3FLSA

P38 kinase crystal structure in complex with 6-(2,4-difluoro-phenoxy)-2-((r)-2-methanesulfonyl-1-methyl-ethylamino)-8-methyl-8h-pyrido[2,3-d]pyrimidin-7-one
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 110
structure length 343
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flsA01
4D2VA 4H1MA 3S2PA 5HZNA 4U7ZA 5BUEA 4I5CA 5E1SA 2WAJA 4C8BA 2B4SB 2VTLA 3HA8A 2Y9QA 4TYJA 4BCGA 5I9VA 3UO4A 4S32A 3RAIA 2VWBA 4BCHA 3DJ7A 3UNZA 1Z9XA 4W8DA 5DGZA 5L2IA 3I81A 1CKIA 4FV2A 5CYIA 2JBOA 3NNWA 4JL9A 4HCTA 5HG8A 2CKPA 4KWPA 3BYSA 4FSWA 4D0WA 1XH5A 3P7AA 4GK2A 2PE0A 4LOQA 4J98A 3VBVA 4DINA 1PXJA 4OAUC 4Z7HA 3W2RA 3KRLA 4M68A 3IGGA 3W10A 2J0IA 3RJCA 4WBBB 3N4VA 4H3BA 5C4KA 2G2HA 3DKOA 3EQFA 2QOFA 4QD6A 2X7FA 1UNGA 3NGAA 5AUZA 4BTJA 5DBXA 3CE3A 3VF9A 4FEXA 3FSFA 2J7TA 3C7QA 3KXMA 4IZ7A 2UZEA 3ZCLA 3CP9A 3ZRKA 3EOCA 4JS8A 5D41A 5FDPA 4IX4A 4FUXA 3UPZA 2UW6A 2XK3A 2RFNA 4XBRA 4EHZA 2PVHA 3KMWA 3RPRA 3SDJA 3D9VA 4GS6A 2PMOX 3ZOSA 3VS7A 5DWRA 2VN9A 4XLVA 4FSMA 5BVEA 3THBA 1GIHA 4CMTA 3UZRA 3FL4A 2GQSA 2CGXA 4MF0A 2W4OA 4NW5A 3VF8A 4C62A 3NYNA 4UWBA 4QMPA 5ITAA 4TYEA 4W9XA 4HYUA 2YJRA 2YCSA 1IRKA 4W9WA 4I1ZA 4CV9A 2PU8A 4DE4A 3F3TA 3UTOA 3ULZA 5CAPA 5BYLA 2GQGA 4RRVA 5A4QA 5C4LA 1H27A 2XJ0A 5HOAA 2YM7A 3CPCA 3QZGA 3VUKA 3QC4A 3R01A 4AT4A 3LJ1A 4L46A 2WU7A 2XM9A 4BDIA 3W32A 3PY0A 4GK4A 4IE9A 4FSNA 4CXAA 4YMJA 3R9HA 3BV3A 4EH4A 3W18A 4E6AA 5JZJA 2ZAZA 1JWHA 3QF9A 2GTNA 2WMBA 5H3QA 2BUJA 2IZUA 4EWHA 3F61A 4HYIA 3VVHA 4AOJA 4BCOA 4LFIA 4ANNA 3DZQA 2F4JA 4GYIA 5IQBA 4BIBA 4AA0A 3EHAA 1KSWA 4CLIA 4QMWA 1U4DA 3VBXA 3IS5A 3HRCA 4E20A 2BHEA 5IUIA 4JG6A 5TOZA 1OI9A 3TNWA 2H6DA 2QOBA 2XJ2A 4FTNA 4GJ2A 4LG4A 5DNRA 3E8CA 2P55A 3BE2A 2DWBA 4QPSA 2BRHA 5K4JA 3MY0A 3Q9WA 5CWZA 4X6QC 2RFSA 2OKRA 3EH9A 4X3FA 3EIDA 3RM6A 3FKOA 3OCTA 4ACCA 3K5VA 4ANOA 4O0XA 1YHWA 4UMRA 2QKWB 3GCVA 4AG8A 5JFSA 3FZSA 4G9CA 3FJQE 1H00A 5DI1A 4IM0A 1W0XC 2ZV7A 4R3CA 3GU4A 4YGAA 3PVGA 3CEKA 4GEOA 4D1XA 2PUPA 2FSOX 3FL5A 1K2PA 5IQHA 2Z02A 3FBVA 3ET7A 4P90A 4EOJA 3OWJA 4UZHA 5CX9A 3QYWA 3ZSGA 5HLNA 3MGYA 2JGZA 5AP2A 3R8MA 2GQRA 4GKIA 3CTJA 4O84A 3IW6A 3VW6A 5KO1A 3RPOA 3MB6A 5D12A 2WQNA 2B53A 3HA6A 1YDRE 4JLCA 4BZNA 2BRBA 2C6OA 3UIUA 4ZP5A 2HW7A 3P08A 2NP8A 1QMZA 1GOLA 4WIHA 3VO3A 4DT9A 4FIJA 1ZY5A 5JQ5A 5FXSA 4IEBA 1DI9A 2GSFA 3EN4A 5EOLA 4J96A 3B8QA 2H34A 5C27A 1YHSA 3LCKA 3CJFA 3QUEA 2P2HA 4MK0A 4BCQA 3PJ2A 3GU6A 5HTCA 3GC8A 2J0JA 4ANLA 2CN8A 4RFZA 2ESMA 2GPHA 4F1MA 2JDTA 3ZLSA 4FICA 3RWQA 3DLZA 4RVKA 3AMAA 4GUEA 1V0OA 3DY7A 5EM7A 5I3OA 3HV7A 4AWIA 3ELJA 5CF8A 3QUPA 1P2AA 5CI6A 4ZEGA 4I41A 2UZBA 3QTZA 4FGBA 4YZNA 4O7RA 2W17A 4XNEA 1LEZA 3ORLA 3EQIA 2CLQA 1W82A 1BI8A 4C0TA 5KMNA 4FOCA 2PMLX 3UIMA 3EQDA 4S34A 4FA2A 3CY2A 4L3PA 5TE0A 1HOWA 3FQHA 4Z9LA 2C5OA 2ITNA 5CVFA 2FSTX 4FTAA 5FRIA 4HVSA 5CSVA 3FKLA 5E90A 4EYMA 3DKGA 4G1WA 3H9RA 4AQCA 4CD0A 4CMOA 3ROCA 2PPQA 1XBAA 4O22A 3ID6C 4QMVA 1OL6A 4D0XA 1M52A 3M11A 5IQAA 1M2PA 3I0OA 2QOKA 5FBNC 3UP2A 5B2MA 5JQ8A 4ZMFA 5J9ZA 2Y4IC 4WG4A 2GDOA 3NVMB 2XS0A 4BWKA 5EFQA 3OW3A 2C6LA 4IVBA 3GP0A 3ZHPC 4AZWA 1O9UA 4HOKA 1ZRZA 2G2FA 4E8AA 4CYIA 4RZWA 4WO5A 2YISA 4A9SA 3DXQA 3PYYA 4MF1A 4XP2A 5CSXA 4EHEA 2HZ0A 3KMUA 5E9EA 4LGHA 1ZLTA 2W4JA 4IB1A 4IHPA 4XHKB 1X8BA 3ATSA 2YM3A 3HECA 3PE2A 3FXWA 2W1CA 2J9MA 4BGHA 4FZFB 2QD9A 4EUUA 4FF8A 4F9BA 3FXXA 5E8VA 4GT5A 3IECA 5CU3A 4YSMA 3C4WA 4AGCA 3ROYA 1LUFA 2UZDA 3LQ5A 4MBIA 4NIFB 3TEIA 2R9SA 3FI8A 4AE9A 3SVVA 5EDPA 2YIWA 5KBRA 2YDJA 5CZIA 3WF9A 4PNIA 3QC9A 2CDZA 2IZTA 5A4LA 5CTPA 3WZEA 3SKCA 5G6VA 4NYEA 5KMIA 3QLGA 2Z2WA 2ZJWA 4ZS4A 1URWA 3FLYA 3OMVA 4NTTA 3U8WA 4TZRA 2HYYA 4UV0A 2XEZA 3O7LB 4RJ6A 2ETKA 4O0RA 2HCKA 3SC1A 2XNGA 5KMJA 4J52A 5C03A 2JLDA 1O6LA 4EK3A 3FI3A 5HTIA 3Q6UA 3ZLWA 2C0TA 3A7GA 4TN6A 2BKKA 5CLPA 1FMKA 4ZSJA 2HAKA 2YLEA 3TJCA 5KHXA 2OZAB 4FV6A 1VYWA 2BZIB 3DS6A 4YZBA 4G6LA 3RMFA 4D2RA 4CKJA 3KRWA 5EM5A 1KE6A 3I5NA 3JUHA 2I1MA 5AJQA 3U51A 1B39A 4RVMA 5L8LA 4FEWA 4XOYA 3ZZEA 1Q8UA 4L6QA 4PTEA 4QMXA 3VRZA 4NJ3A 3PRIA 4XG2A 4O2PA 5DOSA 4UN0C 3C4XA 4RJ4A 2PVLA 5LARA 3LFDA 4QMSA 3R8VA 1K9AA 5M4FA 3DGKA 3MH1A 3MTFA 4TYIA 1AGWA 3ZBXA 4ZTLA 3REPA 3NDMA 3G0FA 3QXPA 3BYMA 5IA2A 4ZXTA 2C3JA 2QLUA 3G9LX 4MXOA 4PPCA 2XK4A 3COIA 3LW0A 4X2GA 4AN9A 5DT3A 2YJSA 4O1OA 4E5BA 5BUIA 2UZOA 4I6QA 3TN8A 3E7OA 5TKDA 4EONA 2R3FA 2O65A 4ENYA 3ACKA 3UJGA 1VEBA 5J1VA 4KUJA 4A4XA 5H2UA 3IQ7A 2HWOA 2R4BA 3PFQA 4OTDA 4R5YA 1KWPA 5HIEA 3LMGA 4EHVA 2JITA 1GZNA 2QURA 3IG7A 3OXTA 2W1DA 3Q2JA 3C5UA 3KGAA 1P4FA 2J2IB 3QQHA 3AGMA 3FMNA 5IA1A 1YWRA 4GH2A 3G15A 5IQFA 3O51A 4G16A 5FEDA 3EYHA 3R8UA 4WHZA 3PJCA 4BCFA 1H26A 2ONLA 4YURA 4CTBA 1XQZA 3O50A 1GIJA 4N70A 4IWOA 2VX1A 5BQ0A 3OW4A 2IVTA 5IA3A 4ASXA 4O1PA 4NZWB 3VS1A 1JAMA 5AR7A 3QWJA 2JIVA 2AYPA 2WTJA 5IQDA 4O7TA 5EH0A 4AFJA 2O2UA 3OXZA 3SG9A 4I3ZA 3LZBA 4P2KA 3QKKA 3CGOA 4EOLA 1H24A 1JOWB 3H3CA 3NW6A 4BDFA 3AT2A 3MVJA 3R22A 2FSLX 1UVRA 5HG5A 4DEEA 3NNUA 1OBGA 4H3PA 3UZTA 3W2PA 4FT9A 4J53A 3F6XA 4F7SA 4LMUA 1PRYA 2VTJA 4DFZE 2F7ZE 