3FLSA

P38 kinase crystal structure in complex with 6-(2,4-difluoro-phenoxy)-2-((r)-2-methanesulfonyl-1-methyl-ethylamino)-8-methyl-8h-pyrido[2,3-d]pyrimidin-7-one
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 110
structure length 343
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flsA01
3GP0A 5IMEA 5JRQA 3FLWA 4U79A 2EB2A 2YCRA 4V0GA 5CSWA 4YHTA 4KSQA 3R9DA 4RJ4A 3COIA 3IW5A 2XIXA 3HV7A 4O7RA 1JBPE 2BKKA 1OL7A 3F7WA 4IM2A 1XH4A 4PP9A 4H3BA 3O17A 3QD4A 3UC4A 4HOKA 4TTHB 5LWNA 2JLDA 5AR4A 3D2IA 5F94A 4IAYA 4W9WA 4B9DA 3V8WA 5E1EA 2GMXA 5AAGA 2B7AA 5IPJA 3DKGA 2PTKA 4JDIA 3VUHA 4U43A 4X6QC 3QTIA 2HYYA 3WBLA 3ZYAA 4DFNA 2ITVA 3K2LA 3U54A 1S9IA 3GC9A 1BI7A 2QOLA 3FKNA 3QCQA 3ORNA 3RMFA 2YISA 4JQ8A 2XEZA 4GUBA 5GJFA 1UKHA 2WTCA 4AU8A 1H0VA 4CCUA 2HWOA 2FYSA 4MAOA 3ZO3A 5KO1A 3NUYA 4AE6A 4EQUA 3TUDA 4K11A 4KKEA 3HZTA 1LEZA 3AC8A 4UMQA 2ZM1A 5C27A 2V62A 1O6KA 2QD9A 3NNVA 4CNHA 4TN6A 4IWDA 3L8XA 4DEBA 4FTKA 2YIWA 3UG2A 3LM5A 3PWDA 2XVDA 3EQCA 3PXKA 4FTOA 1OPKA 3NYXA 4RQVA 4V05A 5CVGA 3VS2A 3OBGA 4AZTA 3N4VA 4GKHA 4PTEA 3MN3A 1REKA 5AV2A 4ASXA 3HMIA 5ANDA 4MXYA 2CNUA 4BCGA 2R4BA 3NAYA 3V5PA 3RWPA 4RC3A 4EBVA 5AV0A 4UALA 4FZ6A 1YI6A 5AP0A 4APPA 4C4EA 3BEGA 5EQPA 1PF8A 5HU3A 4AF3A 3Q4TA 4H3QA 3OF0A 2P2IA 2C6OA 2X39A 4YLJA 4YO4A 4GKIA 2X6EA 2BALA 3A62A 3A7GA 3G90X 3P1AA 4GVAA 4LL5A 4X3JA 3RZBA 4ZZOA 4L7SA 1PKGA 3QKMA 3S00A 4EKLA 5C03A 1JKKA 3BHTA 1B38A 5LVLA 1H27A 4LFIA 4GT3A 2GTNA 3UIBA 5DR6A 3DJ5A 3E8CA 4XH6A 4IJPA 4K8AA 4DEHA 3GU8A 5EK7A 4PY1A 2W99B 5CF4A 4RVLA 4FG7A 2HZIA 4D0XA 2UW8A 1U59A 4D55A 4BWKA 4C2WA 2CKOA 2Z2WA 2UW3A 4EH2A 4AZFA 4QYHA 3ZLWA 2VTNA 3MW1A 3F66A 2W1HA 3BYUA 3QL8A 3UNKA 2WMRA 5L6OA 3IGGA 5I9VA 3I6UA 3LCOA 4DGLC 4BCIA 3PJ1A 2Z7RA 5GIOE 3GGFA 1UU8A 2OZAA 3PYYA 4Y83A 3MPMA 4FV1A 1CTPE 2G1TA 3BQRA 4X6RA 1Q99A 3RK7A 1NVRA 4U45A 5JQ5A 4FT7A 4FZAB 4RVTA 4M69A 4IB5A 1YVJA 1PXNA 2Z8CA 4GYGA 4A4XA 3BKBA 1NVSA 5BVFA 4BF2A 5I9XA 3F5PA 3F82A 3UGCA 3FI4A 4PDPA 1TQIA 4QT1A 5E91A 3IDPA 3ORKA 2W0JA 2Z7SA 5L8KA 1WVWA 3ZLYA 5D11A 5BMMA 4QQCA 4E6QA 3A60A 5TOZA 3R8LA 4ZLOA 4TWOA 3GC0A 3ORLA 4FIGA 4FL3A 4W4VA 3HMMA 4Y73A 1ND4A 4NJDA 4L45A 3VN9A 3OY1A 3FLNC 2QU5A 2X4FA 2O2UA 3JVRA 4IX6A 2WHBA 3GVUA 3V04A 3W10A 5DLSA 3SRVA 3R7IA 3FQHA 3LFBA 2WQEA 2X6DA 3QU0A 3FMHA 4QP4A 2JFLA 3IOPA 3WZKA 3OXTA 2I7QA 3DZQA 3GT8A 4BBMA 4CFVA 4DE4A 5GINE 3G6HA 3WILA 2ZM4A 3PRIA 3VQHA 5AIRA 3ENMA 3OXZA 2C6LA 3EKNA 5D7VA 3VBTA 5LWMA 1ERKA 3PJ3A 3W32A 5FXRA 4FK6A 5DR9A 4FKJA 4XHKB 3G9LX 4QMQA 3M42A 4OTGA 4YJNA 3FMDA 5EYCA 2WD1A 1BYGA 5CEPA 3CQWA 5LVOA 2VX1A 4ZSEA 2YM3A 3E63A 4J1RA 4DEAA 2E9VA 3W1FA 3VULA 3V6RA 2XRUA 3H4JA 4AGUA 3NAXA 1FQ1B 1Q4LA 1VYWA 4EH7A 3IPHA 1PXOA 3TNQB 4CKJA 1DAYA 5HI2A 2VTLA 3R28A 1T46A 3SXFA 4ANMA 4BDKA 4O0RA 4F6SA 5IQDA 3NNUA 5AP5A 2QC6A 4FIJA 2WGJA 5J95A 4FNZA 2IVTA 4AAAA 4YTHA 4IADA 5ITAA 3PXYA 1UWHA 5CSVA 3BGZA 4C4FA 3A99A 4RRVA 4PF4A 4CXAA 1YHSA 3QRIA 3QZGA 1BI8A 2FA2A 3EN7A 3GB2A 2QLQA 2XM8A 3DB6A 4DEDA 4HGEA 4KIOA 4RC2A 4O1PA 4XS2A 2W17A 4ZMEA 1JQHA 3F88A 4RJ7A 4BY9E 2Z7QA 4FX3A 1BL6A 3FJQE 2HZ4A 3TJCA 5HQ0A 3EQIA 3ITZA 1YWRA 1VJYA 3Q5ZA 4FOBA 2W1DA 3WYXA 4MWIA 5BYZA 4R1VA 1TQPA 5L8JA 2ESMA 4U6RA 2ZDTA 5A4TA 4WUNA 4GJ2A 5KZIA 3VS1A 4AGCA 4RLKA 3R2BA 4FSNA 3O50A 3PY0A 3SG9A 2X8IA 3Q9WA 4XUFA 2C1BA 5HD7A 4D0WA 4XBUA 2QO7A 5GHVA 3F3VA 4JR3A 3FSKA 3KXHA 4EOKA 2XIZA 5HLWA 4HZSA 5ANEA 5M09A 4E73A 4C37A 3EN9A 2YEXA 3AC1A 3BHYA 3U9NA 2WIHA 3JUHA 1XBBA 4KINA 3TTIA 2YWVA 3OHTA 2JDVA 4C8BA 4FSMA 3DFAA 1V0BA 4YPSA 3N4TA 4XEYA 5JZJA 3MB6A 3AQVA 3S3IA 5KMNA 4AW2A 3SG8A 4FKUA 4FSQA 4O0XA 3SOAA 2ZV8A 3DBCA 3CPCA 4DT9A 2DQ7X 4RA4A 5HORA 3VC4A 5M4CA 4NW6A 4YBKA 2YWPA 1JLUE 2UZOA 4ITHA 4YHFA 4JQEA 3PVGA 3GC7A 4QP6A 1SZMA 2QR8A 2UZWE 4U40A 4EOPA 4PP7A 2PPQA 3AG9A 3FI3A 4FK3A 4NTSA 2V5QA 3QTUA 4F0IA 5A4LA 4YMJA 4F64A 5CU4A 4DTBA 4DA5A 3FZPA 4TYIA 5T68A 4B6LA 4DTKA 3UMXA 4O2ZA 3ATSA 2JKKA 4CFMA 4WBBB 3LZBA 4WG5A 4R1YA 4EOSA 2OU7A 4EC8A 2Y4PA 4APCA 2Y0AA 4CKRA 3TM0A 4I6QA 4D4SA 3UNJA 4UV0A 4WG3A 3KCKA 1YOMA 4OTHA 4ZZNA 3GU5A 4CT1A 2YCQA 4NKAA 4D2TA 2BZKB 4QQJA 5DN3A 4PV0A 4JOAA 5LARA 2JITA 4YLKA 5L3AA 2QOHA 1YWVA 3KN6A 2XA4A 4ANBA 5G1XA 2YM6A 1YOLA 2CPKE 4ACDA 4C57A 4EH4A 3G0EA 4PMSA 3FPMA 4KWPA 4YSJA 3KXNA 3KVWA 5HTBA 1ZWSA 5L6PA 4RWIA 4GL9A 3SA0A 5LOHA 3MTLA 2BR1A 3CGOA 4CFFA 4I0TA 3V51A 4F7NA 4ZLZA 5FQDC 3ZO4A 3COKA 4F7LA 1QPCA 1S9JA 1L3RE 3ZUVA 3GOKA 3UQCA 4BFMA 4CCBA 1J7IA 4ANSA 3IW6A 3OUNB 2WMAA 3R6XA 1NT2A 1YXTA 3GOPA 3MVMA 4AS0A 3E62A 4P5QA 2VX3A 3MY0A 1M2PA 2ERKA 3RGFA 4DLJA 4QMSA 5I0BA 3NIZA 1MQ4A 4I6BA 1H1PA 4TYHA 1YDRE 1CDKA 2CGVA 3WI6A 2W9ZB 3E7OA 3PUPA 5IQHA 3NZ0A 3LFEA 2W4JA 4G5JA 3HGKA 1UVRA 4J96A 5DPVA 3M11A 3B8RA 4UMTA 2CCIA 5GNKA 3QAME 2ZM3A 4WIHA 3F2NA 3DAEA 3UIXA 3UVRA 5I3OA 5BUIA 4TW9A 5FRIA 5BMSA 5LXMA 4ENXA 2RKUA 3IG7A 4PWNA 2CGXA 4BZNA 4YJRA 1AQ1A 1IAJA 5HESA 4C4JA 4KABA 4X0MA 5KBQA 1NW1A 1UWJA 4O83A 4BIBA 2WQNA 3R83A 4BKJA 4DGMA 2X2KA 3ZM4A 3KREA 4ASEA 4P5ZA 2XK4A 4KBKA 5IEYA 4A9TA 