2VO3A

Structure of pka-pkb chimera complexed with c-(4-(4-chlorophenyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-yl)methylamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
total genus 105
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo3A02
5K5XA 2F57A 2Q0BA 2VNYA 3PY0A 4IZ7A 2F7EE 3O71A 2XK9A 3BYOA 5HD4A 2OF2A 4K2RA 5AP2A 2J0JA 1J7LA 3G0EA 2XIYA 4FOCA 4O6LA 4QMMA 5JN2A 2X4ZA 5HBHA 4JS8A 3HV4A 1XO2B 3PZEA 2Z02A 3VJNA 2ZYBA 2J6MA 4AA4A 1M52A 4DG0E 5M53A 2CNVA 2JKMA 1H08A 4ZOGA 2HAKA 4I4FA 4G6LA 5I0BA 4A06A 4YZCA 5LWMA 4CT2A 4JBQA 4FEXA 4CRSA 1NVSA 4TNBA 2CNQA 5LMBA 3VAPA 2UZBA 3UOHA 5AJQA 4D55A 4EH3A 3CEKA 5CASA 4CG8A 4G2FA 4O0SA 5IUGA 2C5XA 4O0TA 2XRWA 1UWJA 3Q60A 4YJVA 4IAKA 2CCHA 5ACKA 4AA0A 3NW7A 4JQEA 4PPCA 3FI3A 5BX0A 1UWHA 1REJA 3O23A 3Q5ZA 1UKHA 3F9NA 4I0SA 2YM3A 4K9YA 4FX3A 5T3QA 5CZIA 3LXPA 1ATPE 5ANIA 2R3HA 3A4PA 4FV0A 1ZMVA 4II5A 3IDBA 3IG7A 5GNKA 3F2AA 3D2KA 4FA2A 2J4ZA 3BE2A 5EG3A 3L9MA 4ZLYA 2XYNA 3R7UA 4U3YA 2Y7JA 3ZXTA 1U4DA 1XH6A 4EWHA 4ZLZA 5CVFA 1H1RA 2R64A 2J7TA 3NNXA 4KRCA 5KO1A 3JR1A 2RIOA 4WNMA 2PUIA 3WZDA 4YC3A 1XH8A 4FTQA 2ITQA 2WQNA 4QP3A 5CENA 3SG9A 3R7OA 3DBDA 4JI9A 3DK6A 5GZ8A 2ZOQA 5EM7A 2XCKA 2FGIA 4YLJA 2YITA 3FHIA 3R9RA 4GV1A 4U42A 3KXMA 1F0QA 5AA8A 4BCQA 4YP8A 3NYOA 1VZOA 3FSKA 3CC6A 3THBA 3UNZA 2J0IA 3R1QA 4GRBA 5LMKC 4UY9A 4EZ7A 4ARKA 2B9HA 3Q6UA 4YTCA 4R5YA 2WHBA 2EWAA 4Y8DA 4CQEA 4QPSA 2RG6A 4R7IA 2G01A 1L8TA 3E92A 4JL9A 2ITWA 3FZOA 5GHVA 4IANA 4JX7A 3QD3A 2YISA 3NS9A 3V6SA 2JD5A 3JY9A 3NNVA 2ITNA 5IEVA 2H34A 2W1CA 3KXNA 4U41A 2VRXA 3LXKA 3F3WA 5C8KA 4IWQA 4HGLA 2IG7A 4ZSJA 2V0DA 5BVOA 1DI8A 4R8QA 5ANKA 2XJ2A 4NU1A 4EBVA 3C4WA 5EM8A 2CDZA 5HTIA 4U9AA 3R8MA 4DH8A 1U46A 4Y5QA 3LHJA 3MESA 1OIQA 3C1XA 3WIKA 5JGAA 4DTBA 4FK6A 4FTJA 1SNUA 4HZSA 4EYJA 2WTJA 1FGIA 3MDYA 4YO6A 5J5TA 2QO2A 2WPAA 5DHJA 1P14A 5ETFA 3O51A 3LXNA 3O96A 3TZ8A 5CZHA 4G16A 2WMWA 2C0IA 5CF8A 1J7IA 1M2PA 3EYHA 3K3JA 4HNFA 5CU6A 5AUUA 2QONA 2VX3A 2QD9A 2OJJA 2HW6A 3MY1A 1W83A 4DGOA 5HLNA 5JKGA 1KE7A 1URWA 3Q5IA 1CKIA 2C3IB 3G9NA 4ANBA 5EOLA 3ULZA 5JGDA 1U5RA 2XIXA 1YHWA 1JSUA 1WCCA 5FEQA 1OL5A 4FE2A 2WTVA 3RTPA 5AV3A 2Z7RA 5HO7A 1XKKA 2OLCA 3TXOA 5EKOA 1IAJA 3ANQA 3DJ6A 4TY1A 4M12A 4YZNA 2IPXA 1ZRZA 2PMNX 2BFXA 3DK3A 4O7VA 3ZRLA 2ITXA 4YBKA 1TQIA 2VGPA 5A54A 2WQEA 1Z57A 4WA9A 1GIHA 1OL7A 5KZ0A 4C3RA 1YI6A 3W8LA 2OH4A 3GFEA 2OIDA 4MNFA 2O2UA 2VTIA 3A61A 5AP0A 3QA8A 2W5AA 4ITHA 3S3IA 4XV3A 1ZYCA 1Y8YA 1S9IA 3G5DA 3MJ1A 3QKLA 4EHZA 2WTWA 4CD0A 3R73A 4IVAA 4D5HA 3FL5A 4BN1A 2ITZA 3NDMA 3ATTA 3BKBA 2C5OA 3PSCA 2ZJWA 3MIAA 4MWIA 4AOJA 2FVDA 4F7LA 4ZLOA 2PE1A 3QWKA 2C3LA 2R2PA 4LG4A 1P4FA 5M56A 1YXSA 5J9LA 3S0OA 3F5UA 2HOGA 2ZAZA 5M4CA 3QTXA 3I0QA 3A7IA 3LJ2A 4ZP5A 4A07A 4RRVA 2W96B 4W4YA 3EMGA 1U54A 1VYZA 4Q5HA 5E8YA 5IQIA 1QPJA 4EI4A 1H28A 3NPCA 4ZTHA 4UWYA 4HGSA 4L7SA 3TUBA 1V0PA 3R0TA 4U6RA 1Q3WA 3WARA 3Q9ZA 4AX8A 3BYMA 5H8BA 2Z7QA 5HG7A 2B9IA 3R8PA 5KBRA 4W4XA 3E7VA 4D2VA 3QCQA 2B1PA 5GZ9A 4CQGA 2H6DA 2RGPA 2PE0A 4PX6A 4X2KA 2RFDA 4FBXA 5HX6A 5CVGA 4WD5A 3GOKA 1JSTA 1DAYA 1Q8WA 2IVSA 3LAUA 4FSMA 2ITUA 2IVTA 4MXYA 3WE4A 2I0VA 1Q3DA 2AC3A 5AR7A 3QGWA 3F5PA 2OJGA 4YZDA 2FB8A 3BI6A 5M4UA 3EFWA 3O2MA 3G6GA 2ZM3A 4ID7A 5L8LA 2B55A 4MXXA 5CXHA 1Q61A 4BTFA 4R78A 3LFFA 3RM7A 5CF5A 4B0GA 5HX8A 3Q4ZA 4OLIA 5A4QA 1WVXA 5IU2A 2WMBA 2X7OA 2CSNA 1BI7A 5K3YA 3V5WA 4H3PA 4FNXA 4EHEA 1PXNA 3GCUA 2OXXA 4PL5A 3UJGA 3VUKA 5KHWA 2XNPA 1YDRE 1PXIA 2W4KA 3R7IA 1ND4A 4BY9E 4AZVA 5BVNA 3DLZA 3LFSA 4YJSA 4QTEA 4FTAA 3RI1A 3F2NA 2ZVAA 4PDSA 4GK4A 2GHMA 4TZRA 3OY3A 4V0GA 2UV2A 2XK7A 4JRNA 4LFIA 2AUHA 3ZM9A 3BCEA 3P7AA 2BDWA 4DFBA 3O7LD 3NUAA 5EYKA 4FSYA 2F2CB 1Q8YA 3ZTXA 2QURA 3FMEA 3G2FA 3MGYA 4JT3A 4RFYA 4DEDA 2XJ0A 3QUPA 4O38A 4DN5A 1PXOA 2V55A 3FY2A 4FTUA 3N4UA 5HLWA 4L53A 4D58A 3IONA 4XG3A 4E5BA 5IDNA 4YLKA 4AFJA 3DK7A 3GGFA 4IEBA 4U5JA 4WIHA 4JAIA 2XB7A 3IOPA 5IDPA 3OTUA 4PTCA 3K5UA 2R3NA 2BAKA 3M2WA 3QCSA 4FT0A 3F3VA 4Z7HA 4V0GB 3FYJX 3E63A 3ORKA 4RFMA 3RK9A 4K33A 4DEHA 4O7YA 2W9ZB 5KMJA 3LMGA 3UIUA 3LMIA 3F7ZA 2HENA 1G5SA 2PZIA 3VUTA 1Q5KA 3I7BA 4CSVA 3D14A 4TWOA 3TKUA 4XG7A 4D0XA 5IH4A 2WMTA 4UN0C 2NNWB 5HVYA 2W5BA 4PY1A 3FQHA 1OUKA 4JDHA 1UKIA 4M69B 3PA5A 3ROYA 3HRBA 2UZNA 5CSHA 1FMOE 2VWUA 4NM7A 5EM5A 4E5WA 5KMLA 3GQIA 3U4UA 3PXFA 1RDQE 1UU8A 2B9JA 2HZIA 3ANRA 1GIIA 1OECA 5AADA 4EH6A 1REKA 4D9TA 2IN6A 3VULA 4D5KA 2R3FA 2JIIA 2QHMA 4GT4A 2IW9A 4RIYB 3I7CA 3PPZA 2Y9QA 2QCSA 1YXXA 2J9MA 3QTSA 1P2AA 5CWZA 5J95A 4DH1A 4E4NA 3MH0A 4D2RA 5CAVA 3Q04A 4G6OA 3FC1X 5CSVA 4QO9A 2X0GA 4XG4A 3AC4A 5CTPA 3A7GA 1M14A 2R5TA 3DA6A 3PP0A 4I0TA 3TTIA 3L9NA 3QQJA 3REPA 3W2PA 4TYEA 1JPAA 3LIJA 4F7JA 3NVMB 3LE6A 5AUTA 4PV0A 4OT5A 3VWAA 2HZNA 4X3FC 3DLSA 5JFSA 3QKKA 3NUSA 3FBVA 4CEGA 4FTIA 4HCVA 2OKRA 4RGJA 3A60A 5AEPA 4HVDA 3RKBA 5CF6A 1OITA 4XNEA 3ETAA 5I9UA 3DS6A 4PTGA 2A2AA 4PDOA 4N6ZA 4FEQA 5HEZA 4AGCA 5CALA 1J3HA 1H1SA 2PUPA 4MKCA 5E1EA 4HVHA 3QXPA 5EM6A 4RC2A 3OT3A 4RVTA 4C59A 5JH6A 1KE6A 2PVFA 2ONLA 3AC8A 