3OCGA 3Q60A 4L3JA 4OTIA 4YSJA 5DFPA 5FWKK 4EHGA 3QD0A 2XNOA 4DH7A 2PVRA 4CKRA 2YZLA 1WBVA 3HMNA 4DEIA 4C02A 5CF5A 3MY1A 1L8TA 4FNZA 4W4XA 3E87A 3BU5A 4KKEA 3QKLA 5K9IA 2A27A 5KMLA 4K18A 3R7VA 2UZTA 3D83A 3EQBA 3DFAA 5JFXA 3VAPA 2G01A 2Q0NA 3P79A 5CVHA 4AXAA 5TR6A 3RKBA 3NSZA 1Y6AA 4HJOA 3VUGA 4XYFA 3L8SA 1IA8A 3TG1A 3UO5A 3E8NA 4J99A 4ZOGA 2OJJA 4BCJA 4EOMA 2VTAA 4UALA 1PY5A 3FLWA 4EORA 1JVPP 4O0UA 3CTHA 5T6KA 4GU9A 2E9OA 4IX6A 1Y57A 1Y8GA 3HV4A 1YWNA 4I94A 4GJ3A 4J95A 4JQ8A 4QP8A 4YZCA 5IEYA 4MTAA 5KCVA 1TVOA 2FO0A 4BKZA 3LJ0A 4CV8A 5B2KA 2WB8A 4PUZA 2H96A 3W8QA 4BYJA 3FC1X 3U6HA 4CFNA 2ZVAA 3MW1A 2XYNA 2Z7SA 5LWMA 3BE9A 2ZV9A 2VNYA 2IZRA 1OKZA 2JC6A 2OZOA 1XH8A 3Q2MA 1MRYA 3HP5A 3KY2A 1FQ1B 1UU8A 3D5UA 4BDDA 4RPVA 3Q9YA 1YRPA 4DFXE 3A62A 4NCTA 3G6GA 4D2TA 3L9PA 2WQEA 2BKZA 3BEGA 4KB8A 1TQMA 2X2KA 4LI5A 4RIWB 3A8XA 5ETIA 2VRXA 3S3IA 4Q9SA 5M57A 4NEUA 3V5TA 1H1RA 3UZPA 4AE6A 1J3HA 2XYUA 2H9VA 2YCRA 4IB5A 5HX8A 1G5SA 3GXLA 4M66A 4G6OA 2FGIA 3MFTA 3GB2A 1G8AA 2ITWA 3TACA 4N6ZA 5J7BA 1WBSA 4JX7A 1JKKA 4CRLA 2PULA 3N4UA 4FOBA 3FMJA 5E8TA 2OK1A 3RK9A 2UW5A 5AMNA 5GJDA 2UW3A 4C59A 5EQYA 3QQGA 4ASZA 4A9YA 2X7OA 5EW3A 3I79A 3O17A 3OTUA 3AMBA 3DBEA 5BMMA 1SNUA 3AG9A 3EMGA 3JR1A 4GT4A 4G3GA 2CPKE 2E2BA 4YJUA 1WBNA 4U6RA 3U4UA 4ZLYA 1Y8YA 3R1SA 2CKEA 4M69A 4K77A 5IDPA 2GNHA 2XKCA 5EG3A 2GFSA 5EQEA 3I4BA 4FTMA 4IAZA 2RFEA 3P5KA 4YLJA 3VS0A 4Y8DA 3DPKA 1JSVA 5J1WA 3BYUA 4F99A 5ANOA 1WAKA 3EFWA 2XNBA 3A60A 3KN6A 4FKGA 4MNEB 2QHMA 4IZYA 4LGGA 3SLSA 3VBWA 3DBFA 2OXYA 5C8NA 5JKGA 2QODA 3QKMA 4FZ6A 2C3LA 5AAEA 3QAME 4M7IA 3H0ZA 1F5QA 4E4XA 3E3PA 1H1WA 3DCVA 3MWUA 3FWQA 3FZ1A 4FR4A 4BC6A 4J97A 3FMMA 3OOGA 4JBOA 3MDYA 3D5XA 4D2SA 4PMMA 3OUKA 4YO4A 4CEGA 4C2VA 4C61A 2KULA 2XKFA 3F7ZA 1Y6BA 1LP4A 3ZO1A 5A4EA 1DAYA 4Y95A 3DT1A 3SW4A 4C4EA 3QRJA 3DXNA 3GFEA 3KRRA 4D28A 5LMKA 3OTVA 3R30A 4ITIA 3QQLA 4ALWA 4MWHA 2JFLA 5HBEA 3PSBA 4WRSA 2BZHB 5DN3A 3COHA 1Q99A 4UWCA 1I44A 3DAEA 3G51A 3W8LA 4EC8A 2YWPA 4ALVA 2W4KA 2BROA 5CU2A 2X4FA 3OCBA 4XBUA 4IANA 3UGCA 4FGRA 4LM5A 3HP2A 4JDKA 4EH6A 4C37A 3IW8A 3QX2A 4IZAA 2XRUA 4UMTA 1WBPA 4K33A 1H08A 3FY0A 3OEFX 4RA4A 4TW9A 5HCZA 3SX9A 3SXFA 4F0GA 5A9UA 1ZZLA 3KN5A 2Z7QA 4XG3A 4E3CA 2WO6A 3FI4A 4JG7A 1YDTE 2I40A 3MFRA 2PMIA 4IB0A 2PHKA 3A4PA 1WZYA 2VX0A 3HMMA 3VS3A 3W2OA 4I24A 3WZUA 2VWXA 3EFJA 2B9JA 2CKQA 2PZPA 4HYSA 2BAKA 3TUCA 4GUBA 2XK9A 4BIDA 5K4IA 4FKIA 5K5XA 3OT8A 3PJ3A 4IZ5A 3F2RA 4JDIA 3AD5A 1YI6A 2XKDA 3DZOA 3LFFA 2HZ4A 1M7QA 4IAYA 5D11A 3U4WA 3ZM9A 4QP3A 4R78A 4ZTSA 4AGDA 1OUYA 4ZZOA 4RMZA 1CSNA 2OJIA 4HNIA 5E7RA 5D10A 2X2MA 4CFMA 2W5BA 3C0HA 2C1AA 5IISA 1PYEA 4BIEA 5HU3A 3ZDUA 2ZV2A 1RW8A 3OHTA 3UC4A 2VGPA 4KIOA 2I6LA 4I22A 5D7AA 3F3WA 5CAUA 2PZ5A 4D5HA 2PUIA 4Y5QA 2B9IA 4D58A 2GNFA 5EI6A 4DGGA 4GG7A 3MJ1A 4WRGA 2WXVA 3RZBA 3LXKA 1QPCA 3EWHA 4IWPA 4ZS0A 1PXNA 4I23A 5AUVA 2XIKA 3V5PA 4D4RA 4GK3A 3HGKA 2PZRA 2BRNA 4QP7A 4ZLZA 3ANRA 3TI1A 2JKQA 4G34A 3RM7A 3HLLA 4CLJA 5L2SA 3ALOA 1OGUA 2PZYA 3PA4A 2YERA 2HY0A 3F2NA 5DEYA 4FUYA 4WNPA 2RIOA 4IAFA 1Q41A 2QO2A 4QMMA 1T45A 4C2WA 5DH3A 3W2CA 3E8DA 3RCJA 3LQ3A 3QCSA 3V6SA 1GZOA 1W84A 3NLBA 3UYSA 4O86A 4FKWA 4H1JA 4JBPA 3FE3A 1PW2A 1YVJA 2WMUA 5CZHA 3LCDA 4D1SA 5J9LA 5HLWA 2NRYA 2W05A 2RFDA 5IA0A 1XH7A 3MS9A 4UB7A 2WQMA 5IA5A 2BALA 3ZZWA 5FXQA 4H3QA 4AACA 4I4FA 4FKTA 3DXPA 4EUTA 4FSUA 1JBPE 1FVVA 3WIGA 2Z7LA 3D94A 4O27B 4MXXA 4BDJA 1NT2A 1A9UA 4PV0A 2BVAA 4QTEA 3HUBA 1BL6A 3HVCA 4AW0A 3QRIA 4H39A 2O8YA 1OECA 3VNTA 4RFMA 4MX9A 4C7TA 4W4YA 4ZY4A 2IG7A 3NCGA 5IA4A 4O0SA 2P0CA 3FZPA 3KULA 4AFEA 3H0YA 2VAGA 3NMUF 3C4FA 2VWWA 3R1YA 3WYYA 5L3AA 5LQFA 4O2ZA 4FV7A 3V51A 4G5PA 1B6CB 1URCA 1H0VA 1PF8A 3CJGA 4PF4A 4EJNA 3PXYA 3HUCA 4EZ7A 3NUXA 2P2IA 3MPTA 3TDWA 4BDEA 1H25A 4B6LA 2JKOA 4CFWA 1WVWA 3Q04A 2UVZA 5FLFA 1NVQA 4OW8A 3L1SA 4FZ7A 4GFOA 2CGUA 4U81A 4WNKA 5AIKA 3QRTA 1YXVA 2BTRA 5IH4A 3QA0A 1WBWA 3R2BA 5JFWA 4HVGA 3LLAA 5A46A 3I6UA 2QVSE 3NCZA 4N6YA 4GT3A 4YBJA 3KC3A 5KHWA 4ERKA 5B7VA 5JRQA 3U6IA 2OLCA 1WVXA 3TT0A 5AV4A 4E7WA 3SOCA 3WZDA 4CZYB 2QO7A 3RPYA 2I0HA 3MA3A 3KXZA 3R2YA 3O8UA 2OICA 4J8MA 3W16A 2JKMA 3QZHA 4AZVA 4BRXA 3MBLA 4NFMA 4FMQA 2GHMA 2XMYA 4U79A 3C51A 4ZTQA 4DA5A 5A54A 3EYGA 4NL0A 3ZLYA 1NA7A 4BKJA 5ACKA 3UC3A 5GZ8A 4UXLA 2YIQA 4IVAA 4O21A 3ZXZA 5C1QB 3F88A 3FMDA 4FT0A 4F70A 3IW4A 5ETAA 3EN7A 4S33A 2GMXA 4A9RA 2WQBA 3PG3A 4YZMA 5C8KA 2H8HA 2HXQA 4FBXA 4KSPA 3R9DA 1DI8A 3QTQA 4JAJA 4X0MA 3ZONA 4ARKA 4WBOA 3MH0A 2ZM1A 4FKPA 3E92A 2ETRA 3GNIB 4YC6A 4UMUA 5BVFA 3QZFA 2R0IA 4FT3A 4H05A 1OL7A 3M1SA 1H1PA 3D5VA 4UWYA 3NS9A 3UMXA 3V5QA 2WHBA 4RX5A 4DTBA 4EJ7A 1KOAA 3CC6A 3F5PA 5L6WL 4HGLA 2CN5A 3JYAA 4B9DA 4TWOA 3AMYA 4NM3A 4TYHA 5LVLA 2VTTA 3I60A 3VBQA 4F6SA 2G2IA 3KKVA 3NUPA 2XH5A 4DG2E 4WD5A 2WTCA 3IGOA 3VHKA 3WYXA 4BBFA 2VWUA 3E5AA 4R1VA 1QPDA 5GHVA 3TDVA 2QQ7A 1GY3A 5EM8A 4DH1A 4F6WA 3H9OA 5BYYA 2PWLA 4BCPA 2ZV8A 1DM2A 3OCSA 4ZSAA 2CNQA 2ZOQA 3PLAE 5AIRA 1S9JA 2RL5A 3ZEWA 5F20A 5JSMA 4RGJA 2ERKA 5I5ZA 5TT7A 1MRUA 4RIXB 1FVTA 3QRKA 