2VO3A

Structure of pka-pkb chimera complexed with c-(4-(4-chlorophenyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-yl)methylamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 105
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo3A02
3CBLA 1TQMA 3IW6A 1V1KA 5H8EA 4HYIA 5B2KA 5FQDC 3ROCA 4KWPA 4MD7E 5ETCA 2AYPA 3I7CA 2YWPA 5M4CA 1CSNA 4EUTA 2C3JA 4FKWA 3R9HA 4BCFA 2PUNA 4JX7A 5M09A 2QKWB 4UWYA 3BHUA 2YEXA 3RCJA 3NUNA 3UZPA 5DYJA 3CTJA 4MWIA 4XV2A 4RWKA 3ANRA 3V3VA 2JITA 2JDVA 3FWQA 3FQSA 3DBEA 5CSHA 1Y91A 1W84A 2BRMA 1NY3A 5J7HA 5CZIA 4USFA 4YSMA 2I0VA 5CTPA 3RVGA 5H8BA 5CF8A 2XYNA 4IAIA 2VO7A 4QP9A 1YWVA 2IVUA 2YIWA 3P86A 4XS2A 2NPQA 2Y6OA 1H01A 3FLSA 3P7AA 3FXXA 4GL9A 4JIKA 3RPYA 4LOOA 4A9YA 1OL7A 3S0OA 5IUIA 4BZNA 3K54A 2CNQA 2ERZE 3CQEA 2W4KA 4RGJA 3MFUA 5EDRA 3LE6A 4U80A 3SW4A 4DT8A 1O9UA 3PUPA 2R3HA 2VTHA 3S00A 1KOAA 5HG8A 2B9FA 3OT3A 2GNHA 4FK3A 3QC4A 4MQ2A 4RX9A 5HBEA 3PPJA 5TOZA 2XH5A 2C0OA 1OBDA 4C4GA 3S95A 4MF0A 3FKOA 4RFMA 1G3NA 5AP0A 4BDKA 4HVIA 3V01A 2ITWA 1KWPA 2WQMA 2EXMA 1YXXA 2CSNA 3R21A 1GNGA 4RIYA 4WNMA 5BYYA 2RSVA 1Q8YA 1VYWA 3VS4A 4PTGA 4O7TA 3ATSA 4FKOA 3Q6WA 5HLPA 2F57A 2CKOA 3CEKA 4L3LA 5AP3A 2XNMA 4YHTA 4D4RA 3R00A 3LOKA 2C1AA 3ZO4A 4U7ZA 3EJ1A 5J1VA 2YA9A 1NVQA 2C3KA 3P1AA 2C6IA 2WTDA 3OWPA 4O7NA 3PSBA 4FT7A 5CAOA 3PPZA 3WZEA 1UU9A 3AGLA 4FG9A 4YJSA 2WKMA 3BHHA 2OU7A 5I0BA 3L8PA 5EM8A 2XK6A 3LAUA 3VQUA 4I6BA 2WZJA 4GG5A 2VTIA 1BI8A 5L6WL 5FXRA 2HYYA 2P2IA 3QCSA 4BDCA 5JT2A 4A4XA 4YTFA 2CPKE 1I09A 4R3CA 3FL5A 4L7FA 1ZMVA 3P0MA 4TWNA 3CQWA 3UPXA 2W9ZB 2IW9A 3V5TA 4OAUC 1Q5KA 1XO2B 2B55A 4XOYA 5EYCA 5LCKA 4CGAA 4XOZA 2JIVA 3V8SA 4R77A 5I9XA 1H24A 1YVJA 2Z8CA 3FI4A 1OB3A 4M8TA 5J9ZA 2UZNA 4N70A 5AUXA 5CU2A 3TT0A 4QD6A 3F5XA 1MUOA 4OTIA 5LJJA 3TCPA 4XV3A 4ZJIA 4ALUA 1GAGA 4BL1A 1YDRE 5JRQA 3ITZA 3VIDA 4D1SA 4BKYA 4D2SA 4EUUA 2RIOA 3G6GA 2VTTA 5A4EA 2WOTA 4KIPA 1YXSA 3MH3A 1M17A 4FV4A 2WNTA 3GENA 4EH8A 4WRGA 5DPVA 3P9JA 3DXPA 4QPAA 4FSUA 1ND4A 4IB1A 1Q3WA 3WIKA 5JSMA 3VHKA 3MV5A 2CDZA 5M57A 1GOLA 4CYIA 1JAMA 4TYHA 3N9XA 3PE2A 2X81A 4M0YA 3ZONA 3H0YA 1Y8GA 4FUXA 3NIEA 4E5WA 3F9NA 3W55A 1XH7A 3C4FA 3JUHA 4OGRA 3IONA 3UODA 3Q9YA 1ZZ2A 4QMTA 5AUYA 3ERKA 4L8MA 5ANGA 4ANBA 3P4KA 3T3VA 3VBWA 4CG9A 3C5UA 4J71A 4FV9A 3NVMB 3VBXA 3QHRA 2VNYA 2KTYA 3M1SA 1PMVA 4QOXA 1P4OA 3PXQA 4DEIA 5ETAA 1ZRZA 4NM3A 3E7VA 1XH9A 2A2AA 5E91A 4B8LA 5ACKA 4BDJA 2GHGA 2P4IA 2PVYA 3QALE 4LL0A 4TWPA 4W8EA 4CFNA 2RG6A 3A61A 3BHTA 3OCTA 5F9EA 1FGKA 3PJ8A 3VWAA 2OJ9A 4IB5A 3I5NA 3NNXA 4FI1A 1O6KA 2R64A 2RFSA 3TACA 4AGUA 4C33A 4CZTA 4BR3A 3ZRMA 3CSVA 3OG7A 5BVKA 4I24A 2X0GA 2OF2A 4D2TA 2BFXA 4CMOA 3RJCA 4ENXA 3GQLA 3KULB 3GNIB 5I3OA 4EQUA 4AW0A 3FKLA 5IA0A 3KVXA 4YHFA 4YO4A 5KMKA 1LPUA 4O38A 2O65A 2P55A 3ZLXA 3PDTA 5CF5A 1OM1A 4M66A 3BGPA 4Z55A 2C5XA 4IH8A 1R39A 3MFRA 2G2IA 2VN9A 3FC2A 4FV1A 4P90A 1R78A 5JGBA 4FKTA 3ZO2A 4EOQA 3KL8A 4FV6A 2W1ZA 4F9YA 2JFMA 4P7EA 4D4VA 2YACA 3CCNA 3GC7A 2BKZA 3DDPA 4IADA 2C6LA 2VX0A 1YHSA 2GS7A 2R5TA 4HPUE 4MHAA 1FOTA 5E8XA 1UV5A 4YC3A 2UW4A 4FL2A 4DEHA 4DBXA 2BTSA 2NRUA 2YM6A 4RIXA 4MQ1A 3S4QA 4XMOA 1JKSA 1FMKA 5BUIA 4BIDA 5EQPA 5EYKA 4OBPA 5DEYA 1S9JA 4JR7A 4PRJA 4L53A 5J5TA 3EQCA 4AA0A 1R0PA 4IANA 3GCUA 3TDVA 3BYMA 4BDIA 3UO6A 5IEXA 4B99A 5AP6A 4BHZA 1OIUA 3BLHA 5AEPA 4GIHA 4O1PA 3V5LA 4GG7A 2BHEA 2PHKA 3R0TA 3NZ0A 3ALOA 1MRVA 4FT3A 4PMTA 3R8UA 2E9PA 5HE1A 4M7IA 2W05A 4F6SA 4EHGA 5LMKA 5M4UA 2WU6A 5LXMA 4UV0A 4ACDA 4G3GA 4H3QA 2LGCA 3GT8A 3TUBA 3RP9A 4N0SA 3IG7A 2UW8A 3MB7A 4HVHA 1H1WA 4YC8A 2CGVA 1XWSA 4HZSA 2E9VA 4ZZOA 3Q60A 5KMNA 4W4XA 3QA8A 4FTOA 4FTMA 5CVFA 2HY0A 5BUEA 3OXIA 3M11A 5IZFA 1E1XA 3IW4A 4F1TA 3LCSA 3KVWA 3ULIA 5KUPA 2IO6A 2UZOA 5FEQA 3QKMA 2J0LA 5AUZA 4DEGA 4TYJA 3QL8A 3UIUA 3Q96A 3R71A 4HNFA 4O0YA 5DWRA 4E6QA 5LOHA 4DEDA 1CKJA 2XBJA 4LL5A 1ZAOA 5BVEA 1TQIA 2WQBA 1PXOA 2OH4A 3ZO1A 4IB3A 5IMXA 3GU5A 3WZUA 3P08A 4JLCA 5HE0A 2QHMA 2PVRA 4FKRA 4AGWA 1DM2A 3Q4UA 4IM0A 4E7WA 3F2RA 3G9NA 2IZRA 2OJGA 2Z02A 3IQ7A 4L42A 4G3CA 5CU0A 3PXFA 4F4PA 4PMMA 2PE1A 3Q32A 4WD5A 2EB3A 2W0JA 5HEZA 4KKHA 5L2IA 3MIAA 4HCVA 1CMKE 4YBKA 1YOMA 3RHXA 1U5RA 4OTQA 4EH6A 4HYSA 5DT0A 1OPJA 2BR1A 2JDRA 2XRUA 4CTBA 3QQJA 2X4ZA 4QMPA 1YHWA 4GH2A 1WBWA 3F3VA 4LQMA 4ANSA 3LZBA 3QBNA 5BVDA 3VS6A 4FKJA 4ONAA 2OXYA 1ZYDA 3HMPA 4J53A 3E3BX 3UYSA 4U9AA 4HW7A 2UW0A 5HX8A 4MYGA 1WZYA 1GJOA 4IAZA 4L6QA 4QNAA 4AA4A 1YQJA 2QOHA 3P7CA 4NM0A 5FXQA 2V55A 4FKLA 4QPMA 2R0IA 3TEIA 4DHFA 3QC9A 2QNJA 4IFGA 1H0VA 3HKOA 4OAVB 3C1XA 2YHVA 3PIXA 1H1PA 5FBNC 2YM8A 4GT3A 4A4OA 1BYGA 2F7XE 3HLLA 3LQ5A 4FV2A 4L3PA 3QAME 3TNHA 3OOGA 3KF7A 3ATTA 4FZ7A 2BDFA 4EJNA 3UZTA 3Q5IA 5M4FA 4IJPA 3EFJA 5CVHA 4S32A 3ZFXA 4QQTA 2OIBA 4ASZA 3LFBA 4K8AA 2REIA 5GZ8A 2GNLA 4LGHA 5A4LA 5I9YA 2WGJA 4LFIA 2GHMA 5EH0A 2VTRA 4C35A 5HGIA 3NW5A 5ANJA 2RG5A 3W8QA 5JFVA 2QOBA 1QPCA 4YZBA 3ELJA 4JXFA 4J8MA 4EWQA 2F4JA 3BEAA 3RPRA 2IZSA 2XRWA 3E8NA 4IMYA 4IAFA 4UXLA 1H1RA 4FV5A 4MNFA 4FTIA 4WBOA 1Q4LA 5EM5A 4FNXA 4TRLA 3Q4ZA 