2VO3A

Structure of pka-pkb chimera complexed with c-(4-(4-chlorophenyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-yl)methylamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
337
structure length
334
Chain Sequence
b'SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 105
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo3A02
3GT8A 1JSUA 5ETAA 4U45A 3ZUUA 3QQFA 3UO6A 4DITA 5GZ9A 2ZMDA 2GMXA 1FOTA 2QCSA 3CP9A 4FUYA 4NCTC 4YO4A 4O7VA 2Y4IC 5I9WA 1GIHA 4S31A 2BPMA 2XM8A 5AJQA 2JKOA 4GT3A 4IAIA 4L42A 3V5PA 4B9DA 4RIXB 4S30A 2PYWA 1OI9A 2C5YA 4IDTA 4L46A 4UMQA 4DFNA 4D55A 4Z3VA 3NIEA 4JDJA 2XS0A 4XG3A 4F6UA 5IPJA 3MJ1A 4YTHA 2FSOX 5HE3A 3D94A 3NLBA 4IXPA 5KMIA 4Y46A 1H1PA 3M1SA 4KIKB 2PVYA 4NFMA 4QPMA 5IDNA 2X0GA 5CF8A 4M69B 2PU8A 5C01A 3FL4A 4X0MA 4FT7A 4O0TA 3AXWA 3E8NA 2UW6A 4FZAB 5L3AA 3MWUA 3HUBA 4NUSA 3MVJA 2BRNA 1Q41A 3F2NA 3GCQA 4I0RA 3A99A 5E8SA 3KB7A 4RG0A 2ZAZA 4BWXA 4BF2A 5TO8A 4DT9A 1ZOHA 3GU6A 3RPVA 4C4FA 3PLAE 4BCGA 4MTAA 5M55A 3TTIA 4EK4A 3VBYA 4Y85A 3KN5A 4JBPA 3BV3A 3TZ9A 4ENYA 4AZEA 1R1WA 3O96A 3HRCA 1M2QA 2OZAA 2C6IA 4D58A 5JT2A 5GJDA 4IJ9A 4NW6A 3QBNA 2GU8A 4OTDA 4BCHA 4G1WA 4G3EA 5ANGA 5M44A 3W2OA 1SVEA 3GU7A 3BI6A 3RAKA 5DNRA 3TV7A 2JIIA 5TE0A 3P5KA 1ZZLA 2J5FA 4NFNA 5B7VA 2CNVA 4PP9A 1GZ8A 2RIOA 3RCDA 3V8SA 4RC2A 4IAZA 1ZARA 4BCKA 1YXVA 5AV3A 5B0XA 2P4IA 5FP6A 2X81A 3HDNA 3Q5ZA 4XLVA 3AC4A 4E6QA 1Z5MA 5A3XA 5K3YA 5HCYA 4X2KA 1PJKA 1GIJA 4ITJA 2P33A 1KV2A 3UC4A 4RVTA 3H9RA 3WI6A 1HOWA 2X2KA 2R5TA 2F49A 4L7SA 3DS6A 4C3FA 4RWJA 2WU6A 4IM2A 3KEXA 4LRJA 2B4SB 2W1IA 1R0PA 3TKIA 4CFWA 2PZ5A 3CY3A 4U6RA 4ZTMA 5A46A 4QP3A 1JKSA 3TIZA 3RGFA 5C27A 2YAAA 3RAIA 5IU2A 4YZDA 3CKXA 2CMWA 3S00A 1O9UA 2ITUA 4KBKA 4DG3E 3DXNA 4XRLA 3MPAA 3LLTA 4TRLA 4DGLC 4OTIA 4ACHA 4WOVA 2VV9A 4Q2AA 3DKFA 1P14A 3KVXA 4U81A 3ZEPA 2Y4IB 3H0YA 2GS2A 3HMMA 5CZIA 4RWIA 