4AGUA 4XRLA 2QOIA 5ANDA 4AN3A 3NW7A 3CS9A 1A48A 4MAOA 5HE1A 3OZ6A 3U9NA 3OBGA 4R3RA 1UV5A 2WEIA 4IIRA 1Q61A 2GS7A 2IW8A 2IW9A 4BTFA 4EH8A 4ZZNA 3IW5A 1VYZA 3D5WA 2YCQA 4BI0A 4YJOA 2RG6A 3VUIA 4DGMA 5ETFA 3RPVA 3FMEA 4IADA 3FZTA 3W2SA 4C34A 4FNXA 4PX6A 5HO8A 2EUFB 1FOTA 5ANEA 4BBEA 4RT7A 2W1EA 4K6ZA 4GU6A 3NWWA 4MWIA 5CSPA 2QU5A 3OD6X 3KA0A 2QR7A 3EL7A 4FVRA 4U3ZA 2J0MB 3C4CA 2C1BA 2W7XA 3G2FA 3TNIA 4AGWA 4UEUA 3DQWA 4B8LA 4MBLA 4AP7A 3A7IA 2OF4A 1PKGA 2UW4A 4G6NA 5K0KA 3MB7A 4NKSA 2JDSA 2J51A 3O8TA 4B0GA 3QTIA 2O0UA 4LUDA 4G5JA 1OL1A 1UU7A 4QMQA 4MXCA 2GHLA 4E5WA 3UODA 1R0EA 4I6FA 2WTDA 3QQFA 4O83A 3TKHA 4DBXA 3BKBA 1ZYLA 1Q97A 4DH5A 1EH4A 3NNXA 4P5ZA 2IVUA 4GV1A 3VQHA 3GCSA 1Q3DA 4FSTA 3ZFMA 4ZTMA 3HYHA 1MQ4A 4F9CA 3EZRA 4IBMA 4CSVA 4QQ5A 1AD5A 2XB7A 2XRWA 3N9XA 4P5QA 2QR8A 3BRBA 2GU8A 1H07A 2PMNX 3SAYA 2HWPA 3UVPA 1RDQE 3VUTA 3KQ7A 4M14A 3COMA 2ITTA 4TWPA 4CFXA 1IASA 2EB2A 1J7UA 5GJGA 1W98A 5C8MA 4BCMA 3NRMA 4FT5A 3PIZA 4RX8A 2QCSA 4X21A 5J5SA 1GZKA 2WNTA 4DHFA 4RFYA 3CIKA 3NVKI 4JR3A 4OT5A 4E6QA 4NTSA 3R7YA 1OIYA 1ZY4A 2PE2A 4PTCA 3DTCA 2BDWA 4TWCA 5FDXA 4O38A 4BTMA 1V0PA 2EVAA 5E8YA 2WMWA 4JX3A 3R00A 1REJA 2A1AB 1R39A 2YM6A 4QMLA 5E92A 4DH8A 2X81A 5LVPA 3DBQA 5E8UA 3DKFA 3EJ1A 5GZAA 4GCJA 5CXHA 4CNHA 3C4EA 3ORZA 4HNFA 2OIDA 3HL7A 3KXXA 4WUAA 2CNUA 2BZKB 4GFGA 4EBWA 1YXUA 4I6BA 2C69A 2P3GX 3TV4A 3AGLA 2NNWB 1E1XA 4U44A 4BDCA 4F9YA 5CALA 5ETCA 4XJ0A 3S4QA 3PP0A 1ZOEA 3BZ3A 4RBLA 5IMEA 4X3FC 5AP6A 3HV6A 4L00A 3R1NA 4GSBA 4MYGA 4NK9A 3T8OA 4FK3A 3FLSA 4AZSA 4IC7A 3HMOA 3HAVA 4BICA 1QL6A 3RWPA 3JXWA 3NYXA 4RIWA 2ITQA 3Q9ZA 1TQPA 4GG5A 4DYMA 4C3PA 3ACJA 1IG1A 3A99A 4IM3A 5L8KA 4XG7A 5DRDA 3ERKA 1JKSA 2C68A 1FGIA 3LM0A 3MI9A 3OBJA 4FKSA 3MIAA 2CNVA 3Q4UA 3R7EA 4ZIMA 3DJ6A 3QALE 3CR0A 1OPKA 1TKIA 5A3XA 3QQKA 3MN3A 4HZSA 4BTKA 3DKCA 1IAHA 4HPTE 5G1XA 4M15A 2QOLA 5K5NA 4P4CA 4RWIA 2BRGA 3FLNC 3ZMMA 5CU4A 2CHLA 4RIYB 5C01A 4J71A 2R7BA 4ZJVA 3R9NA 4FG9A 4YO6A 3CD8A 2WIHA 4YJSA 3U6JA 3IPHA 5FGKA 2R7IA 4ZJJA 2Z60A 4CMUA 5CEIA 2OBJA 3VUMA 2J0KA 3GGFA 2OZAA 4BHNA 3ZXTA 4I6HA 4GFMA 4DGLC 3NIEA 4CCUA 1YHVA 3FQSA 4JDHA 3EQPA 3AOXA 3VUDA 4EZ5A 3BCEA 2YABA 4ASEA 3ZBFA 4YNOA 4AOTA 1XWSA 3R1QA 5HKMA 4IM2A 4K8AA 2VNWA 5IMXA 3LKMA 4LYNA 3TJDA 4MNEA 4IVCA 3KXGA 3V5LA 5HIDA 2IN6A 2VTIA 3CGFA 3H9FA 5AP5A 3SGCA 5JK3A 4IQ6A 3H4JA 4FX3A 3VHEA 3F5XA 3ZS5A 1W7HA 4APPA 2C6TA 4HGSA 3FPMA 4FNWA 3TZMA 3PXFA 4JT3A 4O0TA 4Y46A 2PE1A 2YHVA 3O23A 4OR5A 4QMOA 4CKIA 4O7ZA 4ZK5A 5HE2A 2XNEA 2R3IA 4RQVA 4Y85A 4JBQA 4QOXA 3EZVA 4D55A 3DB6A 2Y4IB 2HOGA 3GUBA 4XV2A 3K3JA 3BYOA 4FKJA 5CU6A 5CENA 4KIQA 3MA6A 4PDPA 2X7GA 2XNMA 3RCDA 5BMSA 2HZIA 3LFQA 2WMSA 4QMZA 3U9CA 2Y6MA 4FKOA 2YEXA 3E63A 4Z55A 3RBWA 3UO6A 5AEPA 4LV8A 1XH4A 5E8XA 4QTBA 3ORIA 4MXAA 3DBCA 4IFCA 4C3FA 3BX5A 4FODA 3E8EA 3SHEA 2ITUA 4DFBA 2X2LA 2ITPA 3VUHA 3OY1A 1XO2B 2F2CB 3EB0A 3EFLA 3HRFA 4L8MA 4R7HA 1UKHA 2OJFE 2UV2A 3Q32A 3WE8A 4F6UA 3PY3A 4Y5HA 4Q2AA 2CJMA 2XUUA 3DNEA 3I1AA 4NW6A 5HE3A 2NPQA 2WMQA 3QLFA 5EW8A 4UX9A 2I0EA 5LCKA 2WIPA 3PZEA 4TKSA 4O7LA 4OLIA 5EM6A 4FI1A 1YOLA 4G2FA 4FSZA 3W33A 4FTUA 3EFKA 1XBCA 4U3YA 5M56A 4F7LA 4QP2A 4F1OA 4O6EA 4WA9A 2JEDA 3RI1A 3ZRMA 1W8CA 5IQGA 3UIBA 3E93A 2E9PA 4FV0A 3RAWA 3UOKA 4BBMA 1LEWA 2UW7A 4W4VA 2WEVA 3LCSA 4W4WA 4HGEA 3DAJA 4DTAA 5HHWA 2JAVA 3MY5A 5L2TA 4C38A 1ZXEA 4R3PA 2WGJA 4ZJIA 3LAUA 3G9NA 4Z16A 3KK8A 3GC7A 4XP3A 3BBWA 1OZ1A 2WTVA 5JT2A 5M08A 1U54B 3ORTA 3VC4A 2C5XA 1UU3A 1WBOA 2IVSA 4CGAA 5EI8A 3ENMA 3I6WA 4BWPA 1KOBA 4D9UA 2VTNA 2X6EA 3KRXA 3R0TA 3R28A 4RZVA 1YKRA 4FV8A 4KBAA 3WE4A 4EQUA 3GEQA 2ZDUA 3QHWA 4KRDA 4II5A 4M84A 4OTPA 4D9TA 1ZMUA 1YOJA 4BHZA 4F63A 4L7SA 4RQKA 2ITYA 5C26A 4OAVB 3QGWA 5JGBA 5CI7A 2FA2A 4LL5A 1J91A 3BIZA 5CEPA 2V62A 3A8WA 3FDNA 4FEUA 2BFYA 3ZC6A 5CU0A 4FYNA 3OUNB 3VBYA 2HY81 2Y7JA 3IK3A 4YPSA 5AR2A 3R8ZA 3QGYA 3Q3BA 4ZMEA 1HCKA 2C3IB 2NRUA 4IXPA 5HESA 4PDSA 3CSVA 4EK8A 4PY1A 1IA9A 3F2AA 2WQOA 3D14A 1E1VA 3PWYA 3BQCA 3G5DA 2WMTA 4I4EA 5FM2A 5HO7A 3ZYAA 4R5SA 4ZAUA 2JIIA 3V01A 3W1FA 3I7BA 3GU8A 1XR1A 1XJDA 2VU3A 3KMMA 3ZUUA 3ZO2A 3IKAA 3LM5A 3EN6A 2WMVA 3HRBA 4DEDA 3SRVB 2ITOA 2VTPA 5IQEA 3TKIA 4HCVA 5AUXA 3DAKA 3KL8A 2BRMA 2BDJA 4K0YA 4DFLA 2XVDA 2ITVA 2OIBA 4JXFA 2VTOA 3PA3A 2WELA 3FC2A 4IX5A 4ZTHA 3UVRA 1H0WA 3SA0A 3ORNA 3OXIA 3D4QA 3PP1A 3RK7A 1RE8A 2WTKB 2Y0AA 3IDBA 3BHYA 4NWMA 4JDJA 3KF7A 4CCBA 4PTGA 3MVMA 3DOGA 2J4ZA 3W55A 4TTHB 3FI2A 3WIKA 4M0YA 4DTKA 1YXXA 4J8NA 3NZ0A 5AP4A 5IH5A 2PUNA 3RK5A 4FYOA 2ONLC 5LCJA 4LOOA 3UP7A 4ACMA 4E4LA 3DB8A 2PUUA 1RJBA 5AUUA 3FLZA 3F3VA 3Q52A 4EH3A 5CT0A 1PJKA 3FMLA 4LL0A 5CF4A 1JLUE 2VTRA 3VN9A 1JPAA 3DDQA 3HMPA 3LXNA 2UUEA 3PPJA 4DEBA 3FAAA 3LCOA 2QC6A 1Q3WA 3KEXA 4RWKA 2UZUE 3MPAA 3BGZA 3D15A 5HG9A 2A4LA 5GZ9A 2B0QA 3HKOA 4RG0A 3TIZA 3VWAA 2AUHA 3NR9A 4M12A 3R02A 4YJRA 5DVRA 1M7NA 1R0PA 2WTWA 2QLQA 2BDFA 2O63A 5AV3A 3TV7A 4A4LA 4FG7A 4PMTA 1BUHA 1U46A 4BI2A 3NW5A 3OG7A 3GOKA 3PSDA 5AP1A 1OL2A 3QCXA 2AC3A 2GNIA 2OH4A 3UVQA 4A4OA 4MKCA 3RHKA 3QFVA 4B99A 4YP8A 