4BTJA 2NO3A 3ALOA 5HVKA 1XR1A 5M51A 2X6DA 2PMLX 3K54A 4NJDA 4O7TA 2J0KA 5KX8A 4QYHA 4CG9A 3R63A 4P7EA 4WO5A 2J0MB 4DH7A 2RL5A 2CLQA 4O7NA 4R3RA 2J2IB 4FYNA 2OJFE 3EFLA 4F0FA 2E2BA 2YA9A 1W84A 1S9JA 4AWIA 3RPYA 3V5JA 4XOZA 5CSXA 5IZFA 3SGCA 5I9WA 3QUEA 3PWYA 2XS0A 3ERKA 5GJDA 1XQZA 2VAGA 1WBPA 2R3JA 3L9LA 4PL3A 2XZSA 2PY3A 2BRBA 4NKSA 4KS8A 3GEQA 4NUSA 4ACHA 4C35A 3TNIA 3AD5A 3QQLA 3QYZA 4KKGA 4CVAA 4TT7A 1YXVA 2WMXA 4S34A 4GKHA 4FT7A 3VS2A 2XM8A 2PPQA 3AGMA 3QQKA 2R3PA 1Z5MA 3R6XA 1QPEA 1NXKA 2H8HA 3KCFA 4A4OA 3I1AA 4NYEA 3BHYA 4QTAA 3GU8A 3H9OA 5HG5A 3CQWA 2NP8A 3UC4A 2XP2A 2QG7A 4ZJJA 5JZJA 5EQPA 3O17A 5CSPA 1Y91A 1YKRA 2QR8A 1H4LA 2QO7A 3EOCA 3OCTA 4O6EA 4HYSA 5CX9A 3UBDA 3E93A 2UZEA 4CLIA 3PE1A 4PPAA 1GNGA 5B0XA 1APME 4I5CA 2XNNA 4IM2A 2WTIA 3VF8A 3TL8A 2VN9A 3EN5A 5A4CA 4IC7A 3LPBA 2OF4A 3P79A 3TKHA 5CF4A 5CU0A 3EL7A 5IA1A 3FL4A 3QD0A 4ZTLA 3MY5A 2YM5A 3R7VA 2GS7A 4W9XA 4ZTMA 4C4JA 2PVJA 2CPKE 3C50A 3NRMA 3RWPA 4MBLA 2XH5A 2CKOA 3MPAA 3JUHA 3CJGA 3OG7A 3LFNA 3SW7A 3AT3A 3CTJA 5J9YA 5AA9A 4ACGA 4ZMEA 2C1BA 2E9VA 3I0OA 3IW8A 4PNIA 1VYWA 2WXVA 3QRIA 4HCUA 5M55A 1KOAA 4ASXA 4XV2A 4QMZA 5HE2A 4RC4A 2QOKA 3UTOA 3TNHA 1EH4A 4GYIA 3UOLA 1FVTA 2YM6A 4IC8A 4IADA 1YI3A 4NL0A 4GFGA 2XK8A 3BHUA 3V04A 4UMPA 4GK2A 4C33A 3MN3A 3CE3A 4FEUA 1I09A 1OVEA 3TV6A 3O7LB 2PK9A 3QGYA 3R9DA 4AN9A 4O82A 4D4VA 3KN6A 4FK3A 4UZDA 2A27A 3A8XA 5GIOE 4UYNA 5C8MA 3O8UA 3PUPA 2XKEA 5JEBA 3E3BX 3IGGA 2JFLA 2G15A 2EB3A 3D83A 1DI9A 2PL0A 3PIXA 4NH1A 4M3QA 1ZYDA 3SW4A 2Z7SA 4TKSA 4GJ3A 2XBJA 4K18A 5AR5A 2HIWA 3R7EA 3PFQA 1XWSA 2QQ7A 3V51A 5L2WA 3C51A 2P2HA 4L67A 1CKJA 4A9UA 2R3IA 2WTDA 2YIQA 4L7FA 4RMZA 2F4JA 3B8QA 4G3CA 5BQ0A 4I24A 3KKVA 3KN5A 2QNJA 2BPMA 1JAMA 3AMAA 3MA6A 3HLLA 4TYHB 3LZBA 4PPBA 2VWVA 3DBFA 4QMLA 4RJ6A 5DWRA 4ZSAA 1FGKA 3ZUVA 3RNYA 3S1HA 4EOMA 5FWKK 3DZQA 3HEGA 3LQ5A 4IX5A 4NW5A 2OW3A 4BWKA 3F5GA 4RZWA 4F7NA 4UMUA 4QYYA 4PMSA 4EH5A 2DUVA 4JNWA 3WYYA 1FOTA 2R3OA 3OF0A 4RWLA 1MRVA 4F6WA 4C4GA 2W1GA 3KU2A 4QP9A 3LQ3A 5LMKA 3K3IA 4X2GA 2ITPA 4RC3A 4YNEA 4FKTA 1JKLA 3W1FA 2YIXA 3BRBA 3NR9A 3CPCA 4MEDA 3SDJA 3ZZEA 4B7TA 3PXZA 3C4EA 4CXAA 5FTQA 2X4FA 4UYAA 4AZEA 2W9FB 3RAKA 3UYTA 3V3VA 2J90A 4AAAA 2DWBA 2UZTA 3QCYA 2F2UA 1IA9A 4QMOA 1OKZA 4UMRA 3FLNC 4I5HA 4HZRA 2GPHA 5G6VA 2FO0A 3E8DA 4LMUA 3OXZA 2ZDUA 1OKYA 5K4JA 3GB2A 5LARA 1KV2A 3NW6A 3AG9A 5FXSA 1BLXA 2UW9A 3W2OA 1SZMA 4EOPA 3RMFA 4EJ7A 1JKSA 2W5HA 4PNKA 2HZ4A 4MAOA 2W7XA 5A3XA 2XK3A 4FKUA 3Q96A 4YTFA 5HGIA 4CKJA 3R30A 2PSQA 3AMBA 3BU5A 4V01A 4JDKA 3WYXA 4CFVA 3FMMA 4DCAA 1H00A 4FV3A 3DQXA 4UMQA 3CIKA 3TNPC 4MWHA 2FH9A 3T9IA 2OIQA 2BR1A 2JIVA 3SOCA 3FZSA 4NIFA 2XEZA 3P7CA 3WF5A 4FKVA 2PYWA 5EQYA 4KIKB 4XS2A 2WGJA 5E91A 4AW2A 2B53A 2C3KA 3FMKA 3GU4A 4WG4A 4GIIA 1STCE 4MD7E 3UC3A 1W0XC 1H1WA 4FTCA 4OTGA 2FUMA 2KULA 2WQOA 3A7FA 3KFAA 3SAYA 3CS9A 3QRKA 1E9HA 4I6BA 3IGOA 3TNQB 3ZSGA 5BPYA 4TW9A 5F1ZA 4CFMA 4FF8A 3HAVA 4JG6A 2GNIA 4IE9A 4JQ7A 5J1VA 5L3AA 2PZPA 4CYIA 2WQBA 4O0RA 3TZ9A 3FZ1A 4DC2A 2YLEA 4FV7A 4RLLA 3F5XA 4TYJA 4FKWA 4USFA 3II5A 2VGOA 4NIFB 3R71A 2QU6A 3CCNA 1PYXA 1WBTA 4HVGA 2X9FA 2VTPA 3PTGA 4BDEA 3EZRA 5JFVA 2X8IA 1RQQA 2IW8A 5IA0A 4E6AA 3PJCA 3QC9A 3WF8A 5L6WL 3Q9XA 2JEDA 4RJ4A 3HUBA 4A9RA 1ZY4A 2GQGA 2ZM1A 1BI8A 4IJ9A 2YJSA 3JY0A 3VBQA 5LJJA 5FP6A 4F64A 1A48A 5ANJA 2P4IA 2WEVA 4IAZA 4BR3A 2ETMA 5CQWA 4HCTA 1V0BA 5AIRA 4NSTA 4GIHA 4CYJA 5HCZA 3BQCA 5HLPA 4GUBA 5FDPA 2JKOA 2J51A 2R0IA 2YM8A 4G3FA 1Y6BA 2W99B 3C4FA 4CTBA 3OUNB 4ACCA 5GIPE 2JLDA 2XF0A 4KUJA 1PW2A 5FTOA 3NAXA 1YWVA 4H36A 5KBQA 2H9VA 2F49A 4RIXB 5CAUA 1PMNA 2OK1A 1SVHA 4W4WA 3R8LA 1PKGA 4C3FA 5LVLA 5DOSA 4EH7A 2X6EA 4JBVA 3E7OA 4DBXA 4BCKA 3EN7A 4FICA 2B4SB 3GNIB 3HDNA 5HCXA 4U3ZA 5C9CA 5D7AA 3VBTA 5JQ8A 2EB2A 4M0YA 1K3AA 4A4XA 1OPJA 2WMQA 3LCDA 4FNYA 4O27B 5J7BA 4AP7A 1KWPA 4BGQA 5J5SA 3NZ0A 4UWCA 5K9IA 4RX8A 4JR3A 3TV4A 4G9CA 1FBNA 1JWHA 4QD6A 5AM7A 2B7AA 3UVPA 4ZXTA 1ZOGA 2X39A 2ZM4A 4FUYA 2UW0A 3H0YA 3NUUA 3CGOA 3PPKA 3QQUA 2PE2A 3CPBA 3EFKA 5HICA 3PVBA 4USEA 4DFLA 3CD8A 5JQ5A 4EOIA 2QOCA 3GT8A 5E90A 5BMMA 4AA5A 4FOBA 4DITA 3KXZA 4MXOA 4RX7A 2O8YA 3VS3A 5AP5A 3FE3A 4EH4A 5EHOA 4GFMA 2A1AB 3GCQA 4F0GA 5IUIA 2BRHA 3LKMA 2ZDTA 1CKPA 1XBAA 2I0YA 5AIKA 3VBXA 4U0IA 4PP7A 3U9NA 4ZY5A 5HI2A 1OBDA 1ZOHA 1GIJA 1MQBA 4IWOA 4OTWA 4EC9A 5AP4A 3GC8A 3SXSA 2HY81 4BDHA 4QMTA 3W55A 3EQHA 3DKFA 3GCPA 4C34A 2E9OA 3L8PA 3QU0A 4FKQA 2CMWA 3A99A 4S32A 4NEUA 1OL1A 4R77A 3RALA 2ZB0A 4WNPA 4X2NA 4KINA 4DCEA 1GOLA 5BYYA 3OD6X 4L44A 3L8SA 2PVHA 3OW3A 4N0SA 3TN8A 3V5PA 3WZJA 3IDPA 2XKDA 3MA3A 4J96A 5M44A 5BUIA 3DGKA 4D4RA 1UU3A 2JKQA 2XUUA 3QKMA 4AQCA 4BGHA 4BBMA 5AR3A 2AYPA 4HYHA 3RCDA 4BZOA 3HV5A 1VEBA 2NRUA 3E88A 3FMDA 3VUGA 1CTPE 3COHA 3F88A 4EHVA 2I1MA 5IA2A 2HXQA 3BGPA 2JAVA 4KABA 3IDCA 4O2ZA 4FV6A 3KRWA 1WVYA 5DPVA 2VWBA 4YJUA 2VX1A 5AV1A 4FKGA 4NFMA 4O0YA 4O7LA 2E9PA 4WKQA 5KMIA 3IKAA 3ORNA 2IJMA 4NM3A 3MH1A 4F70A 1XH7A 2OG8A 3KXHA 5ANOA 3R28A 2ZV7A 4KNBA 4QQCA 3NLBA 2PVNA 4IW0A 1J91A 3RBWA 5AX3A 