3FLSA

P38 kinase crystal structure in complex with 6-(2,4-difluoro-phenoxy)-2-((r)-2-methanesulfonyl-1-methyl-ethylamino)-8-methyl-8h-pyrido[2,3-d]pyrimidin-7-one
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
total genus 110
structure length 343
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flsA01
4CFMA 5KHWA 3KMWA 3ZFXA 2UVXA 3RZFA 2BIKB 2CJMA 2PVMA 4IZ7A 1IA8A 1JPAA 4HYIA 2UZWE 1ZOEA 4XP2A 5C8KA 3NUUA 3RI1A 3WF9A 4F6UA 3FY0A 3G6GA 2RSVA 3ZLWA 3FMNA 5F4NA 3FV8A 2X7OA 2YAAA 2YDIA 2XP2A 5LXMA 1OM1A 4CNHA 3RPOA 4R7IA 4OTQA 1H26A 4U3ZA 4B4LA 3RKBA 4WD5A 4FSNA 4F65A 4NL0A 2JBOA 5HX8A 4ZEGA 4DGMA 3S00A 4IDVA 1OKYA 3PPJA 5EYDA 5CF4A 3CIKA 2XCKA 2ZOQA 4B6LA 1F0QA 4RJ4A 4DN5A 4BYJA 2R3LA 1YRPA 2OJ9A 4FTJA 2IVUA 2CSNA 3L8SA 3ZEPA 5ACBC 4OTGA 4A06A 1JSVA 3DDQA 4QP6A 4TT7A 1PF8A 5EK7A 5AV0A 3DJ6A 3PWDA 1DI8A 2F49A 1Q8TA 2XUUA 3PTGA 3HUCA 4IFCA 3KXZA 3FXZA 4FX3A 2BZIB 5M07A 3SOAA 4QYEA 4B9DA 3DB8A 3LCKA 1XH8A 3QKMA 3DOGA 1Y6AA 3AT4A 3VRYA 4NU1A 4YNEA 2XNPA 2F4JA 4Q9ZA 4MWIA 4L01A 4DG2E 1WMKA 4YZNA 3K3JA 3QXPA 5KZ0A 2C5VA 4ZSEA 4ANBA 4XRJA 1Q41A 2JAVA 5JFWA 2OXXA 4ZMEA 3FSKA 3U55A 2W96B 5C4KA 1H28A 3F3UA 4MXYA 2WMAA 2YFXA 4N0SA 4WUAA 3VJNA 3R9RA 4U80A 3G0EA 4GUEA 4FUYA 5IEYA 4OT5A 3N9XA 5BYYA 4YTHA 2QONA 3E8NA 4WNPA 1IAHA 1ZMWA 4ANLA 1HCKA 4KIKA 4E6CA 5CAVA 3E5AA 4EOJA 1UWJA 1XH4A 2XNGA 2IZTA 3PE2A 3E7OA 3QHRA 4A9UA 5IMEA 2OG8A 1FQ1B 4PDPA 5KE0A 3OOGA 1E9HA 4RG0A 2WO6A 5AADA 1GIIA 4YZBA 5BYZA 5AIRA 4NEUA 1KE8A 4IE9A 1PMUA 3A61A 4RFZA 4FTMA 4IM0A 2VU3A 3U6IA 4U97A 3IW5A 4OT6A 3ZBFA 5AUYA 2VWIA 4X2NA 2QI8A 3WZJA 3UIMA 4GIHA 4BDCA 2O0UA 2VTIA 3EZRA 5LOHA 3RK7A 2F7XE 3HVCA 5GINE 4X2GA 5CVHA 3P7BA 1MRVA 3KKVA 5I9XA 4WA9A 3V5TA 3ORKA 4U43A 5JZNA 3W2OA 3BGZA 3ZU7A 2JIVA 4G3EA 1BX6A 4LV5A 2YACA 3DU8A 4FIIA 4ALUA 4I0RA 3PLSA 5C03A 4RJ7A 1F3MC 3UVQA 3HRBA 3AGMA 4FZFB 3WYXA 2ITZA 4F9AA 4GFGA 4RWJA 5KZIA 4EC8A 3MJ2A 3OT8A 2X6DA 1H08A 4NJDA 4NTSA 2FUMA 1W98A 3EHAA 4I93A 4QNAA 5AX3A 3MSSA 4JXFA 5GJFA 3UZTA 5ANDA 3P23A 2W1ZA 3QZHA 4BDIA 4CG9A 4PDOA 5DT4A 1E1VA 1AGWA 3PJ1A 3NLBA 3ELJA 1OITA 1KE6A 3IS5A 3S2PA 3VBYA 3KQ7A 3OCTA 2X6EA 4J71A 4QMSA 3I0QA 3RPSA 3NNUA 2VWVA 5IEXA 4JLCA 2X39A 2YWVA 1PXMA 4UXLA 3U4WA 1KE9A 3SGCA 1PY5A 2UW4A 4FR4A 4M15A 4YHTA 1OPKA 4AACA 1YOLA 4PWNA 4LOPA 4Y5HA 2X7GA 5AUVA 2PVLA 2PSQA 5EM6A 4BCGA 2RGPA 4F4PA 4R7BA 4GYGA 4DH3A 3CLYA 4GK4A 4IWDA 5GIOE 2UVYA 1ZXEA 2YHVA 3DXNA 3I1AA 3R2YA 3POZA 5EM5A 2BALA 3GC8A 5FP6A 4M68A 3ET7A 4C4IA 3R04A 4PF4A 1XWSA 1WCCA 1H24A 3AXWA 5M4IA 3JVRA 4Q2AA 4E93A 5J5TA 1AQ1A 4P4CA 3FZRA 2H34A 4WKQA 3FI4A 3GQIA 3DAJA 3NGAA 3WIGA 4AZVA 4F99A 4GL9A 2E2BA 2QC6A 3HMPA 4AU8A 4JOAA 2DQ7X 3B8QA 4BCIA 2QD9A 3DJ5A 3I7BA 4FIHA 3D4QA 3QHWA 2UW9A 2BRBA 4YPSA 4IWOA 3NIEA 4KKEA 4BDBA 4C62A 3DCVA 4JG7A 3D83A 2DWBA 3ENHA 4NCTA 2GHMA 3WZKA 4DTBA 2BAKA 4F0GA 2BAQA 2ETMA 2EXCX 1FOTA 2HCKA 3GUBA 4ANOA 2GHLA 3QKLA 4C37A 4J98A 5GNKA 3O50A 4HYUA 1J7UA 4I5MA 3IW6A 5FDXA 5FP5A 3W33A 4DE4A 4YO4A 4FYOA 2XJ2A 2BZJA 3ZSGA 4EKKA 4CYIA 4GU6A 4WBOA 3C1XA 5GZ8A 4GFOA 2R64A 5HG7A 3ROCA 4FEWA 5IQEA 3LOKA 3CTHA 2XM9A 2I40A 4G3FA 2A27A 2HAKA 3E8DA 3SW4A 2JD5A 2VTSA 3QRKA 2P0CA 5HCYA 2WNTA 4AF3A 2XIRA 4BWKA 2YM3A 1DI9A 3FZSA 4A9TA 4I22A 3ZZWA 4RLKA 5GIPE 2XKEA 2B4SB 3QTSA 2QLQA 5AP2A 1LPUA 5AX9A 3TL8A 1KOBA 5ETAA 4DEDA 4R1VA 5ACKA 2V7OA 2VTPA 2KTYA 3PIYA 3S3IA 4EK3A 1G8SA 2C5OA 1YWVA 2QODA 4ZLOA 4KD1A 3KXHA 4OGRA 2JDTA 3FL4A 4RFYA 2ZM3A 3MTLA 1Y57A 4ZY5A 2JFLA 4QQ5A 4I3ZA 5I9ZA 5M51A 4FTAA 3HMIA 5FXRA 3Q4TA 4PL5A 3E64A 2VRXA 5J9YA 3F9NA 1K9AA 4D2SA 3W1FA 4IM2A 4ZLZA 4B0GA 3ORNA 4RMZA 5EI8A 2P55A 4D4VA 4AZWA 1V1KA 3RM7A 4IX5A 3R8LA 4FTKA 4XH6A 3IO7A 2PVJA 3VS2A 3Q9ZA 3NAYA 3OOMA 2GSFA 3G15A 3RPVA 3ORTA 3D5UA 3LXPA 1VYZA 4X7QA 1OUYA 1YKRA 4HGEA 3VW6A 4EBWA 1XJDA 4QMQA 4D1XA 4W4VA 2OXYA 5HIDA 3U4UA 4C4JA 1PXJA 3PIXA 4JR3A 2VGPA 4BFMA 4GT4A 1ZY5A 3MH0A 1P5EA 4XJ0A 3W8QA 2YJSA 2C4GA 3AD5A 4KBCA 4AX8A 2W1HA 5J95A 3V8WA 3R1SA 3F66A 1WBTA 3FQHA 5E90A 4O81A 3WF7A 2OJJA 2VN9A 4ENXA 2HW7A 2PVRA 4JBQA 3GEQA 3FAAA 1JLUE 3NYVA 3OCBA 4TYEA 4DLIA 4K11A 2ZJWA 4KBAA 4WT6A 1SVHA 5LMAA 2VWWA 3BWFA 1HCLA 3VHKA 1R39A 3ZC6A 2JKMA 4CG8A 3TKIA 1ZYDA 5EDQA 3UOKA 2BIYA 2RL5A 3PZHA 4K77A 4TYHA 5E8SA 1O6YA 5I4NA 4EOMA 2X7FA 3W2PA 5HE2A 3C4ZA 4HW7A 1TKIA 3L8PA 4O7YA 2RFNA 1P4FA 5AA9A 2ERKA 2AC3A 2WMWA 4UWYA 4EK8A 3COIA 3JXWA 3FYJX 4U81A 4NW5A 4WG5A 5BMMA 4LI5A 4QTEA 3C4FA 4QMUA 5J79A 3UO5A 2C30A 2UZEA 3DGKA 4FGRA 4E3CA 2J0MB 3KMMA 2J6MA 4TWOA 5LMBA 4BCJA 1NW1A 4CFUA 1WVYA 3KVXA 1YHWA 3ENMA 4FE2A 3CR0A 1LEWA 3LZBA 4FG9A 4X0MA 3KXGA 4MXOA 5DIAA 2XM8A 5IKWA 1OIYA 2W1GA 4V0GA 2WZJA 3HEGA 3K5UA 5ANJA 3ACJA 5M55A 5I9YA 5AR7A 1Q3DA 4A9RA 5HTCA 1FMOE 2OF2A 2ZV9A 2QOOA 4ZP5A 4BCPA 4WSYA 4DEIA 4BCNA 4DFYA 1MP8A 5CEPA 4FKSA 5IA5A 3TV6A 3P7AA 4FGBA 4M0ZA 4I5CA 3ZSIA 5JGDA 1REJA 2OZAB 3CQUA 3UNZA 5IQGA 4IAKA 4USDA 3Q4CA 3R1QA 3C4EA 3GP0A 4UBAA 4XS2A 5E8VA 4O7ZA 5LCJA 4BC6A 1LR4A 4BYIA 3MN3A 3BU6A 4HVSA 3IW4A 3QLGA 5BNJA 4IB5A 2JFMA 2OFUA 