4BBEA 4GJ3A 4IZYA 2GFCA 4XG7A 3VVHA 4YURA 4Z7GA 4N4SA 2VTJA 4BIDA 5DOSA 2ITTA 5HZNA 2UW7A 2P55A 2FGIA 5EKOA 3QFVA 2NNWB 4F9WA 4YNOA 3HUBA 3QD0A 3KF4A 4YZBA 3R9NA 4FG8A 3F7ZA 2OICA 2OF4A 4GK3A 1VR2A 3VS5A 2J0MB 2QKRA 3OROA 3PIYA 4DH3A 3R8ZA 4I5PA 4QMLA 2W5BA 3PE1A 3HRFA 5AJQA 1WBPA 3FSFA 4C02A 3QBNA 1OB3A 3V8TA 1OIRA 3Q2JA 2A27A 3ODYX 3KMMA 4I6FA 2PVKA 4I5MA 4GFOA 2BKZA 4NJ3A 4X21A 5DIAA 5E8TA 1SYKA 4D2PA 1W98A 3PVUA 3QC9A 4BB4A 1Q97A 5KKRB 4ZTMA 1IAHA 2XIYA 3UNZA 2B9HA 3I60A 4NL0A 4F9AA 4MH7A 4KS7A 2HAKA 4PX6A 2VTSA 3JXWA 5HLNA 4CMOA 3CKWA 3LJ2A 3QRJA 4YC8A 4HNIA 5JFWA 3OCSA 4UWBA 3I7CA 2YERA 1UA2A 3OT8A 2RIOA 2O65A 3K3IA 3LCDA 3EL7A 3WIKA 4HCVA 3WZEA 2G15A 3TT0A 4W8DA 3C4XA 1SVHA 4G3EA 4D4VA 1Q8UA 3HVCA 1FVTA 1OL1A 2AC3A 3AMBA 3IONA 3L8PA 4F7SA 4OAUC 2FB8A 2YIRA 3ULZA 4DH5A 1B6CB 3UPXA 4F6UA 5J5SA 3AGMA 2GPHA 4I0RA 3ORTA 3GCPA 2EXCX 3AC3A 3FZOA 3NYNA 3VHEA 2PSQA 3Q5IA 4ZJIA 5M4UA 4FNYA 2GNIA 3LCSA 4HCUA 2CLXA 3KMUA 3BYMA 4O0WA 3ZDIA 5AR8A 4CYJA 4NZWB 4TYJA 2CCHA 5IA5A 3TIYA 3KRWA 4BCNA 4QO9A 2IW8A 2JIUA 2C47A 2WQOA 4IC8A 4WRGA 5TT7A 4IAFA 4B99A 2A4LA 5LMKA 2R3KA 1YOJA 4EH9A 5I5ZA 3CS9A 5IEVA 2VWUA 3UZPA 1OPJA 3P7AA 4MTAA 2BAKA 5CI7A 4GYIA 1PXMA 3DKCA 3CTHA 2PUUA 4KB8A 2O0UA 3HDMA 3ACKA 3F3WA 2QOQA 4MNEB 2PVYA 5EYDA 2XBAA 3AC2A 3FKLA 5IQFA 5HEZA 3DLZA 4QNYA 4FV8A 4XYFA 2YIXA 3HAMA 2IWIA 2UZEA 1XH8A 4E93A 5J1VA 4I21A 3TZMA 4BGQA 4PUZA 5TO8A 4CD0A 2O3PA 3IGOA 4XOYA 1WZYA 5BVEA 4L7FA 3PY3A 3OW3A 5DRDA 3QQFA 5J7BA 4I4EA 1V1KA 5LMKC 5B2LA 1ZYLA 4FVPA 3QCXA 4PDOA 4JRNA 2R3GA 3FZ1A 4NM5A 4BDEA 3R7GA 1MUOA 3EFJA 3C13A 5GJGA 2PYWA 3W2SA 4OBPA 2JBOA 3A2CA 3HRCA 3MH1A 3O8PA 2R3MA 4UB7A 5K4JA 3Q52A 4HVSA 2QNJA 4O38A 5BX0A 4YUQA 1ZYJA 5C8KA 4QMMA 3G33A 1CMKE 2OBJA 3KVXA 4O6LA 3IECA 3SXSA 3FXZA 1RE8A 1WFCA 4RIWA 4ITJA 3EB0A 1KOBA 4BVUA 3E87A 5IH6A 3CEKA 2C4GA 3UC3A 3KXGA 4BIEA 3FI2A 4M15A 3VW6A 4FSTA 3D14A 3RPSA 5KMLA 1HOWA 1KE5A 4AN2A 1YRPA 2JIVA 4LV5A 2VAGA 3U87A 5IUIA 4RIOA 5HG5A 2ONLC 4M8TA 4IWQA 3MA6A 4P7EA 2LAVA 3R04A 5AP4A 5HE1A 3BIZA 2PUNA 3D5WA 2Y9QA 2WTIA 3HV6A 4G6LA 4U0IA 4IVBA 3WZJA 1IA8A 5KHWA 2OW3A 4M66A 2OIQA 1URWA 2VO0A 3FBVA 5AR3A 4A06A 2YLFA 2VTTA 4O82A 3P4KA 2B9FA 4CZTA 2XJ2A 3ZSGA 3LAUA 4GRBA 3R1NA 2R3PA 3U55A 4O7TA 1FINA 2ZAZA 3ZZEA 4CG9A 4X3FC 4F1TA 4OTQA 4FIHA 1G3NA 5IZFA 2ERZE 4H58A 2O5KA 2XUUA 5E9EA 2GQRA 1YHVA 5EW9A 4BCFA 1CKPA 1DI9A 3BEAA 5A14A 2P3GX 2JD5A 3GU7A 3WE8A 4JVGA 5CF5A 2HY0A 1MRYA 1UNGA 2R3NA 3NGAA 3UIMA 4MBIA 3WZUA 4PDYA 4TYEA 3QUEA 4YTFA 1PJKA 4AT4A 5EI2A 5KZ0A 3V5JA 4F09A 1Y91A 3NCZA 3RVGA 1ZLTA 3KXZA 2J51A 3GFWA 4MD8E 4HYSA 1Y6BA 2F7XE 3DV3A 3OVVA 1FVVA 3JS2A 4AT3A 3FMMA 3UPZA 4YC3A 3POOA 4NKSA 1OPLA 2PU8A 2O63A 3T3UA 4BBFA 3RAKA 5E7RA 3GUBA 3GBZA 4ERWA 5FEEA 4FGRA 3RJCA 1YXXA 4O7LA 4TT7A 2OG8A 3DA6A 1OGUA 4QTCA 2VRXA 5E8WA 4CQEA 4I5HA 3BELA 2QG5A 3P78A 4R7HA 2A19B 3EFLA 4EJ7A 4ZZMA 3II5A 4FUYA 4JJRA 5IEXA 2OF2A 4A4LA 2VGOA 3P9JA 4A9RA 4CKIA 3I6WA 4EEVA 1XBAA 4FVQA 2R3QA 5AP6A 3TWJA 3FL5A 1CSNA 1PYEA 4WO5A 3G6GA 4ZP5A 3Q9XA 1Z9XA 3UZRA 4FF8A 3PXZA 3NLBA 3B2WA 1Z5MA 3E3BX 5IUGA 2CSNA 1P5EA 3OEFX 2WOTA 5TR6A 2C5XA 4L3PA 3RKBA 4IAKA 4GVJA 2XJ1A 1QCFA 5JRSA 3O23A 2WTKB 5JKGA 5IH4A 4QYFA 4MF1A 5EDPA 5LMAA 4AXAA 4J7BA 1H1RA 4BTMA 4FV2A 4Z55A 3FYJX 3L8VA 4V01A 2ETMA 5C8NA 2GHGA 2XP2A 1HCKA 2AUHA 4FI1A 5FLFA 4F7JA 5AA9A 4Z3VA 1WVXA 4G31A 2YIYA 3VUMA 4GK2A 4PMMA 3BV2A 1CM8A 4IB3A 4J8MA 3LJ1A 3OG7A 5BPYA 4IEBA 3PIXA 3BPRA 4UXQA 2C5OA 3EKKA 4PTCA 2YM5A 3C0IA 3AC5A 1R78A 3LCKA 3DDPA 5HG7A 1PW2A 4Y5QA 3EQPA 3OP5A 1UNLA 4EYMA 5C01A 1CKIA 2R3OA 3DB8A 1FOTA 3KY2A 2VTQA 2B55A 2RFNA 4HYHA 2J0JA 4UZDA 3BYSA 4BRXA 4ZTRA 2QOKA 3RAWA 2OK1A 4FOCA 3HYHA 4G6NA 3HL7A 1JSUA 3D7TA 4DYMA 1LUFA 4E6AA 5K5XA 3LKMA 4WNPA 3KKVA 3R7EA 4AW5A 3OWLA 3DZOA 4OR5A 2C5NA 4I24A 2OFUA 3KL8A 2IZUA 2XRWA 3O51A 3ODZX 3TKHA 4DCEA 3ZC6A 3PXQA 4QPAA 3GC8A 4IVAA 4ARKA 2NRUA 4NFMA 4ANNA 3DT1A 2PZIA 4E5WA 5IA3A 4FT5A 2BFYA 3VWAA 3TNWA 3UODA 2BMCA 2LGCA 5BUEA 4XP2A 4QPSA 4C2VA 2YAKA 4JR7A 3GCQA 4TWPA 1OM1A 4YC6A 2C5VA 5HE2A 3UO6A 4Z7HA 3MI9A 4BDAA 2B54A 3UDBA 1O9UA 4F9CA 5L2SA 2BPMA 3RPVA 3CD3A 4LRKA 2JFMA 2C68A 5BVDA 5L2IA 3O71A 3FZTA 3KEXA 3WF9A 4UN0C 4MNEA 5B2KA 2QOCA 5AIKA 3CTQA 3MESA 5JQ8A 4OTPA 4CRLA 3QD3A 5CNNA 3ZHPC 4EJNA 2R0UA 3RTPA 1PXPA 3HMPA 1K3AA 3QGYA 2UZUE 3PZHA 5FDPA 4RLLA 3Q2MA 5JGBA 1OBGA 4ZJVA 2PY3A 4ZIMA 3A4OX 3DXNA 4MKCA 4N57A 5DGZA 3OD6X 3TKIA 1ZZLA 3UOKA 3R8UA 5J79A 3B8QA 4TWCA 5K5NA 4P4CA 3QLFA 4HPUE 3WF6A 4KIPA 3FXXA 4QD6A 3QYWA 2RG6A 3VUIA 4D2VA 4X2FA 4ZTQA 3EYGA 5KX8A 3ZCLA 4FG9A 3CKXA 1ZYDA 3ORZA 1GZ8A 2YA9A 4GT4A 4USDA 5ETFA 3T8OA 3VUDA 4XJ0A 4G3FA 3EOCA 3Q4ZA 1Q62A 3R7YA 3VW8A 2J0LA 4B8LA 5H2UA 3G0FA 3CY2A 5EFQA 3FKOA 2JEDA 3FLYA 3G2FA 3VS6A 4LOOA 1VZOA 4V04A 4HPTE 2FH9A 4QQ5A 5DNRA 3PJ8A 4AOJA 4BCHA 4FV3A 1SVGA 5CS6A 4AACA 4B7TA 4D9UA 4F9YA 5AUXA 3SVVA 2PVFA 2W5AA 1YQJA 5FTOA 4J71A 5DH3A 3HNGA 3ROYA 4X2NA 5M06A 5E8SA 4TYHB 5H3QA 4ANQA 5IH5A 5L2WA 3O7LD 4ANLA 1QPEA 2IVSA 4FTLA 2OFVA 2ZOQA 4EK8A 