 3P0MA 4IAZA 2BR1A 2J6MA 3FL5A 4QPMA 5HD7A 3TZ8A 3I6UA 3G9NA 4PDPA 2JC6A 4RGJA 2J50A 4ZP5A 1PXPA 2WTIA 4C35A 5K5XA 4II5A 4XG9A 3TUBA 4BDKA 2OGVA 2YEXA 4EH2A 4GKHA 1YDTE 1H27A 4G3GA 4EK6A 4K0YA 4IJ9A 2VWWA 2RFDA 3V6SA 4DLJA 2WB8A 2XIXA 3V5WA 2R4BA 4DEEA 3IW4A 3FMHA 2GHMA 4WA9A 3TYKA 4GJ2A 4C38A 3TNQB 5A14A 1BUHA 3CEKA 4FE2A 3D7ZA 5JRSA 5K5NA 5CAOA 1MUOA 4IAFA 4J71A 4X3FA 4YTIA 2X7GA 3AC3A 2E2BA 4ACCA 4JBOA 3KULA 5J8IA 3FBVA 3FYKX 3O8PA 2C4GA 4BCNA 4G16A 5F4NA 3NWWA 4QYEA 5E91A 3MVHA 1R1WA 3V51A 2FYSA 2UW9A 5HG5A 5LMBA 3MESA 2R3RA 2VTAA 5AP7A 3VBXA 3I6WA 5M09A 4DG2E 3Q6WA 2A1AB 2XJ2A 4DH3A 3WILA 3AKKA 5IA0A 4GL9A 3O5AA 4NYEA 4BB4A 3WI6A 3GCUA 3TZ9A 3LFSA 3WF8A 4JLCA 2V7AA 1W83A 4O0SA 3ALNA 3CQUA 3HV5A 1ZYLA 3QQHA 4DHFA 4UEUA 5CAPA 3UO5A 3OWKA 3OT3A 4RJ4A 5B0XA 2DS1A 3DLSA 3FLZA 4USDA 5HORA 1Q24A 4MH7A 1XO2B 4QP6A 1BX6A 4FTOA 1CKJA 5IQDA 3ZEPA 2VWXA 4YZCA 4CZTA 3FMNA 4JRVA 2VTIA 1O6YA 3ROYA 5D11A 2QOLA 4Y83A 4BICA 5AP5A 1REKA 5HO6A 1P4OA 4YTFA 3JS2A 5LOHA 3DZOA 3FXWA 2GSFA 3UP7A 3R7GA 4EOOA 1OI9A 5BVWA 3T3VA 4U3ZA 1LEWA 2IEWA 3CTJA 5LJJA 5LWNA 2JDOA 2A27A 3FKOA 1Q99A 2ZDUA 2ITTA 5LVPA 1I44A 4QPSA 3MVLA 4C4FA 4WT6A 4DG0E 4U0IA 4PV0A 3QRUA 1UWHA 2R3KA 3QA0A 4KSQA 5G6VA 3UDTA 4GYIA 4KRDA 4O82A 5FTGA 4DFUA 3GC7A 5HX8A 2ONLC 5ETCA 3RHXA 4TN6A 4X7QA 4Z3VA 3SOCA 2XA4A 1R0PA 2C0OA 4YSMA 3V5JA 2GQRA 4EYMA 1UU3A 2PMOX 3M1SA 3PG3A 4YHJA 2HZ4A 5DI1A 3G5DA 4O96A 4ZIMA 1WBSA 4FICA 2PY3A 2BIYA 3NUNA 3PVBA 4E26A 1NVSA 1CSNA 2V0DA 3GU7A 2WMBA 3DA6A 4FK3A 2ITPA 4BI2A 4IACA 5IH5A 2BKKA 4RJ6A 2I7QA 3NW6A 3I5NA 5DT4A 4YMJA 1JOWB 2OBJA 1V0OA 5AR7A 2C69A 3MH1A 3I7CA 4HZSA 5F20A 4OW8A 3O7LB 3R7OA 5C1QB 5HEZA 4ZLZA 3OWPA 4BN1A 5KX8A 2XM9A 1H8FA 4MQ1A 4QOXA 4DBXA 3R9DA 5GZ8A 4BBFA 5DMZA 2RG6A 5IH6A 5CU3A 3H9FA 1SYKA 5E8SA 3NLBA 4GFMA 3ZRLA 4FF8A 4IAKA 3OOMA 4DFNA 5A4CA 5AWMA 5CVGA 5A54A 3BKBA 4U43A 3MA6A 4MQ2A 4H3PA 2XIZA 1PY5A 2Y4PA 1OBGA 5IG1A 2EB3A 2G2FA 2P0CA 2BFYA 5IQGA 4EH4A 4RJ8A 3HECA 4X2KA 3MPAA 4F65A 4GSBA 2X4FA 1YOLA 4FIIA 3UMWA 4XG2A 5HU3A 3E88A 3GENA 4FTUA 4RT7A 5KCVA 4Y46A 1K2PA 4CNHA