3ZHPC 5HD4A 2JBPA 3R9DA 5J9LA 5AIRA 3SW7A 2VO3A 2PU8A 4Q9SA 5CI7A 2C68A 3LJ2A 5EW8A 3R7UA 2KULA 4X2NA 3ZZEA 3R9RA 5KMOA 4GU6A 3QTZA 2VZ6A 4JDHA 2YFXA 4OTWA 3QTWA 4RPVA 5AV2A 5LMAA 3MY5A 3VUHA 4D2VA 2WELA 2ZDUA 4WNPA 1BMKA 5DRDA 2PVHA 4PV0A 3NRMA 4ZTQA 3F3TA 2UW7A 2OKRA 5HIEA 3MTFA 4NTSA 3L1SA 5IDNA 4G1WA 4HVDA 5KMJA 3UOJA 3AC8A 5LVMA 3HP5A 3TV6A 4YR8A 3UC4A 3FLQA 4I22A 3QKLA 3C13A 2EB2A 4DH5A 3ORXA 4ENYA 2PULA 4U41A 4W4YA 4NW6A 4RJ3A 2QQ7A 1Y57A 2C30A 2GS2A 3AT3A 4FTRA 4LRKA 3HP2A 3HNGA 3BI6A 4OTHA 1YOLA 5EW3A 3RK5A 4CMTA 2Z2WA 3HEGA 4RC2A 4QTBA 2B7AA 1WCCA 4BVUA 2R3LA 4L43A 5GNKA 3R30A 2UZDA 5C03A 2YCRA 3QRKA 1UU7A 4FSRA 1SYKA 5C26A 2PVLA 4X2JA 2XBAA 3AMBA 2GS6A 5J79A 5FTGA 2VWBA 3CIKA 5FDXA 3R01A 3S3IA 2GTMA 4AF3A 2H8HA 4EH9A 5M51A 2J4ZA 4FZFB 5HVJA 3UIXA 2PUIA 5IQIA 3IKAA 4FEVA 1SNUA 4YZCA 4PMPA 2W17A 5AR8A 3H4JA 2DWBA 5JN2A 4AE6A 2J0IA 2GHLA 4XUFA 1YDSE 2OFVA 3FE3A 2C6KA 4F63A 4MCVA 4NYEA 2AUHA 4NT4A 4ERWA 4PX6A 4HPTE 4E73A 4O7LA 4I93A 1P5EA 3DU8A 2QO7A 3VBVA 3AC4A 3C4EA 3EYGA 4RIWA 5CAPA 3QGYA 4H39A 2PWLA 5HTIA 5EFQA 3QD4A 5H2UA 1P4FA 2UUEA 2VTQA 2XNEA 3LMHA 4MX9A 3G9LX 3PLSA 1AQ1A 2VTNA 4CSVA 2HZIA 4E4MA 3FKNA 3KXZA 5DH3A 3NS9A 3RI1A 4TYGA 5C1QB 2XNOA 3NNUA 1OKWA 1JOWB 3DPKA 4I5HA 5D41A 4LM5A 5EHYA 5AR4A 3V04A 3ID6C 4FEQA 4GV1A 4PL4A 4HVSA 3PY3A 4RVLA 5H3QA 4AP7A 5L8KA 5LCJA 4FIIA 3VUMA 4CQGA 3P23A 4M15A 4UZHA 4X21A 5CSXA 4GKIA 4TPTA 4GT4A 4DITA 2OIQA 2W5HA 3ZM4A 4C62A 3ZBFA 4F7SA 4QP8A 5DE2A 2OF4A 2OICA 1XBBA 2PZYA 3BU3A 3VUKA 4CNHA 4H1MA 1SMHA 3LXKA 3P5KA 3UBDA 4L7SA 3SOCA 4BI0A 2ITTA 5IA4A 3V5WA 4ZJJA 2GNJA 1PMNA 3QLFA 5DG5A 3QLGA 5AAGA 2B1PA 3G33A 2EXEA 4L67A 4NU1A 4C37A 5HOAA 3M42A 3C9WA 4PL3A 2R2PA 4RWIA 2C69A 4S34A 2XUUA 3HV5A 3UJGA 1J3HA 4AE9A 1OZ1A 1SVHA 2ITUA 2QR7A 4B8MA 4M67A 1H27A 5AP5A 4JQEA 4TNBA 4Y85A 3MPMA 5TE0A 2PPQA 1FBNA 3U4WA 3DNEA 3NIZA 2JDTA 2YCSA 5CQWA 5HNGA 5E1EA 4IWQA 3A60A 3OW3A 4O82A 5CASA 3BZ3A 3LMIA 3DJ7A 5BVOA 3JYAA 3QU0A 3WF7A 3WE4A 4BB4A 2ONLC 4FNWA 4O0SA 2UZWE 2QOKA 4V05A 4ZZMA 4AOJA 1TQPA 3PYYA 3PG1A 3HVCA 3ZU7A 4P5ZA 4C2VA 5M44A 4ALVA 2ZDTA 4PF4A 4GS6A 3DZQA 3WF8A 2VTLA 4C57A 2JKKA 2WD1A 1T45A 3RM7A 2UZTA 4AN9A 4WG3A 4B4LA 5IA1A 5L2QA 2UZLA 5AMNA 3NUSA 2IVTA 3VBYA 3V8WA 4A9SA 5JK3A 5J87A 3REPA 4C4FA 2ZMDA 4HZRA 2WO6A 3NNVA 1H1SA 3HA8A 4E26A 4U43A 2HIWA 3GCSA 2W4OA 1J7UA 3E62A 4QT1A 4DTAA 5IQFA 2I1MA 3LFSA 3OZ6A 4EH2A 2W1CA 5C27A 4TNDA 5BNJA 3WBLA 2W5AA 5GIOE 2Y8OA 4IZ7A 4FT0A 5EHOA 3S2PA 5JGDA 5HORA 2W06A 4CKIA 4MNEB 3ENHA 2O5KA 2C6DA 3MBLA 5LVOA 1UNLA 4KRCA 2I0YA 4X2KA 4C58A 4J52A 3SLSA 2CN8A 2W96B 4TYIA 4U97A 4X7QA 4JT3A 5FM2A 3F3UA 3R28A 2VGPA 5E8YA 2JD5A 3CTQA 3K3IA 3WZJA 4IVAA 5M06A 3JY9A 1LEZA 2CJMA 4YJQA 4G9CA 3COIA 4C61A 4KBKA 3MVJA 2AC3A 4NK9A 3D7TB 3EQDA 1XKKA 2W9FB 3DBFA 4YO6A 3VAPA 2BIKB 4X2FA 3H9FA 2PUUA 4QP2A 3FY2A 4NL0A 3GOPA 4I5PA 5GINE 4C34A 1JKLA 3H0ZA 3MY0A 4RSSA 5EI6A 4QNYA 1G5SA 4RX7A 3NYNA 3MJ2A 3RAWA 1W83A 2CGWA 2PZIA 3BLQA 4G17A 4M3QA 4DEAA 4U79A 3QQUA 3R7IA 4JDJA 3CXWA 5C01A 3FMHA 2YWVA 3O8UA 3QYZA 4X6QC 3JVSA 4RA5A 5EDQA 2XJ1A 4MD8E 5E92A 4C3FA 3GC0A 3QD3A 4Z3VA 2C47A 3HV3A 1R1WA 4KSPA 3TZ8A 5AV3A 2QHNA 3FSKA 5JGAA 4D9UA 3ORZA 1IA9A 1U54A 1JKTA 2QONA 3EFLA 3THBA 3HYHA 4Y95A 3QTQA 2ITZA 3QZIA 5LARA 3M2WA 2UZEA 4G2FA 4U81A 4CZUA 3ORPA 5E7RA 3SKCA 4ZS4A 2FSTX 2WMBA 3VUTA 4CXAA 4L01A 2ETKA 4F08A 3EH9A 3A7HA 3GFEA 3ZCLA 2YDIA 5A54A 5CSWA 3UP2A 4IDVA 1DAYA 2ERKA 3ZEWA 3I60A 4W9WA 2BPMA 4B9DA 4Z7HA 3BU6A 5HQ0A 4FT5A 2A1AB 3ZMMA 2VTOA 4UALA 2JKMA 2PZPA 4CCUA 4DGLC 3IDCA 5IH6A 3JS2A 2NNWB 4TWOA 2XKEA 2V22A 1REKA 3RAIA 4KRDA 5CEOA 2BFYA 5CS6A 2VWXA 2C4GA 1Q3DA 2YM3A 2WTVA 1UWHA 4YNEA 5HKMA 1JLUE 5E8ZA 4D2WA 3UE4A 2XEYA 2X39A 4AN3A 3EFWA 4AT5A 1PXNA 1MRYA 4DH8A 3NYXA 4CV9A 5JRSA 2IW8A 2R3PA 4Y83A 1KUTA 2ACXA 4H05A 2OFUA 4MF1A 4EOIA 2IG7A 4IZ5A 3EIDA 3KRRA 3W8LA 3TIYA 1F5QA 2OZOA 4YURA 3PJ2A 3PRIA 5JQ8A 4R3PA 3DLZA 2O0UA 4QMXA 4DTBA 1CKPA 4A4LA 1MP8A 4EKLA 4JQ8A 4XP2A 3VS5A 4D4YA 1IAJA 3DKFA 4ANOA 1H4LA 2XK7A 1HCLA 1ZARA 3JPVA 3KK9A 3KCFA 2X7FA 1NA7A 4MK0A 4BCJA 2PZRA 4F9BA 3FSFA 5LMBA 2BROA 2PVJA 3MJ1A 3P7BA 5CT0A 3KXNA 3SHEA 4K77A 5FRIA 3CKXA 4JBOA 1AD5A 1KSWA 3PZHA 4XJ0A 4AQCA 2P33A 4HOKA 3KN6A 4XV1A 2VX3A 4F1OA 3T9IA 2Y4IB 5IUHA 3MIYA 4F9CA 2OW3A 3QTXA 3CJFA 4IZAA 4WIHA 3FPQA 3HV7A 4FG8A 3PTGA 3CP9A 5IA2A 5HZNA 3OP5A 4G31A 5HU3A 5TKDA 3RZBA 3SA0A 4O96A 4EORA 5CEMA 3QQLA 3I6WA 1WAKA 4RIYB 4GK3A 4LOQA 3GU7A 1YDTE 3LXPA 3IPHA 3WZDA 4BZOA 5HBJA 5IPJA 2W1GA 2BTRA 2YIRA 5A9UA 3BYUA 5CALA 4AT4A 2OIDA 4E1ZA 4FVQA 4O7VA 1H28A 3DK3A 2VWWA 2ZYBA 4UX9A 5ITAA 3TV7A 5E90A 3VS3A 2WTWA 3W33A 3BGZA 3NAYA 2GTNA 3KREA 4YJNA 4BKZA 3E88A 5JH6A 2WPAA 2PSQA 3AG9A 3F3ZA 4C4EA 1H26A 4ZLZA 1U5QA 1VZOA 4FSYA 3FC1X 3NEWA 4GUBA 4DFUA 3KRWA 3DLSA 3TKIA 5BYZA 3MESA 4XNEA 2VTSA 3HV4A 2WMRA 2ITOA 3P79A 3G90X 5FEDA 1NW1A 2GNIA 2XK4A 4QYYA 4F9AA 4G9RA 3C51A 1KE5A 4F7JA 2G01A 5L6OA 2VNWA 4FMQA 4FKIA 4FTCA 4TXCA 2IJMA 3NR9A 4PY1A 5FP5A 4XP3A 2IVSA 2QOFA 2VUWA 3PZEA 4E4XA 