4BGHA 4M68A 3CKWA 4D5KA 1YOJA 1NVSA 4EHVA 3AGMA 4AN2A 1PYXA 1XO2B 5M56A 3EYGA 1U5RA 1XH6A 5EDPA 1JVPP 4FTJA 2ETRA 4F6WA 2QNJA 4O21A 1W83A 4TNBA 2WMTA 5A4QA 4BWPA 2W17A 3IOKA 5BUIA 5C9CA 5DEYA 3F5GA 3ORLA 5DG5A 1M52A 2XIYA 2CJMA 2QODA 3NYVA 5CSVA 3OEFX 3SX9A 4EBVA 5KBQA 2WIPA 3Q4UA 4O38A 2CN5A 2YA9A 3C4CA 4JVGA 4EOKA 2HYYA 2BAQA 3G15A 2VGPA 4F99A 2QO2A 3P7AA 3WIGA 5CU0A 2FUMA 4YJSA 1MUOA 2QURA 4J8NA 3PRIA 2XJ0A 4TL0A 2UW8A 3CY2A 3CTJA 4GH2A 3QA0A 2YWPA 3W1FA 3Q6UA 1DI8A 5HZNA 1PXJA 4X3FC 3AT2A 3CGOA 5HTBA 3DAEA 3NWWA 4MBJA 1H1RA 1WBOA 5E90A 4B8LA 2H9VA 4BCNA 2E9OA 4TYIA 3V6RA 5HTCA 3GQLA 4L8MA 3KU2A 2C0TA 3SVVA 2X9EA 5DOSA 2R0UA 5L6WL 2E9VA 4HW7A 3DLZA 4G9RA 5IUHA 1GIIA 3HUCA 4JIAA 1Y8GA 4FSMA 2UW7A 5BVNA 4YTCA 1OUYA 2C6OA 1Q8UA 3C51A 3P79A 1JPAA 2IVTA 3NAYA 3R2BA 4L01A 5CAVA 3BCEA 5DHJA 4ZP5A 3TG1A 2XCKA 5TKDA 3UNZA 3NX8A 3LCTA 4FV7A 4QMLA 3TUDA 2XCHA 4PNKA 3SA0A 2VWXA 1MRYA 3V5WA 3OW3A 2B52A 3W8LA 2R64A 4C3PA 2QU5A 3R7GA 3ZSGA 3OTVA 3OEZA 2V62A 3IO7A 4GJ2A 4MD8E 4N0SA 4MH7A 5CVHA 4BFMA 3FC2A 3O8TA 3BHYA 5AUWA 3B8QA 3MH2A 3TV4A 4EH4A 3COHA 4CMUA 4QQTA 1QL6A 2G1TA 4F1MA 2QOBA 3FDNA 4QMPA 5C03A 3ZTXA 3OXZA 4DFBA 4OBPA 2YM4A 5E8VA 4DH5A 3VW8A 3DNDA 1VJYA 4FA2A 4XP2A 1LR4A 2QOHA 3PJ3A 5AP1A 4H3PA 4UN0C 4FKPA 2C6EA 2R3PA 2UZEA 3CR0A 4QTBA 4Y5QA 5GZ8A 2YHVA 3BQCA 2JIVA 3LJ1A 3OD6X 3OHTA 3EZRA 4EOOA 3NUYA 4K77A 2BILB 4L3JA 2WMVA 1Q8TA 1H1SA 3AMYA 5LVNA 2QO7A 3F88A 2PMNX 2YM7A 3V6SA 5LMKA 1Q8YA 4FV3A 3W2CA 3UQGA 3RJCA 2YACA 3GB2A 4OBOA 5AM6A 3D7TA 4C59A 1SZMA 1GY3A 1KOBA 4I4FA 5HIBA 4R8QA 5H8BA 1TVOA 5AP0A 4ZLYA 3P23A 4II5A 3QRUA 1H24A 3MVMA 3GC9A 3K3JA 3EL8A 4FOCA 3MY1A 4JG7A 5AV1A 4QD6A 2C4GA 3EKNA 4GK2A 4F63A 5BX0A 4GFGA 3EB0A 4R5YA 1XKKA 2YIWA 2XA4A 4FNXA 4M66A 2H8HA 4XJ0A 4D2RA 4UMPA 1OBGA 1RE8A 4O0SA 2XK9A 3RK7A 2OIBA 1FGIA 3FHRA 4TKSA 2QG7A 2C3KA 4PTGA 3HYHA 1KV1A 1UNHA 2ITXA 