2R3HA 2YABA 1H8FA 4LYNA 3WYYA 4NWMA 5AUZA 4CYIA 2IG7A 1UU7A 4I3ZA 4AG8A 2Y6MA 5DMZA 1O6LA 4HZRA 4PDSA 2ZDUA 3VRZA 4O86A 1TQMA 2C6MA 3CJGA 4YTIA 1KUTA 3RZFA 4P90A 2XS0A 3T9IA 4F1OA 5CT0A 5CSXA 3TI1A 4EH3A 3F3UA 3BHHA 3ERKA 5EW3A 4BDJA 1XR1A 3COMA 3GQLA 4RIXB 4Y5HA 4F9BA 4L53A 4GS6A 3QWJA 3BGQA 4BWXA 3FY2A 5CAVA 2DWBA 4I6HA 1H08A 5DHJA 1SVEA 4XG8A 1YWNA 2XNPA 3OTUA 4YGAA 4N0SA 4LG4A 4MWHA 4L6QA 4M12A 4CZYB 4K2RA 2Y8OA 1XH9A 3QQLA 2QKWB 4DEGA 5HU9A 1A48A 3OBJA 3EQDA 3P79A 5AX3A 1PMVA 4FKOA 4EZ3A 4JX7A 4QP3A 2QVSE 3QHWA 4CSVA 5TKDA 2HXQA 2ZVAA 2E9OA 2PMNX 5CYIA 2R3RA 3U6IA 4IVDA 2E9PA 2OZOA 2X7OA 4MXCA 2XKDA 2XNBA 4KKHA 4NCTA 3PVBA 3QTZA 3V01A 4H05A 4XRLA 2BRHA 5HO7A 2VUWA 2W4KA 3RI1A 4FVRA 3MVJA 1H4LA 1FMKA 2CN8A 2HWPA 3BBTB 2ZMDA 3FQEA 4L68A 5EW8A 3DOGA 5AR5A 4FZDB 1GIHA 2YFXA 4XP3A 1XWSA 2PZYA 4QTDA 4QP8A 4BCJA 2W1ZA 3NVMB 4MK0A 5HIBA 5CY3A 4DGOA 5EHOA 4XG3A 2JDSA 2JGZA 5EHLA 4EORA 2PVLA 5HVKA 4J53A 4II5A 3EWHA 5L8LA 2VZ6A 4X7QA 1PY5A 2UZDA 4ACHA 5A9UA 2VWXA 4NCTC 3UQFA 3MTFA 2C6TA 2JDTA 1IR3A 1AD5A 1DS5A 3GEQA 2J7TA 3O2MA 4RGJA 4U81A 4DG2E 4P2KA 1WBWA 5AM6A 1Q8TA 3P7BA 2YZAA 3LXNA 4L43A 4YJUA 4FV9A 4XV9A 2VV9A 3KCFA 4JT3A 4I23A 1WBTA 4F1MA 4LV8A 2WQMA 3A7HA 5H8EA 5TE0A 5HCYA 3ZRMA 2PMOX 3W16A 4NFNA 1QPJA 5ACBC 3I5NA 4KS8A 3JY0A 2UUEA 5LJJA 2XNOA 4BDCA 3AGLA 3TACA 4E4LA 4ERKA 2RF9A 4BHNA 1BLXA 2GS2A 4K9YA 4CFUA 2FSMX 5J7HA 1OKZA 2ZV2A 5HO6A 4GFMA 4QMXA 5CU6A 5I9WA 5JMSA 4C35A 4TYGA 3NUNA 3VS7A 4ACMA 3TUCA 3HAVA 2W05A 3ATTA 3BQCA 3UVPA 4NT4A 4W8EA 5DT3A 3C4WA 3E3PA 3FC1X 4OT5A 4JIAA 1YI3A 4AZVA 2W1FA 3VIDA 4EUUA 1KE6A 2OH0E 3MH2A 4LUDA 5FUTA 4N6ZA 1QPDA 2XNGA 5EM8A 3FDNA 5IA4A 2UZTA 4RT7A 1J1BA 2GTMA 3JY9A 2E9NA 4U7ZA 3PJCA 5CAOA 2JAMA 3F5UA 3KRRA 3Q9YA 5CSHA 4ACGA 5HICA 4KUJA 2XK6A 4HVDA 2IJMA 2Q0BA 4UX9A 4C34A 2WEVA 2CHLA 3Q04A 4M67A 4FEVA 2BHEA 4FTRA 1FGKA 1M2RA 4TKSA 4TWNA 5IQBA 2WNTA 4U41A 3PE2A 3DKOA 2VO3A 4QRCA 4D5KA 4D4RA 3E8DA 4GU6A 1NY3A 1ZARA 4QP1A 5KMKA 1H1QA 2JAVA 5AUWA 3TNHA 2PUIA 1TVOA 3R7VA 5I4NA 4PTGA 2I40A 1YXSA 4BKZA 4CVAA 2OJGA 3EQBA 3G51A 2YZLA 2A2AA 2B52A 4BKYA 2BRBA 4G2FA 3MFUA 4ZTNA 5JT2A 5IISA 5LVMA 2IW9A 5IQEA 2H34A 1H01A 3D15A 4GG5A 2W5HA 2C6IA 4K6ZA 4RIWB 2GCDA 3LCTA 1GZNA 4PPAA 4YTCA 1PXKA 3AD5A 5D7AA 4C0TA 1TKIA 4K18A 3E7VA 2WMWA 3EIDA 4XLVA 5EDQA 3G9NA 3QQHA 3CQEA 5AP1A 5CU2A 1XJDA 3RAHA 2J5FA 3CSVA 2BDWA 3DAJA 2XNNA 3ORXA 4X2KA 2NO3A 4F63A 1PRYA 4BDFA 4KA3A 2WPAA 4MBJA 4TRLA 3BHVA 4KSPA 5DVRA 3UQGA 4O84A 4FKQA 1XO2B 4G1WA 4AOIA 2CNQA 5C4KA 4X2GA 3CLYA 4XV3A 5M53A 4YJVA 2ETKA 1OECA 2YCFA 3WF5A 4BN1A 3QTXA 4JBOA 4LOPA 2BRGA 4O27B 4KBCA 2H6DA 2PE2A 3QQJA 4G3DA 4AWIA 1YXVA 1BMKA 4RWKA 3F69A 5CVFA 4CMTA 4UZHA 1FBNA 3LXKA 2OXDA 3VBXA 3FHIA 3I7BA 3DGKA 5CU3A 3WOWA 1PXIA 2YACA 4FBXA 4O7ZA 4R78A 3CR0A 3D2KA 4WBOA 2YM7A 5CLPA 3UVQA 2VO7A 3BWFA 2VTAA 1H00A 4IE9A 3PSCA 5CF6A 5DA3A 4BCPA 4O7YA 3MPTA 3DBFA 3JR1A 2YDKA 4IC7A 2XM9A 3ANRA 4E1ZA 3IKAA 3WZDA 3PVWA 3OCGA 1RW8A 3FQSA 4BI1A 4EOMA 3DNEA 4QYEA 5EOLA 1E1XA 4IB0A 3A4PA 4YZCA 5JH6A 2VWWA 4CFNA 4QOXA 3QUDA 1FVRA 2ITUA 1M7NA 4TNBA 2HK5A 1WMKA 3SD0A 3UMWA 5AP3A 1ZAOA 2VWZA 3NWWA 4ZTHA 5KMIA 2VTMA 3TN8A 3PA3A 5FP5A 3NW7A 4I92A 5BVKA 3DY7A 1YDTE 2WMQA 3RNIA 4GMYA 2CGUA 2WXVA 2QHMA 3C1XA 4RIXA 1J7UA 2VGPA 2WB8A 3OT3A 4FTIA 4HGLA 5DBXA 4MF0A 4E20A 5DEYA 3QX2A 5FBNC 1APME 2X81A 2X8DA 5D41A 4EOQA 5ETIA 3ET7A 2YAAA 3KRLA 2R7BA 4A9YA 2I0HA 3UIUA 2BZIB 3TDVA 2WU6A 3KULA 5JFVA 3R02A 4DCAA 3Q4UA 2XK3A 3REPA 1Q8YA 4D9TA 1GOLA 2ITQA 2OJIA 2AYPA 3OW4A 3NUUA 5HNBA 4AN9A 1U4DA 3VUGA 2YIQA 3PG1A 4RX9A 1M2QA 3PPKA 4W4YA 5C9CA 3A8XA 3DCVA 5EM6A 5A46A 5J87A 3VBWA 3FZRA 3I0QA 5EH0A 1M17A 5AP2A 4WG4A 3VS4A 3GI3A 3BLQA 2WTVA 3MFSA 3K54A 4JS8A 4NYEA 4FIEA 4FTQA 4YSMA 3ZS5A 1P14A 4OBQA 3OCBA 4Z9LA 4BDIA 5GIPE 3RNYA 3R71A 3Q32A 3L9MA 4JI9A 3A7JA 4O7SA 3U4WA 3QA8A 2IO6A 3PY1A 5C1QB 3OOGA 3FWQA 2WMTA 5M51A 3D5XA 4FSRA 3LIJA 3TL8A 5CENA 5FDXA 4QMYA 3NUXA 4FSYA 4YU2A 2GNJA 2VX0A 4WD5A 2CJMA 4KRDA 3D7TB 3NSZA 4AZWA 1OUKA 5CT7A 4A9SA 1XBCA 2PWLA 1W7HA 4QNAA 4EQCA 2FUMA 4GW8A 3DKFA 3T9TA 4BI2A 4F65A 4YZ9A 3TJDA 1KE8A 5LVNA 3BZ3A 2WTJA 4GG7A 4D2SA 3SOCA 4L00A 3QXPA 2YM8A 2G01A 3N4UA 4XV1A 2UZBA 2BAJA 5K0KA 2C69A 2XCHA 2XNMA 1IEPA 3LE6A 4IZ5A 4IJ9A 4RX5A 4IFCA 4FZ7A 4DAWA 5HTCA 2QOFA 4O0YA 3RPRA 3AOXA 2WMXA 2YLEA 3PG3A 5HBJA 5I9YA 3F6XA 2P2HA 4IANA 4C4GA 2JIIA 2PVMA 3D5VA 3U6JA 5BQ0A 2J9MA 5HE0A 3PXRA 5KE0A 5KMJA 1MRVA 4RWLA 2UW0A 3FC2A 3FLSA 1G5SA 2XEYA 5DRBA 2OJJA 2BAQA 2DYLA 1H25A 3ZUTA 5DT0A 5I3RA 4CLIA 5I9ZA 3TZ9A 5ICPA 3C5IA 1K9AA 2QOBA 4RMZA 2PZPA 4BZDA 3ZDUA 4Y46A 4XOZA 4USFA 4C3RA 4HYIA 3G15A 1WBNA 1OKVA 3AC4A 3I5ZA 3QGWA 4O22A 5EI6A 4RIYB 2RG5A 2HZ0A 4NW5A 3QLGA 5GZ9A 1KV1A 3FE3A 5CAUA 3W2CA 3FMKA 4IZAA 4YP8A 3ZU7A 5JFSA 4DBXA 4G9RA 4FTMA 5B2MA 5HHWA 2B9IA 5HIDA 1XH5A 2QHNA 2C1AA 3NPCA 4EC9A 4HVGA 5FTGA 1IRKA 3PSDA 5AR2A 4QTEA 4O7VA 3DK3A 3NW5A 3WF8A 3N9XA 3IW4A 3PA5A 3FMNA 1L8TA 3BYVA 2WTWA 2YHVA 3OWPA 4J52A 4ZY6A 3FZSA 4L9IA 4LRMA 3VJOA 1FPUA 2BROA 4B8MA 