5IUGA 2R3NA 4UWBA 3C4CA 3QYWA 4YBJA 2B0QA 4I0TA 1IR3A 4I3ZA 4YLJA 4WNOA 1PXKA 1ZZLA 3FV8A 3MW1A 3AMYA 4ZS0A 3PWYA 1QPDA 2OXDA 3EQIA 4BDGA 3NCGA 3QXOA 4GJ2A 3E8EA 2IZUA 4QQCA 4XG7A 4CCBA 3QCXA 4O91A 4EI4A 3UMXA 5IF1A 4FTKA 1W0XC 3W1FA 3QCQA 4NKAA 3OW4A 4K1BA 2O63A 4NSTA 4AN2A 4M14A 1PRYA 3ZDUA 4TL0A 1V0PA 5DLSA 3VRYA 3ZH8A 2XA4A 1RQQA 3H9OA 3MI9A 5CENA 5EQYA 3DNDA 2WHBA 2X2KA 2YJSA 3JVRA 4F6UA 4JDIA 1M7QA 3FMJA 3KXXA 4ARKA 3OWJA 4EK6A 5GJDA 3DB8A 3I0QA 3R2BA 4MH7A 4OBOA 4BYIA 4I23A 4DEEA 3RM6A 4IEBA 4ZLYA 3G0FA 3DT1A 4BTJA 3GC8A 3S1HA 4GJ3A 4U0IA 3UO5A 2BZKB 3E8DA 4TYHB 1H25A 2X2LA 3W32A 3QZGA 2Q0NA 3DTCA 1B6CB 5HG7A 1MQBA 1E1VA 4IHPA 4BRXA 3Q04A 2DQ7X 2I40A 3CTHA 2X4FA 3C4XA 3D9VA 4H3BA 3RINA 4YSJA 2F7EE 2V5QA 5AM7A 4QTDA 4AZWA 3KU2A 3QTIA 3C5IA 3EHAA 1YWNA 2G2FA 4IB0A 4F99A 2UV2A 4HCUA 2XNBA 4ZSEA 1ZOGA 1ZXEA 2XVDA 4FTQA 4LUEA 5JEBA 4FR4A 3CGFA 3F7WA 4DGGA 2F7ZE 3UGCA 3KRLA 2HOGA 3U54A 3TNQB 3UVQA 4IJ9A 3BCEA 1I44A 3OWLA 4I4FA 4HJOA 4C4JA 2XYUA 2RFDA 4I6FA 1XH4A 1GIIA 2WQNA 1YI4A 2Z7SA 3EN6A 4JBVA 2W1HA 5DBXA 4I5MA 4EQCA 4U6RA 3OF0A 2BHHA 4C3RA 5A4QA 3MPAA 5HNIX 3KCKA 3D83A 3OUNB 3OTUA 4QTAA 2BRNA 2BAJA 4UWCA 4YHJA 3EZVA 5AP2A 3VQHA 4BDHA 1XH5A 4P2KA 4QMLA 1PYXA 3AC2A 4DGOA 4EOMA 2VD5A 3ZSIA 3WIGA 5A4TA 4G3EA 5LVPA 4UMQA 3BKBA 1U46A 4S31A 3R7OA 4H1JA 4RVKA 5FBOA 3KB7A 2DS1A 5D7VA 4M69B 5F95A 3ULZA 3EQRA 4CFVA 5G1XA 2FA2A 3VJOA 4D1ZA 4QMQA 2R7BA 1PMUA 4FTAA 5IU2A 3A8WA 4GYGA 4K0YA 2PMLX 2QOLA 3PXYA 4EZ5A 3O50A 4BGHA 2Z7RA 3E3PA 5BQ0A 4RIXB 3TUCA 3TM0A 5KX8A 3WOWA 4OTGA 4RJ4A 3TUDA 3KEXA 4FV3A 4MXXA 2J5FA 4NJ3A 4A7CA 4R7IA 4FEUA 4IVCA 2PE0A 4RJ7A 4XG6A 3NAXA 2XCKA 2HZNA 2B52A 4LMUA 5C9CA 4JIAA 2YAKA 4QMWA 3FY0A 2C5VA 4FYNA 3WYXA 1Q62A 3D94A 5DIAA 1Q41A 1OPKA 5CEQA 2PK9A 3EKNA 5EKOA 4E5AX 4H3PA 1R0EA 4D2PA 3LQ8A 4O6EA 1YKRA 2VWIA 5FTQA 3R7YA 4PUZA 3SV0A 3I79A 4GFMA 4JX3A 4DH3A 5CANA 2X7OA 4BY9E 3D5WA 4CD0A 2FSLX 2W99B 4WBBB 1YI3A 4O0RA 3I5ZA 3ZLWA 3TL8A 4QYEA 4F0GA 2O8YA 4KNBA 2C3LA 5HCXA 5L2TA 3LJ0A 3Q53A 2VGOA 5EG3A 2I7QA 3GC9A 4FL1A 4FOCA 4EJ7A 5KNJA 3H30A 3NPCA 3SC1A 4F09A 5EM7A 1YXUA 4TN6A 4UMPA 4N6YA 3ZTXA 4BCNA 2PY3A 2BAQA 1W8CA 1ZYSA 2XZSA 3ZRLA 2GQGA 4KIOA 4X3FA 3W10A 3ZSHA 4LOPA 2OJJA 5LVLA 3QQKA 4GU9A 3W2OA 4KS8A 4MTAA 5CQUA 4HGEA 2XNGA 1JNKA 3EWHA 5IG1A 3BE2A 3OUKA 2QOOA 2QG7A 5IEYA 4UYNA 4DN5A 1K2PA 4L46A 2GNGA 4KB8A 4UYAA 2C5YA 2UVZA 3IOKA 3MVHA 3VS7A 4FSQA 1XHAA 3OBGA 3K5UA 4FODA 1DI8A 4KINA 4EOLA 4AFEA 4QP1A 1KE8A 3BV3A 4USDA 3DQXA 4MEDA 1J7LA 3GU6A 3CKWA 4UZDA 3VS2A 2CMWA 5H9BA 3VVHA 3NDMA 3W2CA 3OROA 4HVGA 5IMEA 4KABA 1PW2A 5J1WA 4NZWB 5A3XA 5JZNA 3DDQA 2PMIA 4HGTA 1H0WA 1PMEA 5M55A 2FVDA 5K4IA 5ICPA 4PPCA 3HGKA 3F6XA 4JG7A 1M52A 4MXAA 3G15A 2YIXA 1OL2A 4G6LA 3FMKA 1RDQE 2O3PA 1STCE 2I6LA 1BL7A 3Q4TA 5I9ZA 5AFVA 4DC2A 2J0KA 4FC0A 1OPLA 5B0XA 2GQSA 3FUPA 5AA8A 2XK8A 5CXHA 1KE7A 3SRVA 4RLLA 4NKSA 3ET7A 3FMMA 4WHZA 5HIDA 4U42A 4XX9A 3RK9A 5AADA 1Y6BA 4BCOA 3F82A 3KY2A 3QQFA 2XNPA 1NVRA 3NWWA 4FIFA 4ID7A 4IIRA 4RRVA 4BGQA 2UW5A 2R3IA 3R8MA 5DI1A 4ZXTA 4FX3A 4NCTC 5FXSA 5BX0A 4HGLA 5AV0A 3KN5A 1ZY4A 2VX1A 3U4UA 4GIIA 4AS0A 3EQFA 5AAEA 1IAHA 4M13A 4TKSA 4F6WA 1OIYA 3TZMA 1YOJA 3FLWA 2QCSA 1JKKA 4FV8A 3ACKA 1GZNA 1XBAA 2CLXA 2C0IA 3IW7A 5CAUA 3LFEA 2YCQA 3OXZA 3GB2A 4FGRA 2UW9A 4ZEGA 2EVAA 2OXXA 4DCAA 1WBNA 1YI6A 4K6ZA 3PP1A 3TI1A 4YLLA 4KBAA 3PSCA 5C4LA 3I81A 4FF8A 4IX5A 3FZSA 4BIBA 1JSUA 5BUJA 1Z5MA 2OG8A 4UMUA 4W4WA 2VTPA 5HO8A 4CRSA 4Y73A 1AGWA 1BLXA 5K5XA 4IFCA 1QMZA 5L3AA 4NWMA 4GEOA 4MXZA 2JDSA 3DZOA 3EQPA 5CY3A 2VWZA 2B4SB 4AUAA 3AXWA 4XP0A 5A6NA 4K9YA 4USEA 3GU8A 4U45A 5TR6A 4RQKA 5IA5A 2CCHA 2WMQA 3LPBA 3FJQE 4FBXA 4FIJA 5JKGA 4AXAA 2QU6A 2Y9QA 1WVXA 4UB7A 5FWKK 2OJFE 3KXMA 4WSQA 2HZ0A 4YTHA 2IPXA 4AFJA 3FDNA 4O0VA 3TN8A 3R8ZA 2GSFA 3DB6A 2W1EA 3QFVA 1HCKA 3OCGA 3TZ7A 5I9WA 5EYMA 3MH0A 5H8GA 3FXZA 4KD1A 3A7IA 3PVBA 4O7SA 1IG1A 5KBRA 1VYZA 4FV7A 4ORKA 3MH2A 3QX4A 3ZLSA 5DOSA 2O64A 1OMWA 3NUXA 2IN6A 3MFTA 4O0WA 5BMMA 4E3CA 3MYGA 3BHVA 3TTJA 2JKQA 4O81A 1FGIA 5CI6A 4FEWA 3R63A 4RVTA 3ENMA 3FHIA 4BDBA 1SVEA 2BDJA 4EOPA 3PWDA 4RJ6A 3R04A 5M07A 2BRHA 4BTFA 2UZBA 3ALNA 4PDPA 3D14A 4RFYA 3ZXZA 4DFNA 1Y6AA 4D0XA 4R7BA 3DFCB 4RIWB 3V6RA 4PDSA 2OZAA 3R9OA 5I5ZA 4WSYA 3UQGA 4FKVA 3FLNC 4IC8A 4BCIA 4ZY4A 2R3GA 3TNPC 3LFNA 3Q52A 4OR5A 1SM2A 4WOVA 1ZWSA 2XIKA 4FSNA 2I0HA 2UZUE 3ETAA 5D12A 3WYYA 4F7NA 1MQ4A 4L9IA 5EHLA 3BPRA 5AX9A 3HAVA 5DA3A 5AR3A 4PNKA 2JFLA 3C4WA 3MB6A 3EN4A 4DH1A 4Q9ZA 2XKDA 3DBCA 5M56A 3PJCA 4KIQA 4BI1A 2WTCA 3OOMA 2YDKA 2FYSA 4WT6A 5I9UA 5IQBA 3C0IA 3SDJA 5KMIA 4PDYA 4KKEA 2QC6A 2A4LA 4LV8A 4NTTA 4ITIA 4QTCA 3VO3A 4TY1A 3JY0A 3QXPA 4AOTA 3U51A 2F2CB 2OWBA 2ZAZA 3DY7A 4HYHA 4Y72A 3RPVA 4Q2AA 3GGFA 3LFCA 2F49A 3RMFA 4F0FA 4BTMA 4WG4A 5IA3A 2G9XA 3UDBA 4G6NA 5E8TA 3K3JA 2Y4IC 4WNKA 4JAJA 3QD0A 3R02A 3HRCA 4H36A 4YP8A 2RL5A 1Q97A 5J8IA 4V0GA 2CGUA 3K2LA 4LGGA 3OVVA 5FTOA 4BCPA 1QL6A 1WBSA 3RALA 3LFQA 3R1NA 3DCVA 1WFCA 4J95A 3R1SA 3R7EA 2VO6A 4EEVA 2YERA 2W4JA 2OI4X 