1V1KA 1Q8YA 4RWLA 4NFNA 3TZ9A 4FIEA 3DK7A 3QUDA 3F9NA 3DU8A 3KCKA 4YJPA 5JZNA 4D4YA 4DEGA 1OBDA 3C4ZA 3DJ5A 2BZJA 3POZA 4LV5A 5DYJA 3GBZA 4E4NA 4EEVA 3C5IA 5CEMA 4WUNA 2LAVA 3DK6A 4GMYA 2BAJA 3WZJA 4FSRA 3POOA 4FV9A 4DCEA 1NVSA 5AA8A 5CEKA 4UZDA 4DT8A 3DBDA 4FKUA 4FK6A 3PVUA 4X2NA 4EH2A 5KKRC 2Z7RA 3R21A 4AT3A 3R7OA 3PRFA 3QA8A 4PPAA 2ETMA 3RVGA 1Q5KA 3MH3A 4IX3A 2F9GA 1T46A 2FH9A 2R0UA 4YJVA 4AX8A 5BNJA 3PTGA 4S31A 5HD4A 1TQIA 3GQLA 3PE1A 3CKWA 5I9YA 4GKHA 4IVDA 5GIPE 4FIGA 3GC0A 4E93A 4J7BA 4O6LA 5K3YA 3L8PA 1FPUA 4TNBA 1J1CA 5ICPA 2V22A 2OI4X 3CBLA 5AV2A 4BN1A 1M17A 2FSMX 4IB3A 4JRNA 5DEWA 4C33A 3ZUTA 3HMIA 3BHUA 5AADA 3NPCA 3L9NA 3ZSIA 3QTWA 2YM8A 3OWKA 4RX9A 5L4QA 3P7BA 3B8RA 4V04A 1YXTA 2QI8A 1KE5A 2J5FA 3EQCA 5HO6A 2W99B 4I5PA 2HW6A 3WF5A 3A7FA 3BEAA 4ZSEA 4F65A 2O3PA 5JGDA 4EOKA 2J0LA 2R64A 1KE8A 3K5UA 3KXHA 3VIDA 3VS4A 4EK6A 4Y73A 5KMMA 4CZUA 3QQUA 1APME 2C0IA 2XEYA 1OIRA 5L6OA 3Q96A 4MHAA 5FP5A 3Q6WA 2R3NA 3U55A 2R3QA 3OS3A 5KZ0A 2DQ7X 3SXRA 5LJJA 4F1TA 2YCFA 3A7JA 5CT7A 3TWJA 3T9IA 4Z3VA 4G3EA 4FKRA 1XH6A 4BB4A 4XS2A 4ZSGA 4F08A 4AF3A 1OKWA 4DEHA 2UZNA 2X39A 3D2IA 4BI1A 5CAVA 3DQXA 3BPRA 5AP3A 2XP2A 5F4NA 3GT8A 2V0DA 4RJ3A 3R71A 2XBAA 5CY3A 2EXCX 4FVQA 5F9EA 5HX6A 3R8LA 3LFAA 3E3BX 3WF6A 2BTSA 5KMKA 3T3UA 2GS6A 3EQHA 3UOJA 3NNVA 3CTQA 2RG5A 4JQEA 5KMOA 3PVWA 4AN2A 3B2WA 3C0GA 3F5GA 4O7YA 2HZNA 3LHJA 4JRVA 2B52A 3P23A 5HG7A 5E8ZA 2ZB1A 1PMEA 4L68A 4QMYA 4L52A 3UIXA 4R7BA 2X6DA 2VD5A 4N0SA 4RC3A 4IDVA 3G33A 2WKMA 4CQGA 3RPSA 2UZWE 2VUWA 1JSUA 2JIUA 2WTIA 2R2PA 2C6DA 5A4TA 2EU9A 3RHXA 1OPLA 5KKRB 2YA9A 5IEVA 1LR4A 2PL0A 4EOQA 4CVAA 1Q24A 1OUKA 3ODYX 1P14A 1Q4LA 2F7EE 5DPVA 3ULIA 3TUBA 5KUPA 2YIRA 4IW0A 4F0FA 3LVPA 4N4SA 3O0GA 4TY1A 3F3UA 2XCHA 1ZYJA 5ANKA 1DAWA 5EHYA 4DG3E 3PA5A 1IAJA 3QYZA 4XG4A 4MXYA 3R7IA 4FV1A 4AT5A 4PMPA 3PJ1A 3NUYA 1UNLA 2E9VA 4FTTA 4YJQA 5DR9A 5L2QA 4U9AA 3UNJA 3EQGA 3IOPA 3FXZA 4XV3A 1ZYSA 2QU6A 4FL1A 5E8WA 3RNYA 2J90A 3QCYA 3LMIA 2QKRA 3WF8A 3PPKA 3HZTA 5DT0A 4A9UA 4V0GA 4L3LA 2JFMA 5CQUA 4HW7A 4WG5A 4JQ7A 3NUAA 3L8VA 3UG2A 2E9UA 4C4JA 2BILB 3KF4A 4PL4A 1ZWSA 4A06A 3C1XA 3DK3A 3OVVA 2YWVA 4ID7A 4E4MA 4GIIA 4FSYA 5EOBA 2V55A 4A9TA 3AQVA 4KAOA 4PP9A 1SZMA 2PVFA 2OH0E 2VO6A 1PMVA 5HVKA 5GIOE 2JBPA 2RSVA 3CY3A 4G3FA 4JNWA 3AT4A 3U87A 2X4ZA 4YLKA 3BHTA 4FT7A 3LMHA 3JVRA 3VW8A 2X9EA 2G1TA 2VTMA 3WARA 1I09A 3MVHA 4OTHA 4WOVA 2UW8A 3DTWA 1Q8ZA 4D2WA 2X8DA 4L45A 5B2LA 4O7WA 3AC3A 1KV2A 4FV3A 3CPBA 4EI4A 4L67A 4EOPA 5DMZA 4O7VA 4EH5A 4DBNA 2Y8OA 1PXMA 2OJ9A 3IDPA 2VWYA 1FMOE 2V5QA 2R3KA 2W1IA 4XG8A 4YC3A 5HD7A 4E1ZA 4DF3A 4WKQA 4RIYA 5CEOA 1OVEA 1OPJA 5B0XA 3ALNA 3SQQA 4O0YA 2WOUA 3BYVA 4XV1A 2IWIA 2REIA 2C6EA 4O0VA 5A4CA 3FLQA 2C6IA 5AM6A 4R6VA 3BWFA 3V3VA 4C35A 2VV9A 5KBQA 4BY9E 3ORXA 2OWBA 2WFYA 2YAKA 1PYXA 4FSQA 4K9YA 5AX9A 4YTCA 1KUTA 4OBOA 4QTAA 5C9CA 2AC5A 4ACHA 4NH1A 3PPZA 5AP0A 3AT3A 3UMWA 4CRSA 4TYHB 4O82A 1KE9A 3P1AA 5AFVA 2XK6A 2XCKA 3DA6A 3UG1A 5BVOA 2BIYA 5F1ZA 4KIPA 5HE0A 3R73A 3V8WA 4C4IA 4CG9A 3ZH8A 3TIYA 4KABA 4RJ5A 2C47A 5HI2A 4D2PA 1OITA 3EN5A 2UVXA 2C4GA 5M51A 4TPTA 4LGDA 5J7HA 5FTGA 1OKYA 3GI3A 2OIQA 3G90X 3P7CA 3QXOA 5L8JA 3EL8A 4JAIA 4WSYA 4C3RA 3TCPA 4RIXA 4DLIA 4QO9A 2EWAA 5HNGA 2BAQA 3LPBA 1ZMWA 4O7NA 3MJ2A 5E91A 2Y6OA 2FYSA 3IDCA 1AQ1A 4JR7A 4DG0E 4USEA 5HTBA 5IUGA 2PY3A 4GRBA 3WBLA 5J87A 4NCTC 4JVGA 3E7VA 4CZTA 3Q53A 5KNJA 2VO0A 1JKLA 3AXWA 4MD9E 5D7VA 5BPYA 5LMBA 3COKA 2W1HA 4FTRA 1SMHA 2WPAA 3QD4A 4FV5A 4OUCA 3WI6A 3ANQA 3LXLA 4ZY5A 3IOKA 4JG8A 3UQCA 4ANMA 4YLLA 5J79A 1M2RA 4IAAA 3M42A 3IONA 4MH7A 3D0EA 2CKOA 3KFAA 2HK5A 4O0WA 3PY1A 2JKKA 4KRCA 2WD1A 4FL3A 4OGRA 4U8ZA 4L44A 3S95A 4Q5EA 2WZJA 5HQ0A 3WOWA 2BIKB 4DC2A 4YC8A 2OFUA 3FMHA 4PNKA 4UBAA 4QYGA 4RVLA 2QOOA 4XMOA 4FVPA 2I7QA 2ITXA 5EDQA 4BDGA 3A2CA 4UY9A 1PHKA 3ZSHA 2UZLA 2XK7A 3LFSA 1K3AA 1DS5A 4JJRA 5CVGA 4BZOA 3T3VA 3OEZA 2QG7A 2GNGA 3PUPA 2FVDA 2A0CX 3KB7A 2V7OA 5D9HA 4TL0A 5M4CA 4M69B 3QCQA 4I5MA 1GJOA 4I20A 3PLSA 4I0RA 4E6CA 4FL2A 3AD6A 5EW9A 4AOIA 4O7SA 5EYKA 4NSTA 4GL9A 4LRJA 5DA3A 5T68A 2DUVA 3JVSA 3RAHA 4ANQA 4FIIA 4XRJA 3TKUA 2BFXA 4S30A 4Y72A 2ERZE 2UW0A 1U54A 3D7TA 4C4FA 5M53A 3S0OA 3CQUA 4IC8A 4M67A 4TT7A 3TNPC 4BKYA 1P5EA 2R3PA 4Y83A 1BMKA 3ZEPA 3JY0A 1MUOA 1PXOA 3G6HA 4G3DA 4GVJA 5I9UA 5BVKA 3ETAA 4Z7GA 2XA4A 2R3RA 4FKQA 4QNAA 2RKUA 3AC1A 4R1YA 3RTPA 3V04A 4BVUA 2IZSA 2LGCA 2F2UA 2GTMA 3EN9A 3GQIA 2OU7A 3ORMA 1FVRA 2EXEA 2VTHA 3LQ8A 5JGAA 5CXZA 5JEBA 1PMNA 1R3CA 2IO6A 4YPDA 2QG5A 2XIXA 5LMKC 5GNKA 4FEQA 2P4IA 4XP0A 3ORKA 3NEWA 4DAWA 4KINA 4D1ZA 2EB3A 4KBCA 2W5HA 2C30A 4BCNA 4TNDA 4L9IA 2VX3A 3GCUA 4APCA 5I0BA 4OTRA 1MRVA 3QTUA 2C3KA 3NX8A 3T9TA 4IWQA 4X3JA 4EC9A 2EXMA 2HIWA 4TRLA 2PK9A 4C4GA 4U80A 5EYDA 1L3RE 2P33A 4BR3A 2PTKA 3R9OA 2VTSA 4LUEA 4O96A 4BF2A 4F09A 4O91A 4PL3A 3GCQA 4E73A 4NUSA 4Q5HA 5FTOA 4ALUA 4ERWA 1KV1A 2DYLA 1M14A 4C58A 1UWHA 3ATTA 3R9RA 3D2KA 3EQRA 3R7GA 4AW2A 4XG9A 3HV5A 4MQ2A 4Q9ZA 2VO7A 2WMRA 4QYYA 2R3OA 1J1BA 1ZOHA 3DLSA 2YM5A 4MXZA 5FP6A 1PKDA 