3SX9A 2IN6A 5CAPA 4NTTA 2VTPA 4FV6A 4U3ZA 4BC6A 2X4ZA 1U5QA 3ZONA 4AFJA 1R0EA 2H96A 2VD5A 3LLAA 3CD8A 3EYHA 3D83A 4RFYA 4OTWA 3KXXA 1XH7A 3ZH8A 2Q0NA 5B0XA 3UG1A 1GY3A 1YKRA 2XJ0A 3IW7A 5HNGA 3VUKA 3DXPA 1URCA 2EVAA 4I5CA 3KQ7A 5CWZA 4FODA 2VTRA 4IBMA 4NUSA 1H28A 1XQZA 4FEQA 4ZEGA 3R7OA 4DTAA 4FC0A 3AMYA 3LXLA 2YN8A 3MWUA 4CG8A 4JBPA 4YO6A 4FKLA 2Q83A 4GFGA 2H9VA 2UZNA 1YXUA 3QRKA 5CU0A 4EHZA 2C5YA 2E2BA 5AA8A 1MRUA 3QUPA 5FM2A 5FTQA 2WMUA 3TZ8A 5M44A 3LFSA 1PHKA 2GS7A 5E8YA 3VRYA 1Q8WA 2Z7LA 3VHKA 3E64A 3MJ1A 4E7WA 4FA2A 4ZMFA 4Q9ZA 2OIBA 2OXYA 3HA6A 1RDQE 2BDFA 4XX9A 3UOHA 3HUCA 4EL9A 1UNHA 4KAOA 3NYVA 4IHPA 3ZSIA 3V8SA 4O91A 2XK7A 3I4BA 3K5UA 3Q6UA 4PPBA 4QYYA 1OIQA 3MGYA 5AM7A 2R0IA 2H8HA 5IA0A 3SKCA 4KNBA 3VNTA 1YHWA 4IWPA 2Y7JA 2GU8A 4I0SA 4H1JA 2ITPA 4JDHA 2OJ9A 4O0TA 2PHKA 4WNKA 4BCKA 2G2FA 4L67A 5F4NA 2DS1A 3MIAA 3O8TA 5FD2A 5KMOA 1MQBA 3NW6A 3FMEA 5TF9A 4NM7A 4WRSA 1I44A 3QTSA 4BZOA 4D5HA 3DK6A 3U51A 4NIFA 4E6CA 1O6YA 4O21A 3RCJA 3KA0A 3O7LB 3BBWA 3C50A 1XKKA 3IK3A 4XP0A 5CNOA 2Z02A 5AV1A 4RJ3A 2Y4IB 4D1SA 3ORMA 1E9HA 3R73A 3LFCA 1PXJA 3VO3A 2WQBA 3D9VA 2CLQA 3ORIA 5A4QA 4M68A 2G2HA 2HXLA 5E92A 5LQFA 3GXLA 5EM5A 4EWQA 5A6OA 5CALA 2QQ7A 4UYAA 4ALWA 3K5VA 4JIKA 3TNPC 2CKQA 2BTSA 2BTRA 5AR7A 2NRYA 1P4FA 1ZYCA 2OJFE 4AGDA 1ZYSA 4R3PA 1JOWB 3HV4A 3U9CA 4EZ7A 5IMXA 5ANJA 4O81A 2QLUA 4CRSA 2X7FA 1HCLA 4DFLA 2EB3A 4GIIA 1NVQA 2ITXA 4HVIA 3BU6A 1GZOA 3DQXA 1Q3WA 2VTIA 2RFSA 5H9BA 4FTJA 4EONA 4AQCA 2AC5A 3D5UA 2G9XA 4L8MA 3ZXTA 2QG7A 4BYIA 5T3QA 3NS9A 2QO2A 4M3QA 1JKLA 4WT6A 5CXZA 5L4QA 3DS6A 2E9UA 3MFRA 4FT0A 5AMNA 5HBHA 1BUHA 1P2AA 3M1SA 3U8WA 4EOIA 3OUKA 2Z60A 1OL2A 4MD9E 4F4PA 5JEBA 2A1AB 3FV8A 2GQSA 3W18A 3SHEA 3BWJA 3PXFA 4G34A 2GNFA 4M97A 3C0GA 5D9HA 4O0UA 4O2PA 3W2OA 2XYNA 1Y57A 2R3IA 2W1EA 3VS3A 2W1GA 4KIKB 2P4IA 1BKXA 3PDTA 2PVJA 1I09A 4G3CA 3CXWA 1U54B 3NYOA 4C4HA 2GHMA 3BU5A 5JSMA 3FLQA 3R1YA 3QXOA 4U8ZA 4JBVA 3R1SA 3KFAA 3VAPA 4EZ5A 2QO9A 5ANKA 1WBOA 4B4LA 4E4MA 4ZTSA 1E1VA 1SMHA 4YBJA 4I41A 3EQFA 4QP7A 3RPOA 3L9NA 4EHVA 2WOUA 2FSTX 2RGPA 3EQHA 3R00A 3R22A 4GV1A 3C4FA 3S1HA 2B0QA 3C4ZA 3UE4A 2OGVA 5CTPA 4L3LA 5FWKK 1JPAA 3GCUA 5FM3A 1GZKA 2HW7A 3LQ5A 5KKRC 5C8MA 4Y72A 3WE4A 4FKTA 5L2QA 2YCSA 5CAQA 3GFEA 3P08A 2HY81 5IQCA 2J2IB 4ANOA 2JDOA 4FSZA 3MH3A 4ALUA 5AUVA 2PULA 3CQUA 4CFWA 4LGHA 4LUEA 5ANGA 4CZUA 1YDSE 1OL6A 4O96A 4LQMA 4ZAUA 3HEGA 4FNWA 3BHUA 3F5XA 2XH5A 4BWPA 4OAVB 1XH6A 3DLSA 4TNDA 4BHZA 2B4SB 5DR2A 3K3JA 3R9OA 2I1MA 3B2TA 5ACKA 5ETCA 3LMHA 5HOAA 3FHRA 4R8QA 1P4OA 3W2PA 1NA7A 3OEZA 2CDZA 3N51A 2YITA 4TY1A 1Q3DA 1ZMWA 5C4LA 4RZVA 4C59A 4UWYA 3H10A 2J6MA 4RSSA 5AADA 2ZV9A 3KN5A 3CGFA 2J50A 3DJ6A 4CTCA 1X8BA 3PPJA 4O7WA 2W96B 2BRNA 2BZJA 3KC3A 3RBWA 5D1JA 2HELA 3FAAA 4RIYA 3LM0A 1JKSA 3BE9A 5LMBA 3ALNA 3E8NA 2PVRA 4PL5A 3QCSA 1SM2A 5M4IA 4D1XA 1GAGA 4FYNA 1BX6A 2ITOA 4AZEA 2UZLA 4H39A 3R8PA 3FPQA 4DBNA 4ACCA 2QR7A 3AT3A 3ZM9A 4QPMA 5KUPA 1NXKA 3C4EA 5CQUA 4UY9A 3C5UA 3TCPA 4HCTA 1OZ1A 1OKWA 3UYSA 2B53A 4O0VA 4I22A 4UMPA 2C30A 4RVKA 5AWMA 4FUXA 5E8ZA 4S33A 1M7QA 3OY3A 4K77A 4MQ1A 4DN5A 5B7VA 2CGWA 4NM0A 3ZZWA 2V7OA 5JZNA 3I79A 4IIRA 2C6KA 2PL0A 1A9UA 2XZSA 4OTIA 3ZRKA 2QI8A 4OTRA 4ASZA 5CI6A 3DK7A 3KK9A 4A9UA 4ASDA 3QZFA 5IA1A 4RFMA 1KWPA 3DPKA 3E93A 1RQQA 5EHYA 5CEIA 1JWHA 4CTBA 2CN5A 5F9EA 5EDRA 3HP2A 4ALVA 5E4HA 3NNXA 1OMWA 3O0GA 4NU1A 1OI9A 2V0DA 2BVAA 4J98A 3SDJA 3MVLA 4CV8A 3BV3A 3LW0A 4DFUA 2A0CX 2UW5A 4Q2AA 2R3JA 5A54A 2PE1A 4DEIA 4H1MA 2F9GA 4S30A 2HENA 3DU8A 4FKIA 3SLSA 2F57A 3BU3A 4XG2A 4TZRA 3ZFXA 3QRUA 3L1SA 4OGRA 3SXRA 5FXQA 3EQRA 3H0YA 4D4YA 4QMWA 4MHAA 2VN9A 4G17A 4F6WA 4KBAA 3SC1A 2EWAA 1AGWA 2IVUA 1R3CA 4IM3A 4S31A 4X2JA 3S4QA 4FTAA 5M4FA 2BFXA 1UU9A 2XF0A 4U9AA 4DFXE 5KCVA 2UW4A 3RALA 3UTOA 3UBDA 5JK3A 2V22A 5LVPA 1OITA 5BVNA 5HVYA 3MDYA 3P5KA 2VTOA 5HX8A 2RFDA 3KULB 4RZWA 2VTHA 3QA0A 4OLIA 2FO0A 3EL8A 2HZNA 2UW9A 3P0MA 2CKPA 3LMIA 3R7UA 1ZOGA 3AT4A 5G6VA 1G8SA 4U97A 3BLHA 3ORPA 3I81A 3O8UA 2WZJA 5HE3A 2WTDA 3VF9A 4AA5A 4BDDA 4E4NA 1UKIA 1LP4A 3QX4A 1ZMVA 4IB1A 4YNEA 3MS9A 4O1OA 3W33A 5AV3A 3ROCA 3JPVA 4DEEA 4OTDA 1OL5A 1OIYA 5HCZA 3AMAA 3R1QA 5AAFA 4IMYA 1IG1A 4Y85A 4AX8A 3QZIA 4D1ZA 1U46A 5K0XA 3DJ7A 3QTQA 2BDJA 4WHZA 2XMYA 4FR4A 3L8SA 5HG9A 1DM2A 3GQIA 3UJGA 4FSWA 2P0CA 4OT6A 2PZ5A 1H07A 3OFMA 3TV7A 5CEKA 3KRXA 3M2WA 1LR4A 4FICA 1SNXA 5DT4A 5H8GA 2Y4IC 4WSQA 5KNJA 3TNIA 3LFFA 3LFDA 2IZSA 4QMPA 3TXOA 3HX4A 2WMBA 4FV7A 4MYGA 1Z57A 4J8NA 5IQGA 1W84A 4HNFA 5D12A 1LPUA 2ZB0A 3NDMA 3MV5A 4EH8A 1VYZA 5FG8A 3FEGA 4R77A 2Y6OA 3I1AA 4FYOA 5CVHA 3ZTXA 3D7ZA 3PWYA 3ANQA 4AUAA 3ZXZA 2W4OA 4DGNA 3H0ZA 4XG4A 2PVHA 3P23A 4C36A 1M14A 4USEA 3ULIA 1H0WA 1F3MC 5AEPA 4DFZE 4LRJA 5BNJA 3LXPA 3MPAA 4FSUA 4KIKA 3R9HA 2JKMA 3W55A 2IZRA 2X2LA 4KKGA 4R7IA 4BTKA 4ORKA 4K33A 1U54A 5EI8A 1R1WA 5CASA 2X8EA 2WKMA 3FUPA 3F3TA 3KGAA 4W4WA 4DITA 3NEWA 1QMZA 5AFVA 4QMZA 4MEDA 2PMLX 2VWBA 4PNKA 2OKRA 2WTKC 3OS3A 2CNVA 4EWHA 5GZAA 3A7FA 3NIEA 3FYKX 4IW0A 3H30A 4IFGA 5J8IA 2XIRA 3BE2A 5BUJA 