4QQJA 4XHKB 2ITXA 5D7AA 3NUUA 5FEEA 3HRBA 1ZOHA 3NVKI 5HG9A 3ZFYA 4EOJA 4FKGA 2VWUA 3OBJA 2J0JA 3TTIA 2R3MA 2WOUA 2J2IB 3W16A 4CT2A 5HU9A 3LLTA 2V62A 3VUGA 2DYLA 3W2RA 5AUWA 1OVEA 3DKGA 2X9EA 1SVGA 4FT9A 3ZBXA 4CRLA 4WRSA 4DFYA 3TG1A 4AW5A 3TJDA 4BDAA 4ZJVA 2VU3A 4UMRA 2BZJA 2WQOA 4AW1A 4ZLOA 3ZC6A 4U5JA 3DXQA 3R8VA 3O23A 3HA6A 3R7GA 4E6AA 3EN7A 2YJRA 3VBTA 3B2TA 4ANNA 4FIHA 4IWPA 5K3YA 4BGGA 3PY1A 2WMWA 4II5A 4QMOA 3RTPA 2JC6A 4W9XA 1W82A 3NW7A 3Q9XA 4NM5A 4FKPA 4JJRA 5F4NA 3FZTA 4D5KA 4OLIA 3A7GA 3HMOA 4Q5HA 2BDWA 4FGBA 3F2NA 2YABA 5FG8A 5CEIA 2ZMCA 3QX2A 2QURA 2X6DA 3L8SA 3U9NA 5A14A 4GFOA 4J1RA 5IISA 3F2AA 3D0EA 3UZRA 5AR2A 4KIKB 4XRLA 4DG0E 4ZTLA 4JVGA 4W4VA 2ZJWA 3FL4A 4FNYA 2XCHA 5EOBA 5B7VA 1REJA 3PXKA 3AOXA 2NO3A 3AGMA 3E87A 2WU7A 4X2GA 1ZY5A 2FGIA 3IK3A 4YJTA 4E4LA 1LUFA 3SG8A 3P78A 3R83A 4YU2A 2F9GA 4GT5A 4UMTA 4C2WA 5HD7A 5HTCA 5K9IA 4P5QA 3ZXTA 4BI2A 5L2WA 4R7HA 1OECA 2QODA 5KMMA 1CKIA 2J9MA 4XG3A 1TVOA 2HXQA 1WBTA 3ORMA 3PE1A 4JOAA 4RG0A 5ANDA 4GK4A 2CKQA 5GIPE 3QTUA 3D5XA 5HNBA 4E20A 3TDWA 4BZDA 5KO1A 4FNZA 3FZRA 1NT2A 1U54B 5KMLA 3BWJA 4FSZA 4RX5A 1R3CA 2BALA 4DA5A 5J95A 4WG5A 5DNRA 3ZC5A 4FOBA 2GNFA 5FD2A 5A6OA 1BL6A 3COKA 4YJPA 4FZ6A 4U40A 2C0TA 5HIBA 2WTJA 4Z7GA 3SGCA 2E9NA 4XG4A 4DFXE 2X8DA 4YNOA 3LLAA 3N4VA 4FTUA 3CY3A 2CNVA 2YAAA 1WVWA 1GZKA 4Y8DA 4Z9LA 3E92A 3COMA 4F65A 3HECA 2X6EA 3A4OX 4R78A 2R7IA 5HX6A 4GYIA 2QVSE 3DAKA 4XEYA 2SRCA 4CT1A 2OGVA 4DFZE 1PXIA 4ZSGA 2XM8A 3TIZA 2BCJA 5CU4A 3OHTA 4O27B 3BGQA 4AW2A 4I41A 3D2KA 3QRJA 4EH5A 4NEUA 4FVRA 3QZFA 1Q99A 4MD9E 4WO5A 5HVYA 4YZMA 4DFBA 4G3DA 2B9JA 2HAKA 1OI9A 2JIUA 3OEFX 5HCYA 4RZVA 3RPOA 3W2SA 2J50A 2PMNX 2GFCA 4MBJA 4LG4A 5EM6A 5FGKA 5KZIA 4AT3A 5ETFA 1UKHA 3UVPA 1JWHA 2X9FA 3LCKA 3IS5A 4ACCA 3RAKA 2HCKA 4IDTA 1IRKA 2YLFA 2QOIA 1OL1A 3PA5A 5IH4A 3NUAA 4MNEA 4C36A 4XYFA 4NJDA 4P4CA 3HMMA 3VN9A 4IE9A 2Q0BA 3DAJA 4X3FC 5L6PA 3RKBA 3SX9A 5KHXA 3MVLA 1YRPA 3DBDA 3II5A 2OBJA 3LHJA 1X8BA 4GRBA 4O0XA 4Y5QA 4YJOA 5ETIA 3LJ1A 4AACA 3MA3A 4IX4A 4KS7A 4EH7A 4QP6A 5LMKC 1P2AA 1A48A 3D4QA 3D7TA 3O96A 5L8JA 2PTKA 3R8PA 4EC8A 2YM7A 5CLPA 4PNIA 1WBOA 4ERKA 4YMJA 2HWPA 5HLWA 1OL6A 2QD9A 3A4PA 5HVKA 2WTKB 3F3WA 2A27A 1B39A 4EC9A 1BKXA 4L45A 2F2UA 3WARA 5KKRB 1Q8WA 4F1MA 3MTLA 3UQFA 3GBZA 4FL3A 4ASDA 3IDBA 4MXYA 2VTMA 2W1IA 2EUFB 3D5VA 4NIFA 4TTHB 3RZFA 4NH1A 3MPTA 3Q9WA 5ANEA 5BVNA 4J96A 1ZMUA 2CLQA 2HK5A 4FVPA 2C6EA 4QMSA 4CFFA 2CNUA 2XK3A 1NVSA 2R3QA 5AR7A 3PIYA 3BRBA 5GHVA 4C0TA 3F7ZA 3LFDA 2PUPA 2RF9A 2H34A 4A9UA 2BAKA 3LCDA 4A07A 4CFXA 3CY2A 3IGOA 5CAQA 3HUCA 3U6IA 4OTPA 3ORKA 3FQHA 3CE3A 3QF9A 4ZMFA 3HDNA 4YJRA 4PPBA 5E8UA 3D7ZA 4EOSA 3Q3BA 5IQCA 3SXSA 4JBPA 1W7HA 5C8KA 3JR1A 3CJGA 4ACMA 2ZV2A 3QUEA 4CFUA 3H3CA 1ZMWA 3AC1A 5AV1A 3C0HA 3R22A 3VF9A 3V51A 4BCMA 3UIBA 4E6DA 3NGAA 3NX8A 3OY1A 2JIIA 3QUDA 4C38A 3ZRKA 3C0GA 4CKJA 5A4CA 4BWKA 2GDOA 2J6MA 3L9NA 1L3RE 1H07A 3UO4A 4N57A 3VS1A 5DR9A 3OS3A 5CU3A 2H96A 1Q61A 1XH8A 1YXVA 2PVKA 4I1ZA 1RJBA 4IWOA 3WF6A 1Z57A 4PP7A 1GIJA 4A06A 4HGSA 4FK6A 4I6QA 2FSOX 4DBNA 5T3QA 4M68A 4EWHA 2Y7JA 3GI3A 4MBLA 4FIGA 1KV1A 2JKOA 4KKGA 4ZSJA 4XG8A 3V5QA 5DRBA 5E1SA 5I4NA 4JI9A 3AC5A 1Q8UA 4BDEA 5K0KA 4DTKA 4H58A 2XEZA 4ACGA 4PWNA 2H6DA 3BYVA 4I6HA 1BX6A 4FKSA 1DI9A 2V7OA 4O22A 4EBVA 5HO7A 1H00A 4QMZA 4RIOA 3Q4CA 1A06A 2PL0A 4C7TA 4K18A 4BBMA 4IAKA 3SQQA 4XLIA 4KAOA 2XB7A 3HV6A 4NFMA 4E5BA 4UEUA 4GUEA 3DK6A 5E8VA 3I7BA 5CEPA 1BUHA 5IEVA 5IQHA 4S2ZA 3ORLA 3A8XA 2Y4PA 4AWIA 3IDPA 4OT6A 3U87A 1WVYA 3W18A 4GKHA 3KRJA 2WMTA 4CVAA 5BPYA 3HMIA 3BYSA 4GVAA 1KOBA 4WA9A 1XBCA 3R2YA 4RJ8A 1KE9A 3UP7A 3KMMA 5BYLA 4U3ZA 1ZYLA 2UVXA 4PMSA 5HHWA 4ASXA 4QMYA 2R3FA 1GIHA 4NM7A 2WEVA 5EI8A 4F70A 5K0XA 3T8OA 4BTKA 3NUPA 3RK7A 4GCJA 4KUJA 5JQ5A 4FZDB 1TKIA 4FSWA 3L8XA 4AGDA 2B53A 3AQVA 2YZLA 3O8TA 4F9WA 1J1BA 5EKNA 1SZMA 3F5GA 5GZ9A 2GPHA 3O71A 3MFSA 4O6LA 2GQRA 5EI2A 2UW6A 3V8TA 3BYOA 1RW8A 2C5OA 5IQDA 2R3KA 3UNJA 3DJ6A 4HCTA 5K4JA 3MVMA 5E8SA 4CYJA 3ZUUA 2ZOQA 5EK7A 4AAAA 1K3AA 2QOCA 5M08A 2A0CX 3ZUVA 4CKRA 4YUQA 3DA6A 4C3PA 2UZVA 2I0EA 3UOHA 4DINA 3EYHA 5E9EA 2BMCA 4GMYA 4CTCA 4EONA 5CF4A 4ZSLA 1FQ1B 2QOQA 5GJFA 4QMVA 3MA6A 1E9HA 5LWNA 1UA2A 1EH4A 2FSMX 2VTJA 3G2FA 4FICA 4J8NA 3DFAA 4L00A 1YHVA 2XP2A 2ONLA 4IX6A 4IX3A 1FVVA 3IO7A 4DT9A 3MH1A 2CHLA 3UTOA 1JQHA 5C8MA 5JZJA 2JGZA 3NYOA 3OD6X 4EK3A 3RPSA 4O86A 3KF4A 4AZEA 4I20A 1O6YA 3F69A 2XF0A 4ZOGA 5DT4A 4IC7A 1UVRA 5IQEA 5CXZA 5JFSA 2BUJA 3Q9ZA 5I9VA 1CTPE 1XH6A 4S30A 4PPAA 3LVPA 3UC3A 4BDFA 4O1OA 4RBLA 2P0CA 1WBPA 5DR6A 1F0QA 3NMUF 4I94A 2Q83A 4O21A 4MBIA 3VUDA 2C3IB 4QP7A 3A2CA 4UN0C 3RNYA 2VAGA 3CGOA 3ORIA 4DGMA 1KV2A 1M2RA 4XH6A 3ZYAA 3A99A 2QG5A 4X3FB 2QU5A 2B9IA 2EWAA 5FP6A 4RWJA 4EYMA 4FSTA 3TKUA 2RFEA 2C1BA 5AUTA 4Q5EA 4PTEA 3BEGA 3QQHA 4LRJA 3U6HA 3NW6A 3ACJA 1PHKA 3CQUA 4L3JA 5KHWA 1NXKA 3ZS5A 4D9TA 4AA5A 2VV9A 3DK7A 4DGNA 3EOCA 5IQAA 1Q8TA 3VBQA 4JNWA 3BQCA 1PKGA 2ETMA 5DHJA 3EB0A 3ZDIA 4LMNA 2C6TA 4O2ZA 5J9YA 2YM5A 1HOWA 1PJKA 1PYEA 1UWJA 3E93A 3KGAA 3TNIA 