3PRFA 3QTIA 1H4LA 4C4GA 4QQTA 2X1NA 4D4YA 1Q8UA 3PFQA 5HNBA 1I09A 2FSOX 3ULZA 4BGQA 1BL7A 1W82A 5K4IA 4DA5A 4FG7A 3BKBA 3JUHA 2G15A 4ERKA 3HAVA 2HW6A 3V5JA 3EKNA 4F7JA 3L9NA 3PDTA 3VQUA 1M7NA 3MVJA 3LM5A 4FSUA 4IEBA 3ZO3A 3IOPA 3BYVA 3C4WA 3JS2A 3P86A 5EYCA 4DCEA 1DAYA 1PHKA 2R3PA 4WOVA 4YJVA 3EQCA 4FZ6A 4K8AA 1GIHA 1YXSA 3RCDA 4YC6A 2J50A 5IG1A 4U7ZA 3C7QA 4PPBA 1OECA 4TYJA 4PNIA 4XP3A 3N4VA 5CU6A 4F09A 2PMNX 3LFBA 4L00A 5ANKA 4W9XA 4AE9A 5CEIA 2ZM4A 1UNGA 1FGIA 3PXQA 2YCQA 1IA9A 4ZTLA 2W9FB 2FSTX 2B54A 4O7WA 4FICA 4NM5A 5CYIA 4FKUA 5DH3A 4EH9A 4Z7HA 4MKCA 4TL0A 2GQRA 2ONLC 2WAJA 3PSCA 1B6CB 2CNQA 1YWNA 4IANA 5A9UA 4BDEA 2BTSA 2JDVA 2B9FA 3UO4A 3UC3A 1M2QA 3NNWA 4YJRA 3QL8A 3NDMA 3O17A 1KE5A 2X2KA 5IQHA 5C8MA 3KXMA 2GNFA 1HOWA 5H8BA 1S9JA 3KRRA 4YSJA 2BMCA 4KKGA 1Y6BA 2VTJA 3EWHA 3BE2A 3FLQA 3OUNB 3COMA 4LFIA 2OJFE 2C1AA 2C0OA 3MA3A 3W32A 4CLJA 4EOQA 1PYXA 2CNUA 3V8SA 2YDJA 3GU5A 3KN6A 1CTPE 4QMTA 4YHFA 4O7NA 3FI3A 5D7VA 4BKJA 5JK3A 2B9JA 4XEYA 3EIDA 5FEDA 3MH3A 3AC8A 4AGCA 3GU6A 4DEAA 1IEPA 4ZTMA 2W1IA 5IA1A 2PVFA 4IM3A 4WRSA 4TXCA 4ACDA 4ASXA 4AG8A 2QOHA 4AW2A 2W4KA 3F3WA 4EYMA 1YXTA 3JYAA 3H9FA 4MF0A 4TWNA 3VJOA 4OTRA 5A6OA 2VD5A 5IQIA 5M09A 4K18A 3BGPA 3EQBA 5CXHA 4N4SA 3TZ7A 5I9WA 4L7FA 4BDKA 2O3PA 4W8DA 4FSRA 1J7LA 3LJ0A 2GPHA 4QYFA 2P33A 2GCDA 3QD4A 4NKAA 3HDMA 4O96A 2PYWA 4I92A 1NVSA 3EQIA 3FZ1A 4JG8A 4QD6A 3PJ2A 5CANA 5IH5A 2V22A 2Z7QA 4XMOA 3FQSA 3UMWA 5CALA 2HYYA 4HNFA 4FZAB 3PY1A 4JL9A 4JQ7A 3NUAA 3DAKA 3P7CA 3U6JA 2UW6A 2WTKC 2H9VA 3QD3A 4Y83A 5EDRA 5I3OA 3BHVA 5ETIA 1G3NA 5CEMA 2WTDA 4YBJA 3RTPA 5A4TA 1GNGA 2XK8A 4OBPA 2PZRA 4JBVA 4FNWA 4IZAA 4QP1A 3MW1A 4QPAA 3LJ2A 4YLJA 2OKRA 4TNBA 3TUBA 3UQCA 3K5VA 3PYYA 2C3KA 2QKRA 3QD2B 2QO2A 4RA4A 5HORA 3A4OX 5EM7A 1YI3A 3UBDA 4DT9A 5BVEA 2C6IA 1BI8A 5DN3A 3S4QA 4F7LA 2PE1A 5JZJA 3N4UA 2GNJA 3ANRA 4DH8A 3L9MA 2ITQA 3CD8A 2GTNA 5E8ZA 5HVJA 3GI3A 5LJJA 2GU8A 3KK8A 3OS3A 3SHEA 4NZWB 3LLAA 3AD4A 4FV2A 4PQNA 3V5WA 1U54B 1IASA 2P4IA 2QU5A 2OIDA 3WYYA 2PZPA 3MY1A 3OP5A 4S31A 4RVLA 4AZEA 4J8NA 5CVGA 5KMMA 4PL4A 4XOYA 4HVIA 4J53A 4UMTA 5HE1A 1FPUA 1GZKA 4I24A 4C34A 3HNGA 3ZXTA 2WMSA 3TI1A 3PJCA 2RG5A 3G9LX 1PMEA 5EHYA 2NO3A 3D2KA 4RVTA 3D7ZA 4NH1A 4X2JA 4DH1A 4DTKA 3PVBA 4F6SA 3W16A 2XJ1A 3KRXA 5CU2A 4TYGA 4B8LA 3ZRMA 4OTPA 1TQPA 4FT7A 3ZLYA 5KMLA 3C9WA 2XYUA 1Q4LA 1W83A 3F2NA 2A4LA 4JIKA 3VS3A 1WVWA 4MD9E 4QTDA 4S32A 4BDDA 4JJRA 4L3LA 4BGHA 2QHNA 4FODA 1ZZ2A 1JSUA 5JEBA 1OBDA 3S0OA 2QOKA 3AMYA 1KWPA 4FOBA 4YHJA 1YVJA 2PE0A 2Z7SA 5EOBA 4FEXA 5AV3A 1F5QA 4KSPA 2BR1A 2HELA 4W4YA 5CLPA 3MPTA 5EHOA 5CT0A 2WXVA 5LMKC 5IA4A 4DF3A 3EMGA 3FLZA 3ODYX 4ZS0A 5HLPA 4FKLA 4H58A 2UUEA 3LCSA 4J99A 4JX3A 1WVXA 5CSPA 2HZ4A 4GEOA 4EQCA 2PUPA 5E8XA 3DK7A 3TZMA 2WFYA 2E9UA 4P5ZA 3R7YA 2SRCA 2BRHA 4FIFA 2XK6A 1H00A 3C13A 1Q5KA 3F5UA 4P90A 4ZSAA 3DFCB 2OZAA 1YHSA 2C3JA 4A9SA 3UNKA 3ULIA 3V8TA 2R7IA 4QO9A 4FYNA 3R30A 2ESMA 3WOWA 4D28A 3PXKA 3ORXA 4ARKA 4CSVA 2CKOA 4KNBA 4W8EA 3FZOA 4D2WA 2R3KA 5LVLA 4GV1A 4YJTA 4LOQA 2Y0AA 3E92A 5BUJA 5BYLA 5IQBA 3I5ZA 3GCUA 3FE3A 1GZOA 5HIBA 3TNWA 4PX6A 5HD4A 5D41A 4I0TA 5AP0A 3QRUA 2J51A 4IVBA 4XV2A 3FC2A 5BUIA 4HCUA 3E8EA 5JKGA 3VVHA 4FTCA 3P08A 4CFNA 1RJBA 4YJSA 5AR2A 4WRGA 4FT0A 3UDBA 2JKQA 4O1PA 5CU3A 5BQ0A 4EORA 3KF7A 3ZDIA 5EH0A 1W0XC 4M12A 4XBUA 4ZSJA 3E63A 4AN3A 1P14A 4ZJIA 1U5QA 4IWPA 5FGKA 3QTZA 3S1HA 4I6HA 3HLLA 5HOAA 3R8ZA 3V5PA 4DC2A 4YC3A 3DXQA 5E4HA 3R71A 3VS7A 4D2PA 4J52A 3FMMA 4AZSA 3G6HA 1L3RE 1YQJA 2BHHA 4I5PA 2V7AA 3JY0A 3F3TA 4FTOA 3QXOA 4XYFA 4FL3A 3KFAA 3PY0A 2BDJA 2ZMCA 3UPXA 3U9NA 4HZRA 3CTQA 1M14A 4E4MA 4JR7A 3UOJA 3DLZA 2RG6A 3KB7A 2WMBA 3UVRA 3UZPA 3EH9A 2W17A 5IPJA 3PJ3A 3GGFA 1FVVA 3OG7A 5J9LA 2PWLA 4CKJA 4MWHA 4QP8A 1ZY4A 3DBCA 5BUEA 4A7CA 4EZ7A 4JBOA 2XK7A 3KXNA 4FSTA 3NW7A 1TVOA 5KMNA 4O83A 4FTUA 3ZYAA 2AYPA 2UVZA 4AS0A 1BLXA 3EQFA 4U45A 4AWIA 2R3GA 4G2FA 3R7VA 3RM6A 4BKZA 3FPQA 1H25A 3G51A 4QMNA 3NUNA 4YJQA 1OI9A 3E3PA 2XNEA 4G3GA 3LHJA 1E1XA 4IDTA 3BYOA 2R0UA 2C5NA 5KMIA 2Y8OA 1GZ8A 2DYLA 3L8XA 4GG5A 4I6FA 5DOSA 5CASA 4FV0A 3GU4A 1RQQA 2QOBA 5CQWA 4XV3A 4O0TA 5EDPA 3RHXA 2GFCA 3LFCA 4DG0E 4JQ8A 4FNZA 2BVAA 3QZGA 3MH2A 4U79A 2A2AA 5IQDA 2OO8X 2HOGA 4EUUA 4OBOA 3A2CA 4BCFA 2PPQA 3VS0A 3C50A 4FKVA 2PZIA 3ZEWA 5HLWA 3R7GA 3KF4A 4ZY6A 4M8TA 3ZZEA 4E4XA 5BVDA 2WD1A 4J7BA 4H05A 2GDOA 4L53A 4L3JA 3WZEA 4F08A 2G1TA 5DI1A 4HGSA 2PUNA 2Y6OA 3O7LD 2OI4X 3TJDA 4Z3VA 3QFVA 1LUFA 2GS7A 2PK9A 4RJ6A 4BCMA 3MB6A 2C6MA 2J7TA 4M84A 4BTJA 4Y8DA 4L6QA 3OZ6A 2YERA 1RDQE 1ZMVA 5DE2A 4OUCA 3QQJA 2VO3A 2J4ZA 2ZDTA 4KB8A 2BTRA 4NK9A 5AFVA 2UZOA 3U51A 1U4DA 3DJ7A 3PG1A 3SRVB 4HYHA 3NAXA 4XG7A 1YXVA 4X6QC 3VUHA 2QU6A 1OIQA 3DZOA 3SXSA 1J1BA 4C2VA 4F9CA 4IAYA 2ZV7A 3GNIB 3PXRA 1WFCA 5HNIX 3UYSA 1U46A 2B7AA 4L42A 4MBLA 5AA8A 2R3JA 4RIWA 3IDCA 1QL6A 2RFEA 4RGJA 4TPTA 4EZ5A 3VUIA 2FGIA 2JLDA 2WIHA 4NIFB 4Y46A 2E9VA 4X21A 1YI6A 1IAJA 4EH2A 3QA0A 2RFSA 3U6HA 4QYHA 4JRVA 3HMNA 5CX9A 3EQRA 3PZEA 3RAKA 3UP7A 4IMYA 4AT4A 3UGCA 1NVRA 4F6WA 2E9NA 