4HZRA 2QOHA 4I93A 3ZO3A 1NW1A 3BGQA 4BWXA 4AZTA 4NM0A 3D7TB 2Z8CA 2W96B 4RA5A 2YLFA 1H1QA 3FHRA 3LFBA 4ITJA 1BLXA 2GNLA 5FEEA 3UBDA 3P78A 4XV9A 5IG1A 5FG8A 3MIYA 3GFWA 2CCHA 1NXKA 2XKEA 4RWJA 5DIAA 4ZTRA 3RZFA 4DGOA 4YTFA 5I9WA 3MFUA 2GS2A 4QPAA 5FUTA 2W9ZB 4MNFA 4L01A 2C5YA 3O8PA 4FIHA 3BBTB 5CNOA 4FNYA 4DN5A 2C6KA 3ZO4A 4ZLOA 4MCVA 4KNBA 4RIOA 4U45A 5AAGA 5HICA 2C5NA 4ANBA 3OC1A 3LCTA 5HBJA 1OB3A 4DLJA 1F3MC 4LMNA 4I5HA 3L9LA 4DEAA 1P4OA 4F0IA 5TF9A 3F3ZA 3LJ2A 2XNPA 4EK5A 4QP4A 4RVTA 3PIYA 3QL8A 1PXKA 4ACDA 3S1HA 4KS8A 3LFNA 4NM7A 1O6YA 4L43A 2XBJA 2A2AA 3BV2A 2ACXA 4KBKA 4WT6A 2PSQA 2IW6A 3VJNA 5BVNA 2UVYA 2W06A 5HBHA 4P7EA 1UWJA 2WMXA 4ZZMA 4EBVA 2QO9A 2OXXA 2PVJA 5HIBA 5CAQA 5TO8A 4QYEA 4UYNA 5CASA 2WOTA 3F82A 4IAKA 3R04A 5CSHA 1ZAOA 2G15A 4QTCA 1ZYCA 2BHHA 5I9ZA 5AM7A 3NUNA 4HVIA 5CF6A 4RC4A 2PVYA 1SVHA 2J6MA 3VRYA 3E88A 1YDSE 1H28A 4FTKA 3FYKX 2VTQA 4KIKA 3U54A 2OJGA 4KA3A 2WMAA 4MEDA 5FM3A 2QOQA 4XH6A 4IAIA 3PDTA 4RX7A 4V01A 1ATPE 3FPQA 4QQCA 4DCAA 4K2RA 4I0TA 4C36A 4E26A 4OBQA 4BL1A 4KKHA 3TV6A 4CTCA 5LWNA 3KVWA 1M2QA 3PSCA 3H10A 4QT1A 5EKOA 1XKKA 3K3IA 3QTXA 4M97A 5D1JA 5DRBA 1ERKA 1E9HA 1OMWA 5F95A 1U5QA 3KK9A 1QPEA 1UKIA 2IPXA 5HCYA 1ZYDA 3PXRA 4WNMA 5FQDC 4GIHA 4FTJA 1NY3A 5M55A 4WG3A 2XF0A 1Y91A 3P0MA 3C50A 4AW5A 5A6OA 4B8MA 4FZAB 2QHNA 1GAGA 4U41A 2UZVA 3BWJA 3F69A 1UA2A 5ACBC 4AZFA 3C9WA 4I92A 4L53A 4EQCA 2VZ6A 2JDOA 3MH2A 3R7UA 4L7FA 2PYWA 2NO3A 4NM5A 4J1RA 5DG5A 4QMUA 3IO7A 5E8SA 2F7XE 1YWVA 3OY3A 4DFNA 4ZTNA 5ANJA 4EOSA 2FB8A 5JH6A 3BQRA 3O7LD 2YZAA 4GYGA 5IEXA 3HDNA 5L2WA 2ZMCA 4XUFA 4AU8A 4LRMA 3LLTA 2PVKA 4ACGA 3KVXA 1XHAA 1R78A 3UDBA 3FY2A 4FEVA 3TTJA 4D4SA 2GFCA 3RINA 4F64A 3UYTA 1FINA 3HV3A 1SVEA 3W2QA 3FUPA 4CG8A 4S2ZA 4YTIA 3FZOA 4IWDA 4CFUA 4LOPA 3LE6A 3LFEA 4QYHA 4TWNA 1YOMA 3OWPA 4YHFA 1ZMVA 2YN8A 3OT3A 3NIZA 3PXKA 4EOIA 5JN2A 1OIUA 3E62A 2IJMA 2W1ZA 5KE0A 4ANSA 5CANA 4E6DA 4XOZA 1WBTA 1GZ8A 1SYKA 4YTHA 3ZFYA 4YZ9A 4PP7A 1YQJA 2HENA 3FMKA 4QMNA 1G3NA 3CCNA 5H8EA 5CNNA 2RGPA 1JQHA 2J50A 2R3LA 4EKLA 4L42A 4X2KA 4BDBA 5EHLA 2DS1A 4C57A 4IH8A 2YM4A 1BYGA 3AC2A 2CLXA 3S00A 3DNDA 5M06A 5DR2A 4YUQA 4G31A 3GU7A 3LOKA 2YDIA 3WF7A 4A07A 3PVBA 4LRKA 5A6NA 2X8IA 4DGNA 5K0XA 4OBPA 3R83A 3ITZA 4A7CA 2ZYBA 1LPUA 3BHHA 3GCPA 4JIAA 2OW3A 2YAAA 5AR4A 2W1FA 3V8TA 5IQIA 4FTQA 3E64A 2F49A 5AV1A 3RP9A 3MFSA 4MVFA 4BGQA 1Z5MA 4G3CA 2OSCA 3TZ8A 4U97A 3Q4TA 3AD4A 2OG8A 2X1NA 3BLHA 3OWLA 4MBJA 4OTGA 4PQNA 2XJ1A 3DV3A 3ZFXA 1ZZ2A 3ZTXA 5A14A 2R3GA 3BU6A 3QZIA 2WU6A 3I5ZA 4XG6A 3O2MA 4CQEA 2I0YA 4AS0A 1Q8TA 5JFVA 2YIXA 5HCXA 4B4LA 4QP1A 1QPJA 4YR8A 4BGGA 4KIKB 4HVDA 2GHGA 5J9YA 3PZHA 4TXCA 5AR5A 5BVDA 1OL5A 4FTOA 4F9AA 1YW2A 2X8EA 3F7WA 3PWDA 5HEZA 3NAXA 3SRVA 3WZKA 4E5AX 2QNJA 4FG8A 4RLLA 3V6RA 4AA4A 3LIJA 3Q4ZA 3TXOA 1WMKA 4AZEA 4YHTA 1KE7A 5FD2A 3SV0A 3KXNA 3BLQA 5LVOA 3QHRA 4KKGA 4MD7E 4ZY6A 3BGPA 4FKLA 2CSNA 1OKVA 5BUJA 5HVYA 5H8GA 4IJPA 1OIQA 4FZDB 3H30A 2Y4PA 5DR6A 2OFVA 1ZARA 1H01A 2I0VA 1O6KA 4OTWA 5FBOA 2ZB0A 4QYFA 4EYJA 2FUMA 3V5JA 4M13A 2GCDA 4BDHA 4I21A 3HDMA 5M07A 2IVVA 4FTIA 3UNKA 3HEGA 3CQEA 1WCCA 5J95A 4ASDA 2YITA 4R8QA 5M09A 5CS6A 3R63A 3M2WA 5ANIA 3SW7A 2BMCA 4RSSA 3CLYA 4IDTA 4FIFA 3QU0A 3A7HA 2A19B 3QQJA 3QTSA 1GNGA 4H36A 4K11A 5EK7A 3FKNA 3KCFA 3QX4A 3AC5A 1S9IA 4JI9A 4YJNA 3MYGA 4U42A 3NAYA 4NKAA 4B7TA 4QPMA 2XK8A 5EHOA 4CYJA 2KTYA 4AAAA 2GNJA 3R8PA 5H8BA 4AUAA 3KU2A 1H1SA 1U5RA 3L8XA 5DLSA 3IW7A 4YU2A 2ZM3A 3N4TA 1UNHA 2HELA 1V0BA 2OO8X 3JPVA 1H8FA 2VGOA 4MQ1A 5BVWA 4XCUA 2Q83A 3UOLA 4QQTA 4PPBA 5IZFA 1CM8A 4JIKA 4UXQA 5LXMA 3OOMA 5CEQA 2B1PA 3I0QA 5EKNA 1PXLA 3P4KA 2BCJA 2V7AA 3BHVA 3LFCA 3UPXA 3VS5A 4QNYA 3K54A 4KSQA 5FXRA 3ZLXA 2JAMA 3AC4A 3PXZA 2CGWA 5IUHA 1IR3A 2YIYA 4OTFA 5AUTA 5DHJA 4AW1A 3DDPA 2XIRA 4F9WA 1BL7A 3CXWA 4QRCA 4XEYA 1CTPE 5IQCA 1J7IA 5L6PA 4FE2A 2O64A 3SOAA 4USDA 4ENXA 4WSQA 5HGIA 3PJ8A 3EKNA 3VS6A 5EQPA 4HCUA 4M8TA 2BR1A 3R6XA 1CKPA 3BLRA 4LQMA 2QONA 3UQFA 1YI3A 5CQWA 3OFMA 5HORA 4C4HA 3KREA 1W83A 1Q8WA 1XBBA 1CMKE 2W9FB 4IMYA 1PXPA 1ND4A 5ANGA 5HU9A 1BI7A 4DFUA 3RGFA 3TNHA 3MVLA 5HLPA 3RNIA 2ZM4A 4NIFA 5EI2A 3NUUA 4X6RA 2B9FA 1BKXA 5IPJA 4EOOA 4UMPA 3BELA 3ORPA 5FTQA 5AA9A 3PIXA 3Q4CA 4EH9A 3JS2A 3Q9XA 3N51A 5JMSA 4YJTA 2UW9A 4HYHA 4YNEA 1CKJA 2W5AA 3QD3A 2OXDA 3PXQA 2C0OA 3O96A 1MQBA 4EKKA 2JD5A 2OF2A 1VJYA 4BCKA 3F5UA 3TNQB 1FBNA 3EKKA 4QTDA 4BFMA 4QQJA 2WTKC 4NT4A 3MESA 3OP5A 3TUDA 4PDOA 1PXIA 2JDRA 1RQQA 2W1GA 2BPMA 3Q5ZA 1SVGA 5AWMA 3KRJA 3HNGA 3G0EA 5I3RA 5CAOA 3VQUA 4XX9A 4CT1A 2O5KA 3FSKA 5IF1A 2ZMDA 3GC9A 2X9FA 5AUWA 4ONAA 1PMUA 4F4PA 4R7IA 5EYCA 2OGVA 3F66A 4NU1A 4HVHA 1J7LA 3ZM4A 3CD3A 4BZDA 3FYJX 3SG8A 4G9RA 2PVNA 4CFFA 3C13A 4RLKA 3VS2A 1HCLA 5M44A 5GINE 2XM8A 5LVMA 3CQWA 4DH3A 4HPUE 3ENHA 5AR8A 5AUYA 1WFCA 4X7QA 3NUSA 2F57A 2C6MA 4GW8A 4PRJA 1H4LA 1OM1A 3SXSA 5BYZA 3ODZX 1JKTA 3P9JA 1G8SA 3PG1A 4BYIA 5AX3A 5IU2A 4FV4A 4F7NA 1VZOA 3QWKA 2R3HA 3A61A 4USFA 3OF0A 1STCE 3FHIA 2PZIA 4M3QA 3NYOA 1REKA 2XIZA 4R77A 2B55A 1A06A 3TTIA 2CMWA 4CFVA 