1H1QA 3BWFA 3PVUA 5GJGA 4XG9A 4XV9A 1J1CA 1URCA 2JAVA 4KSQA 2Y0AA 3GQIA 3ZZWA 2BVAA 1FPUA 4V01A 3WF5A 3KKVA 3ZEPA 4QMMA 4E93A 4LI5A 4V04A 3OFMA 4FV0A 4ZY6A 4BCQA 4S33A 3DS6A 2ZB0A 4BHNA 3VHEA 2X8IA 4CG8A 2BKKA 3EMGA 2OK1A 4ACHA 3QD2B 4LYNA 3BE9A 4YC6A 4EZ7A 4RZWA 2R3RA 3TWJA 3UYTA 3G5DA 4CLIA 5B2LA 4O7RA 4BF2A 4EH3A 5KZ0A 4M69A 4OW8A 3IW5A 3L9LA 5EDPA 4YTIA 3I6UA 3R8LA 4O84A 2ZV8A 3CC6A 4QMUA 4MXOA 4RVMA 4APCA 3COHA 3SRVB 5DT3A 4AG8A 4APPA 5CNNA 3UQCA 2YCFA 1W98A 3KQ7A 4J98A 1OL5A 3HMNA 3FQEA 4AZFA 1V0BA 3VJNA 4L52A 4FA2A 3GUBA 3KULA 3ANQA 5AJQA 3TXOA 3Q5ZA 1UNHA 4IWDA 3BHYA 3DGKA 4YGAA 3QGWA 3R9NA 4CQEA 1APME 4QPSA 3UOKA 4GSBA 5HESA 3LKMA 1ZYJA 3WI6A 4WKQA 1ZYCA 4FTTA 5AP4A 3LXLA 2NRYA 4BBEA 2E9UA 5HTBA 3PVGA 4M84A 1OUKA 2Z60A 2XJ2A 4QO9A 3ZOSA 3LIJA 4BWXA 3DTWA 2J51A 3R73A 5ANKA 2BRGA 4OBQA 4R3RA 3UMWA 4DH7A 3TKHA 4F64A 4FTLA 3EL8A 3VF8A 2RFNA 4W8DA 4OTRA 3Q2JA 3UVRA 4K33A 4BWPA 3PJ1A 3HX4A 3L9PA 5ANOA 4AU8A 3RWPA 3POZA 5LWMA 3IOPA 2WB8A 3OT8A 4IM2A 4X0MA 3WZKA 1UU8A 3AD5A 3OXTA 4FTJA 3I0OA 3LM5A 4EOOA 4DG3E 2RGPA 2C5NA 2O2UA 3QQGA 2FB8A 4C59A 5DMZA 4CMUA 5HE3A 2G1TA 3W2QA 4O7WA 5JMSA 1GZ8A 2XKFA 3POOA 1L8TA 3FZ1A 4E4NA 3QCYA 3ZUTA 4M97A 3F5PA 1UNGA 4EKKA 1OITA 3FYKX 4IAYA 4I21A 2H9VA 3O8PA 3ZFMA 5DGZA 5TO8A 5CF6A 5KBQA 5AUVA 2W7XA 3QTSA 2V7AA 4ZTHA 3EQBA 2ETRA 2IWIA 3EZRA 3NCZA 4EK5A 2FUMA 4OUCA 4R1VA 1OKYA 5F1ZA 3QTRA 5DR2A 4BCGA 4C4IA 3MSSA 3SOAA 3ZO3A 3DBQA 1K9AA 3IGGA 4BYJA 1KE6A 2W1FA 5CX9A 3NYVA 2ITVA 1FVTA 5AX3A 1DS5A 3F5UA 2WMVA 4D2RA 3FMLA 2ZV7A 3FMDA 3UNZA 3UPZA 4O83A 2XIXA 1H08A 1P14A 3RNIA 4ZZNA 4EHZA 3HL7A 1PXPA 3B8RA 3DQWA 4EK4A 2JAMA 4M0ZA 4YJUA 4DEBA 1H8FA 4B7TA 3TV4A 1B38A 3DV3A 1G8AA 3R1QA 1F3MC 4LV5A 1FMOE 2ZM4A 1VEBA 3DOGA 4J7BA 2HWOA 4XLVA 1XJDA 2BZHB 3PVWA 3DKCA 2EU9A 5DEWA 4GK2A 5BVFA 5F94A 4EL9A 1PXJA 2IW6A 2VO0A 4BN1A 3JXWA 3LFAA 3TJCA 1Q24A 3O0GA 1OGUA 3KMWA 1CDKA 2XNNA 2ZM1A 2XIYA 2YIQA 4FUYA 1BI7A 2C6MA 2OZAB 4JDKA 5EYDA 5L4QA 2YISA 3QRIA 3H10A 3VULA 4RC3A 4XCUA 4EYJA 5M53A 2PVNA 2G2HA 3LM0A 3EKKA 4AX8A 2VRXA 3E5AA 5G6VA 3UIMA 4ZAUA 2EXCX 4F7LA 5JFWA 2R3OA 3DAEA 5CWZA 1JBPE 2Z7LA 3L9MA 4Y5HA 3FI2A 1T46A 4BCKA 1IEPA 5FLFA 2J90A 1OKZA 4EHVA 3KRXA 4B6LA 2WQEA 4XBUA 3BLRA 4NW5A 3SXRA 3MWUA 4YTCA 4I0SA 1IA8A 4PTCA 4XG2A 1OIQA 4DLIA 2J0MB 5CEKA 4DF3A 4JR3A 2X2MA 3PG3A 3BX5A 2QLUA 3B2WA 5CT7A 1PY5A 3BELA 4G6OA 2ZM3A 3EQHA 4TW9A 4TZRA 3RCDA 5CAVA 2QR8A 5HLNA 4G5JA 5IH5A 3U9CA 5IQGA 5HCZA 1PF8A 5B2MA 2WMSA 5AWMA 3H9RA 4CLJA 3AD4A 1RE8A 2IVVA 1CM8A 3ROYA 4K11A 4TT7A 2Z7QA 3QKKA 4MWHA 2ESMA 2WTKC 2YDJA 4OTDA 3R6XA 2XIZA 4RWLA 4DYMA 3V5PA 4ZSAA 5KKRC 2CGXA 4ANQA 3PLAE 4IVBA 3WF9A 1U59A 4K2RA 3RWQA 4DCEA 4FEXA 3BU5A 4QMNA 4IW0A 5AA9A 4V0GB 4ALWA 2R0UA 4R8QA 5HBHA 2X7GA 2GU8A 5AUUA 3U55A 3UG1A 4AZSA 4YPDA 5GZAA 1MRUA 2IZTA 4BCHA 4QRCA 3Q6UA 4XRJA 3SG9A 3AMAA 4LGDA 3OEZA 3PA4A 3MY1A 2GMXA 1VR2A 4RFZA 4G3FA 1PXMA 2UW3A 4E6CA 1A9UA 1UU3A 5E4HA 4D58A 2R3JA 3RBWA 3AC3A 3BV2A 2XM9A 4G5PA 3BBWA 4FYOA 4O7YA 4D5HA 3GVUA 4PQNA 3F61A 4I0RA 4ANLA 1FINA 2ZV9A 3ZLYA 1DAWA 1WMKA 3NLBA 1G8SA 5TF9A 4U8ZA 4ZIMA 4R5YA 4ZMEA 3OWKA 3PFQA 3N4UA 4KBCA 2J5EA 4JS8A 2B54A 4RA4A 1JVPP 4R5SA 3ODYX 3ORNA 2AC5A 2CKPA 5CSVA 5FDPA 1M7NA 1LP4A 3FZOA 4R6VA 2WXVA 3QUPA 1FVRA 2QLQA 3QZHA 4QYHA 5KCVA 1SNXA 3CPBA 3GEQA 4AZTA 5HE2A 2XJ0A 2FO0A 2HELA 3EN5A 5AP7A 3WILA 5C4KA 4KA3A 3PSDA 4PP9A 5DN3A 4UXQA 4B0GA 4C02A 1VJYA 2YIYA 3GCVA 5EW9A 4ZTNA 5BVWA 2WAJA 2WEIA 3O7LB 5AAFA 3ORTA 4ZTSA 4JG6A 1YW2A 4FSMA 3L8VA 2GFSA 3PXRA 3MGYA 5C8NA 4XBRA 3D2IA 3KK8A 3NNWA 2R4BA 4HYUA 4MXCA 5DVRA 5L8LA 5DFPA 3ZSGA 4LRMA 3B8QA 3UOLA 3G51A 3HUBA 3F66A 3LMGA 3UG2A 1JSTA 5CNOA 5ACBC 4JBQA 2VTAA 3VC4A 5HI2A 3A62A 3VUIA 3OTVA 5AM6A 5T68A 1XR1A 1ZLTA 2J7TA 3O51A 2P3GX 3GP0A 3KMUA 4FKQA 4WUAA 4IQ6A 3HAMA 3EL7A 3G6HA 4D4SA 4JL9A 3HZTA 5CYIA 2C6OA 2WIPA 1YXTA 1Z9XA 5EOLA 4L68A 3FPMA 3OMVA 2YM4A 4ZP5A 1PKDA 2CN5A 4AGCA 2A19B 2ZB1A 5D10A 2CKEA 4JQ7A 3U8WA 3O2MA 4J97A 5CU6A 3T9TA 4BC6A 1QPEA 2JLDA 3PRFA 4M12A 3N51A 2WIHA 3PA3A 4QP4A 5FUTA 3I1AA 3HRFA 2QKRA 2QO2A 4BFMA 3KA0A 2HXLA 4D1XA 1JSVA 3C7QA 3T3UA 2XMYA 2YITA 3PPKA 1S9IA 5LQFA 4AZVA 3OCSA 4RT7A 1JPAA 4G34A 4J99A 3U6JA 4EQMA 3PXZA 4MVFA 4QTEA 4U44A 2OJIA 3DKOA 5E8WA 4ZY5A 5IDPA 3BQRA 1J7IA 2ITQA 5ANIA 2XK9A 3QWJA 3EQGA 3AT2A 3VW6A 2LAVA 2PMOX 1Y8YA 2RKUA 4DFLA 3D5UA 1QCFA 3V6SA 5HO6A 3C50A 3R7VA 1J91A 3PIZA 3MDYA 3OCBA 4N4SA 3AD6A 4EK8A 4X6RA 3E8CA 4PL5A 1ZOEA 4O0TA 4N6ZA 4CZYB 3FAAA 5M4IA 3CD3A 1OIRA 2Y6MA 4O7ZA 2CCIA 3FZPA 3E64A 2OO8X 4IM3A 3KXGA 3FLZA 4I92A 4X3JA 3LW0A 4GW8A 4QYGA 4E8AA 4DE4A 2QI8A 3FEGA 5CSPA 4D0WA 3EN9A 3QA0A 4QP3A 4DG2E 1LR4A 3E7OA 4EBWA 4IAAA 3C4ZA 4IXPA 4D28A 2G15A 3E63A 4ANMA 3VS0A 4MKCA 2OH0E 4NFNA 2X1NA 3QHWA 3OY3A 4QQ5A 4BDDA 2ITYA 3HDMA 3G0EA 3RGFA 3MN3A 4JRVA 4I5CA 1GY3A 4ITHA 4IZYA 5D11A 4D55A 3F88A 4YPSA 4KIKA 2XIRA 3QRTA 2PVMA 4WUNA 4GVJA 4BBFA 1OUYA 5EQEA 4RMZA 5J7BA 4NUSA 4JAIA 2R9SA 3GFWA 3CPCA 1URWA 4FKUA 3GXLA 4IVDA 4JRNA 4EZ3A 4LUDA 1YWRA 3NUYA 