3LCOA 4RVKA 3IONA 3FE3A 3W33A 3ELJA 4LG4A 1ZOEA 4IACA 4RIXA 4RWLA 3QZHA 4EH7A 5JQ8A 4GG7A 4KIOA 1OIYA 2O65A 2Z7RA 3R9HA 4CLJA 4GT4A 1VR2A 4FL2A 4KIKA 2XNNA 3EL7A 4P7EA 4RJ7A 4TT7A 5DH3A 3GU4A 4PMPA 5I9VA 3LLAA 4M69A 3QFVA 4IVAA 1UU8A 3QYWA 2KTYA 3FI2A 4ITHA 2OJFE 5E9EA 4F9BA 2PVMA 4YHFA 5L6OA 3RTPA 4C61A 5HCZA 1Q4LA 1AGWA 3LIJA 5B2KA 4E6DA 2CNQA 1YXUA 1ZYDA 2HAKA 4BYJA 5CAQA 4YNEA 3F69A 4EHEA 2YFXA 3O51A 2VWBA 1GZOA 3GP0A 5AP4A 4D5HA 2YABA 2Z2WA 4KKGA 3FKOA 3VQUA 3LOKA 4C36A 4EC9A 4IZYA 5CTPA 4CXAA 1G8AA 3E63A 3U4UA 3G5DA 3L9LA 4XOZA 4JX7A 4BCFA 1W84A 4Z55A 1REKA 5F1ZA 3MJ2A 3Q3BA 1OVEA 4I20A 3IW4A 2XRUA 3DJ6A 4IFGA 3DTWA 2XBAA 3FZPA 5DR2A 4CV9A 3HV6A 3MVHA 4N6YA 2CGVA 5CALA 4R1YA 1UV5A 3QWJA 3CIKA 3JYAA 3BPRA 1Y8YA 1T45A 3QD4A 3VS4A 4AN9A 2Y6OA 4Z9LA 4OGRA 3EQFA 3FPQA 2XKFA 3LHJA 3PPZA 4DAWA 4RX5A 2YLEA 3PJ8A 5C8KA 3EQBA 5IMXA 3ALNA 3DTCA 3LMGA 4YJUA 3A4PA 5HCXA 3LXNA 3JVSA 2RFSA 5KZ0A 1PMEA 2I0EA 3EHAA 4I6FA 3BWFA 5A54A 4O7RA 3K5UA 4JBVA 4OTWA 5CQWA 5EM7A 5D1JA 5KZIA 2FH9A 1ZYCA 3QKMA 3QC4A 5KO1A 5A4TA 3K54A 1MRUA 5AMNA 4E5AX 1H07A 3ZO4A 4U44A 1IA8A 1H4LA 3KN6A 3OOMA 3HMNA 5DPVA 5I4NA 2VTHA 4ITIA 1FBNA 3TZMA 4LL0A 4C7TA 5E8XA 4Q5EA 4JQ7A 2I6LA 4HGLA 3HL7A 2JGZA 3NIZA 4A4OA 4BL1A 4RT7A 1ZMVA 3BYMA 3LJ0A 1QPDA 1YWVA 2GFCA 2KULA 4J8MA 5CI7A 5HG9A 5J7HA 2LAVA 4BDCA 2Z7QA 5JGAA 4GEOA 5T3QA 5JFWA 2IZSA 2NRUA 5C4LA 4RQVA 2OH0E 2EUFB 3GCPA 2C6MA 1O6YA 2VTNA 5GJGA 4RC3A 4DG2E 1Z9XA 3QQKA 3NZ0A 3TNWA 2PPQA 2XKDA 3EQPA 3U51A 3RK5A 4O2ZA 3SV0A 3DKCA 4JRNA 4IC8A 3QRTA 3OG7A 3D0EA 3ULIA 2RG5A 1IEPA 3R63A 4LYNA 3SLSA 4H05A 4LRMA 2E9PA 3FXZA 3ZZWA 5AUTA 5EHLA 3F7ZA 4G9CA 3GQIA 1UKHA 3QKKA 1OPKA 4QMZA 5K5NA 4FSYA 4EZ3A 1OIRA 3R7IA 4L43A 3Q53A 3TDWA 3G0FA 2PZIA 5KNJA 5C1QB 2PVLA 3POZA 3A7JA 5HHWA 1JLUE 1H1WA 2P0CA 4HNIA 4ERWA 2J0LA 3FZRA 1DM2A 3PLSA 2YDIA 5EYCA 1HCKA 2BCJA 3UVRA 5C8NA 