2ITZA 2YFXA 3AC8A 3C0IA 4M0ZA 4TYGA 5LVNA 3NYVA 4W8EA 2XIYA 3FZRA 3ZC5A 4RJ7A 5I9XA 4D4VA 2G9XA 1CDKA 5HNIX 1WVYA 4U43A 3OROA 2X0GA 3GVUA 2PVMA 3QRUA 5KX8A 4EWQA 3GU5A 4U40A 4AA5A 4EZ3A 5LOHA 5FEQA 4YBKA 4WNOA 3CKXA 4EK4A 4QP6A 4U5JA 4FKVA 2C5VA 2YDKA 3QTRA 4NJDA 4RC2A 5AP7A 5AR3A 1ZOGA 2RF9A 2R3MA 4PWNA 3GENA 3VULA 4U0IA 1SM2A 1YXSA 3LXPA 3MV5A 2QOCA 2CGVA 4YZDA 1R1WA 1YI4A 2ZDTA 4FC0A 4V05A 2VWZA 4X2FA 5HVJA 3DFCB 1VR2A 5AAFA 3TZ7A 4DFYA 4KS7A 3L9MA 3D7ZA 1BX6A 4JOAA 4EH7A 2B9HA 2E9NA 3FQEA 3I7CA 3MPMA 2VWIA 5EYMA 5AV0A 5LMAA 4BDKA 3HAMA 2JDVA 4PL5A 4ORKA 4EQMA 3FV8A 1MP8A 5DT4A 5KZIA 3B2TA 4F7JA 1GIIA 4YHJA 4PDYA 3UE4A 4CT2A 5J8IA 3P86A 3O71A 4G17A 2B54A 4JBVA 5E1EA 4PMSA 3BU3A 1U59A 4ITHA 3WILA 4UYAA 3JY9A 1SNXA 1Q62A 3VJOA 3II5A 4IFGA 2R5TA 4V0GB 4MD8E 4BCIA 4ZSLA 1B38A 5F94A 3ZDIA 2VWVA 4GVAA 3FEGA 5HNBA 5T3QA 4N57A 4HGTA 4QP9A 5DE2A 3TL8A 2W0JA 4K1BA 2SRCA 4FTLA 5BX0A 5M4IA 4RJ8A 3ZRLA 5J5TA 5E4HA 4H58A 2J5EA 2Q0BA 3TM0A 1UU9A 5GJFA 1JNKA 1QCFA 3MSSA 3MTLA 1FGKA 4BDAA 1NVRA 1XH9A 4X3FB 2R3JA 2HXLA 2YACA 4QMTA 4OT6A 1F0QA 5EDRA 3ZUVA 3UQGA 5IKWA 3V8SA 5JRSA 4FTCA 5H9BA 4IACA 2B7AA 3RAKA 3GOPA 3VBTA 5M4UA 3BI6A 4XLIA 5IDNA 3HX4A 4X2JA 4O81A 3QD2B 3ZU7A 4EL9A 4DITA 3Q5IA 3K2LA 2VO3A 3UOHA 3A4OX 3KULB 4OTQA 1Z57A 2XZSA 1IEPA 5I4NA 1JSTA 4I0SA 3V5WA 4UMQA 2XNNA 4IJ9A 4D5KA 3SD0A 3RALA 5IH6A 2CCIA 4KD1A 3QBNA 5CSWA
chains in the Genus database with same CATH superfamily
4D2VA 4H1MA 3S2PA 5HZNA 4U7ZA 5BUEA 4I5CA 5E1SA 2WAJA 4C8BA 2B4SB 2VTLA 3HA8A 2Y9QA 4TYJA 4BCGA 5I9VA 3UO4A 4S32A 3RAIA 2VWBA 4BCHA 3DJ7A 3UNZA 1Z9XA 4W8DA 5DGZA 5L2IA 3I81A 1CKIA 2IF8A 4FV2A 2JBOA 3NNWA 4JL9A 4HCTA 5CYIA 5HG8A 2CKPA 4KWPA 3BYSA 4FSWA 4D0WA 1XH5A 3P7AA 4GK2A 2PE0A 4LOQA 4J98A 3VBVA 4DINA 1PXJA 4OAUC 4Z7HA 3W2RA 3KRLA 4M68A 3IGGA 3W10A 2J0IA 3RJCA 4WBBB 3N4VA 4H3BA 5C4KA 2G2HA 3DKOA 3EQFA 2QOFA 4QD6A 2X7FA 1UNGA 3NGAA 5AUZA 4BTJA 5DBXA 3CE3A 3VF9A 4FEXA 3FSFA 2J7TA 3C7QA 3KXMA 4IZ7A 2UZEA 3ZCLA 3CP9A 3ZRKA 3EOCA 4JS8A 5D41A 5FDPA 4IX4A 4FUXA 3UPZA 2UW6A 2XK3A 2RFNA 4XBRA 4EHZA 2PVHA 3KMWA 3RPRA 3SDJA 3D9VA 4GS6A 2PMOX 3ZOSA 3VS7A 5DWRA 2VN9A 4XLVA 4FSMA 5BVEA 3THBA 1GIHA 4CMTA 3UZRA 3FL4A 2GQSA 2CGXA 4MF0A 2W4OA 4NW5A 3VF8A 4C62A 3NYNA 4UWBA 4QMPA 5ITAA 4TYEA 4W9XA 4HYUA 2YJRA 2YCSA 1IRKA 4W9WA 4I1ZA 4CV9A 2PU8A 4DE4A 3F3TA 3UTOA 3ULZA 5CAPA 5BYLA 2GQGA 4RRVA 5A4QA 5C4LA 1H27A 2XJ0A 5HOAA 2YM7A 3CPCA 3QZGA 3VUKA 3QC4A 3R01A 4AT4A 3LJ1A 4L46A 1ST0A 2WU7A 2XM9A 4BDIA 3W32A 3PY0A 4GK4A 4O4BB 4IE9A 4FSNA 4CXAA 4YMJA 4JMQA 3R9HA 3BV3A 4EH4A 3W18A 4E6AA 5JZJA 2ZAZA 1JWHA 3QF9A 2GTNA 2WMBA 5H3QA 2BUJA 2IZUA 4EWHA 3F61A 4HYIA 3VVHA 4AOJA 4BCOA 4LFIA 4ANNA 3DZQA 2F4JA 4GYIA 5IQBA 4BIBA 4AA0A 3EHAA 1KSWA 4CLIA 4QMWA 1U4DA 3VBXA 3IS5A 3HRCA 4E20A 2BHEA 5IUIA 3VONA 4JG6A 5TOZA 1OI9A 3TNWA 2H6DA 2QOBA 2XJ2A 4FTNA 4GJ2A 4LG4A 5DNRA 3E8CA 2P55A 3BE2A 2DWBA 4QPSA 2BRHA 5K4JA 3MY0A 3Q9WA 5CWZA 4X6QC 2RFSA 2OKRA 3EH9A 4X3FA 3EIDA 3RM6A 3FKOA 3OCTA 4ACCA 3K5VA 4ANOA 4O0XA 1YHWA 4UMRA 2QKWB 3GCVA 4AG8A 5JFSA 3FZSA 4G9CA 3FJQE 1H00A 5DI1A 4IM0A 1W0XC 2ZV7A 4R3CA 3GU4A 4YGAA 3PVGA 3CEKA 4GEOA 4D1XA 2PUPA 2FSOX 3FL5A 1K2PA 5IQHA 2Z02A 3FBVA 3ET7A 4P90A 4EOJA 3OWJA 4UZHA 5CX9A 3QYWA 3ZSGA 5HLNA 3MGYA 2JGZA 5AP2A 3R8MA 2GQRA 4GKIA 3CTJA 4O84A 3IW6A 3VW6A 5KO1A 2XARA 3RPOA 3MB6A 5D12A 2WQNA 2B53A 3HA6A 1YDRE 4JLCA 4BZNA 2BRBA 2C6OA 3UIUA 4ZP5A 2HW7A 3P08A 2NP8A 1QMZA 1GOLA 4WIHA 3VO3A 4DT9A 4FIJA 1ZY5A 5JQ5A 5FXSA 4IEBA 1DI9A 2GSFA 3EN4A 5EOLA 4J96A 3B8QA 2H34A 5C27A 1YHSA 3LCKA 3CJFA 3QUEA 2P2HA 4MK0A 4BCQA 3PJ2A 3GU6A 5HTCA 3GC8A 2J0JA 4ANLA 2CN8A 4RFZA 2ESMA 2GPHA 4F1MA 2JDTA 3ZLSA 4FICA 3RWQA 3DLZA 4RVKA 3AMAA 4GUEA 1V0OA 3DY7A 5EM7A 5I3OA 3HV7A 4AWIA 3ELJA 5CF8A 3QUPA 1P2AA 5CI6A 4ZEGA 4I41A 2UZBA 3QTZA 4FGBA 4YZNA 4O7RA 2W17A 4XNEA 1LEZA 3ORLA 3EQIA 2CLQA 4FJVA 1W82A 1BI8A 2A98A 4C0TA 5KMNA 4FOCA 2PMLX 3UIMA 3EQDA 4S34A 4FA2A 3CY2A 4L3PA 5TE0A 1HOWA 3FQHA 4Z9LA 2C5OA 2ITNA 5CVFA 2FSTX 4FTAA 5FRIA 4HVSA 5CSVA 3FKLA 5E90A 4EYMA 3DKGA 4G1WA 3H9RA 4AQCA 4CD0A 4CMOA 3ROCA 2PPQA 1XBAA 4O22A 3ID6C 4QMVA 1OL6A 4D0XA 1M52A 3M11A 5IQAA 1M2PA 3I0OA 2QOKA 5FBNC 3UP2A 5B2MA 5JQ8A 4ZMFA 5J9ZA 2Y4IC 4WG4A 2GDOA 3NVMB 2AQXA 2XS0A 4BWKA 5EFQA 3OW3A 2C6LA 4IVBA 3GP0A 3ZHPC 4AZWA 1O9UA 4HOKA 1ZRZA 2G2FA 4E8AA 4CYIA 4RZWA 4WO5A 2YISA 4A9SA 3DXQA 3PYYA 4MF1A 4XP2A 5CSXA 4EHEA 2HZ0A 3KMUA 5E9EA 4LGHA 1ZLTA 2W4JA 4IB1A 4IHPA 4XHKB 1X8BA 3ATSA 2YM3A 3HECA 3PE2A 3FXWA 2W1CA 2J9MA 4BGHA 4FZFB 4I6LA 2QD9A 4EUUA 4FF8A 4F9BA 3FXXA 5E8VA 4GT5A 3IECA 5CU3A 4YSMA 3C4WA 4AGCA 3ROYA 1LUFA 2UZDA 3LQ5A 4MBIA 4NIFB 3TEIA 2R9SA 3FI8A 4AE9A 3SVVA 5EDPA 2YIWA 5KBRA 2YDJA 5CZIA 3WF9A 4PNIA 3QC9A 2CDZA 2IZTA 5A4LA 5CTPA 3WZEA 3SKCA 5G6VA 4NYEA 5KMIA 3QLGA 2Z2WA 2ZJWA 4ZS4A 1URWA 3FLYA 3OMVA 4NTTA 3U8WA 4TZRA 2HYYA 4UV0A 2XEZA 3O7LB 4RJ6A 3KIOC 2ETKA 4O0RA 2HCKA 3SC1A 2XNGA 5KMJA 4DHIB 4J52A 5C03A 2JLDA 1O6LA 4EK3A 3FI3A 5HTIA 3Q6UA 3ZLWA 2C0TA 3A7GA 4TN6A 2BKKA 5CLPA 1FMKA 