2I0VA 3HECA 3MFTA 5EYMA 3NUPA 4CFXA 3H9RA 4MXAA 3QTRA 3KF7A 1REJA 4HGSA 4RVMA 3GU4A 5CX9A 3ZO2A 3LFQA 4FEWA 1FGIA 3DBEA 4NEUA 3TV6A 5HTIA 5M08A 5F1ZA 2W1IA 4C7TA 2I0YA 2R5TA 4XCUA 4YPDA 3C51A 3W8QA 4EYJA 4FEXA 4XNEA 2ITWA 3F2AA 3F61A 4QTBA 4FGBA 1PMEA 4RBLA 2XK8A 5E8XA 3VF8A 4E5BA 4EH5A 1H24A 4OUCA 5E90A 3Q6WA 4AA4A 4BICA 3WIGA 3QWKA 2IW6A 3DTWA 3H3CA 4O6EA 4G3GA 4QYGA 5JFXA 5HCXA 3HV5A 4M13A 3UO5A 3E92A 2JKQA 5HG8A 3RM7A 3NRMA 3NCGA 1F0QA 4A07A 5K4IA 2YJSA 4LMUA 4A7CA 3IOKA 5IKWA 3HLLA 2JDRA 4Z16A 5IQAA 4JG7A 3QD2B 4EHGA 3IDCA 4YZMA 4ZK5A 2ACXA 2O64A 1H26A 4H3PA 5ETAA 5FP6A 4E26A 4G6OA 2OH4A 4FKGA 5CF8A 2PK9A 2OXXA 4F0GA 4C4IA 2VU3A 3MVHA 3A8WA 4FV4A 5HGIA 2R3LA 1PYXA 1GJOA 2V55A 3R30A 3EN6A 4CT2A 3TEIA 4R5SA 3NUSA 5HBEA 4RG0A 4AN3A 3S2PA 4HYUA 2V7AA 3MYGA 5EQEA 4WUAA 4F99A 2UVXA 3PRFA 4IX3A 4YJSA 4U42A 4FT3A 5C26A 1ZOEA 2C3KA 3A7IA 4ZSLA 5K9IA 1KSWA 4X3FB 3ZBFA 4B0GA 4ZJJA 3UO4A 3BX5A 4FZFB 3FXWA 2ZYBA 4BR3A 2IVVA 5M57A 2W06A 4ZOGA 5CSPA 3CIKA 4DFBA 3TV4A 2BCJA 4RX7A 4BYJA 2ZMCA 3LLTA 2J4ZA 4R7BA 4QQTA 5H8BA 4AE9A 5JGDA 3KU2A 1Q5KA 2EU9A 4G5PA 4J97A 4JNWA 5F20A 2ETRA 3BRBA 2ZV7A 3OWKA 4XG9A 5CQWA 5LCKA 4BI0A 4C38A 4PL3A 4QMOA 4D2RA 2HOGA 3DQWA 3QC4A 2F7ZE 5AP7A 4JDJA 4DH7A 2QU6A 3Q4CA 2KULA 5FBOA 4FMQA 3O96A 1ZZ2A 3IQ7A 3QKLA 2R2PA 4FTUA 3ZLSA 3ZOSA 4EHEA 3IW8A 4ZSJA 5KBRA 5M56A 5HKMA 2WEIA 4NIFB 2W7XA 2REIA 4FNXA 2WFYA 4R3CA 4IZ7A 2B1PA 2YM4A 3EFWA 5F95A 3AD4A 5EOBA 4XG6A 3CE3A 3TZ7A 4WA9A 3DNDA 3NMUF 2JKOA 4NM3A 4DLIA 4CQGA 2C6DA 3IDBA 5HIEA 3MA3A 1DAWA 2EUFB 2P33A 4GK4A 4UXLA 3GCSA 4OBOA 4ONAA 1Y8GA 5DI1A 4HVHA 2PE0A 5DYJA 3AXWA 3R9RA 5AUYA 3DFCB 4NH1A 3COHA 3D94A 5BVWA 4ZY4A 4EK5A 4IX5A 4I4FA 3BI6A 4L44A 3DDQA 3UP2A 1U5RA 1R39A 3PJ2A 2C0OA 2F49A 3EZRA 4PL4A 1ZMUA 3CCNA 3Q3BA 1GNGA 2WELA 3QF9A 3T3VA 4AOTA 4EBWA 3EHAA 5DEWA 2XKFA 4F70A 3KRJA 5DG5A 2VO6A 4JG8A 4XMOA 2WMSA 2PUPA 4YHJA 4YJPA 3R2YA 3R8VA 2C6EA 1OUYA 3SAYA 1B39A 2X7GA 3OWJA 2VWVA 2OI4X 3CTJA 1ZOHA 3D4QA 3GNIB 3IS5A 4FKRA 4YJTA 5GJDA 1UU3A 4DINA 4DH1A 2QONA 3D0EA 3W8LA 2OSCA 2RSVA 3E88A 5A3XA 2GSFA 4M14A 4K0YA 3PLSA 3RK5A 4YR8A 5AX9A 4ENYA 4L42A 3QRTA 3ENHA 3PZEA 4S34A 1ZY4A 4LL0A 4GSBA 4AW0A 1JSTA 4BDGA 1W82A 3NR9A 3IO7A 4ZY5A 3NUAA 5AUUA 2OLCA 5ANOA 4M7IA 1ATPE 1V0OA 4XV2A 1LEWA 4C58A 5A6NA 3A61A 4U3YA 4LGDA 1J7LA 4FKVA 3Q96A 4JBQA 1JAMA 3QQUA 5CXHA 1YI4A 2X9EA 3EFKA 3FMLA 3QHRA 4IACA 3CP9A 3JYAA 1J1CA 3RP9A 3FL4A 4J95A 3CPBA 4YJOA 3UYTA 2GQGA 1KV2A 4MD7E 2RL5A 1V0PA 3RHXA 1F5QA 4ID7A 4IM0A 4IWOA 3SQQA 4EK6A 4PNIA 1OIUA 1OKYA 1IASA 1UV5A 4IAZA 3P7CA 4GUEA 4Q5EA 3RWQA 3ZC5A 3NX8A 4C62A 3EZVA 2R7IA 2YJRA 4Y95A 1DI8A 3GU6A 3Q53A 3MIYA 3C7QA 4M0ZA 2XBJA 5DE2A 3ZSHA 3NNWA 4AFEA 4F0FA 3PIZA 5IDPA 4GEOA 3MJ2A 1JSVA 3UP7A 5DFPA 5CZIA 5CANA 4PPCA 4C33A 4BCOA 4BCQA 1KE7A 3ZFYA 1ZXEA 4DHFA 5BVOA 5J9LA 1Q8ZA 2VNWA 3SGCA 4PMTA 4IAIA 4BGHA 3TUBA 1JNKA 3LFNA 4GU9A 3TIZA 3VQUA 3MY1A 2GHLA 2GNLA 1OVEA 2B9JA 3V6SA 4FV0A 2WMVA 4Y8DA 4BL1A 4JLCA 3Q60A 3PLAE 4JXFA 4L46A 3F5GA 4LM5A 2QCSA 4DFYA 4G16A 1H1WA 3I0OA 3LVPA 4TPTA 3R21A 5DWRA 3ZUUA 2FVDA 4UEUA 1G8AA 3RPYA 2C0TA 2ITYA 3PP0A 5AV4A 5CEOA 1WAKA 3AT2A 1QL6A 4BGGA 5BYLA 4E4XA 4QTAA 2PMIA 4EOLA 3PP1A 4QP9A 3R01A 3S0OA 2R3FA 2HCKA 2PZRA 3EQGA 4V0GB 5FEQA 5L2TA 5A4EA 2XCKA 3CJFA 4ZS0A 5D10A 1Q24A 3THBA 5J1WA 3EN5A 2VWIA 4RJ5A 1SNUA 2FSLX 4KRCA 4UBAA 5HD4A 4LOQA 4C61A 5IDNA 4O7NA 4RC4A 4IVCA 1WVYA 3KMWA 1A06A 2NP8A 5I9UA 4DG0E 1MP8A 5CZHA 4UYNA 3U6HA 4LMNA 3QYZA 4HJOA 4DH8A 4FTCA 3LOKA 4FIIA 1T45A 2UVYA 3LFAA 4MQ2A 2C3IB 3QZHA 3RHKA 3HMNA 3OC1A 4I1ZA 4UMUA 2ZB1A 2CKEA 4DT8A 4GT5A 4TXCA 2W1CA 3ID6C 2X1NA 4MXXA 4F08A 4BDHA 2DUVA 3EMGA 4S2ZA 2YDIA 2X2MA 4R6VA 3MH0A 4IH8A 4U44A 4YJQA 1JVPP 4E8AA 2O8YA 2W9FB 1W8CA 2WIPA 4JRVA 5A4CA 5J5TA 3TDWA 3AD6A 3E5AA 2F7EE 3C4CA 3QQGA 2ITZA 3MBLA 4Q9SA 4CGAA 4YZDA 3DXQA 3DAKA 2EXEA 4ITIA 4CEGA 1IA9A 4IXPA 3H9OA 3E8EA 2XYUA 3R63A 5AUTA 5AAEA 5HO8A 4FTNA 4EK4A 3OMVA 3VUTA 1ZY5A 5JN2A 4I93A 2NPQA 1BL7A 3VJNA 1Q41A 4IQ6A 2QURA 1CKJA 4YZNA 1YW2A 1PMNA 3FI8A 4MXZA 3NVKI 4EOOA 2ONLA 5J9YA 4AP7A 2UV2A 2PVNA 4U5JA 3LPBA 3ZEPA 3ZFMA 4WSYA 3LMGA 2RFEA 2UW6A 4AA0A 4ZLYA 5JGAA 3DTCA 4EQMA 2YDJA 4ZXTA 3OOMA 4L52A 4RPVA 4N70A 2XK9A 1WBVA 2GS6A 4J99A 4S32A 4EUTA 2SRCA 3L9LA 4FKPA 5FXSA 4NSTA 2HW6A 3ACJA 3ALOA 4I94A 4R3RA 3FMJA 3RCDA 4JL9A 2IZTA 3BCEA 4X3FA 4DF3A 2EXMA 4FT9A 4MX9A 4GCJA 1GIJA 3F3ZA 2R64A 4R5YA 3W2QA 5HLPA 5KMMA 3KK8A 3CBLA 3EN4A 3F9NA 4HW7A 3UOLA 4BTJA 2VWYA 1XHAA 2OIDA 3HDNA 4IDTA 4O0SA 4PMPA 3MB7A 4NK9A 3QKKA 3V5LA 1STCE 2J90A 1PXLA 2XKCA 2C3LA 3HP5A 2BRMA 3VBYA 3ZBXA 3SW7A 2XNEA 3ZLXA 4RWJA 3P86A 4ZS4A 4G9CA 4HGTA 3MY5A 4BTFA 3DBQA 5E8VA 4MVFA 2BIKB 2VNYA 4LGGA 3RINA 4D58A 5IG1A 4DGGA 3LQ8A 2I6LA 3SW4A 3UOJA 2OZAB 3BYOA 3GENA 4W4XA 4QMNA 5EKNA 4JAJA 5J9ZA 4FEUA 2I0EA 1WCCA 3S95A 3PSBA 3QTWA 4M69B 4XRJA 3TKUA 4L3JA 4E5AX 4I20A 4PQNA 4U80A 5HNIX 4RX8A 4BDBA 5IA2A 5CEQA 1Y8YA 2ZJWA 4JAIA 4CLJA 5KHXA 4JX3A 1WBSA 1PMUA 4QMVA 3PFQA 1Y6AA 1Q61A 3SV0A 4BCMA 4QMTA 3VBVA 3EH9A 