1FINA 3OT3A 4ZAUA 3SX9A 4FVQA 4MD7E 3TV4A 4CCBA 4EWQA 2FSLX 4NYEA 3CE3A 1TQIA 1H0VA 4C3PA 3R22A 2X0GA 4PTEA 4PV0A 3OBJA 2F2CB 1Y8GA 3FHRA 2J0IA 3EFJA 4UMUA 4I1ZA 5H2UA 3H30A 4II5A 4ZTSA 2HWOA 3FKNA 2QR8A 4DCAA 4KIOA 3HZTA 4KBKA 5I9VA 5A14A 5TO8A 3HX4A 4EHVA 1M2PA 1UV5A 3LFNA 4FIEA 4DG3E 4DEGA 4IWQA 2R4BA 4RIOA 4RC3A 5E8WA 3CGFA 3PWYA 4D5KA 2EWAA 4IHPA 3M1SA 5AP7A 2FVDA 3EN7A 3PRIA 4FKPA 2Y7JA 4H3PA 2O65A 5L2SA 3WE8A 2W1EA 3KRLA 4FF8A 1OKVA 3OW3A 3QQGA 3AC5A 3AG9A 4CFXA 1H1SA 1OPJA 4V01A 1V0OA 2B52A 4CFVA 2GNHA 5K9IA 3E62A 4RQKA 3AQVA 5L2TA 5HU3A 1P4OA 4D4RA 4O91A 2E9PA 3NUPA 5E92A 5DHJA 4Z9LA 5L6PA 4E6QA 5I3RA 4S34A 3QD0A 1OL5A 3ZLXA 5IZFA 2C6KA 4A4XA 5FWKK 5AUZA 3Q5ZA 2HXLA 1ZOGA 5IH6A 3NPCA 4O0UA 2HXQA 4ACHA 4UN0C 3DBFA 2BZHB 2CKPA 1Z5MA 5TF9A 1K3AA 2R7BA 4FKJA 2ETRA 4FV3A 5HICA 1VZOA 1BL6A 3UOHA 4G1WA 1K2PA 2WMUA 1PXKA 3KRJA 1KSWA 4EEVA 4AZFA 5DPVA 4KSQA 2P2HA 5T6KA 2Q0NA 4RSSA 2UZTA 4F1TA 4C4EA 4LRKA 2VX3A 3KK9A 2OU7A 4YNOA 4CTCA 3G90X 4OTWA 2X81A 3ID6C 2O5KA 1XH9A 3FI8A 4M67A 3UG2A 2C6TA 4H3QA 3AC2A 4AP7A 3I7CA 4OW8A 3UO6A 3H0ZA 2YM8A 5HHWA 3V5LA 4L3PA 2QO7A 1EH4A 2Y4PA 4GIIA 3CGOA 4DGGA 3LAUA 4WBBB 3RHKA 3BYMA 3NUSA 3PXYA 4I21A 3FXWA 3R83A 4Z7GA 4QMLA 2PVHA 2HY0A 3QALE 1YW2A 2UZBA 4QT1A 2UW5A 4D0XA 2UZLA 5ICPA 4O22A 1NA7A 3NSZA 3HL7A 3H0YA 2WMQA 4O0WA 2JKKA 4FKQA 2PTKA 4I0SA 4XV9A 4YZ9A 5C9CA 2HK5A 3I4BA 4PMSA 5B2LA 1FGKA 4GT3A 2FA2A 2YWPA 4CZUA 4LRJA 3KREA 3B8RA 4IIRA 4FTQA 2YZAA 4NW6A 4RLLA 5CS6A 4DHFA 3F61A 1ZOHA 3NNVA 3MIYA 3ORZA 3SDJA 3NRMA 2IPXA 1YI4A 3VO3A 2ZYBA 4FTLA 3DKOA 5EI2A 3OW4A 4XUFA 1O6KA 2X8EA 3D94A 1PXIA 5M44A 3Q32A 1R1WA 3IGGA 4ACMA 2XNNA 4NSTA 2IO6A 4W9WA 3ZH8A 2EB2A 3PUPA 3FZTA 4RX7A 5JRSA 2JGZA 2BUJA 3DBDA 4CT1A 4ZZMA 5ANGA 4MBJA 4ACCA 2VO0A 3R1YA 4JG6A 4OTIA 3TACA 5L2WA 3R7EA 1T45A 3R9NA 4XG3A 2W5BA 3JY9A 3PY3A 2NP8A 2R9SA 1A48A 3BV3A 4JDIA 2XH5A 3GC7A 4ZK5A 3R9OA 2Y9QA 2UZVA 2WMRA 3F69A 4O21A 4UEUA 2CKEA 2QOQA 2LAVA 3WZDA 4QPMA 5DRDA 2XKCA 1Q62A 2O63A 4MF1A 5M4FA 4O7SA 3EKKA 3ANQA 3I81A 4FL1A 4X3FC 3WE4A 5BVOA 3FBVA 4FIJA 5IDNA 2QG5A 2YCSA 3H9OA 4MX9A 4C0TA 5CZHA 2QO9A 2OZOA 4HCTA 4DBNA 2YLEA 2CN5A 3D9VA 3QTXA 4N70A 3E88A 3GBZA 2GQGA 3P1AA 3ALNA 3Q6WA 4YJNA 4EK6A 3CC6A 3QCYA 2J5FA 1ZYCA 2IZUA 2ITPA 4C02A 3PSBA 3L1SA 1KOAA 4WSQA 1UVRA 4DH5A 4Y72A 4AT5A 5FXQA 2H8HA 5ITAA 2YITA 3SG9A 3W2SA 5CF8A 5HCZA 1UU7A 2QURA 3DTCA 4L43A 3LJ1A 3VBQA 4G5JA 3TG1A 3QQFA 2V0DA 2X2LA 3NVMB 4CCUA 3UMXA 3IW7A 3LFEA 2B0QA 2GQSA 1QPJA 4R3CA 3HECA 2UW8A 4A9YA 5F95A 2ITVA 1J3HA 4XRLA 5CEKA 5D1JA 5HLNA 3BHTA 2OIBA 4E5WA 3GC9A 4RVKA 3QCSA 3QWJA 3R73A 4FSZA 3NW5A 2C47A 2I1MA 3ERKA 1KV2A 4FMQA 2VTOA 3P4KA 4RIYB 4AW1A 4ENYA 3O96A 5KMKA 1G8AA 4AN9A 2YISA 4BWPA 4EOLA 3VS1A 5FBOA 1H1QA 2REIA 5EM8A 3E3BX 3DS6A 4O0XA 1SMHA 4R5SA 4XLIA 1CDKA 2CGUA 2BRMA 4FKIA 1MRYA 4YGAA 3HMOA 3MVHA 3HA8A 4M7IA 3ZO1A 3EL7A 4AA4A 4HVHA 5KNJA 4RPVA 2W4OA 3TEIA 4EL9A 3BBWA 4PTGA 1O6LA 4FI1A 3BQRA 5B0XA 4EH5A 3CY2A 4PY1A 3FDNA 4Y73A 3TWJA 3ZTXA 4YUQA 3Q53A 2FYSA 3WIKA 2GNLA 5CXZA 5BVKA 3BEAA 3REPA 4QMWA 4ITIA 2YM6A 3EB0A 2R3OA 4KS8A 1YDSE 1R0PA 5ETFA 4YZDA 3UE4A 4PP7A 4O7RA 4E5AX 1ZMUA 2PHKA 2G2HA 3ZXZA 5A6NA 3T8OA 1A9UA 4W4WA 2J0LA 4MVFA 3POOA 3R0TA 4GCJA 4E1ZA 1H27A 4R3PA 3OF0A 3VUMA 3GCPA 4F7SA 2XEYA 3OBGA 2WELA 4UZDA 1WBNA 3ZCLA 2QR7A 3OFMA 2XF0A 2VZ6A 5AP4A 1VR2A 2WPAA 5CWZA 1NT2A 1PXPA 4EOKA 4M69B 3DKCA 5JN2A 5BPYA 5CI6A 3VWAA 4OTDA 4FEQA 1NY3A 1H07A 1WBPA 4EH8A 3WILA 2QOIA 3GFEA 2QCSA 4MK0A 1ATPE 5TKDA 2QG7A 2Z02A 4APPA 2IVSA 2WQNA 4O2ZA 3QRTA 1DS5A 2C6EA 4RJ3A 2VUWA 1UKIA 3RWQA 3OY1A 5ANOA 4E4NA 4C2WA 2V55A 3R7UA 2C0TA 2BFXA 4CZTA 3FMKA 4FIGA 1CKIA 4IX6A 4O7LA 4RIXB 2XVDA 4KABA 5DFPA 4OAVB 4DAWA 4DTAA 3TT0A 2R3NA 3KCKA 5I9UA 1YOMA 4NUSA 2XRUA 3W8LA 2VWZA 3CBLA 3ODZX 3PSDA 5C8NA 5FUTA 2JIIA 5BX0A 4XX9A 4F7NA 4AW5A 3F7WA 3R9DA 4O7VA 2VWBA 1UKHA 4TKSA 3TDVA 3FC1X 2J2IB 2UZDA 4C8BA 4HJOA 3P0MA 4C3FA 4R7HA 3UODA 4C61A 2I0VA 3TV7A 1Q3WA 2WMXA 3E93A 1PXLA 1WBVA 2PVYA 2VTMA 1DAWA 2BDFA 2C6LA 2O64A 2YA9A 2AUHA 3RAHA 4TYIA 3IOKA 3I5NA 4U44A 4EYJA 5HTBA 5GZAA 2XNBA 3RNYA 3V01A 3ZSHA 4DYMA 5HQ0A 5JGBA 3KGAA 5M4CA 1OL7A 2OICA 2UV2A 5C01A 4FVPA 5AR3A 2FH9A 3QTWA 4KA3A 2GTMA 3BZ3A 4K2RA 1Q24A 4MXAA 3TCPA 5GHVA 1UU3A 3OHTA 4GS6A 4XOZA 3NYOA 2X4FA 2WEVA 4HVDA 5CTPA 4FEUA 1SZMA 4TNDA 4I5HA 3UIUA 3L9LA 4HNIA 1UWHA 4O6LA 3BHYA 3K54A 2VV9A 5CVFA 4BDHA 5IMXA 3PLAE 3FKLA 3OXIA 3OUKA 3RPYA 2WHBA 3VBVA 4E7WA 4R77A 2XKFA 5IUGA 4FOCA 3O2MA 3JPVA 3A7FA 5D11A 3T9TA 5G1XA 3EQPA 4FK3A 1PW2A 3DK6A 2R3RA 4ORKA 3D5XA 4XBRA 4FTTA 4YMJA 3SVVA 3ORMA 5HG8A 4ZIMA 3UJGA 4D2VA 3H4JA 4U0IA 3LIJA 3QZIA 2ZM1A 3K3IA 4NM3A 5LVOA 2XRWA 3CXWA 3VUKA 3Q3BA 2F2UA 3TUCA 1XO2B 3SOCA 3QTRA 4V05A 4JRNA 2W05A 3BPRA 1URCA 2GNGA 3W10A 4PMTA 2R3QA 1GZNA 5EW3A 2UZUE 2CCHA 3LKMA 4D55A 3DZQA 3CP9A 4HGLA 4KKHA 2PL0A 2BRGA 3O51A 4GVJA 4J96A 4RWIA 3GCVA 4I94A 4BI0A 3QQKA 5KHXA 4CMTA 1LP4A 4BZDA 3O23A 3GCQA 5AUUA 2C5XA 3P9JA 2WTKB 4TY1A 3D15A 5FTOA 4APCA 5A46A 5CAOA 2VTRA 1YDRE 2DS1A 