4ZSJA 2HAKA 2YLEA 3TJCA 5KHXA 2OZAB 4FV6A 1VYWA 2BZIB 3DS6A 4YZBA 4G6LA 3RMFA 4D2RA 4CKJA 3KRWA 5EM5A 1KE6A 3I5NA 3JUHA 2I1MA 5AJQA 3U51A 1B39A 4RVMA 5L8LA 4FEWA 4XOYA 3ZZEA 1Q8UA 1W2CA 4L6QA 4PTEA 4QMXA 3VRZA 4NJ3A 3PRIA 4XG2A 4O2PA 5DOSA 4UN0C 3C4XA 4RJ4A 2PVLA 5LARA 3LFDA 4QMSA 3R8VA 1K9AA 5M4FA 3DGKA 3MH1A 3MTFA 4TYIA 1AGWA 3ZBXA 4ZTLA 3REPA 3NDMA 3G0FA 3QXPA 3BYMA 5IA2A 4ZXTA 4AQKA 2C3JA 2QLUA 3G9LX 4MXOA 4PPCA 2XK4A 3COIA 3LW0A 4X2GA 4AN9A 5DT3A 2YJSA 4O1OA 4E5BA 5BUIA 2UZOA 4I6QA 3TN8A 3E7OA 5TKDA 4EONA 2R3FA 2O65A 4ENYA 3ACKA 3UJGA 1VEBA 5J1VA 4KUJA 4A4XA 5H2UA 3IQ7A 2HWOA 2R4BA 3PFQA 3UDZA 4OTDA 4R5YA 1KWPA 5HIEA 3LMGA 4EHVA 2JITA 1GZNA 2QURA 3IG7A 3OXTA 2W1DA 3Q2JA 3C5UA 3KGAA 1P4FA 2J2IB 3QQHA 3AGMA 3FMNA 5IA1A 1YWRA 4GH2A 3G15A 5IQFA 3O51A 4G16A 5FEDA 3EYHA 3R8UA 4WHZA 3PJCA 4BCFA 1H26A 2ONLA 4YURA 4CTBA 1XQZA 3O50A 1GIJA 4N70A 4IWOA 2VX1A 5BQ0A 3OW4A 2IVTA 5IA3A 4ASXA 4O1PA 4NZWB 3VS1A 1JAMA 5AR7A 3QWJA 2JIVA 2AYPA 2WTJA 5IQDA 4O7TA 5EH0A 4AFJA 2O2UA 3OXZA 3SG9A 4I3ZA 3LZBA 4P2KA 3QKKA 3CGOA 4EOLA 1H24A 1JOWB 3H3CA 3NW6A 4BDFA 3AT2A 3MVJA 3R22A 2FSLX 1UVRA 5HG5A 4DEEA 3NNUA 1OBGA 4H3PA 3UZTA 3W2PA 4FT9A 4J53A 3F6XA 4F7SA 4LMUA 1PRYA 2VTJA 4DFZE 2F7ZE 3OCGA 3Q60A 4L3JA 4OTIA 4YSJA 5DFPA 5FWKK 4EHGA 3QD0A 2XNOA 4DH7A 2PVRA 4CKRA 2YZLA 1WBVA 3HMNA 4DEIA 4C02A 5CF5A 3MY1A 1L8TA 4FNZA 4W4XA 3E87A 3BU5A 4KKEA 3QKLA 5K9IA 2A27A 5KMLA 4K18A 3R7VA 2UZTA 3D83A 3EQBA 3DFAA 5JFXA 3VAPA 2G01A 2Q0NA 3P79A 5CVHA 4AXAA 5TR6A 3RKBA 3NSZA 1Y6AA 4HJOA 3VUGA 4XYFA 3L8SA 1IA8A 3TG1A 3UO5A 3E8NA 4J99A 4ZOGA 2OJJA 4BCJA 4EOMA 2VTAA 4UALA 1PY5A 3FLWA 4EORA 1JVPP 4O0UA 3CTHA 5T6KA 4GU9A 4DHJA 2E9OA 4IX6A 1Y57A 1Y8GA 3HV4A 1YWNA 4I94A 4GJ3A 4J95A 4JQ8A 4QP8A 4YZCA 5IEYA 5BV3A 4MTAA 5KCVA 1TVOA 2FO0A 4BKZA 3LJ0A 4CV8A 5B2KA 2WB8A 4PUZA 2H96A 3W8QA 4BYJA 3FC1X 3U6HA 4CFNA 2ZVAA 3MW1A 2XYNA 2Z7SA 5LWMA 3BE9A 2ZV9A 2VNYA 2IZRA 1OKZA 2JC6A 2OZOA 1XH8A 3Q2MA 1MRYA 3HP5A 3KY2A 1FQ1B 1UU8A 3D5UA 4BDDA 4RPVA 3Q9YA 1YRPA 4DFXE 3A62A 4NCTA 3G6GA 4D2TA 3L9PA 2WQEA 2BKZA 3BEGA 4KB8A 1TQMA 2X2KA 4LI5A 4RIWB 3A8XA 5ETIA 2VRXA 3S3IA 4Q9SA 5M57A 4NEUA 3V5TA 1H1RA 3UZPA 1OGYA 4AE6A 1J3HA 2XYUA 2H9VA 2YCRA 4IB5A 5HX8A 1G5SA 3GXLA 4M66A 4G6OA 2FGIA 3MFTA 3GB2A 1G8AA 2ITWA 3TACA 4N6ZA 5J7BA 1WBSA 4JX7A 1JKKA 4CRLA 2PULA 3N4UA 4FOBA 3FMJA 5E8TA 2XAOA 2OK1A 3RK9A 2UW5A 5AMNA 5GJDA 2UW3A 4C59A 5EQYA 3QQGA 4ASZA 4A9YA 2X7OA 5EW3A 3I79A 3O17A 3OTUA 3AMBA 3DBEA 5BMMA 1SNUA 3AG9A 3EMGA 3JR1A 4GT4A 4G3GA 2CPKE 2E2BA 4YJUA 1WBNA 4U6RA 3U4UA 4ZLYA 1Y8YA 3R1SA 2CKEA 4M69A 4K77A 5IDPA 2GNHA 2XKCA 5EG3A 2GFSA 5EQEA 3I4BA 4FTMA 4IAZA 2RFEA 3P5KA 4YLJA 3VS0A 4Y8DA 3DPKA 1JSVA 5J1WA 3BYUA 4F99A 5ANOA 1WAKA 3EFWA 2XNBA 3A60A 3KN6A 4FKGA 4MNEB 2QHMA 4IZYA 4LGGA 3SLSA 3VBWA 3DBFA 2OXYA 5C8NA 4O4FA 2QODA 3QKMA 4FZ6A 2C3LA 5AAEA 3QAME 4M7IA 3H0ZA 1F5QA 4E4XA 3E3PA 1H1WA 3DCVA 3MWUA 3FWQA 3FZ1A 4FR4A 4BC6A 4J97A 3FMMA 3OOGA 4JBOA 3MDYA 3D5XA 4D2SA 4PMMA 3OUKA 4YO4A 4CEGA 4C2VA 4C61A 2KULA 2XKFA 3F7ZA 1Y6BA 1LP4A 4LDTA 3ZO1A 5A4EA 1DAYA 4Y95A 3DT1A 3SW4A 4C4EA 3QRJA 3DXNA 3GFEA 3KRRA 4D28A 5LMKA 3OTVA 3R30A 4ITIA 3QQLA 4ALWA 4MWHA 2JFLA 5HBEA 3PSBA 4WRSA 2BZHB 5DN3A 3COHA 1Q99A 4UWCA 1I44A 3DAEA 3G51A 3W8LA 4EC8A 2YWPA 4ALVA 2W4KA 2BROA 5CU2A 2X4FA 3OCBA 4XBUA 4IANA 3UGCA 4FGRA 4LM5A 3HP2A 4JDKA 4EH6A 4C37A 3IW8A 3QX2A 4IZAA 2XRUA 4UMTA 1WBPA 4K33A 1H08A 3FY0A 3OEFX 4RA4A 4TW9A 5HCZA 3SX9A 3SXFA 4F0GA 5A9UA 1ZZLA 3KN5A 2Z7QA 4XG3A 4E3CA 2WO6A 3FI4A 4JG7A 1YDTE 2I40A 3MFRA 2PMIA 4IB0A 2PHKA 3A4PA 1WZYA 2VX0A 3HMMA 3VS3A 3W2OA 4I24A 3WZUA 2VWXA 3EFJA 2B9JA 2CKQA 2PZPA 4HYSA 2BAKA 3TUCA 4BJJA 4GUBA 2XK9A 4BIDA 5K4IA 4FKIA 5K5XA 3OT8A 3PJ3A 4IZ5A 3F2RA 4JDIA 3AD5A 1YI6A 2XKDA 3DZOA 3LFFA 2HZ4A 1M7QA 4IAYA 5D11A 3U4WA 3ZM9A 4QP3A 4R78A 4ZTSA 4AGDA 1OUYA 4ZZOA 4RMZA 2NYAA 1CSNA 4QDVA 3AKKA 2OJIA 4HNIA 5E7RA 5D10A 2X2MA 4CFMA 2W5BA 3C0HA 2C1AA 5IISA 1PYEA 4BIEA 5HU3A 3ZDUA 2ZV2A 1RW8A 3OHTA 3UC4A 2VGPA 4KIOA 2I6LA 4I22A 5D7AA 3F3WA 5CAUA 2PZ5A 4D5HA 2PUIA 4Y5QA 2B9IA 4D58A 2GNFA 5EI6A 4DGGA 4GG7A 3MJ1A 4WRGA 2WXVA 3RZBA 3LXKA 1QPCA 3EWHA 4IWPA 4ZS0A 1PXNA 4I23A 5AUVA 2XIKA 3V5PA 4D4RA 4GK3A 3HGKA 2PZRA 2BRNA 4QP7A 4ZLZA 3ANRA 3TI1A 2JKQA 4G34A 3RM7A 3HLLA 4CLJA 5L2SA 3ALOA 1OGUA 2PZYA 3PA4A 2YERA 2HY0A 3F2NA 5DEYA 4FUYA 4WNPA 2RIOA 4IAFA 1Q41A 2QO2A 4QMMA 1T45A 4C2WA 5DH3A 3W2CA 3E8DA 3RCJA 3LQ3A 3QCSA 3V6SA 1GZOA 1W84A 3NLBA 3UYSA 4O86A 4FKWA 4H1JA 4JBPA 3FE3A 1PW2A 1YVJA 2WMUA 5CZHA 3LCDA 4D1SA 5J9LA 5HLWA 2NRYA 2W05A 2RFDA 5IA0A 1XH7A 3MS9A 4UB7A 2WQMA 5IA5A 2BALA 3ZZWA 5FXQA 4H3QA 4AACA 4I4FA 4FKTA 3DXPA 4EUTA 4FSUA 1JBPE 1FVVA 3WIGA 2Z7LA 3D94A 4O27B 4MXXA 4BDJA 1NT2A 1A9UA 4PV0A 2BVAA 4QTEA 3HUBA 1BL6A 3HVCA 4AW0A 3QRIA 4H39A 2O8YA 1OECA 3VNTA 4RFMA 4MX9A 4C7TA 4W4YA 4ZY4A 2IG7A 3NCGA 5IA4A 4O0SA 2P0CA 3FZPA 3KULA 4AFEA 3H0YA 2XALA 2VAGA 3NMUF 3C4FA 2VWWA 3R1YA 3WYYA 5L3AA 5LQFA 4O2ZA 4FV7A 3V51A 4G5PA 1B6CB 1URCA 1H0VA 1PF8A 3CJGA 4PF4A 4EJNA 3PXYA 3HUCA 