3OCTA 4K1BA 5HX6A 1JKTA 5CEMA 5IF1A 3ZO1A 5EQYA 3HA8A 3LJ0A 3H9FA 5E1SA 3R0TA 5LCJA 4FIFA 4M0YA 4RA5A 4WKQA 2F2UA 3FLZA 2HIWA 4YLLA 3SRVB 3VBQA 4D2WA 4DG3E 4GH2A 4UMRA 3V5QA 4AT5A 4KD1A 4UWCA 5IU2A 3V3VA 2XB7A 3LQ3A 3CC6A 3V5WA 3RM6A 5FEDA 1ZRZA 5EYKA 2GDOA 2WU7A 2F4JA 4D28A 1GIIA 4XBRA 4FKSA 4IX4A 4JG6A 2R9SA 4QMUA 4EKKA 2C3JA 4CMUA 5L6WL 4C3PA 4C3FA 2QOOA 2QOIA 2WAJA 1J91A 4H36A 1KOAA 4MXOA 5FGKA 4JQ7A 3ZMMA 3EJ1A 3FY0A 3QALE 4LI5A 4PRJA 4JDKA 5EM7A 4FE2A 4WNOA 2BILB 1M52A 2BZHB 4FV5A 5E8UA 2XIKA 3WARA 4L01A 4ZSGA 2ITNA 3MSSA 2JBPA 2J0KA 4ZTLA 2IPXA 2GNHA 5EG3A 1VEBA 4RFZA 4EI4A 4GIHA 2WO6A 3JVSA 4RJ6A 4WOVA 4E3CA 3KB7A 3RAIA 1J3HA 2UVZA 2BHHA 4TL0A 1PKDA 3UZTA 2J0IA 4RQKA 4WNMA 3RK9A 4DC2A 5IQIA 2JC6A 3F2RA 3OZ6A 4AZSA 4EOJA 5IUHA 2BUJA 3L9PA 5GZ8A 3QCYA 3Q9ZA 3ZEWA 4N6YA 2UZVA 3TTJA 3C9WA 1W83A 2KTYA 2X9FA 1EH4A 2GNGA 2QODA 3C0HA 3DBDA 2J5EA 4MBLA 3PA4A 4OTFA 4XLIA 2OO8X 2X0GA 4EH6A 4IAAA 4QP2A 3R8MA 4IDVA 4FKWA 1K2PA 4OW8A 3HV3A 3LHJA 1RJBA 3QQKA 2F2CB 4EK3A 4FL1A 4AW1A 5ANIA 3VS0A 5HVJA 5M07A 2G2IA 4FTTA 2XKEA 3BGPA 3U4UA 3WF7A 2CMWA 2OWBA 3CY3A 2GFSA 4W9XA 3TG1A 5M55A 5T6KA 2FSOX 2BIYA 4FL2A 1H1SA 3PTGA 4MNFA 4ZSAA 3BLRA 3ELJA 3ZRLA 4MCVA 1OBDA 1W0XC 3HRBA 4KIQA 4Q5HA 1KE9A 3G5DA 5K3YA 4A4OA 2C0IA 4RJ8A 1FMOE 3HMOA 3HKOA 4AGWA 3OXIA 3OTVA 1R0PA 4M84A 3W2RA 3V5TA 3KXMA 3GCVA 3PPZA 4E6DA 5BYYA 4CV9A 3POZA 3ETAA
chains in the Genus database with same CATH superfamily
3GP0A 5IMEA 5JRQA 3FLWA 4U79A 2EB2A 2YCRA 4V0GA 5CSWA 4YHTA 4KSQA 3R9DA 4RJ4A 3COIA 3IW5A 2XIXA 3HV7A 4O7RA 1JBPE 2BKKA 1OL7A 3F7WA 4IM2A 1XH4A 4PP9A 4H3BA 3O17A 3QD4A 3UC4A 4HOKA 4TTHB 5LWNA 2JLDA 5AR4A 3D2IA 5F94A 4IAYA 4W9WA 4B9DA 3V8WA 5E1EA 2GMXA 5AAGA 2B7AA 5IPJA 3DKGA 3O5AA 2PTKA 4JDIA 3VUHA 4U43A 4X6QC 3QTIA 2HYYA 3WBLA 3ZYAA 4DFNA 2ITVA 3K2LA 3U54A 1S9IA 3GC9A 1BI7A 2QOLA 3FKNA 3QCQA 3ORNA 3RMFA 2YISA 4JQ8A 2XEZA 4GUBA 5GJFA 1UKHA 2WTCA 4AU8A 1H0VA 4CCUA 2HWOA 2FYSA 4MAOA 3ZO3A 5KO1A 3NUYA 4AE6A 4EQUA 3TUDA 4K11A 2XARA 4KKEA 3HZTA 1LEZA 3AC8A 4UMQA 2ZM1A 5C27A 2V62A 1O6KA 2QD9A 3NNVA 4CNHA 4TN6A 4IWDA 3L8XA 4DEBA 4FTKA 2YIWA 3UG2A 3LM5A 3PWDA 2XVDA 3EQCA 3PXKA 4FTOA 1OPKA 3NYXA 4RQVA 4V05A 5CVGA 3VS2A 3OBGA 4AZTA 3N4VA 4GKHA 4PTEA 3MN3A 1REKA 5AV2A 4ASXA 3HMIA 5ANDA 4MXYA 2CNUA 4BCGA 2R4BA 3NAYA 3V5PA 3RWPA 4RC3A 4EBVA 5AV0A 4UALA 4FZ6A 1YI6A 5AP0A 4APPA 4C4EA 3BEGA 5EQPA 1PF8A 5HU3A 4AF3A 3Q4TA 4H3QA 3OF0A 2P2IA 2C6OA 2X39A 4YLJA 4YO4A 4GKIA 2X6EA 2BALA 3A62A 3A7GA 3G90X 3P1AA 4GVAA 4LL5A 4X3JA 3RZBA 4ZZOA 4L7SA 1PKGA 3QKMA 3S00A 4EKLA 5C03A 1JKKA 3BHTA 1B38A 5LVLA 1H27A 4LFIA 4GT3A 2GTNA 3UIBA 5DR6A 3DJ5A 3E8CA 4XH6A 4IJPA 4K8AA 4DEHA 3GU8A 5EK7A 4PY1A 2W99B 5CF4A 4RVLA 4FG7A 2HZIA 4D0XA 2UW8A 1U59A 4D55A 4BWKA 4C2WA 2CKOA 2Z2WA 2UW3A 4EH2A 4AZFA 4QYHA 3ZLWA 2VTNA 3MW1A 3F66A 2W1HA 3BYUA 3QL8A 3UNKA 2WMRA 5L6OA 3IGGA 5I9VA 3I6UA 3LCOA 4DGLC 4BCIA 3PJ1A 2Z7RA 5GIOE 3GGFA 1UU8A 2OZAA 3PYYA 4Y83A 3MPMA 4FV1A 1CTPE 2G1TA 3BQRA 4X6RA 1Q99A 3RK7A 1NVRA 4U45A 5JQ5A 4FT7A 4FZAB 4RVTA 4O4FA 4M69A 4IB5A 1YVJA 1PXNA 2Z8CA 4GYGA 4A4XA 3BKBA 1NVSA 5BVFA 4BF2A 5I9XA 3F5PA 3F82A 3UGCA 3FI4A 4PDPA 1TQIA 4QT1A 5E91A 3IDPA 3ORKA 2W0JA 2Z7SA 5L8KA 1WVWA 3ZLYA 5D11A 5BMMA 4QQCA 4E6QA 3A60A 5TOZA 3R8LA 4ZLOA 4TWOA 3GC0A 3ORLA 4FIGA 4FL3A 4W4VA 3HMMA 4Y73A 1ND4A 4NJDA 4L45A 3VN9A 3OY1A 3FLNC 2QU5A 2X4FA 2O2UA 3JVRA 4IX6A 2WHBA 3GVUA 3V04A 3W10A 5DLSA 3SRVA 3R7IA 3FQHA 3LFBA 2WQEA 2X6DA 3QU0A 3FMHA 4QP4A 2JFLA 3IOPA 3WZKA 3OXTA 2I7QA 3DZQA 3GT8A 4BBMA 4CFVA 4DE4A 5GINE 3G6HA 3WILA 2ZM4A 3PRIA 3VQHA 5AIRA 3ENMA 3OXZA 2C6LA 3EKNA 5D7VA 3VBTA 5LWMA 1ERKA 3PJ3A 3W32A 5FXRA 4FK6A 5DR9A 4FKJA 4XHKB 3G9LX 4QMQA 3M42A 4OTGA 4YJNA 3FMDA 5EYCA 2WD1A 1BYGA 5CEPA 3CQWA 5LVOA 2VX1A 4ZSEA 2YM3A 3E63A 4J1RA 4DEAA 2E9VA 3W1FA 3VULA 3V6RA 2XRUA 3H4JA 4AGUA 3NAXA 1FQ1B 1Q4LA 1VYWA 4EH7A 3IPHA 1PXOA 3TNQB 4CKJA 1DAYA 5HI2A 2VTLA 3R28A 1T46A 3SXFA 4ANMA 4BDKA 4O0RA 4F6SA 5IQDA 3NNUA 5AP5A 2QC6A 4FIJA 2WGJA 5J95A 4FNZA 2IVTA 4AAAA 4YTHA 4IADA 5ITAA 3PXYA 1UWHA 5CSVA 3BGZA 4C4FA 3A99A 4RRVA 4PF4A 4CXAA 1YHSA 3QRIA 3QZGA 1BI8A 2FA2A 3EN7A 3GB2A 2QLQA 2XM8A 3DB6A 4DEDA 4HGEA 4KIOA 3TMOA 3PFYA 4RC2A 4O1PA 4XS2A 2W17A 4ZMEA 1JQHA 3F88A 2X0PA 4RJ7A 4BY9E 3VONA 2Z7QA 4AXEA 4FX3A 1BL6A 3FJQE 2HZ4A 3TJCA 5HQ0A 3EQIA 3ITZA 1YWRA 1VJYA 3Q5ZA 4FOBA 2W1DA 3WYXA 4MWIA 5BYZA 4R1VA 1TQPA 5L8JA 2ESMA 4U6RA 2ZDTA 5A4TA 4WUNA 4GJ2A 5KZIA 3VS1A 4AGCA 4RLKA 3R2BA 4FSNA 3O50A 3PY0A 3SG9A 2X8IA 3Q9WA 4XUFA 2C1BA 5HD7A 4D0WA 4XBUA 2QO7A 5GHVA 3F3VA 4JR3A 3FSKA 3KXHA 4EOKA 2XIZA 5HLWA 4HZSA 5ANEA 5M09A 4E73A 4C37A 3EN9A 2YEXA 3AC1A 3BHYA 3U9NA 2WIHA 3JUHA 1XBBA 4KINA 3TTIA 2YWVA 3OHTA 2JDVA 4C8BA 4FSMA 3DFAA 1V0BA 4YPSA 3N4TA 1W2CA 4XEYA 3MB6A 5JZJA 3AQVA 3S3IA 5KMNA 4AW2A 3PUFC 3SG8A 4FKUA 4FSQA 4O0XA 3SOAA 2ZV8A 3DBCA 3CPCA 4DT9A 2DQ7X 4RA4A 5HORA 3VC4A 5M4CA 4NW6A 4YBKA 2YWPA 1JLUE 2UZOA 4ITHA 4YHFA 4JQEA 3PVGA 3GC7A 4QP6A 1SZMA 2QR8A 2UZWE 4U40A 4EOPA 4PP7A 2PPQA 3AG9A 3FI3A 4FK3A 