4O2PA 2HZ4A 4EOKA 3KC3A 2FH9A 2WMXA 4ASEA 5BMSA 4R1YA 3FXWA 3LFFA 1M2QA 3DJ5A 4NCTA 3N4TA 1PXLA 4CFWA 3DXNA 5L2SA 5HG5A 3RHKA 1M2PA 4YZDA 2BZIB 4Z16A 2PE2A 3FLYA 2YZAA 4MAOA 1M14A 4TYEA 4NIFB 2X8EA 2ITPA 4FIEA 4DLJA 2HY81 2XS0A 4HNIA 3BBTB 3GCPA 4PDOA 2E9OA 4C8BA 4EHEA 2ITNA 3SVVA 2UVYA 2XKCA 3O17A 4UY9A 3EFKA 4AOIA 4UBAA 2JEDA 1UKIA 5J5SA 2HW7A 3PJ3A 4ITJA 2E2BA 4DAWA 4F0IA 1OBGA 5AIKA 2PZ5A 5CZHA 3O7LD 5D9HA 1QPJA 4RQVA 2JDOA 2WMAA 3PY0A 3PP0A 4FTNA 5HICA 5KE0A 3W2PA 3OC1A 3NSZA 2PVFA 1Q8ZA 5AR5A 3FI8A 3GU4A 2BILB 4O0UA 4CFMA 3ZM9A 2WMUA 3GOKA 3Q2MA 4A9RA 3A7FA 1O6LA 3MS9A 3ODZX 4IBMA 4FE2A 3RAHA 3I4BA 3VRZA 5CVGA 4CV8A 1V0OA 4BIEA 2VWYA 2BIYA 4EH4A 3IW8A 4GFGA 5I3RA 3FI3A 4YLKA 1WBVA 3VNTA 3KFAA 2GCDA 4OT5A 1ERKA 1OKVA 3D15A 3LXNA 4RJ5A 1IASA 5JFXA 5K5NA 2YN8A 3AT4A 2QO9A 2DUVA 3CD8A 3VW8A 2V0DA 3CS9A 3TZ9A 2PYWA 2HENA 3FBVA 3QWKA 4RC4A 4FZAB 5A46A 2JBOA 4ZK5A 2HW6A 3BIZA 5F20A 3KXHA 5TT7A 1U4DA 2ZVAA 3LQ3A 4YZNA 2W1DA 4YJVA 3TNWA 2NP8A 4I4EA 4U3YA 1GZOA 4FG7A 3K5VA 5AV4A 4ZTMA 3LCTA 1LEWA 4BKJA 2WTIA 4RX8A 2OSCA 3UNKA 3SD0A 2B9HA 4CEGA 2VWVA 2BRBA 3FHRA 4L44A 5IKWA 4Y46A 5AP1A 2WFYA 3QRUA 4C4HA 2P2HA 3FMEA 3FMNA 4TWCA 5D1JA 1XQZA 4G16A 4JG8A 3SXFA 4A9TA 2OLCA 4QYFA 4IACA 1ATPE 3CLYA 3CR0A 3IECA 5FM3A 3SAYA 4BICA 3A7JA 3LCOA 3V5JA 2YLEA 4ZTRA 4RLKA 3FYJX 4YZ9A 2W5BA 3WE8A 4OTFA 5LVNA 5T6KA 3GCQA 3R1YA
chains in the Genus database with same CATH superfamily
3CBLA 1TQMA 3IW6A 1V1KA 5H8EA 4HYIA 5B2KA 5FQDC 3ROCA 4KWPA 4MD7E 5ETCA 2AYPA 3I7CA 2YWPA 5M4CA 1CSNA 4EUTA 2C3JA 4FKWA 3R9HA 4BCFA 2PUNA 4JX7A 3AKLA 2QKWB 4UWYA 3BHUA 2YEXA 3RCJA 3NUNA 3UZPA 5DYJA 3CTJA 4MWIA 4XV2A 4RWKA 3ANRA 3V3VA 2JITA 2JDVA 3FWQA 3FQSA 3DBEA 5CSHA 1Y91A 1W84A 2BRMA 1NY3A 5J7HA 5CZIA 3W0PA 4USFA 4YSMA 2I0VA 5CTPA 3RVGA 5H8BA 5CF8A 2XYNA 3W0NA 4IAIA 2VO7A 4QP9A 1YWVA 2IVUA 2YIWA 3P86A 4XS2A 2NPQA 2Y6OA 1H01A 3FLSA 3P7AA 3FXXA 4GL9A 4JIKA 3RPYA 4LOOA 4A9YA 1OL7A 3S0OA 5IUIA 4BZNA 3K54A 2CNQA 2ERZE 3CQEA 2W4KA 4RGJA 3MFUA 5EDRA 3LE6A 4U80A 3SW4A 4DT8A 1O9UA 3PUPA 2R3HA 2VTHA 3S00A 1KOAA 5HG8A 2B9FA 3OT3A 2GNHA 4FK3A 3QC4A 4MQ2A 4RX9A 5HBEA 3PPJA 5TOZA 2XH5A 2C0OA 1OBDA 4C4GA 3S95A 4MF0A 3FKOA 4RFMA 1G3NA 5AP0A 4BDKA 4HVIA 3V01A 2ITWA 1KWPA 2WQMA 2EXMA 1YXXA 2CSNA 3R21A 1GNGA 4RIYA 4WNMA 5BYYA 2RSVA 1Q8YA 1VYWA 3VS4A 4PTGA 4O7TA 3ATSA 4FKOA 3Q6WA 5HLPA 2F57A 2CKOA 3CEKA 4L3LA 5AP3A 2XNMA 4YHTA 4D4RA 3R00A 3LOKA 2C1AA 3ZO4A 4U7ZA 3EJ1A 5J1VA 2YA9A 1NVQA 2C3KA 3P1AA 2C6IA 2WTDA 3OWPA 4O7NA 3PSBA 4FT7A 5CAOA 3PPZA 3WZEA 1UU9A 3AGLA 4FG9A 4YJSA 4MUQA 2WKMA 3BHHA 2OU7A 5I0BA 3L8PA 5EM8A 2XK6A 3LAUA 3VQUA 4I6BA 2WZJA 4GG5A 2VTIA 1BI8A 5L6WL 5FXRA 2HYYA 2P2IA 3QCSA 4BDCA 5JT2A 4A4XA 4YTFA 4AXFA 2CPKE 1I09A 4R3CA 3FL5A 4L7FA 1ZMVA 3P0MA 4TWNA 3CQWA 3UPXA 2W9ZB 2IW9A 3V5TA 4OAUC 1Q5KA 1XO2B 2B55A 4XOYA 5EYCA 5LCKA 4CGAA 4XOZA 2JIVA 3V8SA 4R77A 5I9XA 1H24A 1YVJA 2Z8CA 3FI4A 1OB3A 4M8TA 5J9ZA 2UZNA 4N70A 5AUXA 5CU2A 3TT0A 4QD6A 1TZDA 1MUOA 3F5XA 4OTIA 5LJJA 3TCPA 4XV3A 4ZJIA 4ALUA 1GAGA 4BL1A 1YDRE 5JRQA 3AKKA 3ITZA 3VIDA 4D1SA 4BKYA 4D2SA 4EUUA 2RIOA 3G6GA 2VTTA 5A4EA 2WOTA 4KIPA 1YXSA 3MH3A 1M17A 4FV4A 2WNTA 3GENA 4EH8A 4WRGA 5DPVA 3P9JA 3DXPA 4QPAA 4FSUA 1ND4A 4IB1A 1Q3WA 3WIKA 5JSMA 3VHKA 3MV5A 2CDZA 5M57A 1GOLA 4CYIA 1JAMA 4TYHA 3N9XA 3PE2A 2X81A 4M0YA 3ZONA 3H0YA 1Y8GA 4FUXA 3NIEA 4E5WA 3F9NA 3W55A 1XH7A 3C4FA 3JUHA 4OGRA 3IONA 3UODA 3Q9YA 1ZZ2A 4QMTA 4O4BB 3ERKA 5AUYA 4L8MA 5ANGA 4ANBA 3P4KA 3T3VA 3VBWA 4CG9A 3C5UA 4J71A 4FV9A 3NVMB 3VBXA 3QHRA 2VNYA 2KTYA 3M1SA 1PMVA 4QOXA 1P4OA 3PXQA 4DEIA 5ETAA 1ZRZA 4NM3A 3E7VA 1XH9A 2A2AA 5E91A 4B8LA 5ACKA 4BDJA 2GHGA 2P4IA 2PVYA 3QALE 4LL0A 4TWPA 4W8EA 4CFNA 2RG6A 3A61A 3BHTA 3OCTA 5F9EA 1FGKA 3PJ8A 3VWAA 2OJ9A 1G8KA 4IB5A 3I5NA 3NNXA 4FI1A 1O6KA 2R64A 2RFSA 3TACA 4AGUA 4C33A 4CZTA 3W0SA 4BR3A 3ZRMA 3CSVA 3OG7A 5BVKA 4I24A 2X0GA 2OF2A 4D2TA 2BFXA 4CMOA 3RJCA 4ENXA 3GQLA 3KULB 3GNIB 5I3OA 4EQUA 4AW0A 3FKLA 5IA0A 3KVXA 4YHFA 4YO4A 5KMKA 1LPUA 4O38A 2O65A 2P55A 3ZLXA 3PDTA 5CF5A 1OM1A 4M66A 3BGPA 4Z55A 2C5XA 4IH8A 1R39A 3MFRA 2G2IA 2VN9A 3FC2A 4FV1A 4P90A 1R78A 5JGBA 4FKTA 3ZO2A 4EOQA 3KL8A 4FV6A 2W1ZA 4F9YA 2JFMA 4P7EA 4D4VA 2YACA 3CCNA 3GC7A 2BKZA 3DDPA 4IADA 2C6LA 2VX0A 1YHSA 2GS7A 2R5TA 4HPUE 4MHAA 1FOTA 5E8XA 1UV5A 4YC3A 2UW4A 4FL2A 4DEHA 4DBXA 2BTSA 2NRUA 2YM6A 4RIXA 4MQ1A 3S4QA 4XMOA 1JKSA 1FMKA 5BUIA 4BIDA 5EQPA 5EYKA 4OBPA 5DEYA 1S9JA 4JR7A 4PRJA 4L53A 5J5TA 3EQCA 4AA0A 1R0PA 4IANA 3GCUA 3TDVA 3BYMA 4BDIA 3UO6A 5IEXA 4B99A 5AP6A 4BHZA 1OIUA 3BLHA 5AEPA 4GIHA 4O1PA 3V5LA 4GG7A 2BHEA 2PHKA 3R0TA 3NZ0A 3ALOA 1MRVA 4FT3A 4PMTA 3R8UA 2E9PA 5HE1A 4M7IA 2W05A 4F6SA 4EHGA 5LMKA 5M4UA 2WU6A 5LXMA 4UV0A 3NFFB 4ACDA 4G3GA 4H3QA 2LGCA 3GT8A 3TUBA 3RP9A 4N0SA 3IG7A 2UW8A 3MB7A 4HVHA 1H1WA 2X0PA 2CGVA 4YC8A 1XWSA 4HZSA 2E9VA 4ZZOA 3Q60A 5KMNA 4W4XA 3QA8A 4FTOA 4FTMA 5CVFA 2HY0A 5BUEA 3OXIA 3M11A 5IZFA 4I6LA 1E1XA 3IW4A 4F1TA 3LCSA 3KVWA 3ULIA 5KUPA 2IO6A 2UZOA 5FEQA 3QKMA 2J0LA 5AUZA 4DEGA 