2FA2A 4FSTA 3UMXA 2UVXA 3DU8A 3PXYA 4H1MA 3FPQA 3W32A 4ZZMA 4C0TA 5AUVA 4FEVA 1OPKA 1BKXA 2X2LA 3FAAA 4LGGA 3I5NA 5CS6A 5EDPA 5FD2A 1HCKA 3BYSA 3CTHA 1BL6A 5KMMA 3BYVA 4HYIA 2CKEA 4ZTQA 4IWPA 1NVQA 2R7BA 5HVJA 3LFQA 1HCLA 3VUMA 3MH3A 5AM6A 4AN2A 2PVMA 4MTAA 4EOQA 4FEWA 2CCIA 1WBVA 5IMXA 5AR4A 5I9VA 3RAWA 3I79A 4WUAA 1PMVA 3LCKA 3KMUA 3FXWA 4C2WA 3QRJA 4D2PA 5IA5A 2QKWB 2DQ7X 3BPRA 3MV5A 3F66A 1IA8A 4XG8A 3UIBA 3DJ5A 3OEZA 2BRGA 2X8EA 3NYNA 4APPA 3V5TA 1UNLA 3DZOA 1ZYJA 2VNWA 1ZZLA 1OL2A 4YZ9A 4AG8A 4C62A 5IQCA 4PMMA 4X3FB 5DLSA 3G6HA 1T46A 5HHWA 4PMPA 2LAVA 3W18A 4B4LA 1Q8ZA 3ZRMA 4E1ZA 3HAMA 3R9OA 4O0WA 2IWIA 4CZUA 4EUUA 3DV3A 2YFXA 2YN8A 4FGBA 4G9RA 3UQGA 3SV0A 3ZBFA 3PDTA 3HMNA 1VJYA 3MB7A 3NWWA 1SNXA 1Z9XA 3HKOA 2XEYA 4ZJIA 2EXMA 2YHVA 3QC4A 5HE0A 3U6HA 4NCTA 3D2IA 3CBLA 2UZLA 3GU6A 3FXZA 4FC0A 3VF9A 2WQMA 3BEGA 4EOJA 3BX5A 5AP3A 1M2QA 3ZONA 3SOAA 4UALA 2YCSA 4DGNA 1B6CB 3NIZA 4M68A 5D41A 4EUTA 5IQEA 3LCOA 4PP9A 4QQ5A 3RK7A 1UVRA 3F82A 3HRFA 2VTTA 3TV7A 4F65A 3C5IA 2GNHA 4IB3A 2BRMA 3KRLA 2JDVA 2R3MA 3DT1A 3MTFA 3QUDA 4IX3A 2HW7A 2GDOA 4KBKA 3UP2A 3ZLWA 3ORTA 3B8RA 5BYLA 2ACXA 3POZA 1JBPE 2WTCA 2YIWA 3FDNA 4EJNA 3NW5A 4FZ6A 4GVAA 5A9UA 3VO3A 3OMVA 2BAJA 5J87A 2C0TA 3KGAA 2YACA 1PXPA 3PVUA 1YWRA 2C68A 4B9DA 4RBLA 4XBUA 3E8EA 4IM0A 4DEEA 3DCVA 1IG1A 3QQHA 4RG0A 4N4SA 5HIDA 4JR7A 4XOYA 3MPMA 3R22A 4E93A 1R3CA 3OCSA 4DG2E 4QPAA 2XIRA 3H30A 3BZ3A 1PY5A 3LXLA 1M2RA 5J7HA 2C6KA 3F6XA 3RPVA 1ZYSA 2A0CX 5TE0A 5LXMA 4J1RA 2PUUA 4AW1A 3QX4A 4BZNA 3EZVA 3VBWA 4O22A 3G0FA 2X9EA 3DDPA 3GU5A 3PJ8A 2XYUA 2VTSA 4F1TA 4LI5A 1SMHA 4MYGA 4FIIA 3MWUA 4I6FA 3ATSA 5CT7A 4MBIA 3CY3A 1YI4A 4R3CA 3MVJA 4MF1A 3GENA 5DEYA 4YO4A 4ZEGA 2WTKC 4PTEA 3AGLA 4IQ6A 4CKRA 4JJRA 4EK6A 4PF4A 3BU6A 4IBMA 1DM2A 1X8BA 3L8XA 3KB7A 1TQMA 3QD2B 5G1XA 3DFAA 2WAJA 5EI8A 3Q32A 2W06A 4FVQA 1Q4LA 3BIZA 3LCSA 2CGVA 4NJ3A 5AV0A 2XKCA 5DR6A 4RWIA 3QHRA 3SD0A 5E1SA 3RM6A 4WT6A 5EDRA 4AFEA 3F3UA 3DAKA 4W8DA 2HXLA 5AP1A 5DI1A 3QLFA 4O84A 2VTMA 4RA4A 4QQTA 4EQMA 3ZOSA 3QAME 3S2PA 4X2JA 3ODZX 1OB3A 2C6MA 3S4QA 4DE4A 5AX9A 1Q8UA 3KREA 3C7QA 3PY3A 2IZTA 3AD6A 3TI1A 4QP7A 1OIUA 1OUYA 1PXKA 4QNYA 5FBNC 3VS1A 1DS5A 3OWPA 3BBWA 2V5QA 4FTOA 4ANSA 4DTAA 4F99A 3WI6A 5CAPA 3SG8A 3FKNA 2O64A 2OSCA 4F1OA 2Q83A 5BVEA 2QLUA 3D7ZA 4FKPA 4GVJA 4G6NA 4IVBA 4P4CA 4BTKA 5CXZA 3A7JA 5C4LA 4YHTA 4L68A 2BTSA 4RJ7A 4U40A 5C1QB 5AV4A 5JFWA 1QL6A 4C02A 5ETIA 3VQUA 2JDRA 4L3JA 2VO0A 4ENXA 3QCXA 4GUEA 4KS7A 3AC1A 2C69A 4QYGA 4YPDA 5FBOA 4C4FA 5KMKA 1JVPP 4ZY4A 3BHHA 1URCA 4LOQA 4O7WA 2VX0A 2UVYA 1JKTA 3VRYA 3MYGA 4L43A 5E8ZA 5AWMA 4MBJA 3L9PA 4M69A 4WNOA 1MRYA 2QOHA 2FYSA 4OBOA 3RAIA 4O86A 5IQBA 2X8DA 3OOMA 3KK8A 4ONAA 3CJFA 3NCZA 3AMYA 4I93A 4FV9A 4U80A 5CAQA 4CKIA 4IH8A 1K9AA 4IXPA 3DB8A 1FMKA 4L46A 5KKRC 4CCBA 5D11A 4RQKA 4RIYA 2C5VA 3FJQE 4ZTNA 3OVVA 2IZUA 1CMKE 4NKAA 1FVRA 1QMZA 3V8TA 5KZIA 5I3RA 4S2ZA 2ETKA 1ZLTA 4DFZE 4E4MA 3CQUA 5EI6A 1PRYA 2RFNA 3OC1A 3D5UA 5E8VA 2C5YA 3A62A 1PJKA 1WZYA 4WUNA 4UMTA 2C47A 5FEEA 2H96A 5DYJA 3RGFA 5CLPA 1WMKA 5CNNA 1V0OA 4U45A 2HY0A 4YJQA 1L3RE 5ANEA 3WF9A 2QG5A 3NX8A 4ALVA 5AAGA 4L6QA 3U8WA 5IH5A 4IAFA 4USDA 4A9TA 4D2SA 4TYIA 4FV1A 5CQUA 4OT6A 5HCYA 4F6SA 4I23A 3DXNA 3R02A 3VHEA 2EVAA 4NW6A 1ZZ2A 4P90A 2CJMA 5LVMA 5HORA 5CAOA 5DA3A 3CSVA 4HPUE 4QMYA 5IKWA 4E20A 5ANDA 4BGGA 2XBAA 3VHKA 4BDAA 4RX5A 5IF1A 5ETCA 3OXIA 3KXGA 5IMEA 4R3PA 2XNMA 2YIRA 1YHVA 3COIA 4LUEA 4F9AA 3KEXA 4FV4A 3QF9A 1WFCA 4H1JA 2BRNA 4WOVA 5TT7A 3DXPA 5B7VA 3IW4A 3I5ZA 2VWXA 1KE8A 3QTZA 2XJ1A 2YDKA 1U5QA 4EORA 4Q9ZA 4FGRA 3MVLA 4BWXA 4ZZOA 3O50A 4Z16A 3QA0A 2GS2A 5JSMA 3D15A 1NW1A 3F7WA 4HGTA 4BCGA 3C0HA 5FM2A 3QTRA 1PXMA 4I94A 4RWKA 5HBJA 5EYMA 3IS5A 3Q6WA 4J53A 4JBPA 5M08A 1VR2A 3U4WA 4J99A 3C0IA 3D5WA 4O83A 2DS1A 4BF2A 1FPUA 4OTFA 2VTJA 3RINA 5IQDA 5I3OA 4FZFB 3KMMA 4ZAUA 3PVGA 4AOIA 3TEIA 4XLIA 3Q4UA 1ZY5A 3UZPA 4DH5A 4TWPA 4JDIA 3FEGA 4JX3A 2VD5A 1WBOA 4FSUA 4JXFA 4M0ZA 3RHXA 3FI4A 3GCSA 3R7GA 4XG2A 3KVWA 5DIAA 4EH9A 5A6OA 3VS6A 1KOBA 4DLJA 5M09A 2BZJA 3EKKA 3L1SA 2YJRA 4DHFA 1GZNA 3NNWA 2C6LA 4IX4A 1HOWA 3QD4A 1UNGA 2W1EA 4MK0A 4O0VA 4CNHA 3PIYA 5BMSA 3T3VA 1NY3A 4L45A 5D7VA 3ZEPA 1WAKA 4EH8A 4EONA 1RE8A 2W1DA 2YM7A 4FT9A 4QMSA 4YHJA 4CFNA 4FNWA 5HTCA 2P0CA 2Y0AA 3OWJA 3Q52A 3UYSA 3DNEA 4MQ2A 3AT4A 2UZWE 3DKOA 3JXWA 3DB6A 4QMPA 3TKIA 4XG9A 5EH0A 4JAJA 1OL6A 3COKA 3D4QA 2HK5A 3EHAA 2ETRA 4M14A 4M13A 4E5AX 3GVUA 5T6KA 4BIEA 4FKSA 4ASZA 1J1CA 3P5KA 4IB0A 3ZUTA 4FIEA 2SRCA 3F3ZA 4OTQA 3NUXA 3D7TB 4UXQA 4DG3E 4NFNA 3MFUA 4AU8A 5HZNA 5LCJA 2OWBA 5HG8A 4C4HA 3LM0A 3FI8A 3QTQA 5CU2A 3M1SA 4HNIA 5HIEA 3DOGA 5CVHA 5D9HA 4BDFA 3U87A 3BLQA 2JGZA 4E6QA 3PXRA 3FLYA 4RIWA 3HUCA 3D0EA 2JBOA 1GY3A 3TDWA 5E8XA 5JK3A 3VW6A 3NMUF 5E8SA 2Y4IC 3FZRA 3OHTA 4E8AA 4J7BA 1TKIA 3P4KA 4XX9A 3FI2A 4TYHA 2G2HA 3EKNA 2YWPA 2IVVA 4FUXA 5AMNA 3CGFA 4TPTA 5EFQA 4C4IA 4IM3A 5LVPA 4FKLA 4LV5A 4BB4A 4F63A 1I44A 2C6DA 4EKLA 4QMQA 2NRYA 2I0HA 3QQFA 2YABA 4FTNA 2W17A 3LM5A 4GG5A 4X6QC 5CEOA 3DBEA 