4E26A 5EI8A 3NW6A 3EJ1A 3QLFA 4WBOA 3TIYA 3W2QA 5IA1A 3ZLYA 4L68A 1OL7A 4BDDA 3OUKA 5JZNA 2FA2A 3C4EA 3A7IA 2VD5A 5M57A 2XYNA 2VN9A 1J7LA 3ITZA 1KE7A 4FIIA 3UVQA 1AD5A 4EC8A 5BVOA 3RKBA 1KE8A 4WUNA 4CKJA 2J0IA 2RGPA 4JAIA 5H8GA 5AR4A 5HEZA 2R3NA 4G6LA 2YISA 3ACJA 1KWPA 3CTHA 4XV2A 4YR8A 2XRWA 3VJOA 2W1DA 2WOTA 3EMGA 5HNBA 3KVWA 4LOQA 5AA8A 1G5SA 4MQ1A 4BDAA 3I81A 2OIQA 2YM6A 4W9WA 3RAHA 2WQEA 4BVUA 4DH1A 4C4IA 4XV3A 3ID6C 2YM5A 4ZSJA 4N4SA 2BDFA 5E91A 3R7EA 2X7FA 1NVQA 3KULB 5M06A 1YDSE 4QMUA 3I5NA 3OT3A 2H34A 2XIZA 2CCIA 4M0ZA 4A06A 5GJFA 3I4BA 4RVLA 5DIAA 4IANA 2C1AA 5EKOA 3VW6A 3W16A 4HZRA 3FXXA 4QOXA 5FBNC 4L7FA 3HV4A 2JDVA 2B9JA 4E3CA 2W1CA 1Q8ZA 4JG6A 4LL5A 4JBOA 2CN8A 3BLHA 4EH2A 2UW0A 3EFWA 4NM5A 3E3PA 3OF0A 4KA3A 5CLPA 3R8LA 2G2IA 4J71A 5HO7A 2IO6A 3QZGA 4ZJIA 3NUAA 2VTSA 2W4KA 5M08A 4FTAA 5AAFA 4QNAA 3ET7A 1VYWA 3LZBA 3SC1A 3EN7A 4YPSA 5HBEA 4G5PA 3DQXA 4O0YA 3ZUVA 4B0GA 4AOIA 2BTSA 3LCSA 2CKQA 3MIYA 3EQDA 2HCKA 3DBCA 2YCSA 2WEIA 4TYHB 1BI7A 5HIDA 3G90X 3F2AA 2I7QA 3LCKA 2WB8A 3ZC5A 4IX4A 4FKQA 3VRZA 1Q97A 4O81A 5CXHA 4FKOA 4H39A 1L3RE 4MNFA 3AD6A 5I9UA 3BHVA 4DLIA 4AFEA 2YAKA 3BIZA 4FSTA 4HYIA 2BHEA 4QMVA 4U9AA 1PXIA 5EOBA 3Q9WA 4UY9A 3V8TA 3QL8A 3SXSA 4AUAA 4FR4A 5HESA 4C2WA 3BZ3A 4FL3A 4TW9A 5L8KA 1V0BA 1G8SA 2PZPA 4GFMA 4EQUA 3ALOA 2ZM3A 3QHWA 5BMSA 5EOLA 5CEMA 4O83A 2QHMA 2OJGA 3CLYA 2QKRA 4Z16A 4NT4A 2W1GA 3MFUA 3T3VA 2CGXA 4F7LA 4I5PA 5JSMA 4E5BA 1M7NA 2F57A 2I0YA 2QOCA 3MTFA 3OROA 4KKEA 3H9FA 4L52A 4ANQA 4ASZA 2B0QA 4MXAA 2Q0NA 4U0IA 4YBJA 4AE6A 4DEBA 1SNUA 3C7QA 1JKLA 3OP5A 3DT1A 3OUNB 4H3QA 4AX8A 3UMXA 4QMTA 3ZSIA 3FKNA 1Y6AA 2R3FA 4A7CA 3DY7A 4K6ZA 2CCHA 3PTGA 5LCKA 1EH4A 3U9NA 4JDIA 2XIXA 1W98A 4EOPA 2C5VA 5FM3A 4O96A 3OXIA 2O8YA 2C5XA 3D14A 3BHUA 5LARA 2C6LA 4F70A 4DEHA 1FPUA 2JDSA 4FVPA 2FSTX 1NW1A 2WMQA 3UOKA 3VVHA 2YIQA 3AC1A 3ZOSA 1JNKA 3BYSA 3MGYA 