4AW0A 2YIQA 4BDGA 4YU2A 2AC5A 3MFUA 4DGOA 5IH4A 3L8VA 2B55A 3VC4A 1PKGA 4IX4A 4IX3A 1JWHA 3BHHA 1YWRA 2OJIA 3B2TA 3BV2A 2HZ0A 3QAME 5ANIA 2J0KA 4NKSA 4Y85A 4AGWA 3F7ZA 5E8YA 3BYSA 5CSVA 3VUDA 3MFTA 4CLIA 4EK5A 1YXUA 4BCQA 4QP4A 4IW0A 4CKIA 5LVNA 4JX7A 5AIKA 3LFAA 5AAFA 1P2AA 1ZAOA 1RW8A 3UG1A 1JSTA 3VBXA 4EI4A 4RT7A 3PVGA 3GC0A 2VX1A 4W4XA 1V0BA 4O86A 3AC1A 3SD0A 3TNIA 5AV2A 4I23A 4EZ3A 5KBQA 3G5DA 1KE7A 3BI6A 3GT8A 4JVGA 1QMZA 1JAMA 5CSXA 3ZBXA 4ZY4A 4QP2A 4BBMA 4D5HA 4UWBA 3FYKX 4CRSA 2WTCA 4PMMA 1OL6A 4OLIA 5EFQA 2J0JA 3P78A 5K4JA 5B2MA 3MESA 3ATTA 4JT3A 2FB8A 3DT1A 3TZ8A 4CRLA 4C58A 3GENA 5IQAA 1NXKA 2OF4A 2Q0BA 2WGJA 5HO8A 3W55A 4D9TA 1XHAA 3EQHA 3KU2A 3HMMA 2PUIA 3KVWA 2B9HA 3GCSA 2W5AA 4WNKA 5AR5A 1XH5A 5DRBA 4ASZA 3QGWA 2YEXA 4KIKB 2CLQA 2YIXA 4L52A 5EW9A 2W7XA 3V3VA 2CCIA 2Y4IC 3AGLA 3PPZA 5LVPA 5IUIA 4MNEB 3RJCA 3FJQE 4GJ2A 4QTCA 2ZAZA 4ANMA 2VTQA 2WU7A 5T68A 3PPKA 3RCJA 1WBWA 4UX9A 2YIWA 2HZIA 1Q8WA 1Q61A 4TN6A 4AE6A 3RAIA 3LCDA 4RBLA 4E26A 3UVPA 5L3AA 4IXPA 4XV1A 4BZOA 4EOSA 4ALWA 1MQBA 4OAUC 3N51A 3LLTA 4D4SA 4JAIA 2WQOA 5HO6A 5E7RA 1SVGA 1M2RA 1ZYLA 3MYGA 1R78A 4H39A 4YO6A 3R01A 4I4EA 5DYJA 3VBWA 2ITYA 3LXKA 3R8PA 3MGYA 2HZNA 3OVVA 3RP9A 3UQGA 3QYZA 1H0WA 5CQUA 5JT2A 2UW0A 3ZUUA 4C35A 2XK3A 5M08A 3GU8A 5LCKA 2OJGA 3O7LB 4MNFA 1QPEA 5LQFA 1W8CA 1Y91A 3FMEA 3AC3A 4GU9A 3SLSA 4A4LA 2V5QA 4KS7A 4QNYA 5E91A 3NCZA 2ITUA 4IJ9A 3BU5A 4Y95A 3VIDA 3T3VA 4BIEA 3FUPA 4IQ6A 2W1FA 3HP2A 3UC4A 3ETAA 4QRCA 2QVSE 4TZRA 2I6LA 4RX5A 4F70A 4DFUA 2OXDA 3I60A 4RWKA 3MI9A 5FM2A 3FEGA 3A8XA 4GG7A 2XBJA 2PVKA 4RJ8A 3GFWA 3QKKA 5CNOA 4BY9E 2CGVA 5HESA 3DK3A 1OVEA 2GS2A 2YIYA 4DT8A 4RC4A 3IECA 2CKQA 1H1RA 2VWYA 5F1ZA 1H01A 2JDRA 4Y5QA 4FV5A 4BKYA 5DR9A 3FLSA 3VN9A 3A99A 3BLHA 2RIOA 2Z7RA 4H1JA 2CPKE 4A4OA 2VO6A 4G9CA 4GJ3A 5K0XA 2EXEA 3BELA 4LV8A 4RIXA 4GYIA 2ITNA 4CFWA 4QMOA 2ITWA 1PYEA 2G2FA 2WMTA 2PMLX 1URWA 2IW6A 5AP1A 3LFFA 3VUTA 2R3IA 2C3IB 4KIQA 3PVUA 4C57A 1OZ1A 1BI7A 4N57A 3R8UA 3U9CA 4WHZA 4ACGA 3TUDA 4ZS4A 5J7BA 3R28A 3DFAA 4HZSA 3MPAA 4LL5A 3QLFA 1YDTE 4PTCA 5AJQA 2JBPA 5DLSA 3EL8A 3WBLA 4YTFA 2B1PA 5D7AA 3FY2A 4BHNA 4GW8A 2PUUA 4TRLA 4YJUA 5K5XA 2IVVA 2XJ0A 1U59A 2PVNA 2YZLA 3NWWA 4ITHA 2YLFA 2F57A 3R8MA 4BIBA 2OWBA 4AFJA 3MWUA 2FO0A 5FG8A 3VQHA 4XG8A 4DH7A 1XBCA 3TIZA 4CV9A 4L7SA 5C4LA 3C0HA 3F5GA 3OXZA 2XCHA 5DG5A 2HY81 2JKOA 1VYWA 4YTCA 5H8EA 4NCTC 3PG3A 3AT3A 4BB4A 1Z57A 4FTNA 2CNVA 4KIPA 4NFNA 4CQGA 4ZTRA 3BEGA 4B8MA 3SAYA 3RINA 4WNMA 3I79A 4AUAA 1XR1A 2ZDUA 4HPUE 4AAAA 1XBAA 3GB2A 4IAIA 3R8VA 2VWUA 2XYNA 3SQQA 2BFYA 4O1OA 4QMMA 3QF9A 1Q97A 3QA8A 4DEBA 4BF2A 5M57A 4O38A 4RJ5A 4UMQA 4D9UA 2O8YA 2XIXA 3BQCA 2R3FA 2W99B 1IRKA 4U9AA 4PPCA 3BLRA 3VNTA 3C0GA 2W5HA 4FVRA 5D10A 4XP0A 2QKWB 3NEWA 4IVDA 2C1BA 3NCGA 3AD6A 2W0JA 3CSVA 3O8UA 2QHMA 2ETKA 3HV3A 4LM5A 4WO5A 3PP1A 2W4JA 1QPCA 4LQMA 3DBQA 3EYGA 3RMFA 4CGAA 2ZMDA 3P79A 4IZ5A 4BCKA 3CY3A 3SXFA 4BWXA 2JEDA 4BDFA 3CCNA 3GVUA 2EXMA 5DGZA 1PKDA 1X8BA 3DLSA 3VS4A 5I0BA 1OL2A 3QBNA 3H3CA 5F94A 3SG8A 1DM2A 4C59A 3RNIA 4GUBA 1YOJA 4EH7A 2Q83A 4JS8A 3ZDUA 4RX8A 2O2UA 2WTIA 4H3BA 1G5SA 4ZSLA 4EH4A 4J8MA 1JKLA 1S9IA 3FMJA 4AA0A 4GRBA 4HGTA 3M2WA 3ZOSA 5AM7A 2OH0E 4O6EA 5AAGA 2LGCA 3PA3A 4JDJA 5HZNA 3ATSA 3JR1A 3RALA 4R3RA 1FVRA 3WARA 3C5IA 4EJ7A 5J87A 1PRYA 4QP7A 3RAWA 4DINA 1XBBA 3WI6A 3EQDA 4XHKB 5J7HA 2B9IA 1ERKA 4QMVA 5CAPA 4YLKA 3DDPA 2XZSA 1XQZA 5G6VA 2ZB0A 5DVRA 4O7TA 4FL2A 4ZMFA 5BVNA 3MVLA 4YBKA 4QYGA 4EC9A 2YM7A 2VO7A 1PJKA 2CHLA 3CPBA 4UV0A 3SKCA 4Z16A 1Q8YA 2G9XA 4M3QA 3Q4ZA 5ETCA 3LXLA 4BTFA 4D1ZA 4PRJA 2ITXA 3Q52A 5HE3A 2CDZA 3GOPA 3OWKA 5EW8A 3VHEA 5GZ9A 4BN1A 5AM6A 4DGNA 4ERWA 4ZJVA 1OB3A 2CGWA 4AQCA 4L45A 3ACKA 3GU7A 3LCOA 5M53A 3LMIA 3ROYA 4TYHB 5GJGA 4FSQA 2NNWB 4FEVA 2ERZE 3G2FA 4QTBA 3BX5A 4KWPA 4MXCA 3FHIA 5CZIA 4EOOA 3IW8A 4MBIA 5EQEA 4NFMA 2JAMA 4TWPA 3VAPA 1U54A 2YDKA 2YIRA 5AP5A 4GKIA 1ND4A 5AEPA 4AOJA 4D2TA 3QQLA 3MFSA 4HCVA 2IW8A 4RQVA 3TXOA 4MNEA 4NT4A 2WTJA 3DNEA 5DMZA 4IACA 3LW0A 3UZRA 2H6DA 3PXFA 4KAOA 2W1DA 1SYKA 3QZFA 3AMBA 4AOTA 4D58A 5HVYA 5D12A 1APME 2JDSA 1UU9A 4V0GB 3II5A 3BLQA 2XBAA 3DKFA 4EKLA 4UWCA 4UB7A 5A4CA 3FQEA 3MB7A 4FZDB 3HV4A 3QUEA 5JGAA 3OC1A 1KV1A 2J9MA 4U5JA 1GIJA 3QU0A 3I0OA 3EYHA 5E1SA 4ZLYA 1B39A 4IH8A 5I5ZA 4U3YA 5LMKA 5HI2A 1UNHA 3ZS5A 5A4QA 1J1CA 1M17A 4EBVA 2VGOA 2WQEA 4YJOA 3EN6A 4GVAA 2VTAA 2VTTA 5J9ZA 3O0GA 4G3DA 2Z8CA 1OIRA 3CS9A 3LFSA 5K0KA 1IR3A 2FSMX 5JSMA 1I44A 3FLYA 2P3GX 3F82A 4L9IA 4Q9SA 4PL3A 5HG9A 4O0VA 4E4LA 1WAKA 4G6OA 4I4FA 3ZRKA 4Q5HA 4YZMA 3C51A 4DEEA 5KX8A 5FQDC 4CMUA 3I6UA 3TKUA 4G6LA 3V5QA 4IC8A 3HP5A 3KA0A 5T3QA 4F63A 3EFLA 2YM5A 4PDSA 4RWLA 3UIBA 3P5KA 1M52A 4A07A 4NTTA 2PULA 1PMNA 4GK3A 3QX4A 4UYAA 2XS0A 2F7EE 3LXNA 3QQUA 3U8WA 2BCJA 1PXNA 3MY0A 4BRXA 2ZV2A 3DV3A 3Q9XA 1LEZA 1SNXA 1UA2A 2OK1A 4AA5A 2IWIA 2OLCA 1H1PA 2PZ5A 3B2WA 4CD0A 3FWQA 2A1AB 3V04A 4DITA 3D14A 3O8TA 3ZHPC 3TJCA 5EKNA 1H8FA 3KULB 3MFRA 4K6ZA 4MAOA 4K9YA 3TNQB 2OBJA 4QMYA 5H8GA 3UOLA 2ITOA 2H96A 3KC3A 2BILB 