1YRPA 5IISA 2OO8X 4RIWB 4EOOA 5BUJA 4FG9A 1SYKA 3VS5A 3OUKA 2B52A 2X1NA 3AC2A 4L01A 5E8UA 4O21A 3IW7A 5H8EA 4QP2A 3TACA 4BCMA 1H1QA 1BMKA 1PF8A 3TTJA 2ERZE 4TTHB 3E3PA 3Q4TA 4NT4A 1BYGA 4X3JA 2XNOA 5FEDA 3RP9A 3ZLXA 3ZRKA 3HNGA 4CFXA 4D2WA 4U43A 2WEIA 4I3ZA 2YLFA 1PHKA 5HO8A 4EEVA 2BDFA 4FKOA 1LEWA 5ANGA 4E4LA 3LFDA 4J97A 3UNJA 3EH9A 4MF0A 3ZC6A 3VUHA 4YBJA 4FG7A 4BDGA 4B6LA 3ZSHA 4C61A 4U79A 3HDMA 3TIZA 3HA6A 3DJ7A 4JRVA 4TXCA 4PDYA 3EYGA 4E7WA 4UZHA 4WSYA 4EK5A 3RCJA 4BC6A 3MFSA 3AD4A 4IFCA 2BROA 2OZOA 4XP3A 5JRSA 2EXEA 3WBLA 4B8MA 3QALE 5IEXA 4ZTRA 1KUTA 2VV9A 4F9BA 4Q5EA 1H0VA 4Q9SA 1QPDA 4XLVA 5DVRA 4ZJVA 2UW3A 4IAYA 1LEZA 4F9WA 5KHXA 5DEWA 3W2RA 3GC9A 4XBRA 3CY2A 4I6HA 1FVVA 3COMA 5GINE 4FL3A 3ZS5A 3TG1A 2I40A 4K8AA 4AZFA 4FTKA 4AW0A 2QOOA 5DRBA 3PWDA 5AUXA 2C6EA 1KE5A 3K2LA 2WELA 4Z9LA 4H58A 4YJOA 2BHEA 3FXXA 3GP0A 3MY0A 4OBQA 5BVWA 4G3DA 3OWKA 3BELA 3EN6A 2QKRA 4BKZA 3E8NA 3BLHA 4ZY6A 3WOWA 3DAJA 2PVLA 2OFUA 1H27A 4M97A 5HU9A 3UG2A 5L8KA 4U7ZA 4HGEA 4IDVA 5AUYA 1LR4A 3ZO1A 4S31A 4F7SA 4QP6A 2V7AA 4KIOA 3PXQA 2V7OA 4OAUC 1OGUA 2Y4PA 3MPTA 5DBXA 3RPRA 4KIKA 4AGWA 4C3PA 4E4XA 4DGMA 3N4TA 3FMNA 1H8FA 1UU7A 4K0YA 5DN3A 1JKKA 1H07A 5I4NA 3GCVA 1LP4A 4UV0A 3FPMA 3HVCA 5HKMA 3IQ7A 4ASDA 3TJDA 4FYOA 2XMYA 4OTRA 3ZSIA 2XNEA 5D1JA 3KULA 3LMHA 2W1HA 4XRLA 4FIGA 2HCKA 3EN9A 4ASEA 3CLYA 4I92A 4KIQA 3GI3A 4FV5A 4D28A 3FHRA 4MX9A 4FTMA 3WIGA 4M84A 2Z8CA 4L00A 1E1XA 3Q2MA 2WZJA 2P33A 3SRVB 3AXWA 2GHGA 3Q53A 2XM9A 1OPLA 1ZXEA 4FTRA 4JIAA 4R7HA 5CY3A 4QP1A 4EBWA 2WO6A 2UW7A 3ORXA 1WBWA 1XBCA 4ZS4A 3DAEA 3G90X 4RPVA 2JITA 4RZVA 5BNJA 4BFMA 3EL8A 3ZFYA 4Y46A 1T45A 3KULB 4YC8A 2PULA 2EU9A 2WMRA 4C4EA 5D10A 4R1YA 5HQ0A 3FY0A 3R01A 3GBZA 4OTPA 2VO7A 1ERKA 4Y85A 5AR8A 4YC6A 2QVSE 3V8SA 4EZ3A 4BHNA 1R0PA 2IZRA 2GTNA 2VTLA 2WMVA 3BGQA 1GZ8A 3R04A 3ULIA 1H24A 4U97A 1ZMWA 5HBEA 3W16A 1IAHA 3MFTA 4JDJA 2C0OA 4O96A 5B2LA 5HG9A 2PU8A 3TZ7A 2OI4X 3UZTA 2FSMX 3F3TA 3BGZA 3WZEA 2R4BA 4BKYA 2CKQA 2UUEA 4GEOA 4F1MA 2NPQA 4N70A 3PIZA 1IEPA 4RIXA 5TR6A 1SM2A 4D1XA 3GC7A 4DEBA 3KL8A 2Q0NA 4E6CA 4V04A 3R21A 4CTCA 2QOIA 3OY1A 2GQRA 3LFEA 3LJ0A 4AT4A 3CQEA 1J1BA 3I6UA 4WSQA 5DT3A 5C27A 4FZDB 5TF9A 1KSWA 4XP2A 3EIDA 3WZUA 4W9WA 4IMYA 3ZDIA 3UOJA 3R1NA 4XCUA 4DLIA 3W33A 1YQJA 1OIYA 2XA4A 5GJFA 1RJBA 4GH2A 1GZKA 1UA2A 3R7YA 4OUCA 2R3GA 2RFSA 5HE3A 5EHLA 5C01A 2VUWA 3EQRA 1H1PA 5DG5A 1W82A 1OI9A 1A9UA 4FNZA 4U8ZA 5IUHA 3QWJA 4ANMA 3BWFA 4S33A 2F7XE 3WZKA 3UQFA 4ZSLA 2WOTA 2YDJA 4OW8A 3W2SA 3G33A 1ZARA 3H0ZA 2Z7LA 4LL5A 3HRCA 3P23A 5FG8A 2W1IA 3ZDUA 4BDKA 4J98A 4BCFA 2GMXA 2C30A 2JAMA 2WTKB 1CDKA 4DEIA 3NUYA 3EQGA 5IQHA 4JG8A 3O0GA 1OBGA 3HL7A 4IWDA 3ORLA 3RPSA 4QRCA 3MH2A 3HGKA 5KNJA 4DGLC 4LRKA 3KRRA 3SQQA 3NAYA 4Z3VA 2UZOA 4AOTA 2VO6A 1UU9A 2J5EA 4FZ7A 4JQ8A 3ZLYA 4RJ5A 4O7SA 4DT8A 3C4XA 3OBGA 3C4CA 4IZ5A 4I41A 5KMOA 4IZYA 4Y83A 5F4NA 2R3KA 3DFCB 3R1YA 4EK3A 2R0UA 3PYYA 4O2PA 4FT5A 2JBPA 3ITZA 5JZNA 4D1SA 3JS2A 3PA3A 3WF6A 4MVFA 4QMXA 4MD8E 1KV1A 5DFPA 4M67A 3UMWA 3BU3A 4L3LA 4X7QA 4NK9A 1BL7A 2WMAA 3G51A 3HYHA 4IHPA 4XUFA 3HP5A 4FKJA 2PVRA 4DF3A 5BYZA 4RWJA 1Q8TA 2W1ZA 2VTNA 4KA3A 3BYUA 3MW1A 4YR8A 3NVKI 2HWPA 3QX2A 4GU6A 2JIUA 3NUNA 1A06A 2WMUA 3NNUA 4MH7A 5IA3A 3V8WA 2Y6OA 2EXCX 5H3QA 3BE9A 3UE4A 3OTVA 5HE1A 4OAVB 4KBCA 4AZWA 2YERA 2RF9A 3HA8A 2GHLA 5CEQA 4C36A 2ESMA 1B38A 1P5EA 2CGUA 4QMVA 4CCUA 4EQUA 3TM0A 2VTRA 2ZV9A 2HELA 1TVOA 4QMWA 2YDIA 4RVKA 3PSDA 5HNGA 2QC6A 4EK4A 4IVCA 3VIDA 1JNKA 2O3PA 4CRLA 1P4OA 3UIMA 3CKXA 3HMOA 3ZU7A 3BV2A 3EN4A 3ID6C 1E1VA 3RPOA 4WNKA 4QP8A 3KXXA 3QRTA 4XP0A 4CMTA 5BUEA 3DXQA 3KK9A 5EK7A 2CNUA 3U51A 4O7ZA 2QU5A 3VS0A 1YHSA 5BVKA 1TQPA 4LGDA 5M57A 2J50A 2O5KA 4DAWA 5E9EA 4D9UA 3VN9A 4YUQA 4RT7A 2VTOA 4ORKA 2PZRA 3QXOA 5KKRB 5J79A 4FI1A 4O1PA 1QCFA 3R83A 5E92A 2R3QA 3Q9WA 4IAAA 5DT4A 4F09A 4B8LA 3VVHA 4PL4A 1AD5A 1O6KA 2WOUA 3D94A 3QTUA 3SA0A 1XH9A 5H9BA 4GG7A 3TT0A 2Y8OA 3UO5A 4OR5A 4QYEA 3CD3A 2FSOX 2V22A 2WFYA 1JOWB 4S30A 1QPCA 3KY2A 2W0JA 1ZYLA 4ALWA 5HIBA 4EC8A 3GXLA 3R00A 5M07A 4TL0A 4I20A 5A4EA 2PVKA 4CFWA 5HU3A 4APCA 4PMTA 2VWIA 4LRJA 4UWBA 4BBEA 4X3FA 4YMJA 1W8CA 3A7HA 3ZH8A 4CMOA 1WBNA 3QTWA 1YVJA 4EOSA 4ANLA 3P7BA 3Q3BA 4FL2A 5DE2A 3ZXZA 2PWLA 3L8VA 3PP1A 3OW4A 2V62A 3QQGA 3EQCA 2CN8A 3OROA 3OP5A 4G31A 3SX9A 4C38A 4QNAA 4EHGA 2WIPA 3OOGA 3ZO2A 4YLLA 2XNGA 5FXQA 2BMCA 5A46A 2YCRA 4BYJA 5EOBA 4Y72A 3LFBA 3PA4A 4EQCA 2OJ9A 1Y57A 3IPHA 3ACKA 3PJ2A 5DH3A 3OFMA 3S95A 4DFNA 4BDDA 3QYWA 3M11A 4DEGA 4EK8A 2G2FA 3KRJA 3U54A 4YJTA 4KWPA 3W10A 4FV2A 2BUJA 3HMIA 2ZV8A 3UQCA 4D1ZA 2ITYA 3FKOA 2X7GA 4KKHA 2G1TA 2YCFA 3BQRA 2QI8A 2B54A 2GFSA 4FSRA 3P1AA 3TDVA 4G1WA 4F6UA 3GFWA 4C58A 1R39A 2BILB 4TYGA 2OZAA 4AGDA 5M4IA 3LFCA 3KC3A 4UBAA 2C6OA 5CYIA 4BVUA 4RJ8A 1O9UA 4Y5HA 3IOKA 4E6DA 4MCVA 5CEMA 3HX4A 4ITJA 1F5QA 4K77A 2WIHA 5LCKA 2XK4A 3TZMA 3VUIA 4BI1A 3EQPA 3MSSA 4UB7A 3PSBA 5DRDA 3SHEA 4QTCA 2PTKA 3P08A 3WILA 1PMUA 2JDOA 3QHWA 1YXTA 4YTHA 3TWJA 5A4LA 3POOA 4PQNA 1ZOEA 4NTSA 3ORMA 3UODA 3N4VA 