4TYJA 3QL8A 3UIUA 3Q96A 3R71A 4HNFA 4O0YA 5DWRA 4E6QA 5LOHA 4DEDA 1CKJA 2XBJA 4LL5A 1ZAOA 5BVEA 1TQIA 2WQBA 1PXOA 2OH4A 3ZO1A 4IB3A 5IMXA 3GU5A 3WZUA 3P08A 4JLCA 5HE0A 2QHMA 2PVRA 4FKRA 4AGWA 1DM2A 3Q4UA 4IM0A 4E7WA 3F2RA 3G9NA 2IZRA 2OJGA 2Z02A 3IQ7A 4L42A 4G3CA 5CU0A 3PXFA 4F4PA 4PMMA 2PE1A 3Q32A 4WD5A 2EB3A 2W0JA 5HEZA 4KKHA 5L2IA 3MIAA 4HCVA 1CMKE 4YBKA 1YOMA 3RHXA 1U5RA 4OTQA 4EH6A 4BJJB 4HYSA 5DT0A 1OPJA 2BR1A 2JDRA 2XRUA 4CTBA 3QQJA 2X4ZA 4QMPA 1YHWA 4GH2A 1WBWA 3F3VA 4LQMA 4ANSA 3LZBA 3QBNA 5BVDA 3VS6A 4FKJA 4ONAA 2OXYA 1ZYDA 3HMPA 4J53A 3E3BX 3UYSA 4U9AA 4HW7A 2UW0A 5HX8A 4MYGA 1WZYA 1GJOA 4IAZA 4L6QA 4QNAA 4AA4A 1YQJA 2QOHA 3P7CA 4NM0A 5FXQA 2V55A 4FKLA 4QPMA 2R0IA 3TEIA 4DHFA 3QC9A 2QNJA 4IFGA 3W0OA 1H0VA 3HKOA 4OAVB 3C1XA 2YHVA 3PIXA 1H1PA 5FBNC 3UDZA 2YM8A 4GT3A 4A4OA 1BYGA 2F7XE 3HLLA 3LQ5A 4FV2A 4L3PA 3QAME 3TNHA 3OOGA 3O5AA 3KF7A 3ATTA 4FZ7A 2BDFA 4EJNA 3UZTA 3Q5IA 5M4FA 4IJPA 3EFJA 5CVHA 4S32A 3ZFXA 4QQTA 2OIBA 4ASZA 3LFBA 4K8AA 2REIA 3UDSA 5GZ8A 2GNLA 4LGHA 5A4LA 5I9YA 2WGJA 4LFIA 2GHMA 5EH0A 2VTRA 4C35A 5HGIA 3NW5A 5ANJA 2RG5A 3W8QA 5JFVA 2QOBA 1QPCA 4YZBA 3ELJA 4JXFA 4J8MA 4EWQA 2F4JA 3BEAA 3RPRA 4O4CA 2IZSA 2XRWA 3E8NA 4IMYA 4IAFA 4UXLA 1H1RA 4FV5A 4MNFA 4FTIA 4WBOA 1Q4LA 5EM5A 4FNXA 4TRLA 3Q4ZA 3ZHPC 5HD4A 2JBPA 3R9DA 5J9LA 5AIRA 3SW7A 2VO3A 2PU8A 4Q9SA 5CI7A 2C68A 3LJ2A 5EW8A 3R7UA 2KULA 4X2NA 3ZZEA 3R9RA 5KMOA 4GU6A 3QTZA 2VZ6A 4JDHA 2YFXA 4OTWA 3QTWA 4RPVA 5AV2A 5LMAA 3MY5A 3VUHA 4D2VA 2WELA 2ZDUA 4WNPA 1BMKA 5DRDA 2PVHA 4PV0A 3NRMA 4ZTQA 3F3TA 2UW7A 2OKRA 5HIEA 3MTFA 4NTSA 3L1SA 5IDNA 4G1WA 4HVDA 5KMJA 3UOJA 3AC8A 5LVMA 3HP5A 3TV6A 4YR8A 3UC4A 3FLQA 4I22A 3QKLA 3C13A 2EB2A 4DH5A 3ORXA 4ENYA 2PULA 4U41A 4W4YA 4NW6A 4RJ3A 2QQ7A 1Y57A 2C30A 2GS2A 3AT3A 4FTRA 4LRKA 3HP2A 3HNGA 3BI6A 4OTHA 1YOLA 5EW3A 3RK5A 4CMTA 2Z2WA 3HEGA 4RC2A 4QTBA 2B7AA 1WCCA 4BVUA 2R3LA 4L43A 5GNKA 3R30A 2UZDA 5C03A 2YCRA 3QRKA 1UU7A 4FSRA 1SYKA 5C26A 2PVLA 4X2JA 2XBAA 3AMBA 2GS6A 5J79A 5FTGA 2VWBA 3CIKA 5FDXA 3R01A 3S3IA 2GTMA 4AF3A 2H8HA 4EH9A 5M51A 2J4ZA 4FZFB 2IEWA 5HVJA 3UIXA 2PUIA 3IKAA 5IQIA 4FEVA 1SNUA 4YZCA 4PMPA 2W17A 5AR8A 3H4JA 2DWBA 5JN2A 4AE6A 2J0IA 2GHLA 4XUFA 1YDSE 2OFVA 3FE3A 2C6KA 4F63A 4MCVA 4NYEA 2AUHA 4NT4A 4ERWA 4PX6A 4HPTE 4E73A 4O7LA 4I93A 1P5EA 2XALA 3DU8A 2QO7A 3VBVA 3AC4A 3C4EA 3EYGA 4RIWA 5CAPA 3QGYA 4H39A 2PWLA 5HTIA 5EFQA 3QD4A 5H2UA 1P4FA 2UUEA 2VTQA 2XNEA 3LMHA 4MX9A 3G9LX 3PLSA 1AQ1A 2VTNA 4CSVA 2HZIA 4E4MA 3FKNA 3KXZA 5DH3A 3NS9A 3RI1A 4TYGA 5C1QB 2XNOA 3NNUA 1OKWA 1JOWB 3DPKA 4I5HA 5D41A 4LM5A 5EHYA 5AR4A 3V04A 3ID6C 4BJJA 4FEQA 4GV1A 4PL4A 4HVSA 3PY3A 4RVLA 5H3QA 4AP7A 5L8KA 5LCJA 4FIIA 3VUMA 4CQGA 3P23A 4M15A 4UZHA 4X21A 5CSXA 4GKIA 4TPTA 4GT4A 4DITA 2OIQA 2W5HA 3ZM4A 4C62A 3ZBFA 4F7SA 4QP8A 5DE2A 2OF4A 2OICA 1XBBA 2PZYA 3BU3A 3VUKA 4CNHA 4H1MA 1SMHA 3LXKA 3P5KA 3UBDA 4L7SA 3SOCA 4BI0A 2ITTA 5IA4A 3V5WA 4ZJJA 2GNJA 1PMNA 3QLFA 5DG5A 3QLGA 5AAGA 2B1PA 3G33A 2EXEA 4L67A 4NU1A 4C37A 5HOAA 3M42A 3C9WA 4PL3A 2R2PA 4RWIA 2C69A 4S34A 2XUUA 3HV5A 3UJGA 1J3HA 4AE9A 1OZ1A 1SVHA 2ITUA 2QR7A 4B8MA 4M67A 1H27A 5AP5A 4JQEA 4TNBA 4Y85A 3MPMA 5TE0A 2PPQA 3W0MA 1FBNA 3U4WA 3DNEA 3NIZA 2JDTA 2YCSA 5CQWA 5HNGA 5E1EA 4IWQA 3A60A 3OW3A 4O82A 5CASA 3BZ3A 3LMIA 3DJ7A 5BVOA 3JYAA 3QU0A 3WF7A 3WE4A 4BB4A 2ONLC 4FNWA 4O0SA 2UZWE 2QOKA 4V05A 4ZZMA 4AOJA 1TQPA 3PYYA 3PG1A 3HVCA 3ZU7A 4P5ZA 4C2VA 5M44A 4ALVA 2ZDTA 4PF4A 4GS6A 3DZQA 3WF8A 2VTLA 4C57A 2JKKA 2WD1A 1T45A 3RM7A 2UZTA 4AN9A 4WG3A 4B4LA 5IA1A 5L2QA 2UZLA 5AMNA 3NUSA 2IVTA 3VBYA 3V8WA 4A9SA 5JK3A 5J87A 3REPA 4C4FA 2ZMDA 4HZRA 2WO6A 3NNVA 1H1SA 3HA8A 4E26A 4U43A 2HIWA 3GCSA 2W4OA 1J7UA 3E62A 4QT1A 4DTAA 5IQFA 2I1MA 3LFSA 3OZ6A 4EH2A 2W1CA 5C27A 4TNDA 5BNJA 3WBLA 2W5AA 5GIOE 2Y8OA 4IZ7A 4FT0A 5EHOA 3S2PA 5JGDA 5HORA 2W06A 4CKIA 4MNEB 3ENHA 2O5KA 2C6DA 3MBLA 5LVOA 1UNLA 4KRCA 2I0YA 4X2KA 4C58A 4J52A 3SLSA 2CN8A 2W96B 4TYIA 4U97A 4X7QA 4JT3A 5FM2A 3F3UA 3R28A 2VGPA 5E8YA 2JD5A 3CTQA 3K3IA 3WZJA 4IVAA 5M06A 3JY9A 1LEZA 2CJMA 4YJQA 4G9CA 3COIA 4C61A 4KBKA 3MVJA 2AC3A 4NK9A 3D7TB 3EQDA 1XKKA 2W9FB 3DBFA 4YO6A 3VAPA 2BIKB 4X2FA 3H9FA 2PUUA 4QP2A 3FY2A 4NL0A 3GOPA 4I5PA 5GINE 4C34A 1JKLA 3H0ZA 3MY0A 4RSSA 5EI6A 4QNYA 1G5SA 4RX7A 3NYNA 3MJ2A 3RAWA 1W83A 2CGWA 2PZIA 3BLQA 4G17A 4M3QA 4DEAA 4U79A 3QQUA 3R7IA 4JDJA 3CXWA 5C01A 3FMHA 2YWVA 3O8UA 3QYZA 4X6QC 3JVSA 4RA5A 5EDQA 2XJ1A 4MD8E 5E92A 4C3FA 3GC0A 3QD3A 4Z3VA 2C47A 3HV3A 2XANA 1R1WA 4KSPA 3TZ8A 5AV3A 2QHNA 3FSKA 5JGAA 4D9UA 3ORZA 1IA9A 1U54A 1JKTA 2QONA 3EFLA 3THBA 3HYHA 4Y95A 3QTQA 2ITZA 3QZIA 5LARA 3M2WA 2UZEA 4G2FA 4U81A 4CZUA 3ORPA 5E7RA 3W0RA 3SKCA 4ZS4A 2FSTX 2WMBA 3VUTA 4CXAA 4L01A 2ETKA 4F08A 3EH9A 3A7HA 3GFEA 3ZCLA 2YDIA 5A54A 5CSWA 3UP2A 4IDVA 1DAYA 2ERKA 3ZEWA 3I60A 4W9WA 2BPMA 4B9DA 4Z7HA 3BU6A 5HQ0A 4FT5A 2A1AB 3ZMMA 2VTOA 4UALA 2JKMA 2PZPA 4CCUA 4DGLC 3IDCA 5IH6A 3JS2A 2NNWB 4TWOA 2XKEA 2V22A 1REKA 3RAIA 4KRDA 5CEOA 2BFYA 5CS6A 2VWXA 2C4GA 1Q3DA 2YM3A 2WTVA 1UWHA 4YNEA 