5FBNC 4YPDA 5CSWA 3RZBA 3KMUA 4CT2A 3LVPA 4PPAA 3BGQA 3EJ1A 3PA5A 1OKZA 4AXAA 3NMUF 3D2IA 1U5RA 3AT2A 1ZYJA 1ZYSA 3O8PA 4IVCA 4DGLC 2GNIA 3D7TB 3NR9A 3Q9YA 4XG6A 4ZSGA 3FLNC 4FNYA 4USEA 2I0YA 1YXXA 3MH1A 4S2ZA 1JBPE 5HEZA 2YCRA 3MJ1A 4YJPA 3OTVA 3ZFMA 4ANNA 5CAUA 5KMJA 4FK6A 4FA2A 5CF5A 2J90A 3IONA 4NJ3A 4I6QA 5CEQA 3TNHA 2C69A 4AOIA 4C4HA 3ZONA 1V0PA 5AR4A 3D5WA 4HPTE 3ORLA 2XIYA 3OWPA 1R3CA 2NPQA 2F7ZE 5L8KA 1RE8A 4BDAA 2CN8A 2X9EA 3FMDA 3MVMA 5HBJA 3A8WA 4EHEA 2JC6A 2UW3A 2ITTA 3D0EA 5EI6A 5D9HA 5A3XA 2YN8A 2WKMA 4ANSA 3C0IA 1KUTA 3F6XA 1WBSA 5EG3A 4MXZA 5IA3A 3MIAA 2OH4A 2QNJA 2YJRA 4EHGA 3IQ7A 1SNUA 4ZZNA 2XMYA 5C27A 5AP6A 1OUKA 4I6BA 5DEYA 3VF9A 3IDBA 5C26A 4MCVA 3KY2A 4X3FB 4MQ1A 4L67A 3F5XA 4FKTA 2XKDA 3E87A 2YAKA 2J5EA 1SM2A 3HV5A 4KRDA 5ANEA 5IA2A 5IA0A 3RVGA 3DB6A 4FV1A 4YTIA 4MTAA 3KN5A 5HKMA 3ZO4A 4E6DA 2QLUA 4BTKA 3IPHA 3WF8A 3TN8A 3LCTA 5JQ5A 3EZVA 3R21A 4UZHA 5CF6A 2UZNA 1REKA 3OWLA 2RFDA 4EONA 3LPBA 1JOWB 2JIUA 3NYXA 4O0RA 2VNWA 3IK3A 3COKA 3MA6A 4IZYA 3DTWA 5HIEA 4EH3A 1J91A 3SV0A 4JNWA 3DPKA 4FV4A 2CLXA 4P2KA 3HDNA 4EJNA 1OKWA 4AZTA 2I7QA 1IG1A 4X2FA 3R7OA 2YCFA 3K2LA 4K33A 2WTWA 2PY3A 4U42A 4HVGA 2G2IA 1OMWA 5CU4A 2A19B 3DA6A 3NZ0A 5DT0A 4GT5A 3KXXA 4OTHA 3R02A 3OEFX 4C36A 2BROA 2OSCA 3NVKI 5BVWA 1Z9XA 5HE0A 3GQLA 2IZRA 4M97A 2WQBA 3BHUA 1QPDA 3NX8A 3AOXA 3NW6A 3F3ZA 3IGOA 3THBA 1CSNA 3IDPA 3HRFA 3WZUA 5CNNA 2BKZA 4ONAA 3LM0A 2VTNA 3L9PA 4RC2A 3RK9A 4C33A 4MQ2A 4F9WA 4OBQA 3W2QA 3ZC5A 5A4EA 3BWJA 4G6NA 4J97A 4IC7A 1CKPA 4O82A 3GXLA 2UW7A 4JI9A 1T46A 3CKWA 5H9BA 5KUPA 1QCFA 4P7EA 4U8ZA 5AR8A 3SRVA 4FV9A 1PXOA 3FLWA 4O84A 4RZVA 4CZYB 3I6WA 5IU2A 4IB3A 2IG7A 4DLJA 4X2KA 3HRCA 4E5BA 4FBXA 2WB8A 3PJ8A 4F64A 4XLVA 3ZLSA 4X6RA 1YHVA 4JAJA 2R5TA 4WIHA 4LGGA 5L6WL 3TTJA 5EKOA 1CKJA 3R63A 2W1CA 4FSYA 4NIFA 4D2RA 4XG2A 3CTJA 3OD6X 3ORPA 4IB1A 3CPCA 4CVAA 5M4UA 1ZZLA 4R1YA 4YURA 1XH7A 4QPSA 2F9GA 4M14A 4C3RA 4YR8A 5TR6A 1ZLTA 4G5PA 4X3JA 4AN2A 2NRYA 3ZM9A 4EQMA 2BHEA 3H9RA 4C4FA 1JVPP 4F0FA 2ZV8A 4U40A 3MS9A 3BYUA 3BRBA 4BBFA 3U54A 3HA6A 4C38A 2ACXA 3CJFA 3DBEA 4DFLA 4BI2A 4FKRA 4RZWA 4D0WA 5IUHA 5AUXA 4H1MA 1A06A 3UYTA 3QX2A 3R9HA 4V04A 4DBXA 5FD2A 2C0IA 1BKXA 4L44A 2RKUA 3EN4A 4R5YA 2XIZA 3ITZA 3KEXA 4JBPA 4LRMA 5IISA 3HAMA 2XNMA 2QOCA 4HYSA 4PUZA 2WOUA 2VTHA 4IAZA 4BL1A 3O71A 2WMVA 2V62A 4KUJA 4MH7A 5TT7A 4AFEA 3Q60A 5H3QA 4LL0A 4UMPA 2IJMA 4CTBA 4KRCA 3TKHA 3OXTA 3NIZA 5J1WA 3IG7A 2GHGA 2BPMA 3DXPA 3WF6A 1WZYA 5K5NA 4QOXA 1O9UA 3TZ9A 3PE1A 1CM8A 5AMNA 5DNRA 2WQMA 4ASDA 5HO7A 4IVAA 2BAJA 5CEOA 4WUNA 5E1EA 4I41A 4EQUA 3FPMA 5EHLA 4LMUA 3G0FA 4R8QA 5EQPA 5HTIA 3A4PA 4N6ZA 2IVTA 3OY3A 4PP9A 1MRUA 4MEDA 2A0CX 3HGKA 3KL8A 3WF5A 2XEZA 3A7JA 4QMXA 3LQ3A 4J1RA 3RGFA 3KCFA 3QRJA 3DQWA 4O0YA 4EHZA 3F88A 3HV6A 4F1OA 4UMRA 5J5SA 3OMVA 1JNKA 5L2QA 5JRQA 2GMXA 5HNGA 3ZUVA 4QP9A 3NYNA 1TQMA 2VTLA 2XA4A 2EB3A 2XB7A 4WG4A 2Z60A 3VS5A 2I0HA 1R0EA 2E9OA 4MD8E 4CYJA 4PNKA 2XNOA 3VW8A 3KULA 4QTAA 3IKAA 3PVWA 2PE2A 3Q4UA 2Z7LA 2B53A 4Q5EA 1H1WA 3A60A 2BRNA 5CSHA 1W84A 4CMOA 4E8AA 4U6RA 2QOFA 4GMYA 2GFSA 2WEIA 3QYWA 1OGUA 4XCUA 3UTOA 4B99A 4L8MA 4FV6A 4BVUA 5F9EA 3TTIA 5CT7A 5HBEA 4I20A 3TNPC 4B7TA 1JQHA 1NVQA 3A62A 4QQCA 2WOTA 3D7TA 3OCGA 2VAGA 2Z2WA 2JITA 4WG3A 3BBTB 3R00A 3R2BA 5HX6A 4QQJA 5DEWA 2WIPA 4DFZE 3LMHA 5EQYA 4P5QA 2R0IA 4NM0A 3BU3A 5TE0A 4GH2A 5EYMA 2OGVA 4KINA 3G33A 3RWPA 5L8JA 3A7GA 5KO1A 4EOPA 5HG5A 3GOKA 4UYNA 4F9YA 4F9BA 1OL1A 5AWMA 5IDPA 4BZNA 2CGXA 5LWMA 4UY9A 5HU9A 3QQHA 4JDHA 2W9ZB 4FTRA 1FVTA 3DY7A 3ZUTA 3R7IA 4E73A 5KMOA 3SXRA 4S30A 3MPMA 1OIUA 4CV8A 2HIWA 2BZKB 2ZB1A 4GK2A 5FM3A 4FG8A 4ALVA 5AUWA 3LFDA 3NUXA 3W2RA 4F0IA 1FBNA 3C5UA 3QCXA 4M13A 4ZXTA 1JKSA 5JQ8A 3Q2JA 3DQXA 3ZMMA 4BI1A 4USFA 3VRZA 4YC8A 5AP3A 3E7VA 1CMKE 3QUDA 3RPRA 3N4TA 4X3FA 5F20A 2C6OA 2QQ7A 4UXQA 4WNOA 4ZTHA 4BHZA 4C7TA 4G3CA 2QOLA 4FT3A 4BCOA 4CFFA 3W2CA 4FV7A 2G01A 3EOCA 3PA4A 4ID7A 2HWPA 1BUHA 1OPLA 4QMPA 3Q04A 3CQWA 4OTFA 3S95A 4FZ7A 4MYGA 4AT3A 3COHA 1STCE 2YM4A 2CMWA 3VBTA 1JKKA 4FKWA 3QTUA 4BICA 3CKXA 5IEVA 3V51A 3H10A 5FDPA 5DWRA 5FXSA 5FTGA 4G16A 3HKOA 4L46A 4FTIA 2X4ZA 2GS6A 4IBMA 1AD5A 1JKTA 2Y4IB 5AV4A 1GY3A 3PXZA 4QP3A 4U41A 5DA3A 1Q99A 2X8IA 1UNLA 5L6OA 2PMOX 4MXXA 1B38A 2IZSA 4J95A 4QYYA 1UU8A 1Q8ZA 4FC0A 3FMLA 4TWCA 4CXAA 3TIYA 2P2IA 3VS6A 4E6AA 3QUPA 5B7VA 2X2MA 4CEGA 5J1VA 3LFQA 1WBOA 5A4LA 5L8LA 1ZRZA 3G9NA 2X8DA 3Q5IA 4LYNA 5HGIA 4HOKA 1MUOA 3CEKA 2W06A 3DAEA 3OTUA 3QWKA 2KULA 4RIWB 4DFNA 4CQEA 4RIYA 3KRWA 4EH6A 2EUFB 2OIQA 3SW7A 4LUEA 4FSMA 3QCQA 4R6VA 4S33A 5BMSA 5JFXA 1PMVA 3MY5A 5JFSA 5L2IA 3VUGA 5TOZA 3T3UA 5E8UA 4ZTNA 4IADA 3AMAA 3FMHA 2BDWA 3DNDA 4BBEA 4DFBA 5J8IA 4AGUA 4GKHA 3ALOA 1SVEA 3BE9A 3M42A 2RF9A 3QC9A 3C4CA 4RVMA 2DUVA 3F2AA 4OR5A 3LE6A 4LOOA 3Q6UA 3CQEA 5KKRB 5L4QA 1GOLA 2WTVA 3VULA 4LGHA 3TM0A 2C6DA 5DR2A 4RRVA 2C5YA 3NNXA 3ZO2A 3UPZA 5JFVA 4IFGA 3UP2A 3JVSA 4BIDA 5M56A 2XK4A 1VEBA 5LVMA 4XG9A 4NWMA 2IW9A 5JH6A 4O2PA 4YSMA 4ANQA 5CI7A 4JQEA 3RBWA 5AAEA 2WU6A 4G17A 5HVKA 5KKRC 