2OH0E 1Q24A 4FG8A 2OZAB 3EQFA 5F20A 1K2PA 4J8MA 4AGUA 5KE0A 3VQHA 4MQ1A 4WG5A 5CEIA 3PZHA 3UGCA 1OKVA 3DKCA 3IW6A 4YJNA 5IEYA 3BHVA 1R78A 2BDJA 3KMWA 4MXCA 3H3CA 5L2SA 4IFGA 3U6IA 4O81A 2XK6A 3MVMA 1V1KA 4FIHA 4NM5A 4PRJA 2VO3A 3R8VA 2IO6A 3JVRA 4FSWA 2ERKA 3MS9A 2OXYA 3U9CA 1GAGA 3ZO4A 3AT2A 4GMYA 3FUPA 3MBLA 3NGAA 2GSFA 4OTHA 4A4LA 4GS6A 2IVUA 1XHAA 4AS0A 4EH2A 5L2IA 4YGAA 5C03A 2AC5A 4C37A 2BZIB 4BRXA 4CZTA 3M42A 5EQEA 5EW3A 5JT2A 2GU8A 4BCNA 4BCIA 1O6YA 4P5ZA 3PY1A 4JVGA 5J8IA 3HMPA 5TOZA 3UPZA 5A14A 4LOPA 4JBOA 3D5XA 4CT1A 1OZ1A 3VRZA 4EWQA 5ACBC 5DNRA 5AUWA 4AZTA 4ANOA 4XYFA 3H9FA 3QBNA 3R2BA 3TCPA 4BDBA 3FSFA 4YPSA 5L2TA 5HOAA 2C5NA 4WRSA 3OEFX 3BEAA 4K6ZA 4X6RA 1BUHA 5I5ZA 4I5MA 4C2VA 2BKKA 3DNDA 1ZWSA 2BVAA 4YJRA 3BV3A 3E87A 5CSWA 2BAQA 3VS4A 3ZUUA 2Y4IB 4X0MA 4ANQA 1CSNA 5HO6A 3FQSA 4YSMA 4YHFA 3HV6A 1U54B 3ALNA 4BL1A 3R1SA 3E5AA 4YNOA 1OMWA 3PJ1A 4EKKA 4FKIA 2G2IA 2J5FA 3HMMA 4P2KA 4EYMA 4CV8A 5LMAA 5KUPA 3AC3A 4ZZNA 2QLQA 2BZKB 4Y95A 2JDTA 3GC0A 3ZYAA 3E8CA 4I0RA 5C8NA 1NT2A 3R9NA 4GT5A 2HWOA 4G3EA 2BIYA 1YOJA 2I0EA 4J71A 5L6OA 1IRKA 3BWJA 3ZC5A 2UZVA 2REIA 4YSJA 3OCGA 4DYMA 4EOKA 3QZHA 4FVRA 2GS6A 4CFUA 4R5SA 5E8TA 2OICA 4ACDA 3MJ2A 5CI6A 2BKZA 2VWWA 3NSZA 4PUZA 2X2MA 4M7IA 4J95A 1Y8GA 5CU4A 3UPXA 2GNLA 4ZIMA 5L6PA 3KA0A 4DBNA 5IQAA 1H25A 2QOQA 4KRDA 4ZS0A 5JRQA 2B0QA 3ZCLA 2QOFA 3ZMMA 4QYFA 5CEPA 3ORZA 3ZM4A 2BFYA 2JDSA 4BDIA 2A19B 3ODYX 3HECA 1YW2A 4F08A 3P78A 4KB8A 3ZEWA 3I6WA 2YIYA 4F9CA 5JGBA 1G8AA 4Z7GA 2ITTA 4CLJA 3QZFA 2ZMCA 1XBBA 3IECA 3H10A 4LL0A 4RJ3A 3EWHA 3LFAA 4JOAA 3VC4A 1GJOA 3O8TA 4D0WA 2GQSA 5BVFA 3FLSA 3KCKA 1PMEA 2HYYA 3QZIA 5HESA 4BDJA 4D4SA 4G5JA 4A7CA 2ZMDA 3R8UA 2CGWA 3CXWA 1AQ1A 3ZBXA 3LVPA 2YM4A 3MB6A 1YDTE 1YXUA 3CR0A 4M8TA 4N6YA 3DKGA 4ERKA 4EZ5A 4D2TA 3ACJA 5HD7A 4DTKA 3GQLA 4BTMA 3F2RA 2WMSA 1M17A 3FZTA 3KF4A 3QTIA 4HJOA 4C8BA 5A4TA 1XJDA 2JKKA 4O0UA 1PXLA 4HW7A 4H3QA 5KMNA 3V5QA 3VBYA 3T9TA 4L8MA 4UEUA 2W4JA 2YZAA 4A9SA 4LQMA 3DTWA 5AR2A 2OU7A 3VS7A 2P3GX 4HOKA 4ZSGA 5CT0A 4DFXE 4MXZA 2F9GA 5F9EA 4G34A 1BX6A 4HYUA 4ZSEA 5DR2A 4RVMA 3UNKA 4XJ0A 5LVNA 2VWZA 3C13A 4M15A 3W2QA 3OCBA 5L2QA 4BCJA 3Q9YA 4AE6A 3ROCA 4CGAA 4BZDA 2YCQA 2UVZA 1R1WA 3MIYA 5H2UA 5T68A 3ORIA 4EOLA 4RIOA 5JMSA 2WU6A 3JYAA 4G17A 1LUFA 4V05A 4FTTA 4FTLA 3ZFXA 5KCVA 2W4OA 4W8EA 4N57A 4XEYA 5FXRA 3SC1A 5K0KA 3LLTA 3C9WA 4IB1A 2VTQA 4PDPA 2RG5A 2CLXA 4XMOA 3C5UA 2QODA 5A6NA 4L3PA 4XV9A 3ZZWA 2PUNA 2YAKA 4NM0A 5FRIA 4AN3A 1ZAOA 2XIKA 5TKDA 3Q2JA 5J1WA 2F7ZE 4I6QA 5E4HA 4QMNA 5AAEA 4GL9A 2O63A 2C6IA 5K4IA 5C4KA 1JSVA 2B9FA 3DDQA 4IACA 2FSLX 5GZAA 1JLUE 4O91A 4RFZA 1U59A 5EDQA 2YZLA 4P5QA 3PXKA 3B2WA 3OZ6A 4YTIA 4FV8A 2EUFB 4NWMA 5E7RA 5EKNA 2I6LA 3RVGA 3BBTB 3SVVA 3HZTA 3HP2A 3EJ1A 3VW8A 5AFVA 4H05A 2R3LA 3R8ZA 4BICA 4E73A 2ITVA 3BHTA 4TWNA 4FL1A 4BI0A 4DEAA 3R9HA 4CMUA 3LOKA 3DQWA 4FR4A 4NCTC 4NTTA 5DT0A 3A2CA 4AT3A 4WG3A 5F95A 3SLSA 4JIKA 2X81A 5DR9A 3D7TA 1YWNA 4GJ2A 5AUZA 2XVDA 3RAHA 5ICPA 2W05A 4DFUA 1H0WA 3JVSA 2WNTA 3UO6A 2WU7A 1FINA 3FQEA 3V01A 3P0MA 1W98A 3EQDA 3H4JA 4G5PA 2HZ0A 3SXFA 4IZAA 3MVHA 5J9ZA 4BIBA 4X2FA 3CP9A 3F69A 3DBQA 2GNFA 4K1BA 4QP4A 5LWNA 4C57A 2E9NA 3JPVA 5L8JA 2E9UA 2GFCA 2OGVA 5AV2A 1J7UA 1GZOA 5HNIX 2R9SA 3GUBA 4BYIA 5B2MA 1XH5A 4QT1A 5AP7A 4H39A 4WBBB 4RX9A 3UVQA 4GU9A 3G9LX 5EI2A 4GSBA 2QR7A 2BCJA 2G9XA 3TIYA 2UW8A 3FLQA 3U6JA 3D9VA 4UX9A 3OBJA 4IVDA 2OFVA 1OIRA 4RVLA 2VU3A 4C7TA 3E62A 3LCTA 4U44A 4I4EA 1MRUA 2VWYA 3Q4CA 4FODA 4O0XA 4HVIA 1Q99A 4BKJA 2ZV2A 3V6RA 4GFOA 4LGHA 4D4YA 2X2KA 3DBCA 3H9RA 2RFEA 1SVEA 5LQFA 4XH6A 4RLKA 3PLAE 5JFXA 1Q97A 3IK3A 2GNJA 3OS3A 4XG6A 4O7RA 1R0EA 3VUDA 5EHYA 5EYCA 3UVRA 4IIRA 2UW4A 4ACMA 2Y6MA 4IDTA 2QHNA 4TWCA 4QPMA 3FMHA 4BI2A 3WF7A 3PE2A 3NUPA 4MD9E 4GK3A 3VBVA 1OM1A 3UDBA 2OIBA 2JC6A 3UIXA 4I1ZA 4YURA 3FKLA 1WVWA 4BCHA 3PG3A 4FSNA 4FMQA 5DMZA 4KSQA 2GNGA 4YJPA 2QOBA 3NEWA 4BCOA 3FV8A 2PHKA 5TO8A 3NYVA 3A4OX 3RNIA 4FSQA 2W1FA 3ET7A 3PRIA 3FZPA 3MTLA 4NZWB 5FGKA 2P2IA 2BTRA 3EFJA 4CFFA 1O6LA 4AW5A 3U55A 3FMLA 1PXJA 4OTIA 4RA5A 2GTMA 2UZUE 4E3CA 3MI9A 2DYLA 5LVOA 3DY7A 3I81A 5GJGA 4R7BA 3F61A 4W4VA 3C0GA 2YAAA 3TJCA 5AAFA 5L4QA 1B39A 5FM3A 4XRJA 5FLFA 5BVDA 4QOXA 4ENYA 3PRFA 4KIPA 2C1AA 2PMIA 2CGXA 2PMOX 2WB8A 4FIJA 4ERWA 1Y6AA 5I9XA 3PVWA 3K5VA 2UZDA 1F3MC 3ENMA 4F9YA 4I22A 3LJ1A 5FDXA 5F94A 4OGRA 5CEKA 4GKIA 2R7IA 1YDSE 1KE9A 3O8PA 2BHHA 1MQ4A 1Q62A 1FQ1B 2XKFA 3ELJA 4QMUA 4AUAA 2XCHA 2GCDA 4KAOA 3UOKA 2I7QA 4FSZA 4E26A 3DPKA 2ITOA 2O65A 3RK5A 2OBJA 5K5NA 3NCGA 1NA7A 3SRVA 2BIKB 3ZFMA 4O1OA 5IG1A 4LMNA 5K0XA 3G15A 1RW8A 4LRMA 4EL9A 3UZRA 2RSVA 3ORPA 4ZK5A 1YOLA 2OJIA 2O0UA 1W7HA 4AXAA 2YWVA 1G3NA 2PZ5A 4F4PA 1PYEA 5IA4A 1M7NA 4QQJA 2BALA 3R2YA 3ZHPC 5ITAA 4LM5A 4QTBA 5HTBA 4XV1A 4G3GA 4I21A 4BHZA 5IQGA 3SKCA 1Q41A 3OXTA 4I5PA 3SXRA 2IW6A 3VJOA 2WD1A 5IPJA 4GYGA 4L9IA 4LV8A 4ALUA 5FUTA 4DH3A 2QOLA 1AGWA 2WKMA 3FC2A 2LGCA 3FWQA 3KVXA 3PLSA 5EW8A 4GW8A 4BDCA 4QTDA 4UXLA 2Z60A 1H26A 3TUDA 4LYNA 3FMJA 4AF3A 2OXDA 3RZBA 5M4FA 