4NTSA 2V5QA 3QTUA 4F0IA 5A4LA 4YMJA 4F64A 5CU4A 4DTBA 4DA5A 3FZPA 4TYIA 5T68A 4B6LA 4DTKA 3UMXA 4O2ZA 3ATSA 2JKKA 4CFMA 4WBBB 3LZBA 4WG5A 4R1YA 4EOSA 2OU7A 4EC8A 2Y4PA 4APCA 2Y0AA 4CKRA 3TM0A 4I6QA 4D4SA 3UNJA 4UV0A 4WG3A 3KCKA 1YOMA 4OTHA 4ZZNA 3GU5A 4CT1A 2YCQA 4NKAA 4D2TA 2BZKB 4QQJA 5DN3A 4PV0A 4JOAA 5LARA 2JITA 4YLKA 5L3AA 2QOHA 1YWVA 3KN6A 2XA4A 4ANBA 5G1XA 2YM6A 1YOLA 2CPKE 4ACDA 4C57A 4EH4A 3G0EA 4PMSA 3FPMA 4KWPA 4YSJA 3NFGB 3KXNA 3KVWA 5HTBA 1ZWSA 5L6PA 4RWIA 4GL9A 3SA0A 5LOHA 3MTLA 2BR1A 3CGOA 4CFFA 4I0TA 3V51A 4F7NA 4ZLZA 5FQDC 3ZO4A 3COKA 4F7LA 1QPCA 1S9JA 1L3RE 3ZUVA 3GOKA 3UQCA 4BFMA 4DHZA 4CCBA 1J7IA 4ANSA 3IW6A 3OUNB 2WMAA 3R6XA 1NT2A 1YXTA 3GOPA 3MVMA 4AS0A 3E62A 4P5QA 2VX3A 3MY0A 1M2PA 2ERKA 3RGFA 4DLJA 4QMSA 5I0BA 3NIZA 1MQ4A 4I6BA 1H1PA 4TYHA 1YDRE 1CDKA 2CGVA 3WI6A 2W9ZB 3E7OA 3PUPA 5IQHA 3NZ0A 3LFEA 2W4JA 4G5JA 3HGKA 1UVRA 4J96A 5DPVA 3M11A 3B8RA 4UMTA 2CCIA 5GNKA 3QAME 2ZM3A 4WIHA 3F2NA 3DAEA 3UIXA 3UVRA 5I3OA 5BUIA 4TW9A 5FRIA 5BMSA 5LXMA 4ENXA 2RKUA 3IG7A 4PWNA 2CGXA 4BZNA 1TZDA 4YJRA 1AQ1A 1IAJA 5HESA 4C4JA 4KABA 4X0MA 5KBQA 1NW1A 1UWJA 4O83A 4BIBA 2WQNA 3R83A 4BKJA 4DGMA 2X2KA 3ZM4A 3KREA 4ASEA 4P5ZA 2XK4A 4KBKA 5IEYA 4A9TA 4BBEA 4GJ3A 4IZYA 2GFCA 4XG7A 3VVHA 4YURA 4Z7GA 4N4SA 2VTJA 4BIDA 5DOSA 2ITTA 5HZNA 2UW7A 2P55A 2FGIA 5EKOA 3QFVA 2NNWB 4F9WA 4YNOA 3HUBA 3QD0A 3KF4A 4YZBA 3R9NA 4FG8A 3F7ZA 2OICA 2OF4A 4GK3A 1VR2A 3VS5A 2J0MB 2QKRA 3OROA 3PIYA 4DH3A 3BL7A 3R8ZA 4I5PA 4QMLA 2W5BA 3PE1A 3HRFA 5AJQA 1WBPA 3FSFA 4C02A 3QBNA 1OB3A 3V8TA 1OIRA 3Q2JA 2A27A 3ODYX 3KMMA 4I6FA 2PVKA 4I5MA 4GFOA 2BKZA 4NJ3A 4X21A 5DIAA 5E8TA 1SYKA 4D2PA 1W98A 3PVUA 3QC9A 4BB4A 1Q97A 5KKRB 4ZTMA 1IAHA 2XIYA 3UNZA 2B9HA 3I60A 4NL0A 4F9AA 4MH7A 4KS7A 2HAKA 4PX6A 2VTSA 3JXWA 5HLNA 4CMOA 3CKWA 3LJ2A 3QRJA 4YC8A 4HNIA 5JFWA 3OCSA 4UWBA 3I7CA 2YERA 1UA2A 3OT8A 2RIOA 2O65A 3K3IA 3LCDA 3EL7A 3WIKA 4HCVA 3WZEA 2G15A 1G8JA 3TT0A 4W8DA 3C4XA 1SVHA 4G3EA 4D4VA 1Q8UA 3HVCA 1FVTA 1OL1A 2AC3A 3AMBA 3IONA 3L8PA 4F7SA 4OAUC 2FB8A 2YIRA 3ULZA 4DH5A 1B6CB 3UPXA 4F6UA 5J5SA 3AGMA 2GPHA 4I0RA 3ORTA 3GCPA 2EXCX 3AC3A 3FZOA 3NYNA 3VHEA 2PSQA 3Q5IA 4ZJIA 5M4UA 4FNYA 2GNIA 3LCSA 4HCUA 2CLXA 3KMUA 3BYMA 4O0WA 3ZDIA 5AR8A 4CYJA 4NZWB 4TYJA 2CCHA 5IA5A 3TIYA 3KRWA 4BCNA 4QO9A 2IW8A 2JIUA 2C47A 2WQOA 4IC8A 4WRGA 5TT7A 4IAFA 4B99A 2A4LA 5LMKA 2R3KA 1YOJA 4EH9A 5I5ZA 3CS9A 5IEVA 2VWUA 3UZPA 1OPJA 3P7AA 4MTAA 2BAKA 5CI7A 4GYIA 1PXMA 3DKCA 3CTHA 2PUUA 4KB8A 2O0UA 3HDMA 3ACKA 3F3WA 2QOQA 4MNEB 2PVYA 5EYDA 2XBAA 3AC2A 3FKLA 5IQFA 5HEZA 3DLZA 3ML1A 4QNYA 4FV8A 4XYFA 2YIXA 3HAMA 2IWIA 2UZEA 1XH8A 4E93A 5J1VA 4I21A 3TZMA 4BGQA 4PUZA 5TO8A 4CD0A 2O3PA 3IGOA 4XOYA 1WZYA 5BVEA 4L7FA 3PY3A 3OW3A 5DRDA 3QQFA 5J7BA 4I4EA 1V1KA 5LMKC 5B2LA 1ZYLA 4FVPA 3QCXA 4PDOA 4JRNA 2R3GA 3FZ1A 4NM5A 4BDEA 3R7GA 1MUOA 3EFJA 3C13A 5GJGA 2PYWA 3W2SA 4OBPA 2JBOA 3A2CA 3HRCA 3MH1A 3O8PA 2R3MA 4UB7A 5K4JA 3Q52A 4HVSA 2QNJA 4O38A 5BX0A 4YUQA 1ZYJA 5C8KA 4QMMA 3G33A 1CMKE 2OBJA 3KVXA 4O6LA 3IECA 3SXSA 3FXZA 1RE8A 1WFCA 4RIWA 4ITJA 3EB0A 1KOBA 4BVUA 3E87A 5IH6A 3CEKA 2C4GA 3UC3A 3KXGA 4BIEA 3FI2A 4M15A 3VW6A 4FSTA 3NFFB 3D14A 3RPSA 5KMLA 1HOWA 1KE5A 4AN2A 1YRPA 2JIVA 4LV5A 2VAGA 3U87A 5IUIA 4RIOA 5HG5A 2ONLC 4M8TA 4IWQA 3MA6A 4P7EA 2LAVA 3R04A 5AP4A 5HE1A 3BIZA 2PUNA 3D5WA 2Y9QA 2WTIA 3HV6A 4G6LA 4U0IA 4IVBA 3WZJA 1IA8A 5KHWA 2OW3A 4M66A 2OIQA 1URWA 2VO0A 3FBVA 5AR3A 4A06A 2YLFA 2VTTA 4O82A 3P4KA 2B9FA 4CZTA 2XJ2A 3ZSGA 3LAUA 4GRBA 3R1NA 2R3PA 1XMMA 4O7TA 3U55A 1FINA 2ZAZA 3ZZEA 4CG9A 4X3FC 4F1TA 4OTQA 4FIHA 1G3NA 5IZFA 2ERZE 4H58A 2O5KA 2XUUA 5E9EA 2GQRA 1YHVA 5EW9A 4BCFA 1CKPA 1DI9A 3BEAA 5A14A 2P3GX 2JD5A 3GU7A 3WE8A 4JVGA 5CF5A 2HY0A 1MRYA 1UNGA 2R3NA 3NGAA 3UIMA 4MBIA 3WZUA 4PDYA 4TYEA 3QUEA 4YTFA 1PJKA 4AT4A 5EI2A 5KZ0A 3V5JA 4F09A 1Y91A 3NCZA 3RVGA 1ZLTA 3KXZA 2J51A 3GFWA 4MD8E 4HYSA 1Y6BA 2F7XE 3DV3A 3OVVA 1FVVA 3JS2A 4AT3A 3FMMA 3UPZA 4YC3A 3POOA 4NKSA 1OPLA 2PU8A 2O63A 3T3UA 4BBFA 3RAKA 5E7RA 3GUBA 3GBZA 4ERWA 5FEEA 4FGRA 3RJCA 1YXXA 4O7LA 4TT7A 2OG8A 3DA6A 1OGUA 4QTCA 2VRXA 5E8WA 4CQEA 4I5HA 3BELA 2QG5A 3P78A 4R7HA 2A19B 3EFLA 4EJ7A 4ZZMA 3II5A 4FUYA 4JJRA 5IEXA 2OF2A 4A4LA 2VGOA 3P9JA 4A9RA 4CKIA 3I6WA 4EEVA 1XBAA 4FVQA 2R3QA 5AP6A 3TWJA 3FL5A 1CSNA 1PYEA 4WO5A 3G6GA 4ZP5A 3Q9XA 1Z9XA 3UZRA 4FF8A 3PXZA 3NLBA 3B2WA 1Z5MA 3E3BX 5IUGA 2CSNA 1P5EA 3OEFX 2WOTA 5TR6A 2C5XA 4L3PA 3RKBA 4IAKA 4GVJA 2XJ1A 3TYKA 1QCFA 5JRSA 3O23A 2WTKB 5JKGA 5IH4A 4QYFA 4MF1A 5EDPA 5LMAA 4AXAA 4J7BA 1H1RA 4BTMA 4FV2A 4Z55A 3FYJX 2XAMA 3L8VA 4V01A 2ETMA 5C8NA 2GHGA 2XP2A 1HCKA 2AUHA 4FI1A 5FLFA 4F7JA 5AA9A 4Z3VA 1WVXA 4G31A 2YIYA 3VUMA 4GK2A 4PMMA 3BV2A 1CM8A 4IB3A 4J8MA 3LJ1A 3OG7A 5BPYA 4IEBA 3PIXA 3BPRA 4UXQA 2C5OA 3EKKA 4PTCA 2YM5A 3C0IA 3AC5A 1R78A 3LCKA 3DDPA 5HG7A 1PW2A 4Y5QA 3EQPA 3OP5A 1UNLA 4EYMA 5C01A 1CKIA 2R3OA 3DB8A 1FOTA 3KY2A 2VTQA 2B55A 2RFNA 4HYHA 2J0JA 4UZDA 3BYSA 4BRXA 4ZTRA 2QOKA 3RAWA 2OK1A 4FOCA 3HYHA 4G6NA 3HL7A 1JSUA 3D7TA 4DYMA 1LUFA 4E6AA 5K5XA 3LKMA 