3F2RA 5LARA 3FXXA 3OCSA 5FEQA 3QC4A 1GAGA 1OBGA 2PMIA 2EVAA 2IN6A 4JIAA 5LWNA 3HUBA 4BGGA 3U87A 5K3YA 3M11A 3D5VA 1BYGA 5DBXA 5IF1A 5JMSA 3MBLA 2R2PA 4M69A 1XKKA 3FL5A 4G34A 4LMNA 1ZARA 5CY3A 4EWHA 4PMPA 4L68A 4IB0A 3SA0A 4ZTQA 4CKRA 3QTQA 3R6XA 4O0SA 3T9IA 5HD7A 3V6RA 2R3MA 3MDYA 5HBHA 5CENA 4M0YA 5BVFA 2R3HA 3VF8A 3DKGA 2VNYA 2I0EA 4RX9A 4BTMA 3HV7A 3PP0A 4FV8A 4FSWA 2NRUA 1BMKA 5B2KA 4YZCA 2JDOA 4EK4A 4EOIA 5FRIA 4FNXA 5C1QB 3F3VA 2EU9A 5A54A 3EFKA 3EFWA 3PIZA 1FMKA 1MQ4A 5FTQA 5E9EA 4O27B 5EOLA 4IAFA 2C3LA 2XIKA 3QRIA 3UNJA 3HYHA 4D1SA 2HENA 2YABA 3RK5A 4AGDA 4E20A 3A7HA 3F5PA 3Q2MA 4IAAA 5HCXA 4DFXE 1M7QA 3CD3A 5DR6A 3NUYA 4GFMA 1Y8YA 3BIZA 4GSBA 3EN5A 3Q96A 3W18A 3UQFA 3OEZA 3MV5A 5FLFA 3EQGA 4N6YA 4XG4A 4H36A 2ZVAA 5EYKA 2ONLA 4YLLA 4DEHA 3OWJA 4G9RA 4PDYA 2PZYA 5KBRA 4R78A 4BR3A 3ORIA 4FUXA 4Z55A 3TDWA 1W7HA 3NS9A 3SC1A 4ZJJA 3LQ8A 3MTFA 4FT9A 3E8CA 4RFMA 3LQ5A 5IQCA 3ZRLA 5CAQA 2XK9A 3ZFYA 3ZM4A 3UIXA 4ZOGA 1GJOA 1VJYA 2OW3A 3AC4A 4FKGA 2VWXA 4FKOA 4UALA 2C68A 2Y6MA 4JDKA 4F1MA 4RA5A 4MHAA 4QMZA 4IJPA 2BKKA 3QGYA 3C4XA 5DT3A 3BCEA 4TW9A 4ITJA 4XNEA 3A7IA 4BDJA 3LMGA 1J7IA 4LGDA 5AV1A 3FKOA 4LUDA 3CJGA 4BCHA 5KCVA 2OFVA 5GJDA 4K0YA 3V6SA 5AUTA 4EUTA 2VX0A 3EN9A 4FT5A 3R1NA 1L8TA 5FEEA 3FI2A 2X9FA 4K1BA 4TTHB 4ASEA 3FZPA 4LG4A 5CU0A 5M06A 1ZWSA 4G31A 4YP8A 2PU8A 3OROA 3Q9WA 4ZZOA 4NM7A 5E8TA 3FSFA 1XH6A 4M66A 5IQFA
chains in the Genus database with same CATH superfamily
4CFMA 5KHWA 3KMWA 3ZFXA 2UVXA 3RZFA 2BIKB 2CJMA 2PVMA 4IZ7A 1IA8A 1JPAA 4HYIA 2UZWE 1ZOEA 4XP2A 5C8KA 3NUUA 3RI1A 3WF9A 4F6UA 3FY0A 3G6GA 2RSVA 3ZLWA 3FMNA 5F4NA 3FV8A 2X7OA 2YAAA 2YDIA 2XP2A 5LXMA 1OM1A 4CNHA 3RPOA 4R7IA 4OTQA 1H26A 4U3ZA 4B4LA 3RKBA 4WD5A 4FSNA 4F65A 4NL0A 2JBOA 5HX8A 4ZEGA 4DGMA 3S00A 4IDVA 1OKYA 3PPJA 5EYDA 5CF4A 3CIKA 2XCKA 2ZOQA 4B6LA 1F0QA 4RJ4A 4DN5A 4BYJA 2R3LA 1YRPA 2OJ9A 4FTJA 2IVUA 2CSNA 3L8SA 3ZEPA 5ACBC 4OTGA 4A06A 1JSVA 3DDQA 4QP6A 4TT7A 1PF8A 5EK7A 5AV0A 3DJ6A 3PWDA 1DI8A 4I6LA 2F49A 1Q8TA 2XUUA 3PTGA 3HUCA 4IFCA 3KXZA 3FXZA 4FX3A 2BZIB 4AQKA 3SOAA 5M07A 4QYEA 4B9DA 3DB8A 3LCKA 1XH8A 3QKMA 4QEBA 3DOGA 1Y6AA 3AT4A 3VRYA 4NU1A 4YNEA 2XNPA 2F4JA 4Q9ZA 4MWIA 4L01A 4DG2E 1WMKA 4YZNA 3K3JA 3QXPA 5KZ0A 2C5VA 4ZSEA 4ANBA 4XRJA 1Q41A 2JAVA 5JFWA 2OXXA 4ZMEA 3FSKA 3U55A 2W96B 5C4KA 1H28A 3F3UA 4MXYA 2WMAA 2YFXA 4N0SA 4WUAA 3VJNA 3R9RA 4U80A 3G0EA 4GUEA 4FUYA 5IEYA 4OT5A 3N9XA 5BYYA 4YTHA 2QONA 3E8NA 4WNPA 1IAHA 1ZMWA 4ANLA 1HCKA 4KIKA 4E6CA 5CAVA 3E5AA 4EOJA 1UWJA 1XH4A 2XNGA 2IZTA 3PE2A 3E7OA 3QHRA 4A9UA 5IMEA 2OG8A 4LDTA 1FQ1B 4PDPA 5KE0A 3OOGA 1E9HA 4RG0A 2WO6A 5AADA 1GIIA 4YZBA 5BYZA 5AIRA 4NEUA 1KE8A 4IE9A 1PMUA 3A61A 4RFZA 4FTMA 4IM0A 2VU3A 3U6IA 4U97A 3IW5A 4OT6A 3ZBFA 4AXCA 5AUYA 2VWIA 4X2NA 2QI8A 3WZJA 3UIMA 4GIHA 4BDCA 2O0UA 2VTIA 3EZRA 5LOHA 3RK7A 2F7XE 3HVCA 5GINE 4X2GA 5CVHA 3P7BA 1MRVA 3KKVA 5I9XA 4WA9A 3V5TA 3ORKA 4U43A 5JZNA 3W2OA 3BGZA 3ZU7A 2JIVA 4G3EA 1BX6A 4LV5A 2YACA 3DU8A 4FIIA 4ALUA 2XAOA 4I0RA 3PLSA 5C03A 4RJ7A 1F3MC 3UVQA 3HRBA 3AGMA 4FZFB 3WYXA 2ITZA 4F9AA 4GFGA 4RWJA 5KZIA 4EC8A 3MJ2A 3OT8A 2X6DA 1H08A 4NJDA 4NTSA 2FUMA 1W98A 3EHAA 4I93A 4QNAA 5AX3A 3MSSA 4JXFA 5GJFA 3UZTA 5ANDA 3P23A 2W1ZA 3QZHA 4BDIA 4CG9A 4PDOA 5DT4A 1E1VA 1AGWA 3PJ1A 3NLBA 3ELJA 1OITA 1KE6A 3IS5A 3S2PA 3VBYA 3KQ7A 3OCTA 2X6EA 4J71A 4QMSA 3I0QA 3RPSA 3NNUA 2VWVA 5IEXA 4JLCA 2X39A 2YWVA 1PXMA 4UXLA 3U4WA 1KE9A 3SGCA 1PY5A 2UW4A 4FR4A 4M15A 4YHTA 1OPKA 4AACA 1YOLA 4PWNA 4LOPA 4Y5HA 2X7GA 5AUVA 2PVLA 2PSQA 5EM6A 4BCGA 2RGPA 4F4PA 4R7BA 4GYGA 4DH3A 3CLYA 4GK4A 4IWDA 5GIOE 2XAMA 2UVYA 1ZXEA 2YHVA 3DXNA 3I1AA 3R2YA 3POZA 5EM5A 2BALA 3GC8A 5FP6A 4M68A 3ET7A 4C4IA 3R04A 4PF4A 1XWSA 1WCCA 1H24A 3AXWA 5M4IA 3JVRA 4Q2AA 4E93A 5J5TA 1AQ1A 4P4CA 3FZRA 2H34A 4WKQA 3FI4A 3GQIA 3DAJA 3NGAA 3WIGA 4AZVA 4F99A 4GL9A 2E2BA 2QC6A 3HMPA 4AU8A 4JOAA 2DQ7X 3B8QA 4BCIA 2QD9A 3DJ5A 3I7BA 4FIHA 3D4QA 3QHWA 2UW9A 2BRBA 4YPSA 4IWOA 3NIEA 4KKEA 4BDBA 4C62A 3DCVA 4JG7A 3D83A 2DWBA 3W0QA 3ENHA 4NCTA 2GHMA 3WZKA 4DTBA 2BAKA 4F0GA 2BAQA 2ETMA 2EXCX 1FOTA 2HCKA 3GUBA 4ANOA 2GHLA 3QKLA 4C37A 4J98A 5GNKA 3O50A 4HYUA 1J7UA 4I5MA 3IW6A 1XMMA 5FDXA 5FP5A 3W33A 4DE4A 4YO4A 4FYOA 2XJ2A 2BZJA 3ZSGA 4EKKA 4CYIA 4GU6A 4WBOA 3C1XA 5GZ8A 4GFOA 2R64A 5HG7A 3ROCA 4FEWA 5IQEA 2X0OA 3LOKA 3CTHA 2XM9A 2I40A 4G3FA 2A27A 2HAKA 3E8DA 3SW4A 2JD5A 2VTSA 3QRKA 2P0CA 5HCYA 2WNTA 4AF3A 2XIRA 4BWKA 2YM3A 1DI9A 3FZSA 4A9TA 4I22A 3W0RA 3ZZWA 4RLKA 5GIPE 2XKEA 2B4SB 3QTSA 2QLQA 5AP2A 1LPUA 5AX9A 3TL8A 1KOBA 5ETAA 4DEDA 4R1VA 4JMQA 5ACKA 2V7OA 2VTPA 2KTYA 3PIYA 3S3IA 4EK3A 1G8SA 2C5OA 1YWVA 2QODA 4ZLOA 3AKJA 4KD1A 3KXHA 4OGRA 2JDTA 3FL4A 4RFYA 2ZM3A 3MTLA 1Y57A 4ZY5A 2JFLA 4QQ5A 4I3ZA 5I9ZA 5M51A 4FTAA 3HMIA 5FXRA 3Q4TA 3TMOA 4PL5A 3E64A 2VRXA 5J9YA 3F9NA 1K9AA 4D2SA 3W1FA 4IM2A 4ZLZA 4B0GA 3ORNA 4RMZA 5EI8A 4DHJA 2P55A 4D4VA 4AZWA 1V1KA 3RM7A 4IX5A 3R8LA 4FTKA 4XH6A 3IO7A 2PVJA 3VS2A 3Q9ZA 3PUFC 3NAYA 3OOMA 2GSFA 3G15A 3RPVA 3ORTA 3D5UA 3LXPA 1VYZA 4X7QA 1OUYA 1YKRA 4HGEA 