1OKWA 3QFVA 2C4GA 3EQBA 4YU2A 3AQVA 4MNEA 4H3BA 3EQIA 5EYDA 3FLZA 3RWQA 4WBOA 2XRUA 5ETAA 3AOXA 2X7FA 4ITIA 3ZLSA 4AZSA 2FSTX 2XNBA 5FP5A 3B2TA 4MHAA 1PKDA 2JFMA 4BBFA 2PVYA 2KTYA 2R3RA 3IO7A 4FVPA 2CKPA 3NIEA 1YOMA 4L52A 1UNHA 4ANNA 4YZBA 5B2KA 1JQHA 3PJ3A 4KD1A 3GOPA 3ZO3A 4WHZA 2C6TA 4IB5A 4TN6A 4BIDA 3ENHA 4OBPA 4HVSA 3HV3A 3D5VA 3P86A 4DT9A 4FKRA 1ZMUA 5CI7A 2CHLA 3KRXA 2YEXA 4AT5A 2VZ6A 4MNEB 4U81A 4CZYB 4AE9A 3I4BA 5D12A 4Z55A 3P9JA 1WBSA 2CN5A 4LUDA 5EW9A 3GU7A 5FQDC 4MXAA 2ONLC 2XIZA 4J8NA 3DTCA 3A8WA 1MP8A 3RHKA 3TNWA 2RKUA 4KKEA 2J0LA 4LOOA 2QO9A 2VTHA 4DFYA 1IR3A 5H8GA 2BZHB 2VTAA 2PZYA 3LLAA 5LOHA 5IQFA 4IAIA 4XHKB 4KSPA 4R1VA 5IH6A 5C26A 1DAWA 5E8WA 1MUOA 3CTQA 1M7QA 4YZMA 3QLGA 3KF7A 3FYKX 4WRGA 5CANA 3PPJA 4GCJA 4HPTE 2C3JA 3UG1A 3QL8A 4AACA 3RZFA 4KBAA 3QZGA 3N9XA 4FIFA 3T8OA 4IJPA 3WE8A 4DGGA 1XH4A 3PG1A 4B99A 3TUCA 4CV9A 3V5LA 5I9ZA 2UW5A 3C4ZA 3OWLA 3RJCA 4X21A 3KQ7A 2A4LA 4A9YA 4BCPA 4J52A 4FT3A 1LPUA 3N51A 3S00A 4TRLA 3AC5A 3EB0A 4Q2AA 2IZSA 4JG7A 1G8SA 4DA5A 5DGZA 4GT3A 4FZAB 4R6VA 1UV5A 3NYXA 3FLWA 4OTDA 3CKWA 4DINA 5CU3A 5I9YA 2UW6A 1IASA 4ZMFA 4M66A 5HNBA 1CM8A 3W8QA 5M06A 2Z2WA 3IW5A 4ZTSA 2ZB1A 3UO4A 3T3UA 4RSSA 5CNOA 3MFRA 3VNTA 4RQVA 3BLRA 3UP7A 4IX6A 3HV7A 3W2CA 3LW0A 5FTGA 1NVRA 4BWPA 3QRUA 1SVGA 1H01A 3LQ8A 4JLCA 3E64A 4PWNA 4TNDA 4F0IA 3I60A 4L42A 2P55A 3OT8A 4K11A 4Y73A 5AP6A
chains in the Genus database with same CATH superfamily
5K5XA 2F57A 2Q0BA 2VNYA 3PY0A 4IZ7A 2F7EE 3O71A 2XK9A 3BYOA 5HD4A 2OF2A 4K2RA 5AP2A 2J0JA 1J7LA 3G0EA 2XIYA 4FOCA 4O6LA 4QMMA 5JN2A 2X4ZA 5HBHA 4JS8A 3HV4A 1XO2B 3PZEA 2Z02A 3VJNA 2ZYBA 2J6MA 4AA4A 1M52A 4DG0E 5M53A 2X0PA 2CNVA 2JKMA 1H08A 4ZOGA 2HAKA 4I4FA 4G6LA 5I0BA 4A06A 4YZCA 5LWMA 4CT2A 4JBQA 4FEXA 4CRSA 1NVSA 4TNBA 2CNQA 5LMBA 3VAPA 2UZBA 3UOHA 5AJQA 4D55A 4EH3A 3CEKA 5CASA 4CG8A 4G2FA 4O0SA 5IUGA 2C5XA 4O0TA 2XRWA 1UWJA 3Q60A 4YJVA 4IAKA 2CCHA 5ACKA 4AA0A 3NW7A 4JQEA 4PPCA 1XMMA 3FI3A 5BX0A 1UWHA 1REJA 3O23A 3Q5ZA 1UKHA 3F9NA 4I0SA 2YM3A 4K9YA 4FX3A 5T3QA 5CZIA 3LXPA 1ATPE 5ANIA 2R3HA 3A4PA 4FV0A 1ZMVA 4II5A 3IDBA 3IG7A 5GNKA 3F2AA 3D2KA 4FA2A 2J4ZA 3BE2A 5EG3A 3L9MA 4ZLYA 2XYNA 3R7UA 4U3YA 2Y7JA 3ZXTA 1U4DA 1XH6A 4EWHA 4ZLZA 5CVFA 1H1RA 2R64A 2J7TA 3NNXA 4KRCA 5KO1A 3JR1A 2RIOA 4WNMA 2PUIA 3WZDA 4YC3A 1XH8A 4FTQA 2ITQA 2WQNA 4QP3A 5CENA 3SG9A 3R7OA 3DBDA 4JI9A 1XMLA 3DK6A 5GZ8A 2ZOQA 5EM7A 2XCKA 2FGIA 4YLJA 2YITA 3FHIA 3P5JC 3R9RA 4GV1A 4U42A 3KXMA 1F0QA 5AA8A 4BCQA 4YP8A 3NYOA 1VZOA 3FSKA 3CC6A 3THBA 3UNZA 2J0IA 3R1QA 4GRBA 5LMKC 4UY9A 4EZ7A 4ARKA 2B9HA 3Q6UA 4YTCA 4R5YA 2WHBA 2EWAA 4Y8DA 4CQEA 4QPSA 2RG6A 4R7IA 2G01A 1L8TA 3E92A 4JL9A 2ITWA 3FZOA 5GHVA 4IANA 4JX7A 3QD3A 2YISA 3NS9A 3V6SA 2JD5A 3JY9A 3NNVA 2ITNA 5IEVA 2H34A 2W1CA 3KXNA 4U41A 2VRXA 3LXKA 3F3WA 5C8KA 4IWQA 4HGLA 2IG7A 4ZSJA 2V0DA 5BVOA 1DI8A 4R8QA 5ANKA 2XJ2A 4NU1A 4EBVA 3C4WA 5EM8A 2CDZA 5HTIA 4U9AA 3R8MA 4DH8A 1U46A 4Y5QA 3LHJA 3MESA 1OIQA 3C1XA 3WIKA 5JGAA 4DTBA 4FK6A 4FTJA 3KIOC 1SNUA 4HZSA 4EYJA 2WTJA 1FGIA 3MDYA 4YO6A 5J5TA 2QO2A 2WPAA 5DHJA 1P14A 5ETFA 3O51A 3LXNA 3O96A 3TZ8A 5CZHA 4G16A 2WMWA 3TMOA 2C0IA 5CF8A 1J7IA 1M2PA 3EYHA 3K3JA 4HNFA 5CU6A 5AUUA 2QONA 2VX3A 2QD9A 2OJJA 2HW6A 3MY1A 1W83A 4DGOA 5HLNA 5JKGA 1KE7A 1URWA 3Q5IA 1CKIA 2C3IB 3G9NA 4ANBA 5EOLA 3ULZA 5JGDA 1U5RA 2XIXA 1YHWA 1JSUA 1WCCA 5FEQA 1VLRA 1OL5A 4FE2A 2WTVA 3RTPA 5AV3A 2Z7RA 5HO7A 1XKKA 2OLCA 3TXOA 5EKOA 1IAJA 3ANQA 3DJ6A 4TY1A 4M12A 4YZNA 2IPXA 1ZRZA 2PMNX 2BFXA 3DK3A 4O7VA 3BLAA 3ZRLA 2ITXA 4YBKA 1TQIA 2VGPA 5A54A 2WQEA 1Z57A 4WA9A 1GIHA 1OL7A 5KZ0A 4C3RA 1YI6A 3W8LA 1G8KA 2OH4A 3GFEA 2OIDA 4MNFA 2O2UA 2VTIA 3A61A 5AP0A 1OGYA 3QA8A 2W5AA 4ITHA 3S3IA 4XV3A 1ZYCA 1Y8YA 1S9IA 3G5DA 3MJ1A 3QKLA 4EHZA 2WTWA 4CD0A 3R73A 4IVAA 4D5HA 3TYKA 3FL5A 4BN1A 2ITZA 3NDMA 3ATTA 3BKBA 2C5OA 3PSCA 2ZJWA 3MIAA 4MWIA 4AOJA 2FVDA 4F7LA 4ZLOA 2PE1A 3QWKA 2C3LA 2R2PA 4LG4A 1P4FA 5M56A 1YXSA 5J9LA 3S0OA 3F5UA 2HOGA 2ZAZA 5M4CA 3QTXA 3I0QA 3A7IA 3LJ2A 4ZP5A 4A07A 4RRVA 2W96B 4W4YA 3EMGA 1U54A 1VYZA 4Q5HA 5E8YA 5IQIA 1QPJA 4EI4A 1H28A 3NPCA 4ZTHA 4UWYA 4HGSA 4L7SA 3TUBA 1V0PA 3R0TA 4U6RA 1Q3WA 3WARA 3Q9ZA 4AX8A 3BYMA 5H8BA 2Z7QA 5HG7A 2B9IA 3BL9A 3R8PA 5KBRA 4W4XA 3E7VA 4D2VA 3QCQA 2B1PA 5GZ9A 4CQGA 2H6DA 2RGPA 2PE0A 4PX6A 4X2KA 2RFDA 4FBXA 5HX6A 5CVGA 4WD5A 4DHZA 3GOKA 1JSTA 1DAYA 1Q8WA 2IVSA 3LAUA 4FSMA 2ITUA 2IVTA 4MXYA 3WE4A 2I0VA 1Q3DA 2AC3A 5AR7A 3QGWA 3F5PA 2OJGA 4YZDA 2FB8A 3BI6A 5M4UA 3EFWA 3O2MA 3G6GA 2ZM3A 4ID7A 5L8LA 2B55A 4MXXA 5CXHA 1Q61A 4BTFA 4R78A 3LFFA 3RM7A 5CF5A 4B0GA 5HX8A 3Q4ZA 4OLIA 5A4QA 3ML1A 1WVXA 5IU2A 2WMBA 2X7OA 2CSNA 1BI7A 5K3YA 3V5WA 4H3PA 4FNXA 4EHEA 1PXNA 3GCUA 2OXXA 4PL5A 3UJGA 3VUKA 5KHWA 2XNPA 1YDRE 1PXIA 2W4KA 3R7IA 1ND4A 4BY9E 4AZVA 5BVNA 3DLZA 3LFSA 4YJSA 4QTEA 4FTAA 3RI1A 3F2NA 2ZVAA 4PDSA 4GK4A 2GHMA 4TZRA 3OY3A 4V0GA 2UV2A 2XK7A 4JRNA 4LFIA 2AUHA 3ZM9A 3BCEA 3P7AA 2BDWA 4DFBA 3O7LD 3NUAA 5EYKA 4FSYA 2F2CB 1Q8YA 3ZTXA 2QURA 3FMEA 3G2FA 3MGYA 4JT3A 4RFYA 4DEDA 