5HKMA 1JLUE 5E8ZA 4D2WA 3UE4A 2XEYA 2X39A 4AN3A 3EFWA 4AT5A 1PXNA 2X0OA 1MRYA 4DH8A 3NYXA 4CV9A 5JRSA 2IW8A 2R3PA 4Y83A 1KUTA 2ACXA 4H05A 2OFUA 4MF1A 4EOIA 2IG7A 4IZ5A 3EIDA 3KRRA 3W8LA 3TIYA 1F5QA 2OZOA 4YURA 3PJ2A 3PRIA 5JQ8A 2XARA 4R3PA 3DLZA 2O0UA 4QMXA 4DTBA 1CKPA 4A4LA 1MP8A 4EKLA 4JQ8A 4XP2A 3VS5A 4D4YA 1IAJA 3DKFA 4ANOA 1H4LA 2XK7A 1HCLA 1ZARA 3JPVA 3KK9A 3KCFA 2X7FA 1NA7A 4MK0A 4BCJA 2PZRA 4F9BA 3FSFA 5LMBA 2BROA 2PVJA 3MJ1A 3P7BA 5CT0A 3KXNA 3SHEA 4K77A 5FRIA 3CKXA 4JBOA 1AD5A 1KSWA 3PZHA 4XJ0A 4AQCA 2P33A 4HOKA 3KN6A 4XV1A 2VX3A 4F1OA 3T9IA 2Y4IB 5IUHA 3MIYA 4F9CA 2OW3A 3QTXA 3CJFA 4IZAA 4WIHA 3FPQA 3HV7A 4FG8A 3PTGA 3CP9A 5IA2A 5HZNA 3OP5A 4G31A 5HU3A 5TKDA 3RZBA 3SA0A 1TFFA 4O96A 4EORA 5CEMA 3QQLA 3I6WA 1WAKA 4RIYB 4GK3A 4LOQA 3GU7A 1YDTE 3LXPA 3IPHA 3WZDA 4BZOA 5HBJA 5IPJA 2W1GA 2BTRA 2YIRA 5A9UA 3BYUA 5CALA 4AT4A 2OIDA 4E1ZA 4FVQA 4O7VA 1H28A 3DK3A 2VWWA 2ZYBA 4UX9A 5ITAA 3TV7A 5E90A 3VS3A 2WTWA 3W33A 3BGZA 3NAYA 2GTNA 3KREA 4YJNA 4BKZA 3E88A 5JH6A 2WPAA 2PSQA 3AG9A 3F3ZA 4C4EA 1H26A 4ZLZA 1U5QA 1VZOA 4FSYA 3FC1X 3NEWA 4GUBA 4DFUA 3KRWA 3DLSA 3TKIA 5BYZA 3MESA 4XNEA 2VTSA 3HV4A 2WMRA 2ITOA 3P79A 3G90X 5FEDA 1NW1A 2GNIA 2XK4A 4QYYA 4F9AA 4G9RA 3C51A 1KE5A 4F7JA 2G01A 5L6OA 2VNWA 4FMQA 4FKIA 4FTCA 4TXCA 2IJMA 3NR9A 4PY1A 5FP5A 4XP3A 2IVSA 2QOFA 2VUWA 3PZEA 4E4XA 5IUGA 2R3NA 4UWBA 3C4CA 3QYWA 4YBJA 2B0QA 4I0TA 1IR3A 4I3ZA 4YLJA 4WNOA 1PXKA 1ZZLA 3FV8A 3MW1A 3AMYA 4ZS0A 3PWYA 1QPDA 2OXDA 3EQIA 4BDGA 3NCGA 3QXOA 4GJ2A 3E8EA 2IZUA 4QQCA 4XG7A 4CCBA 3QCXA 4O91A 4EI4A 3UMXA 5IF1A 4FTKA 1W0XC 3W1FA 3QCQA 4NKAA 3OW4A 4K1BA 2O63A 4NSTA 4AN2A 4M14A 1PRYA 3ZDUA 4TL0A 1V0PA 5DLSA 3VRYA 3ZH8A 2XA4A 1RQQA 3H9OA 3MI9A 5CENA 5EQYA 3DNDA 2WHBA 2X2KA 2YJSA 3JVRA 4F6UA 4JDIA 1M7QA 3FMJA 3KXXA 4ARKA 3OWJA 4EK6A 5GJDA 3DB8A 3I0QA 3R2BA 4MH7A 4OBOA 4BYIA 4I23A 4DEEA 3RM6A 4IEBA 4ZLYA 3G0FA 3DT1A 4BTJA 3GC8A 3S1HA 4GJ3A 4U0IA 3UO5A 2BZKB 3E8DA 4TYHB 1H25A 2X2LA 3W32A 3QZGA 2Q0NA 3DTCA 1B6CB 5HG7A 1MQBA 1E1VA 4IHPA 4BRXA 3Q04A 2DQ7X 2I40A 3CTHA 2X4FA 3C4XA 3D9VA 4H3BA 3RINA 4YSJA 2F7EE 2V5QA 5AM7A 4QTDA 4AZWA 1W2DA 3KU2A 3QTIA 3C5IA 3EHAA 1YWNA 2G2FA 4IB0A 4F99A 2UV2A 4HCUA 2XNBA 4ZSEA 1ZOGA 1ZXEA 2XVDA 4FTQA 4LUEA 5JEBA 1W2CA 4FR4A 3CGFA 3F7WA 4DGGA 2F7ZE 3UGCA 3KRLA 2HOGA 3U54A 3TNQB 3UVQA 4IJ9A 3BCEA 1I44A 3OWLA 4I4FA 4HJOA 4C4JA 2XYUA 3ML1A 2RFDA 4I6FA 1XH4A 1GIIA 2WQNA 4JMQA 1YI4A 2Z7SA 3EN6A 4JBVA 2W1HA 4DHZA 5DBXA 4I5MA 4EQCA 4U6RA 3OF0A 2BHHA 4C3RA 5A4QA 3MPAA 5HNIX 3KCKA 3D83A 3OUNB 3OTUA 4QTAA 2BRNA 2BAJA 4UWCA 4YHJA 3EZVA 5AP2A 3VQHA 4BDHA 1XH5A 4P2KA 4QMLA 1PYXA 3AC2A 4DGOA 4EOMA 2VD5A 3ZSIA 3WIGA 5A4TA 4G3EA 5LVPA 4UMQA 3BKBA 1U46A 4S31A 3R7OA 4H1JA 4RVKA 1OGYA 5FBOA 3KB7A 2DS1A 5D7VA 4M69B 5F95A 3ULZA 3EQRA 4CFVA 5G1XA 2FA2A 3VJOA 4D1ZA 4QMQA 2R7BA 1PMUA 4FTAA 5IU2A 3A8WA 4GYGA 4K0YA 2PMLX 2QOLA 3PXYA 4EZ5A 3O50A 4BGHA 2Z7RA 3E3PA 5BQ0A 4RIXB 3TUCA 3TM0A 5KX8A 3WOWA 4OTGA 4RJ4A 3TUDA 3KEXA 4FV3A 4MXXA 2J5FA 4NJ3A 4A7CA 4R7IA 4FEUA 4IVCA 4DDIA 2PE0A 4RJ7A 4XG6A 3NAXA 2XCKA 2HZNA 2B52A 4LMUA 5C9CA 4JIAA 2YAKA 4QMWA 3FY0A 2C5VA 3TMOA 4FYNA 3WYXA 1Q62A 3D94A 5DIAA 1Q41A 1OPKA 5CEQA 2PK9A 3EKNA 5EKOA 4E5AX 4H3PA 1R0EA 4D2PA 3LQ8A 4O6EA 1YKRA 2VWIA 5FTQA 3R7YA 4PUZA 3SV0A 3I79A 4GFMA 4JX3A 4DH3A 5CANA 2X7OA 4BY9E 3D5WA 4CD0A 2FSLX 2W99B 4WBBB 1YI3A 4O0RA 3I5ZA 3ZLWA 3TL8A 4QYEA 4F0GA 2O8YA 4KNBA 2C3LA 5HCXA 5L2TA 3LJ0A 3Q53A 2VGOA 5EG3A 2I7QA 3GC9A 4FL1A 4FOCA 4EJ7A 5KNJA 3H30A 3NPCA 3SC1A 4F09A 5EM7A 1YXUA 4TN6A 4UMPA 4N6YA 3ZTXA 4BCNA 2PY3A 2BAQA 1W8CA 1ZYSA 2XZSA 3ZRLA 2GQGA 4KIOA 5M09A 4X3FA 3W10A 3ZSHA 4LOPA 3BL9A 2OJJA 5LVLA 3QQKA 4GU9A 3W2OA 4KS8A 4MTAA 5CQUA 4HGEA 2XNGA 1JNKA 3EWHA 5IG1A 3BE2A 3OUKA 2QOOA 2QG7A 5IEYA 4UYNA 4DN5A 1K2PA 4L46A 2GNGA 4KB8A 4UYAA 2C5YA 2UVZA 3IOKA 3MVHA 3VS7A 4FSQA 1XHAA 3OBGA 3K5UA 4FODA 1DI8A 4KINA 4EOLA 4AFEA 4QP1A 1KE8A 3BV3A 4USDA 3DQXA 4MEDA 1J7LA 2X0QA 3GU6A 3CKWA 2ZFYA 4UZDA 3VS2A 2CMWA 5H9BA 3VVHA 3NDMA 3W2CA 3OROA 4HVGA 5IMEA 4KABA 1PW2A 5J1WA 4NZWB 5A3XA 4LV7A 5JZNA 3DDQA 2PMIA 4HGTA 3NFGB 1H0WA 1PMEA 5M55A 2FVDA 5K4IA 5ICPA 4PPCA 3HGKA 3F6XA 4JG7A 1M52A 4MXAA 3G15A 2YIXA 1OL2A 4G6LA 3FMKA 1RDQE 2O3PA 1STCE 2I6LA 1BL7A 3Q4TA 5I9ZA 5AFVA 4DC2A 2J0KA 4FC0A 1OPLA 5B0XA 2GQSA 3FUPA 5AA8A 2XK8A 5CXHA 1KE7A 3SRVA 4RLLA 4NKSA 3ET7A 3FMMA 4WHZA 5HIDA 4U42A 4XX9A 3RK9A 5AADA 1Y6BA 4BCOA 3F82A 3KY2A 3QQFA 2XNPA 1NVRA 3NWWA 4FIFA 4ID7A 4IIRA 4RRVA 4BGQA 2UW5A 2R3IA 3R8MA 5DI1A 4ZXTA 4FX3A 4NCTC 5FXSA 5BX0A 4HGLA 5AV0A 3KN5A 1ZY4A 2VX1A 3U4UA 4GIIA 4AS0A 3EQFA 5AAEA 1IAHA 4M13A 4TKSA 4F6WA 1OIYA 3TZMA 1YOJA 3FLWA 2QCSA 1JKKA 4FV8A 3ACKA 1GZNA 1XBAA 2CLXA 2C0IA 3IW7A 5CAUA 3LFEA 2YCQA 3OXZA 3GB2A 4FGRA 2UW9A 4ZEGA 2EVAA 2OXXA 4DCAA 1WBNA 1YI6A 4K6ZA 3PP1A 3TI1A 4YLLA 4KBAA 3PSCA 5C4LA 3I81A 4FF8A 4IX5A 3FZSA 4BIBA 1JSUA 5BUJA 1Z5MA 2OG8A 4UMUA 4W4WA 2VTPA 5HO8A 4CRSA 4Y73A 1AGWA 2AQXA 1BLXA 5K5XA 4IFCA 1QMZA 5L3AA 4NWMA 4GEOA 4MXZA 2JDSA 3DZOA 3EQPA 5CY3A 2VWZA