4WNPA 3KKVA 3R7EA 4AW5A 3OWLA 3DZOA 4OR5A 2C5NA 4I24A 2OFUA 3KL8A 2IZUA 2XRWA 3O51A 3ODZX 3TKHA 4DCEA 3ZC6A 3PXQA 4QPAA 3GC8A 4IVAA 4ARKA 2NRUA 4NFMA 4ANNA 3DT1A 2PZIA 4E5WA 5IA3A 4FT5A 2BFYA 3VWAA 3TNWA 3UODA 2BMCA 2LGCA 5BUEA 4XP2A 4QPSA 4C2VA 2YAKA 4JR7A 3GCQA 4TWPA 1OM1A 4YC6A 2C5VA 5HE2A 3UO6A 4Z7HA 3MI9A 4BDAA 2B54A 3UDBA 1O9UA 4F9CA 5L2SA 2BPMA 3RPVA 3CD3A 4LRKA 2JFMA 2C68A 5BVDA 5L2IA 4AXFA 3O71A 3FZTA 3KEXA 3WF9A 4UN0C 4MNEA 5B2KA 2QOCA 5AIKA 3CTQA 3MESA 5JQ8A 4OTPA 4CRLA 1G8KA 3QD3A 5CNNA 3ZHPC 1ST0A 4EJNA 2R0UA 3RTPA 1PXPA 3HMPA 1K3AA 3QGYA 2UZUE 3PZHA 5FDPA 4RLLA 3Q2MA 5JGBA 1OBGA 4ZJVA 2PY3A 4ZIMA 3A4OX 3DXNA 4MKCA 4N57A 5DGZA 3OD6X 3TKIA 1ZZLA 3UOKA 3R8UA 5J79A 3B8QA 4TWCA 5K5NA 4P4CA 3QLFA 2AEGA 4HPUE 3WF6A 4KIPA 3FXXA 4QD6A 3QYWA 2RG6A 3VUIA 4D2VA 4X2FA 4ZTQA 3EYGA 5KX8A 3ZCLA 4FG9A 3CKXA 1ZYDA 2IF8A 3ORZA 1GZ8A 2YA9A 4GT4A 4USDA 5ETFA 3T8OA 3VUDA 4XJ0A 4G3FA 3EOCA 3Q4ZA 1Q62A 3R7YA 3VW8A 2J0LA 4B8LA 5H2UA 3G0FA 3CY2A 5EFQA 3FKOA 2JEDA 3FLYA 3G2FA 3VS6A 3KIOC 4LOOA 1VZOA 4V04A 4HPTE 2FH9A 4QQ5A 5DNRA 3PJ8A 4AOJA 4BCHA 4FV3A 1SVGA 5CS6A 4AACA 4B7TA 2XALA 4D9UA 4F9YA 5AUXA 3SVVA 2PVFA 2W5AA 1YQJA 5FTOA 4J71A 5DH3A 3HNGA 3ROYA 4X2NA 5M06A 5E8SA 4TYHB 5H3QA 4ANQA 5IH5A 5L2WA 3O7LD 4ANLA 1QPEA 2IVSA 4FTLA 2OFVA 2ZOQA 4EK8A 2R3HA 2YABA 1H8FA 4LYNA 3WYYA 4DHJA 3UDSA 4NWMA 5AUZA 4CYIA 2IG7A 1UU7A 4I3ZA 4AG8A 2Y6MA 5DMZA 1O6LA 4HZRA 4PDSA 2ZDUA 3VRZA 4O86A 1TQMA 2C6MA 3CJGA 4YTIA 1KUTA 3RZFA 4P90A 2XS0A 3T9IA 4F1OA 5CT0A 5CSXA 3TI1A 4EH3A 3F3UA 3BHHA 3ERKA 5EW3A 4BDJA 1XR1A 3COMA 3GQLA 4RIXB 4Y5HA 4F9BA 4L53A 4GS6A 3QWJA 3BGQA 4BWXA 3FY2A 5CAVA 2DWBA 4I6HA 1H08A 5DHJA 1SVEA 4XG8A 1YWNA 2XNPA 3OTUA 4YGAA 4QEBA 4N0SA 4LG4A 4MWHA 4L6QA 4M12A 4CZYB 4K2RA 2Y8OA 1XH9A 3QQLA 2QKWB 4DEGA 5HU9A 1A48A 3OBJA 3EQDA 3P79A 5AX3A 1PMVA 4FKOA 4EZ3A 4JX7A 4DDGA 4QP3A 2QVSE 3QHWA 4CSVA 3W0QA 5TKDA 2HXQA 2ZVAA 2E9OA 2PMNX 5CYIA 2R3RA 3U6IA 4IVDA 2E9PA 2OZOA 2X7OA 2X0QA 2XKDA 2XNBA 4KKHA 4MXCA 3PVBA 3QTZA 4NCTA 3V01A 4H05A 4XRLA 2BRHA 5HO7A 2VUWA 2W4KA 3RI1A 4FVRA 3MVJA 1H4LA 1FMKA 2CN8A 2HWPA 3BBTB 2ZMDA 3FQEA 4L68A 4I6LA 5EW8A 3DOGA 5AR5A 4FZDB 1GIHA 2YFXA 4XP3A 1XWSA 2PZYA 4QTDA 4QP8A 4BCJA 2W1ZA 3NVMB 4MK0A 4FRFA 5HIBA 5CY3A 4DGOA 5EHOA 4XG3A 2JDSA 2JGZA 5EHLA 4EORA 2XAOA 2PVLA 5HVKA 4J53A 4II5A 3EWHA 5L8LA 2VZ6A 4X7QA 1PY5A 2UZDA 4ACHA 5A9UA 2VWXA 4NCTC 3UQFA 3MTFA 2C6TA 2JDTA 1IR3A 1AD5A 1DS5A 3GEQA 2J7TA 3O2MA 4RGJA 4U81A 4DG2E 4P2KA 1WBWA 2IEWA 5AM6A 1Q8TA 3P7BA 2YZAA 3LXNA 4L43A 4YJUA 4FV9A 4XV9A 2VV9A 3KCFA 4JT3A 4I23A 1WBTA 4F1MA 4LV8A 2WQMA 3A7HA 5H8EA 5TE0A 5HCYA 3ZRMA 2PMOX 3W16A 4NFNA 1QPJA 5ACBC 3I5NA 4KS8A 3JY0A 2UUEA 5LJJA 2XNOA 4BDCA 3AGLA 3TACA 4E4LA 4ERKA 2RF9A 4BHNA 1BLXA 2GS2A 4K9YA 4CFUA 2FSMX 5J7HA 1OKZA 2ZV2A 5HO6A 4GFMA 4QMXA 5CU6A 5I9WA 5JMSA 4C35A 4TYGA 3NUNA 3VS7A 4ACMA 3TUCA 3HAVA 2W05A 3ATTA 3BQCA 3UVPA 4NT4A 4W8EA 5DT3A 3C4WA 3E3PA 3FC1X 4OT5A 4JIAA 1YI3A 4AZVA 2W1FA 3VIDA 4EUUA 1KE6A 2OH0E 3MH2A 4LUDA 5FUTA 4N6ZA 1QPDA 2XNGA 5EM8A 3FDNA 5IA4A 2UZTA 4RT7A 1J1BA 2GTMA 3JY9A 2E9NA 4U7ZA 3PJCA 5CAOA 2JAMA 3F5UA 3KRRA 3Q9YA 5CSHA 4ACGA 5HICA 4KUJA 2XK6A 4HVDA 2IJMA 2Q0BA 4UX9A 4C34A 2WEVA 2CHLA 3Q04A 4M67A 4FEVA 2BHEA 4FTRA 1FGKA 3BLAA 1M2RA 4TKSA 4TWNA 5IQBA 2WNTA 4U41A 3PE2A 3DKOA 2VO3A 4QRCA 4D5KA 4D4RA 3E8DA 4GU6A 1NY3A 1ZARA 4QP1A 5KMKA 1H1QA 2JAVA 5AUWA 3TNHA 2PUIA 1TVOA 3R7VA 5I4NA 4PTGA 2I40A 1YXSA 4BKZA 4CVAA 2OJGA 3EQBA 3G51A 2YZLA 2A2AA 2B52A 4BKYA 2BRBA 4G2FA 3MFUA 4ZTNA 5JT2A 5IISA 5LVMA 2IW9A 5IQEA 2H34A 1H01A 3D15A 4GG5A 2W5HA 2C6IA 4K6ZA 4RIWB 2GCDA 3LCTA 1GZNA 4PPAA 4YTCA 1PXKA 3AD5A 5D7AA 4C0TA 1W2FA 1TKIA 4K18A 3E7VA 2WMWA 3EIDA 4XLVA 5EDQA 3G9NA 3QQHA 3CQEA 5AP1A 5CU2A 1XJDA 3RAHA 2J5FA 3CSVA 2BDWA 3DAJA 2XNNA 3ORXA 4X2KA 2NO3A 4F63A 1PRYA 4BDFA 4KA3A 2WPAA 4MBJA 4TRLA 3BHVA 4KSPA 5DVRA 3UQGA 4O84A 4FKQA 1XO2B 4G1WA 4AOIA 2CNQA 5C4KA 4X2GA 3CLYA 4XV3A 5M53A 4YJVA 2ETKA 1OECA 2YCFA 3WF5A 4BN1A 3QTXA 4JBOA 4LOPA 2BRGA 4O27B 4KBCA 2H6DA 2PE2A 3QQJA 4G3DA 4AWIA 1YXVA 1BMKA 4RWKA 3F69A 5CVFA 4CMTA 4UZHA 1FBNA 3LXKA 2OXDA 3VBXA 3FHIA 3I7BA 3DGKA 5CU3A 3WOWA 1PXIA 2YACA 4FBXA 4O7ZA 4R78A 3CR0A 3D2KA 4WBOA 2YM7A 5CLPA 3UVQA 2VO7A 3BL9A 3BWFA 2VTAA 1H00A 4IE9A 3PSCA 5CF6A 5DA3A 4BCPA 4O7YA 3MPTA 3DBFA 3JR1A 2YDKA 4IC7A 2XM9A 3ANRA 4E1ZA 3IKAA 3WZDA 3PVWA 3OCGA 1RW8A 3FQSA 4BI1A 4EOMA 3DNEA 4QYEA 5EOLA 1E1XA 4IB0A 3A4PA 4YZCA 5JH6A 2VWWA 4CFNA 4QOXA 3AKKA 3QUDA 1FVRA 4AAYA 2ITUA 1M7NA 4TNBA 2HK5A 1WMKA 3SD0A 3UMWA 5AP3A 1ZAOA 2VWZA 3NWWA 4ZTHA 5KMIA 2VTMA 3TN8A 3PA3A 5FP5A 3NW7A 4I92A 5BVKA 3DY7A 1YDTE 2WMQA 3RNIA 4GMYA 2CGUA 2WXVA 2QHMA 3C1XA 4RIXA 1J7UA 2VGPA 2WB8A 3OT3A 4FTIA 4HGLA 5DBXA 4MF0A 4E20A 5DEYA 3QX2A 5FBNC 1APME 2X81A 2X8DA 5D41A 4EOQA 5ETIA 3ET7A 2YAAA 3KRLA 2R7BA 4A9YA 2I0HA 3UIUA 2BZIB 3TDVA 2WU6A 3KULA 5JFVA 3R02A 4DCAA 3Q4UA 2XK3A 3REPA 1Q8YA 4D9TA 1GOLA 2ITQA 2OJIA 2AYPA 3OW4A 3NUUA 5HNBA 4AN9A 1U4DA 3VUGA 2YIQA 3PG1A 4RX9A 1M2QA 3PPKA 4W4YA 5C9CA 3A8XA