2XJ0A 3QUPA 4O38A 4DN5A 1PXOA 2V55A 3FY2A 4FTUA 3N4UA 5HLWA 4L53A 4D58A 3IONA 4XG3A 4E5BA 5IDNA 4YLKA 4AFJA 3DK7A 3GGFA 4IEBA 4U5JA 4WIHA 4JAIA 2XB7A 3IOPA 5IDPA 3OTUA 4PTCA 3K5UA 2R3NA 2BAKA 3M2WA 3QCSA 4FT0A 3F3VA 4Z7HA 4V0GB 3FYJX 3E63A 3ORKA 4RFMA 3RK9A 4K33A 4DEHA 4O7YA 2W9ZB 5KMJA 3LMGA 3UIUA 3LMIA 3F7ZA 2HENA 1G5SA 2PZIA 3VUTA 1Q5KA 3I7BA 4CSVA 3D14A 4TWOA 3TKUA 4XG7A 4D0XA 5IH4A 2WMTA 4UN0C 2NNWB 5HVYA 2W5BA 4PY1A 3FQHA 1OUKA 4JDHA 1UKIA 4M69B 3PA5A 3ROYA 3HRBA 2UZNA 5CSHA 1FMOE 2VWUA 4NM7A 5EM5A 4E5WA 5KMLA 3GQIA 3U4UA 3PXFA 1RDQE 1UU8A 2B9JA 2HZIA 3ANRA 1GIIA 1OECA 5AADA 4EH6A 1REKA 4D9TA 2IN6A 3VULA 4D5KA 2R3FA 2JIIA 2QHMA 4GT4A 2IW9A 4RIYB 3I7CA 3PPZA 2Y9QA 2QCSA 1YXXA 2J9MA 3QTSA 1P2AA 5CWZA 5J95A 4DH1A 4E4NA 3MH0A 4D2RA 5CAVA 3Q04A 4G6OA 3FC1X 5CSVA 4QO9A 2X0GA 4XG4A 3AC4A 5CTPA 3A7GA 1M14A 2R5TA 3DA6A 3PP0A 4I0TA 3TTIA 3L9NA 3QQJA 3REPA 3W2PA 4TYEA 1JPAA 3LIJA 4F7JA 3NVMB 3LE6A 5AUTA 4PV0A 4OT5A 3VWAA 2HZNA 4X3FC 3DLSA 5JFSA 3QKKA 3NUSA 3FBVA 4CEGA 4FTIA 4HCVA 2OKRA 4RGJA 3A60A 5AEPA 4HVDA 3RKBA 5CF6A 1OITA 4XNEA 3ETAA 5I9UA 3DS6A 4PTGA 2A2AA 4PDOA 4N6ZA 4FEQA 5HEZA 4AGCA 5CALA 1J3HA 1H1SA 2PUPA 4MKCA 5E1EA 4HVHA 3QXPA 5EM6A 4RC2A 3OT3A 4RVTA 4C59A 5JH6A 1KE6A 2PVFA 2ONLA 3AC8A 4BTJA 2NO3A 3ALOA 5HVKA 1XR1A 5M51A 2X6DA 2PMLX 3K54A 4NJDA 4O7TA 2J0KA 5KX8A 4QYHA 4CG9A 3R63A 4P7EA 4WO5A 2J0MB 4DH7A 2RL5A 2CLQA 4O7NA 4R3RA 2J2IB 4FYNA 2OJFE 3EFLA 4F0FA 2E2BA 2YA9A 1W84A 1S9JA 4AWIA 3RPYA 3V5JA 4XOZA 5CSXA 5IZFA 3SGCA 5I9WA 4LV7A 3QUEA 3PWYA 2XS0A 3ERKA 5GJDA 1XQZA 2VAGA 1WBPA 2R3JA 3L9LA 4PL3A 2XZSA 2PY3A 2BRBA 4NKSA 4KS8A 3GEQA 4NUSA 4ACHA 4C35A 3TNIA 3AD5A 3QQLA 3QYZA 4KKGA 4CVAA 4TT7A 1YXVA 2WMXA 4S34A 4GKHA 4FT7A 3VS2A 2XM8A 2PPQA 3AGMA 3QQKA 2R3PA 1Z5MA 3R6XA 1QPEA 1NXKA 2H8HA 3KCFA 4A4OA 3I1AA 4NYEA 3BHYA 4QTAA 3GU8A 3H9OA 5HG5A 3CQWA 2NP8A 3UC4A 2XP2A 2QG7A 4ZJJA 5JZJA 5EQPA 3O17A 5CSPA 1Y91A 1YKRA 2QR8A 1H4LA 2QO7A 3EOCA 3OCTA 4O6EA 4HYSA 5CX9A 3UBDA 3E93A 2UZEA 4CLIA 3PE1A 4PPAA 1GNGA 5B0XA 1APME 4I5CA 2XNNA 4IM2A 2WTIA 3VF8A 3TL8A 2VN9A 3EN5A 5A4CA 4IC7A 3LPBA 2OF4A 3P79A 3TKHA 5CF4A 5CU0A 4F78A 3EL7A 5IA1A 3FL4A 3QD0A 4ZTLA 3MY5A 2YM5A 3R7VA 2GS7A 4W9XA 4ZTMA 4C4JA 2PVJA 2CPKE 3C50A 3NRMA 3RWPA 4MBLA 2XH5A 2CKOA 3MPAA 3JUHA 3CJGA 3OG7A 3LFNA 3SW7A 3AT3A 3CTJA 5J9YA 5AA9A 4ACGA 4ZMEA 2C1BA 2E9VA 3I0OA 3IW8A 4PNIA 1VYWA 2WXVA 3QRIA 4HCUA 5M55A 1KOAA 4ASXA 4XV2A 4QMZA 5HE2A 4RC4A 2QOKA 3UTOA 3TNHA 1EH4A 4GYIA 3UOLA 1FVTA 2YM6A 4IC8A 3W0MA 4IADA 1YI3A 4NL0A 4GFGA 2XK8A 3BHUA 3V04A 4UMPA 4GK2A 4C33A 3MN3A 3CE3A 4FEUA 1I09A 1OVEA 3TV6A 3O7LB 2PK9A 3QGYA 3R9DA 4AN9A 4O82A 4D4VA 3KN6A 4FK3A 4UZDA 2A27A 3A8XA 5GIOE 4UYNA 5C8MA 3O8UA 3PUPA 2XKEA 5JEBA 3E3BX 3IGGA 2JFLA 2G15A 2EB3A 3D83A 4AXFA 1DI9A 2PL0A 3PIXA 4NH1A 4M3QA 1ZYDA 3SW4A 2Z7SA 4TKSA 4GJ3A 2XBJA 4K18A 5AR5A 2HIWA 3R7EA 3PFQA 1XWSA 2QQ7A 3V51A 5L2WA 3C51A 2P2HA 4L67A 1CKJA 4A9UA 2R3IA 2WTDA 2YIQA 4L7FA 4RMZA 2F4JA 3B8QA 4G3CA 5BQ0A 4I24A 3KKVA 3KN5A 2QNJA 3W0RA 2BPMA 2AEGA 1JAMA 3AMAA 3MA6A 3HLLA 4TYHB 3LZBA 4PPBA 2VWVA 3DBFA 4QMLA 4RJ6A 5DWRA 4ZSAA 1FGKA 3ZUVA 3RNYA 3S1HA 4EOMA 5FWKK 3DZQA 3HEGA 3LQ5A 4IX5A 4NW5A 2OW3A 4BWKA 3F5GA 4RZWA 4F7NA 4UMUA 4QYYA 4PMSA 4EH5A 2DUVA 4JNWA 3WYYA 1FOTA 2R3OA 3OF0A 4RWLA 1MRVA 4F6WA 4C4GA 2W1GA 3KU2A 4QP9A 4BJJB 3LQ3A 5LMKA 3K3IA 4X2GA 2ITPA 4RC3A 4YNEA 4FKTA 1JKLA 3W1FA 2YIXA 3BRBA 3NR9A 3CPCA 4MEDA 3SDJA 3ZZEA 4B7TA 3PXZA 3C4EA 4CXAA 5FTQA 2X4FA 4UYAA 4AZEA 2W9FB 3RAKA 3UYTA 3V3VA 2J90A 4AAAA 2DWBA 2UZTA 3QCYA 2F2UA 1IA9A 4QMOA 1OKZA 4UMRA 3FLNC 4I5HA 4HZRA 2GPHA 5G6VA 2FO0A 3E8DA 4LMUA 3OXZA 2ZDUA 1OKYA 5K4JA 3GB2A 5LARA 1KV2A 3NW6A 3AG9A 5FXSA 1BLXA 2UW9A 3W2OA 1SZMA 4EOPA 3RMFA 4EJ7A 1JKSA 2W5HA 4PNKA 2HZ4A 4MAOA 2W7XA 5A3XA 2XK3A 3UDSA 4FKUA 3Q96A 4YTFA 5HGIA 4CKJA 3R30A 2PSQA 3AMBA 3BU5A 4V01A 4JDKA 3WYXA 4CFVA 3FMMA 4DCAA 1H00A 4FV3A 3DQXA 4UMQA 3CIKA 3TNPC 4MWHA 2FH9A 3T9IA 2OIQA 2BR1A 2JIVA 3SOCA 3FZSA 4NIFA 2XEZA 3P7CA 3WF5A 4FKVA 2PYWA 5EQYA 4KIKB 4XS2A 2WGJA 5E91A 4AW2A 2B53A 2C3KA 3FMKA 3GU4A 4WG4A 4GIIA 1STCE 4MD7E 3UC3A 1W0XC 1H1WA 4FTCA 4OTGA 2FUMA 2KULA 2WQOA 3A7FA 3KFAA 3SAYA 3CS9A 3QRKA 1E9HA 4I6BA 3IGOA 3TNQB 3ZSGA 5BPYA 4TW9A 5F1ZA 4CFMA 4FF8A 3HAVA 4JG6A 2GNIA 4IE9A 4JQ7A 5J1VA 5L3AA 2PZPA 4CYIA 2WQBA 4O0RA 3TZ9A 3FZ1A 4DC2A 2YLEA 4FV7A 4RLLA 3F5XA 4TYJA 4FKWA 4USFA 3II5A 2VGOA 4NIFB 3R71A 2QU6A 3CCNA 1PYXA 1WBTA 4HVGA 2X9FA 2VTPA 3PTGA 4BDEA 3EZRA 5JFVA 2X8IA 1RQQA 2IW8A 5IA0A 4E6AA 3PJCA 3QC9A 3WF8A 5L6WL 3Q9XA 2JEDA 4RJ4A 3HUBA 4A9RA 1ZY4A 2GQGA 2ZM1A 1BI8A 4IJ9A 2YJSA 3JY0A 3VBQA 5LJJA 5FP6A 4F64A 1A48A 5ANJA 2P4IA 2WEVA 4IAZA 2XAOA 4BR3A 2ETMA 5CQWA 4HCTA 1V0BA 5AIRA 4NSTA 4GIHA 4CYJA 5HCZA 3BQCA 5HLPA 4GUBA 5FDPA 2JKOA 2J51A 2R0IA 2YM8A 4G3FA 1Y6BA 2W99B 3C4FA 4CTBA 3OUNB 4ACCA 5GIPE 2JLDA 2XF0A 4KUJA 1PW2A 5FTOA 3NAXA 1YWVA 4H36A 5KBQA 2H9VA 2F49A 4RIXB 5CAUA 1PMNA 2OK1A 1SVHA 4W4WA 3R8LA 1PKGA 4C3FA 5LVLA 5DOSA 4EH7A 2X6EA 4JBVA 3E7OA 4DBXA 4BCKA 3EN7A 