4EZ7A 3NUXA 2P2IA 3MPTA 3TDWA 4BDEA 1H25A 4B6LA 2JKOA 4CFWA 1WVWA 3Q04A 2UVZA 5FLFA 1NVQA 4OW8A 3L1SA 4FZ7A 4GFOA 2CGUA 4U81A 4WNKA 5AIKA 3QRTA 1YXVA 2BTRA 5IH4A 3QA0A 1WBWA 3R2BA 5JFWA 4HVGA 3LLAA 5A46A 3I6UA 2QVSE 3NCZA 4N6YA 4GT3A 4YBJA 3KC3A 5KHWA 4ERKA 5B7VA 5JRQA 3U6IA 2OLCA 1WVXA 3TT0A 5AV4A 4E7WA 3SOCA 3WZDA 4CZYB 2QO7A 3RPYA 2I0HA 3MA3A 3KXZA 3R2YA 3O8UA 2OICA 4J8MA 3PUFC 3W16A 2JKMA 3QZHA 4AZVA 4BRXA 3MBLA 4NFMA 4FMQA 2GHMA 2XMYA 4U79A 3C51A 4ZTQA 4DA5A 5A54A 3EYGA 4NL0A 4AXFA 3ZLYA 1NA7A 4BKJA 5ACKA 3UC3A 5GZ8A 4UXLA 2YIQA 4IVAA 4O21A 3ZXZA 5C1QB 3F88A 3FMDA 4FT0A 4F70A 3IW4A 5ETAA 3EN7A 4S33A 2GMXA 4A9RA 2WQBA 3PG3A 4YZMA 5C8KA 3W0RA 2H8HA 2HXQA 4FBXA 4KSPA 3R9DA 1DI8A 3QTQA 4JAJA 4X0MA 3ZONA 4ARKA 4WBOA 3MH0A 2ZM1A 4FKPA 3E92A 2ETRA 3GNIB 4YC6A 4UMUA 5BVFA 3QZFA 2R0IA 4FT3A 4H05A 1OL7A 3M1SA 1H1PA 3D5VA 4UWYA 3NS9A 3UMXA 3V5QA 2WHBA 4RX5A 4DTBA 4EJ7A 1KOAA 3CC6A 3F5PA 5L6WL 4HGLA 2CN5A 3JYAA 4B9DA 4TWOA 3AMYA 4NM3A 4TYHA 5LVLA 2VTTA 3I60A 3VBQA 4F6SA 2G2IA 3KKVA 3NUPA 2XH5A 4DG2E 4WD5A 2WTCA 3IGOA 3VHKA 3WYXA 4BBFA 2VWUA 3E5AA 4R1VA 1QPDA 5GHVA 3TDVA 2QQ7A 1GY3A 4DHZA 5EM8A 4DH1A 4F6WA 3H9OA 5BYYA 2PWLA 4BCPA 2ZV8A 1DM2A 3OCSA 4ZSAA 2CNQA 2ZOQA 3PLAE 5AIRA 1S9JA 2RL5A 3ZEWA 5F20A 5JSMA 4RGJA 2ERKA 5I5ZA 5TT7A 1MRUA 4RIXB 1FVTA 3QRKA 4AGUA 4XRLA 2QOIA 5ANDA 4AN3A 3NW7A 3CS9A 1A48A 4MAOA 5HE1A 3OZ6A 3U9NA 3OBGA 4R3RA 1UV5A 2WEIA 4IIRA 1Q61A 2GS7A 2IW8A 2IW9A 4BTFA 4EH8A 4ZZNA 3IW5A 1VYZA 3D5WA 2YCQA 4BI0A 4YJOA 2RG6A 3VUIA 4DGMA 5ETFA 3RPVA 3FMEA 4IADA 3FZTA 3W2SA 4C34A 4FNXA 4PX6A 5HO8A 2EUFB 1FOTA 5ANEA 4BBEA 4RT7A 2W1EA 4K6ZA 4GU6A 3NWWA 4MWIA 5CSPA 2QU5A 3OD6X 3KA0A 2QR7A 3EL7A 4FVRA 4U3ZA 2J0MB 3C4CA 2C1BA 2W7XA 3G2FA 3TNIA 4AGWA 4UEUA 3DQWA 4B8LA 4MBLA 4AP7A 3A7IA 2OF4A 1PKGA 2UW4A 4G6NA 5K0KA 3MB7A 4NKSA 2JDSA 2J51A 3O8TA 4B0GA 3QTIA 2O0UA 4LUDA 4G5JA 1OL1A 1UU7A 4QMQA 4MXCA 2GHLA 4E5WA 3UODA 1R0EA 4I6FA 2WTDA 3QQFA 4O83A 3TKHA 4DBXA 3BKBA 1ZYLA 1XMMA 1Q97A 4DH5A 1EH4A 3NNXA 4P5ZA 2IVUA 4GV1A 3VQHA 4DDGA 3GCSA 1Q3DA 4FSTA 3ZFMA 4ZTMA 3HYHA 1MQ4A 4F9CA 3EZRA 4IBMA 4CSVA 4QQ5A 1AD5A 2XB7A 2XRWA 3N9XA 4P5QA 2QR8A 3BRBA 2GU8A 1H07A 2PMNX 3SAYA 2HWPA 3UVPA 1RDQE 3VUTA 5JKGA 3KQ7A 4M14A 3COMA 2ITTA 4TWPA 4CFXA 1IASA 2EB2A 1J7UA 5GJGA 1W98A 5C8MA 4BCMA 3NRMA 4FT5A 3PIZA 4RX8A 2QCSA 4X21A 5J5SA 1GZKA 2WNTA 4DHFA 4RFYA 3CIKA 3NVKI 4JR3A 4OT5A 4E6QA 4NTSA 3R7YA 1OIYA 1ZY4A 2PE2A 4PTCA 3DTCA 2BDWA 4TWCA 5FDXA 4O38A 4BTMA 1V0PA 2EVAA 5E8YA 2WMWA 4JX3A 3R00A 1REJA 2A1AB 1R39A 2YM6A 4QMLA 5E92A 4DH8A 2X81A 5LVPA 3DBQA 5E8UA 3DKFA 3EJ1A 5GZAA 4GCJA 5CXHA 4CNHA 3C4EA 3ORZA 4HNFA 2OIDA 3HL7A 3KXXA 4WUAA 2CNUA 2BZKB 4GFGA 4EBWA 1YXUA 4I6BA 2C69A 2P3GX 3TV4A 3AGLA 2NNWB 1E1XA 4U44A 4BDCA 4F9YA 5CALA 5ETCA 4XJ0A 3S4QA 3PP0A 1ZOEA 3BZ3A 4RBLA 5IMEA 4X3FC 5AP6A 3HV6A 4L00A 3R1NA 4GSBA 4MYGA 4NK9A 3T8OA 4FK3A 3FLSA 4AZSA 4IC7A 3HMOA 2XANA 4BICA 3HAVA 1QL6A 3RWPA 3JXWA 3NYXA 1G8JA 4RIWA 2ITQA 3Q9ZA 1TQPA 4GG5A 4DYMA 4C3PA 3ACJA 1IG1A 3A99A 4IM3A 5L8KA 4XG7A 3TMOA 5DRDA 3ERKA 1JKSA 2C68A 1FGIA 3LM0A 3MI9A 3OBJA 4FKSA 3MIAA 2CNVA 3Q4UA 3R7EA 4ZIMA 3DJ6A 3QALE 3CR0A 1OPKA 1TKIA 5A3XA 3QQKA 3MN3A 4HZSA 4BTKA 3DKCA 1IAHA 4AXDA 4HPTE 5G1XA 4M15A 2QOLA 5K5NA 4P4CA 4RWIA 2BRGA 3FLNC 3ZMMA 5CU4A 2CHLA 4RIYB 5C01A 4J71A 1TFFA 2R7BA 3UDTA 4ZJVA 3R9NA 4FG9A 4YO6A 3CD8A 2WIHA 4YJSA 3U6JA 3IPHA 5FGKA 2R7IA 4ZJJA 2Z60A 4CMUA 5CEIA 2OBJA 3VUMA 2J0KA 3GGFA 2OZAA 4BHNA 3ZXTA 4I6HA 4GFMA 4DGLC 3NIEA 4CCUA 1YHVA 3FQSA 4JDHA 3EQPA 3AOXA 3VUDA 4EZ5A 3BCEA 2YABA 4ASEA 3ZBFA 4YNOA 4AOTA 1XWSA 3R1QA 5HKMA 4IM2A 4K8AA 2VNWA 5IMXA 3LKMA 4LYNA 3TJDA 4MNEA 4IVCA 3KXGA 3V5LA 5HIDA 2IN6A 2VTIA 3CGFA 3H9FA 5AP5A 3SGCA 5JK3A 4IQ6A 3H4JA 4FX3A 3VHEA 3F5XA 3ZS5A 1W7HA 4APPA 2C6TA 4HGSA 3FPMA 4FNWA 3TZMA 3PXFA 4JT3A 4O0TA 4Y46A 2PE1A 2YHVA 3O23A 4OR5A 4QMOA 4CKIA 4O7ZA 4ZK5A 5HE2A 2XNEA 2R3IA 4RQVA 4Y85A 4JBQA 4QOXA 3EZVA 4D55A 3DB6A 2Y4IB 2HOGA 3GUBA 4XV2A 3K3JA 3BYOA 4FKJA 5CU6A 5CENA 4KIQA 3MA6A 4PDPA 2X7GA 2XNMA 3RCDA 5BMSA 2HZIA 3LFQA 2WMSA 4QMZA 3U9CA 2Y6MA 4FKOA 4QEBA 2YEXA 3E63A 4Z55A 3RBWA 3UO6A 5AEPA 4LV8A 1XH4A 5E8XA 4QTBA 3ORIA 4MXAA 3DBCA 4IFCA 4C3FA 3BX5A 4FODA 3E8EA 3SHEA 2ITUA 4DFBA 2X2LA 2ITPA 3VUHA 3OY1A 1XO2B 2F2CB 3EB0A 3EFLA 3HRFA 4L8MA 4R7HA 1UKHA 2OJFE 2UV2A 3Q32A 3WE8A 4F6UA 3PY3A 4Y5HA 4Q2AA 2CJMA 2XUUA 3DNEA 3I1AA 4NW6A 5HE3A 2NPQA 2WMQA 3QLFA 5EW8A 4UX9A 2I0EA 5LCKA 2WIPA 3PZEA 4TKSA 4O7LA 4OLIA 5EM6A 4FI1A 1YOLA 4G2FA 4FSZA 3W33A 4FTUA 3EFKA 1XBCA 4U3YA 5M56A 4F7LA 4QP2A 4F1OA 4O6EA 4WA9A 2JEDA 3RI1A 3ZRMA 1W8CA 5IQGA 3UIBA 3E93A 2E9PA 4FV0A 3RAWA 3UOKA 4BJJB 4BBMA 1LEWA 2UW7A 4W4VA 2WEVA 3LCSA 4W4WA 4HGEA 3DAJA 4DTAA 5HHWA 2JAVA 3MY5A 5L2TA 4C38A 1ZXEA 4R3PA 2WGJA 4ZJIA 3LAUA 3G9NA 4Z16A 3KK8A 3GC7A 4XP3A 3BBWA 1OZ1A 2WTVA 5JT2A 5M08A 1U54B 3ORTA 4AXCA 3VC4A 4FRFA 2C5XA 1UU3A 1WBOA 2IVSA 4CGAA 5EI8A 3ENMA 3I6WA 4BWPA 1KOBA 4D9UA 2VTNA 2X6EA 3KRXA 3R0TA 3R28A 4RZVA 1YKRA 4FV8A 4KBAA 3WE4A 4EQUA 3GEQA 2ZDUA 3QHWA