3VW6A 4EBWA 1XJDA 4QMQA 4D1XA 4W4VA 2OXYA 5HIDA 3U4UA 4C4JA 1PXJA 3PIXA 4JR3A 2VGPA 4BFMA 4GT4A 1ZY5A 3MH0A 1P5EA 4XJ0A 3W8QA 2YJSA 2C4GA 3AD5A 4KBCA 4AX8A 2W1HA 5J95A 3V8WA 3R1SA 3F66A 1WBTA 3FQHA 5E90A 4O81A 3WF7A 2OJJA 2VN9A 4ENXA 2HW7A 2PVRA 4JBQA 3GEQA 3FAAA 1JLUE 3NYVA 3OCBA 4TYEA 4DLIA 4K11A 2ZJWA 4KBAA 4WT6A 1SVHA 5LMAA 2VWWA 3BWFA 1HCLA 3VHKA 1R39A 3ZC6A 2JKMA 4CG8A 3TKIA 1ZYDA 5EDQA 3UOKA 2BIYA 2RL5A 3PZHA 4K77A 4TYHA 5E8SA 1O6YA 5I4NA 4EOMA 2X7FA 3W2PA 5HE2A 3C4ZA 4HW7A 1TKIA 3L8PA 4O7YA 2RFNA 1P4FA 5AA9A 2ERKA 2AC3A 2WMWA 4UWYA 4EK8A 3COIA 3JXWA 3FYJX 4U81A 4NW5A 4WG5A 5BMMA 4LI5A 4QTEA 3C4FA 4QMUA 5J79A 3UO5A 2C30A 2UZEA 3DGKA 4FGRA 4E3CA 2J0MB 3KMMA 2J6MA 4TWOA 5LMBA 4BCJA 1NW1A 4CFUA 1WVYA 3KVXA 1YHWA 3ENMA 4FE2A 3CR0A 1LEWA 3LZBA 4FG9A 4X0MA 3KXGA 4MXOA 5DIAA 2XM8A 5IKWA 1OIYA 2W1GA 4V0GA 2WZJA 3HEGA 3K5UA 5ANJA 3ACJA 5M55A 5I9YA 5AR7A 1Q3DA 4A9RA 5HTCA 1FMOE 2OF2A 2ZV9A 2QOOA 4ZP5A 4BCPA 4WSYA 4DEIA 4BCNA 4DFYA 1MP8A 5CEPA 4FKSA 5IA5A 3TV6A 3P7AA 4FGBA 4M0ZA 4I5CA 3ZSIA 5JGDA 1REJA 2OZAB 3CQUA 3UNZA 5IQGA 4IAKA 4USDA 3Q4CA 3R1QA 3C4EA 4O4EA 3GP0A 4UBAA 4XS2A 5E8VA 4O7ZA 5LCJA 4BC6A 1LR4A 4BYIA 3MN3A 3BU6A 4HVSA 3IW4A 3QLGA 5BNJA 4IB5A 2JFMA 2OFUA 3PRFA 3QTIA 1H4LA 4C4GA 4QQTA 2X1NA 4D4YA 1Q8UA 3PFQA 5HNBA 1I09A 2FSOX 3ULZA 4BGQA 1BL7A 1W82A 5K4IA 4DA5A 4FG7A 3BKBA 3JUHA 2G15A 4F78A 4ERKA 3HAVA 2HW6A 3V5JA 3EKNA 4F7JA 3L9NA 3PDTA 3VQUA 1M7NA 3MVJA 3LM5A 4FSUA 4IEBA 3ZO3A 3IOPA 3BYVA 3C4WA 3JS2A 3P86A 5EYCA 4DCEA 1DAYA 1PHKA 2R3PA 4WOVA 4YJVA 3EQCA 4FZ6A 4K8AA 1GIHA 1YXSA 3RCDA 4YC6A 2J50A 5IG1A 4U7ZA 3C7QA 4PPBA 1OECA 4TYJA 4PNIA 4XP3A 3AKLA 3N4VA 5CU6A 4F09A 2PMNX 3LFBA 4L00A 5ANKA 4W9XA 4AE9A 5CEIA 2ZM4A 1UNGA 1FGIA 3PXQA 2YCQA 1IA9A 4ZTLA 2W9FB 2FSTX 2B54A 4O7WA 4FICA 4NM5A 5CYIA 4FKUA 5DH3A 4EH9A 4Z7HA 4MKCA 4TL0A 2GQRA 2ONLC 2WAJA 3PSCA 1B6CB 2CNQA 1YWNA 4IANA 5A9UA 4BDEA 2BTSA 2JDVA 2B9FA 3UO4A 3UC3A 1M2QA 3NNWA 1ST0A 4YJRA 3QL8A 3NDMA 3O17A 1KE5A 2X2KA 5IQHA 5C8MA 3KXMA 2GNFA 1HOWA 5H8BA 1S9JA 3KRRA 4YSJA 2BMCA 4KKGA 1Y6BA 2VTJA 3EWHA 3BE2A 3FLQA 3OUNB 3COMA 4LFIA 2OJFE 2C1AA 2C0OA 3MA3A 3W32A 4CLJA 4EOQA 1PYXA 2CNUA 3V8SA 2YDJA 3GU5A 3KN6A 1CTPE 4QMTA 4YHFA 4O7NA 3FI3A 5D7VA 4BKJA 5JK3A 2B9JA 4XEYA 3EIDA 5FEDA 3MH3A 3AC8A 4AGCA 3GU6A 4DEAA 1IEPA 4ZTMA 2W1IA 5IA1A 2PVFA 4IM3A 4WRSA 4TXCA 4ACDA 4ASXA 4AG8A 2QOHA 4AW2A 2W4KA 3F3WA 4EYMA 1YXTA 3JYAA 3H9FA 4MF0A 4TWNA 3VJOA 4OTRA 5A6OA 2VD5A 5IQIA 5M09A 4K18A 3BGPA 3EQBA 5CXHA 4N4SA 3TZ7A 5I9WA 4L7FA 4BDKA 2O3PA 4W8DA 4FSRA 1J7LA 3LJ0A 2GPHA 4QYFA 2P33A 2GCDA 3QD4A 4NKAA 3HDMA 4O96A 2PYWA 4I92A 1NVSA 3EQIA 3FZ1A 4JG8A 4QD6A 3PJ2A 5CANA 5IH5A 2V22A 2Z7QA 4XMOA 3FQSA 3UMWA 5CALA 2HYYA 1W2CA 4HNFA 4FZAB 3PY1A 4JL9A 4JQ7A 3NUAA 3DAKA 3P7CA 3U6JA 2UW6A 2WTKC 2H9VA 3QD3A 4Y83A 5EDRA 5I3OA 3BHVA 5ETIA 1G3NA 5CEMA 2WTDA 4YBJA 3RTPA 5A4TA 1GNGA 2XK8A 4OBPA 2PZRA 4JBVA 4FNWA 4IZAA 4QP1A 3MW1A 4QPAA 3LJ2A 4YLJA 2OKRA 4TNBA 3TUBA 3UQCA 3K5VA 3PYYA 2C3KA 2QKRA 3QD2B 2QO2A 4RA4A 5HORA 3A4OX 5EM7A 1YI3A 3UBDA 4DT9A 5BVEA 2C6IA 1BI8A 5DN3A 3S4QA 4F7LA 2PE1A 5JZJA 3N4UA 2GNJA 3ANRA 4DH8A 3L9MA 2ITQA 3CD8A 2GTNA 5E8ZA 5HVJA 1VLRA 3GI3A 5LJJA 2GU8A 3KK8A 3OS3A 3SHEA 4NZWB 3LLAA 3AD4A 4FV2A 4PQNA 3V5WA 1U54B 1IASA 2P4IA 2QU5A 2OIDA 3WYYA 2PZPA 3MY1A 3OP5A 4S31A 4RVLA 4AZEA 4J8NA 5CVGA 5KMMA 4PL4A 4XOYA 4HVIA 4J53A 4UMTA 5HE1A 1FPUA 1GZKA 4I24A 4C34A 3HNGA 3ZXTA 2WMSA 3TI1A 3PJCA 2RG5A 3G9LX 1PMEA 5EHYA 2NO3A 3D2KA 4RVTA 3D7ZA 4NH1A 4X2JA 4DH1A 4DTKA 3PVBA 4F6SA 3W16A 2XJ1A 3KRXA 5CU2A 4TYGA 4B8LA 3ZRMA 4OTPA 1TQPA 4FT7A 3ZLYA 5KMLA 3C9WA 2XYUA 1Q4LA 1W83A 3F2NA 2A4LA 4JIKA 3VS3A 1WVWA 4MD9E 4QTDA 4S32A 4BDDA 4JJRA 4L3LA 4BGHA 2QHNA 4FODA 1ZZ2A 1JSUA 5JEBA 1OBDA 3S0OA 2QOKA 3AMYA 1KWPA 4FOBA 3BLAA 4YHJA 1YVJA 2PE0A 2Z7SA 5EOBA 4FEXA 5AV3A 1F5QA 4KSPA 2BR1A 2HELA 4W4YA 5CLPA 3MPTA 5EHOA 5CT0A 2WXVA 5LMKC 5IA4A 4DF3A 3EMGA 3FLZA 4FRFA 3ODYX 4ZS0A 5HLPA 4FKLA 4H58A 2UUEA 3LCSA 4J99A 4JX3A 1WVXA 5CSPA 2HZ4A 4GEOA 4EQCA 2PUPA 5E8XA 3DK7A 3TZMA 2AQXA 2WFYA 2E9UA 4P5ZA 3R7YA 2SRCA 2BRHA 4FIFA 2XK6A 1H00A 3C13A 1Q5KA 3F5UA 4P90A 4ZSAA 3DFCB 2OZAA 1YHSA 2C3JA 4A9SA 3UNKA 3ULIA 3V8TA 2R7IA 4QO9A 3W0PA 4FYNA 3R30A 2ESMA 3WOWA 4D28A 3PXKA 3ORXA 4ARKA 4CSVA 2CKOA 4KNBA 2X0PA 4W8EA 3FZOA 4D2WA 2R3KA 5LVLA 4GV1A 4YJTA 4LOQA 2Y0AA 3E92A 5BUJA 5BYLA 5IQBA 3I5ZA 3GCUA 3FE3A 1GZOA 5HIBA 3TNWA 4PX6A 5HD4A 5D41A 4I0TA 5AP0A 3QRUA 2J51A 4IVBA 4XV2A 3FC2A 5BUIA 4HCUA 3E8EA 5JKGA 3VVHA 4FTCA 3P08A 4CFNA 1RJBA 4YJSA 5AR2A 4WRGA 4FT0A 3BL7A 3UDBA 2JKQA 4O1PA 5CU3A 5BQ0A 4EORA 3KF7A 3ZDIA 5EH0A 1W0XC 4M12A 4XBUA 4ZSJA 3E63A 4AN3A 3NFFB 1P14A 4ZJIA 1U5QA 4IWPA 5FGKA 3QTZA 3S1HA 4I6HA 3HLLA 5HOAA 3R8ZA 3V5PA 4DC2A 4YC3A 3DXQA 5E4HA 3R71A 3VS7A 1W2FA 4D2PA 4J52A 3FMMA 4AZSA 3G6HA 1L3RE 1YQJA 2BHHA 4I5PA 2V7AA 3JY0A 3F3TA 4FTOA 3QXOA 4XYFA 4FL3A 3KFAA 3PY0A 2BDJA 2ZMCA 3UPXA 3U9NA 4HZRA 3CTQA 1M14A 4E4MA 4JR7A 3UOJA 3DLZA 2RG6A 3KB7A 2WMBA 3UVRA 3UZPA 3EH9A 2W17A 5IPJA 3PJ3A 3GGFA 