4FICA 2B4SB 3GNIB 3HDNA 5HCXA 4U3ZA 5C9CA 5D7AA 3VBTA 5JQ8A 2EB2A 4M0YA 1K3AA 4A4XA 1OPJA 2WMQA 3LCDA 4FNYA 4O27B 5J7BA 4AP7A 1KWPA 4BGQA 5J5SA 3NZ0A 4UWCA 5K9IA 4RX8A 4JR3A 3TV4A 4G9CA 1FBNA 1JWHA 4QD6A 5AM7A 2B7AA 3UVPA 4ZXTA 1ZOGA 2X39A 2ZM4A 4FUYA 2UW0A 3H0YA 3NUUA 3CGOA 3PPKA 3QQUA 2PE2A 3CPBA 3EFKA 5HICA 3PVBA 4USEA 4DFLA 3CD8A 5JQ5A 4EOIA 2QOCA 3GT8A 5E90A 5BMMA 4AA5A 4FOBA 4DITA 3KXZA 4MXOA 4RX7A 2O8YA 3VS3A 5AP5A 3FE3A 4EH4A 4LDTA 5EHOA 4GFMA 2A1AB 3GCQA 4F0GA 5IUIA 2BRHA 3LKMA 2ZDTA 1CKPA 1XBAA 2I0YA 5AIKA 3VBXA 4U0IA 4PP7A 3U9NA 4ZY5A 5HI2A 1OBDA 1ZOHA 1GIJA 1MQBA 4IWOA 4OTWA 4EC9A 5AP4A 3GC8A 3SXSA 2HY81 4BDHA 4QMTA 3W55A 3EQHA 3DKFA 3GCPA 4C34A 2E9OA 3L8PA 3QU0A 4FKQA 2CMWA 3A99A 4S32A 4NEUA 1OL1A 4R77A 3RALA 2ZB0A 4WNPA 4X2NA 4KINA 4DCEA 1GOLA 5BYYA 3OD6X 4L44A 3L8SA 2PVHA 3OW3A 4N0SA 3TN8A 3V5PA 3WZJA 3IDPA 2XKDA 3MA3A 4J96A 5M44A 5BUIA 3DGKA 4D4RA 1UU3A 2JKQA 2XUUA 3QKMA 4AQCA 4BGHA 4BBMA 5AR3A 2AYPA 4HYHA 3RCDA 4BZOA 3HV5A 1VEBA 2NRUA 3E88A 3FMDA 3VUGA 1CTPE 3COHA 3F88A 4EHVA 2I1MA 5IA2A 2HXQA 3BGPA 2JAVA 4KABA 3IDCA 4O2ZA 4FV6A 3KRWA 1WVYA 5DPVA 2VWBA 4YJUA 2VX1A 5AV1A 4FKGA 4NFMA 4O0YA 4O7LA 2E9PA 4WKQA 5KMIA 3IKAA 3ORNA 2IJMA 4NM3A 3MH1A 4F70A 1XH7A 2OG8A 3KXHA 5ANOA 3R28A 2ZV7A 4KNBA 4QQCA 3NLBA 2PVNA 4IW0A 1J91A 3RBWA 5AX3A 2FA2A 4FSTA 3UMXA 2UVXA 3DU8A 3PXYA 4H1MA 3FPQA 3W32A 4ZZMA 4C0TA 5AUVA 4FEVA 1OPKA 1BKXA 2X2LA 3FAAA 4LGGA 3I5NA 5CS6A 5EDPA 5FD2A 1HCKA 3BYSA 3CTHA 1BL6A 5KMMA 3BYVA 4HYIA 2CKEA 4ZTQA 4IWPA 1NVQA 2R7BA 5HVJA 3LFQA 1HCLA 3VUMA 3MH3A 5AM6A 4AN2A 2PVMA 4MTAA 4EOQA 4FEWA 2CCIA 1WBVA 5IMXA 5AR4A 5I9VA 3RAWA 3I79A 4WUAA 1PMVA 3LCKA 3KMUA 3FXWA 4C2WA 3QRJA 4D2PA 5IA5A 2QKWB 2DQ7X 3BPRA 3MV5A 3F66A 1IA8A 4XG8A 3UIBA 3DJ5A 3OEZA 2BRGA 2X8EA 3NYNA 4APPA 3V5TA 1UNLA 3DZOA 2X0OA 1ZYJA 2VNWA 1ZZLA 1OL2A 4YZ9A 4AG8A 4C62A 5IQCA 4PMMA 4X3FB 5DLSA 3G6HA 1T46A 5HHWA 4PMPA 2LAVA 3W18A 4B4LA 1Q8ZA 3ZRMA 4E1ZA 3HAMA 3R9OA 4O0WA 2IWIA 4CZUA 4EUUA 3DV3A 2YFXA 2YN8A 4FGBA 4G9RA 3UQGA 3SV0A 3ZBFA 3PDTA 3HMNA 1VJYA 3MB7A 3NWWA 1SNXA 1Z9XA 3HKOA 2XEYA 4ZJIA 2EXMA 2YHVA 3QC4A 5HE0A 3U6HA 4NCTA 3D2IA 3CBLA 2UZLA 3GU6A 3FXZA 4FC0A 3VF9A 2WQMA 3BEGA 4EOJA 3BX5A 5AP3A 1M2QA 3ZONA 3SOAA 4UALA 2YCSA 3PFYA 4DGNA 1B6CB 3NIZA 4M68A 5D41A 4EUTA 5IQEA 3LCOA 4PP9A 4QQ5A 3RK7A 1UVRA 3F82A 3HRFA 2VTTA 3TV7A 4F65A 3C5IA 2GNHA 4IB3A 2BRMA 3KRLA 2JDVA 2R3MA 3DT1A 3MTFA 3QUDA 4IX3A 2HW7A 2GDOA 4KBKA 3UP2A 3ZLWA 3ORTA 3B8RA 5BYLA 2ACXA 3POZA 1JBPE 2WTCA 2YIWA 3FDNA 4EJNA 3NW5A 4FZ6A 4GVAA 5A9UA 3VO3A 3OMVA 2BAJA 5J87A 2C0TA 3KGAA 2YACA 1PXPA 3PVUA 1YWRA 2C68A 4B9DA 4RBLA 4XBUA 3E8EA 4IM0A 4DEEA 3DCVA 1IG1A 3QQHA 4RG0A 4N4SA 5HIDA 4JR7A 4XOYA 3MPMA 3R22A 4E93A 2X0QA 1R3CA 3OCSA 4DG2E 4QPAA 2XIRA 3H30A 3BZ3A 1PY5A 3LXLA 1M2RA 5J7HA 2C6KA 3F6XA 3RPVA 1ZYSA 2A0CX 5TE0A 5LXMA 4J1RA 2PUUA 4AW1A 3QX4A 3NFGB 4BZNA 3EZVA 3VBWA 4O22A 3G0FA 2X9EA 3DDPA 3GU5A 3PJ8A 2XYUA 2VTSA 4F1TA 4LI5A 1SMHA 4MYGA 4FIIA 3MWUA 4I6FA 3ATSA 5CT7A 4MUQA 4MBIA 3CY3A 1YI4A 4R3CA 3MVJA 4MF1A 3GENA 5DEYA 4YO4A 4ZEGA 2WTKC 4PTEA 3AGLA 4IQ6A 4CKRA 4JJRA 4EK6A 4QEBA 4PF4A 3BU6A 4IBMA 1DM2A 1X8BA 3L8XA 3KB7A 1TQMA 3QD2B 5G1XA 3DFAA 2WAJA 5EI8A 3Q32A 2W06A 4FVQA 1Q4LA 3W0QA 3BIZA 3LCSA 2CGVA 4NJ3A 5AV0A 2XKCA 5DR6A 4RWIA 3QHRA 3SD0A 5E1SA 3RM6A 4WT6A 5EDRA 4AFEA 3F3UA 3DAKA 4W8DA 2HXLA 5AP1A 5DI1A 3QLFA 4O84A 2VTMA 4RA4A 4QQTA 3W0OA 4EQMA 3ZOSA 3QAME 3S2PA 4X2JA 3ODZX 1OB3A 2C6MA 3S4QA 4DE4A 5AX9A 1Q8UA 3KREA 3C7QA 3PY3A 2IZTA 3AD6A 3TI1A 4QP7A 1OIUA 1OUYA 1PXKA 4QNYA 5FBNC 3VS1A 1DS5A 3OWPA 3BBWA 2V5QA 4FTOA 4ANSA 4DTAA 4F99A 3WI6A 5CAPA 3SG8A 3FKNA 2O64A 2OSCA 4F1OA 2Q83A 5BVEA 2QLUA 3D7ZA 4FKPA 4GVJA 4G6NA 4IVBA 4P4CA 4BTKA 5CXZA 3A7JA 5C4LA 4YHTA 4L68A 2BTSA 4RJ7A 4U40A 2IF8A 5AV4A 5C1QB 5JFWA 1QL6A 4C02A 5ETIA 3VQUA 2JDRA 4L3JA 2VO0A 4ENXA 3QCXA 4GUEA 4KS7A 3AC1A 2C69A 4QYGA 4YPDA 5FBOA 4C4FA 5KMKA 1JVPP 4ZY4A 3BHHA 1URCA 4LOQA 4O7WA 2VX0A 2UVYA 1JKTA 3VRYA 3MYGA 4L43A 5E8ZA 5AWMA 4MBJA 3L9PA 4M69A 4WNOA 1MRYA 2QOHA 2FYSA 4OBOA 3RAIA 4O86A 5IQBA 2X8DA 3OOMA 3KK8A 4ONAA 3CJFA 3NCZA 3AMYA 4I93A 4FV9A 4U80A 5CAQA 4CKIA 4IH8A 1K9AA 4IXPA 3DB8A 1FMKA 4L46A 5KKRC 4CCBA 5D11A 4RQKA 4RIYA 2C5VA 3FJQE 4ZTNA 3OVVA 2NYAA 2IZUA 1CMKE 4NKAA 1FVRA 1QMZA 3V8TA 5KZIA 5I3RA 4S2ZA 2ETKA 1ZLTA 4DFZE 4E4MA 3CQUA 5EI6A 1PRYA 2RFNA 3OC1A 3D5UA 5E8VA 2C5YA 3A62A 1PJKA 1WZYA 4WUNA 4UMTA 2C47A 5FEEA 2H96A 5DYJA 3RGFA 5CLPA 3AKJA 1WMKA 5CNNA 1V0OA 4U45A 2HY0A 4YJQA 1L3RE 5ANEA 3WF9A 2QG5A 3NX8A 4ALVA 5AAGA 4L6QA 3U8WA 5IH5A 4IAFA 4USDA 4A9TA 4D2SA 4TYIA 4FV1A 4O4DA 5CQUA 4OT6A 5HCYA 4F6SA 4I23A 3DXNA 3R02A 3VHEA 2EVAA 4NW6A 1ZZ2A 4P90A 2CJMA 5LVMA 5HORA 5CAOA 5DA3A 3CSVA 4HPUE 4QMYA 5IKWA 4E20A 5ANDA 4BGGA 2XBAA 3VHKA 4BDAA 4RX5A 4O4CA 5IF1A 5ETCA 3OXIA 3KXGA 5IMEA 4R3PA 2XNMA 2YIRA 1YHVA 3COIA 4LUEA 4F9AA 3KEXA 4FV4A 3QF9A 1WFCA 4H1JA 2BRNA 4WOVA 5TT7A 3DXPA 5B7VA 3IW4A 3I5ZA 2VWXA 1KE8A 3QTZA 2XJ1A 2YDKA 1U5QA 4EORA 4Q9ZA 2XAMA 3MVLA 4FGRA 4BWXA 4ZZO