1FVVA 3OG7A 5J9LA 2PWLA 4CKJA 4MWHA 4QP8A 1ZY4A 3DBCA 5BUEA 4A7CA 4EZ7A 4JBOA 2XK7A 3KXNA 4FSTA 3NW7A 1TVOA 5KMNA 4O83A 4FTUA 3ZYAA 2AYPA 2UVZA 4AS0A 1BLXA 3EQFA 4U45A 4AWIA 2R3GA 4G2FA 3R7VA 3RM6A 4BKZA 3FPQA 1H25A 3G51A 4QMNA 3NUNA 4YJQA 1OI9A 3E3PA 2XNEA 4G3GA 3LHJA 1E1XA 4IDTA 3BYOA 2R0UA 2C5NA 5KMIA 2Y8OA 1GZ8A 2DYLA 3L8XA 4AXDA 4GG5A 4I6FA 5DOSA 5CASA 4FV0A 3GU4A 1RQQA 2QOBA 5CQWA 4XV3A 4O0TA 5EDPA 3RHXA 2GFCA 3LFCA 4DG0E 4JQ8A 4FNZA 2BVAA 3QZGA 3MH2A 4U79A 2A2AA 5IQDA 2OO8X 2HOGA 4EUUA 4OBOA 3A2CA 4BCFA 2PPQA 3VS0A 3C50A 4FKVA 2PZIA 3ZEWA 5HLWA 3R7GA 3KF4A 4ZY6A 4M8TA 3ZZEA 4E4XA 5BVDA 2WD1A 4J7BA 4H05A 2GDOA 4L53A 4L3JA 3WZEA 4F08A 2G1TA 5DI1A 4HGSA 2PUNA 2Y6OA 3O7LD 2OI4X 3TJDA 4Z3VA 3QFVA 1LUFA 2GS7A 2PK9A 4RJ6A 4BCMA 3MB6A 4AXFA 2C6MA 2J7TA 4M84A 4BTJA 4Y8DA 4L6QA 3OZ6A 2YERA 1RDQE 1ZMVA 5DE2A 4OUCA 3QQJA 2VO3A 2J4ZA 2ZDTA 4KB8A 2BTRA 2IEWA 4NK9A 5AFVA 2UZOA 3U51A 1U4DA 3DJ7A 3PG1A 3SRVB 4HYHA 3NAXA 4XG7A 1YXVA 4X6QC 3VUHA 2QU6A 1OIQA 3DZOA 3SXSA 1J1BA 4C2VA 4F9CA 4IAYA 2ZV7A 3GNIB 3PXRA 1WFCA 5HNIX 3UYSA 1U46A 2B7AA 4L42A 4MBLA 5AA8A 2R3JA 4RIWA 3IDCA 1QL6A 2RFEA 4RGJA 4TPTA 4EZ5A 3VUIA 2FGIA 2JLDA 2WIHA 4NIFB 4Y46A 2E9VA 4X21A 1YI6A 1IAJA 4EH2A 3QA0A 2RFSA 3U6HA 4QYHA 4JRVA 3HMNA 5CX9A 3EQRA 3PZEA 3RAKA 4BJJB 3UP7A 4IMYA 4AT4A 3UGCA 1NVRA 4F6WA 3O5AA 2E9NA 1FINA 3OT3A 4ZAUA 3SX9A 4FVQA 4MD7E 3TV4A 4CCBA 4EWQA 2FSLX 4NYEA 3CE3A 1TQIA 1H0VA 4C3PA 3R22A 2X0GA 4PTEA 4PV0A 3OBJA 2F2CB 1Y8GA 3FHRA 2J0IA 3EFJA 4UMUA 4I1ZA 5H2UA 3H30A 4II5A 4ZTSA 2HWOA 3FKNA 3UDSA 2QR8A 4DCAA 4KIOA 3HZTA 4KBKA 5I9VA 5A14A 5TO8A 3HX4A 4EHVA 1M2PA 1UV5A 3LFNA 4FIEA 4DG3E 4DEGA 4IWQA 2R4BA 4RIOA 4RC3A 5E8WA 3CGFA 3PWYA 4D5KA 2EWAA 4IHPA 3M1SA 5AP7A 2FVDA 3EN7A 3PRIA 4FKPA 2Y7JA 4H3PA 2O65A 5L2SA 3WE8A 2W1EA 3KRLA 4FF8A 1OKVA 3OW3A 3QQGA 3AC5A 3AG9A 4CFXA 1H1SA 1OPJA 4V01A 1V0OA 2B52A 4CFVA 2GNHA 5K9IA 3E62A 4RQKA 3AQVA 5L2TA 5HU3A 1P4OA 4D4RA 4O91A 2E9PA 3NUPA 5E92A 5DHJA 4Z9LA 5L6PA 3KIOC 4E6QA 5I3RA 4S34A 3QD0A 1OL5A 3ZLXA 5IZFA 2C6KA 4A4XA 5FWKK 5AUZA 3Q5ZA 2HXLA 1ZOGA 5IH6A 3NPCA 4O0UA 2HXQA 4ACHA 4UN0C 3DBFA 2BZHB 2CKPA 1Z5MA 5TF9A 1K3AA 2R7BA 4FKJA 2ETRA 4FV3A 5HICA 1VZOA 1BL6A 3UOHA 4G1WA 1K2PA 2WMUA 1PXKA 3KRJA 1KSWA 4EEVA 4AZFA 5DPVA 4KSQA 2P2HA 5T6KA 2Q0NA 4RSSA 2UZTA 4F1TA 4C4EA 4LRKA 2VX3A 3KK9A 2OU7A 4YNOA 4CTCA 3G90X 4OTWA 2X81A 3ID6C 2O5KA 1XH9A 3FI8A 4M67A 3UG2A 2C6TA 4H3QA 3AC2A 4AP7A 3I7CA 4OW8A 3UO6A 3H0ZA 2YM8A 5HHWA 3V5LA 4L3PA 2QO7A 1EH4A 2Y4PA 4GIIA 3CGOA 4DGGA 3LAUA 4WBBB 3RHKA 3BYMA 3NUSA 3PXYA 4I21A 3FXWA 3R83A 4Z7GA 4QMLA 2PVHA 2HY0A 3QALE 1YW2A 2UZBA 4QT1A 2UW5A 4D0XA 2UZLA 5ICPA 4O22A 1NA7A 3NSZA 3HL7A 3H0YA 2WMQA 4O0WA 2JKKA 4FKQA 2PTKA 4I0SA 4XV9A 4YZ9A 5C9CA 2HK5A 3I4BA 4PMSA 5B2LA 1FGKA 4GT3A 2FA2A 2YWPA 4CZUA 4LRJA 3KREA 3B8RA 4IIRA 4MUQA 4FTQA 2YZAA 4NW6A 4RLLA 5CS6A 4DHFA 3F61A 1ZOHA 3NNVA 3MIYA 3ORZA 3SDJA 3NRMA 2IPXA 1YI4A 3VO3A 3PFYA 2ZYBA 4FTLA 3DKOA 5EI2A 3OW4A 4XUFA 1O6KA 2X8EA 3D94A 4O4CA 1PXIA 5M44A 3Q32A 1R1WA 3IGGA 4ACMA 2XNNA 4NSTA 2IO6A 4W9WA 3ZH8A 2EB2A 3PUPA 3FZTA 4RX7A 5JRSA 2JGZA 2BUJA 3DBDA 4CT1A 4ZZMA 4O4BB 5ANGA 4MBJA 4ACCA 2VO0A 3R1YA 4JG6A 4OTIA 3TACA 5L2WA 3R7EA 1T45A 3R9NA 1ST4A 4XG3A 3ML1A 2W5BA 3JY9A 3PY3A 2NP8A 2R9SA 1A48A 3BV3A 4JDIA 2XH5A 3GC7A 4ZK5A 3R9OA 2Y9QA 2UZVA 2WMRA 3F69A 4O21A 4UEUA 2CKEA 2QOQA 2LAVA 3WZDA 4QPMA 5DRDA 2XKCA 1Q62A 2O63A 4MF1A 5M4FA 4O7SA 3EKKA 3ANQA 3I81A 4FL1A 4X3FC 3WE4A 5BVOA 3FBVA 4FIJA 5IDNA 2QG5A 2YCSA 3H9OA 4MX9A 4C0TA 5CZHA 2QO9A 2OZOA 4HCTA 4DBNA 2YLEA 2CN5A 3D9VA 3QTXA 4N70A 3E88A 3GBZA 2GQGA 3P1AA 3ALNA 3Q6WA 4YJNA 4EK6A 3CC6A 3QCYA 2J5FA 1ZYCA 2IZUA 2ITPA 4C02A 3PSBA 3L1SA 1KOAA 4WSQA 1UVRA 4DH5A 4Y72A 4AT5A 5FXQA 2H8HA 5ITAA 2YITA 3SG9A 3W2SA 5CF8A 5HCZA 1UU7A 2QURA 3DTCA 4L43A 3LJ1A 3VBQA 4G5JA 3TG1A 3QQFA 2V0DA 2X2LA 3NVMB 4CCUA 3UMXA 3IW7A 3LFEA 2B0QA 2GQSA 1QPJA 4R3CA 3HECA 2UW8A 4A9YA 5F95A 2ITVA 1J3HA 4XRLA 5CEKA 5D1JA 5HLNA 3BHTA 2OIBA 4E5WA 3GC9A 4RVKA 3QCSA 3QWJA 3R73A 4FSZA 3NW5A 2C47A 2I1MA 3ERKA 1KV2A 4FMQA 2VTOA 3P4KA 4RIYB 4AW1A 4ENYA 3O96A 5KMKA 1G8AA 4AN9A 2YISA 4BWPA 4EOLA 3VS1A 5FBOA 1H1QA 2REIA 5EM8A 3E3BX 3DS6A 4O0XA 1SMHA 4R5SA 4XLIA 1CDKA 2CGUA 2BRMA 4FKIA 1MRYA 4YGAA 3HMOA 3MVHA 3HA8A 4M7IA 3ZO1A 3EL7A 4AA4A 4HVHA 5KNJA 4RPVA 2W4OA 3TEIA 4EL9A 3BBWA 4PTGA 1O6LA 4FI1A 3BQRA 5B0XA 4EH5A 3CY2A 4PY1A 3FDNA 4Y73A 3TWJA 3ZTXA 4YUQA 3Q53A 2FYSA 3WIKA 2GNLA 5CXZA 5BVKA 3BEAA 3REPA 4QMWA 4ITIA 2YM6A 3EB0A 2R3OA 4KS8A 1YDSE 1R0PA 5ETFA 4YZDA 3UE4A 4PP7A 4O7RA 4E5AX 1ZMUA 2PHKA 2G2HA 3ZXZA 5A6NA 3T8OA 1A9UA 4W4WA 2J0LA 4MVFA 3POOA 3R0TA 4GCJA 4E1ZA 1H27A 4R3PA 3OF0A 3VUMA 3GCPA 4F7SA 2XEYA 3OBGA 2WELA 4UZDA 1WBNA 3ZCLA 2QR7A 3OFMA 2XF0A 2VZ6A 5AP4A 1VR2A 2WPAA 5CWZA 1NT2A 1PXPA 4EOKA 4M69B 4BJJA 3DKCA 5JN2A 5BPYA 5CI6A 3VWAA 4OTDA 4FEQA 1NY3A 1H07A 1WBPA 4EH8A 3WILA 2QOIA 3GFEA 2QCSA 4MK0A 1ATPE 5TKDA 2QG7A 2Z02A 4APPA 2IVSA 2WQNA 4O2ZA 3QRTA 1DS5A 2C6EA 4RJ3A 2VUWA 1UKIA 3RWQA 3OY1A 5ANOA 4E4NA 4C2WA