3D83A 2C69A 3ANRA 1JSVA 4I41A 4RA4A 1WFCA 3IDBA 3PP1A 5BYYA 3C50A 3A2CA 4KIPA 1JKTA 2VWVA 4NYEA 2R3HA 5BVFA 4V04A 2DWBA 3KXNA 3OFMA 3QTIA 4DEDA 3A7GA 4AG8A 3T9IA 2BDWA 4GU6A 3HMIA 5E8TA 1PW2A 2ZV9A 2PVRA 3E8CA 4J97A 4A9RA 2PE0A 3T9TA 4CZYB 5KUPA 3WF5A 3NUUA 4E6CA 4EK3A 4GMYA 4UZHA 5ETCA 5I3RA 2R7BA 4FYNA 3FWQA 3GFWA 2WTWA 2XM9A 2B9IA 3Q52A 5KMMA 3UOLA 4ALUA 4KSPA 4AU8A 5L8JA 2OF4A 4APCA 4ACGA 3FZTA 4PUZA 3DJ5A 4AW5A 2BKZA 3R1YA 3TUCA 3JVRA 4EUTA 3OT8A 3R71A 4KABA 4IVDA 2AC3A 2HELA 4ZTRA 4IE9A 3NYOA 1U54B 5CT0A 2GNHA 3RHKA 4CLIA 4EWHA 5IQFA 2WMUA 4AW1A 3MB6A 4YTIA 5J95A 2UZBA 4G6OA 2VO7A 4QPAA 5A4LA 5DFPA 3CXWA 2UVZA 5IA0A 2XH5A 4PQNA 2PY3A 5IEXA 5FGKA 3QU0A 3VS2A 4AACA 3UOJA 4MF1A 4P2KA 2Y6MA 1H25A 2I0VA 3B2TA 1S9IA 3FSFA 4GVJA 3RPYA 4DFYA 2JAMA 5J1VA 3R9DA 4HCTA 3CQWA 2PVNA 4RMZA 4DTAA 2CGWA 4XP3A 4F7SA 2A4LA 4YP8A 3EQCA 4QP6A 2BMCA 2XKEA 4I22A 2XEZA 4ZSEA 4FGRA 4CFVA 3PY1A 5KMJA 5HTIA 2X6EA 4AOTA 3QA8A 4MXOA 4QP1A 3PJCA 4YBKA 4DINA 5A4EA 3QD0A 1XH5A 2BTRA 4UEUA 4BGQA 3ODZX 2YJRA 2PUIA 4YZCA 3HV7A 2HWOA 4N70A 4UX9A 3R28A 3E92A 2C30A 3SG9A 4YUQA 3AOXA 2X2MA 5A6OA 2QQ7A 4AZFA 1HCLA 4PDOA 3U9CA 3HAVA 3U6HA 5A9UA 1UNLA 2OJJA 1W82A 3D7ZA 4EOIA 4U3YA 2G9XA 2XJ2A 4XMOA 3PXFA 3LFQA 2WNTA 5FQDC 4KB8A 4BDJA 1PRYA 3QLGA 5CSPA 4E7WA 4H3BA 2OH4A 2GNGA 5JGDA 3PZEA 4IADA 4JI9A 3LAUA 3TWJA 5AADA 5JRSA 2A0CX 5AR7A 4BBFA 2W7XA 4W9XA 1KUTA 4FV0A 3RWPA 4X2GA 3CJGA 1A06A 2RKUA 2G01A 4O6LA 5DWRA 4F1TA 1OBDA 4YLJA 2BFYA 1CTPE 4FYOA 4CVAA 3W8QA 5L2IA 4FIFA 4FNYA 3VWAA 4FTMA 3FLWA 4Y72A 4QQJA 4QPSA 4CCBA 1BYGA 2J6MA 3UJGA 2C3IB 2WO6A 4GVAA 4G16A 2ESMA 5IQEA 4FKIA 4BCIA 4UYAA 2GTMA 3H3CA 3N4TA 3C0HA 2X8DA 5EH0A 5J5TA 3QYZA 4CKIA 2RSVA 2XNMA 1H0WA 3S2PA 3UVPA 3EN5A 2QD9A 3AGLA 3MDYA 3N4VA 3ZC6A 3KULA 2Y9QA 3JS2A 4J98A 4R7IA 4PPBA 4WUAA 3UNJA 3ZS5A 4E73A 3BELA 2HK5A 3TDVA 3MY5A 5FXRA 3NVKI 2VNWA 4OT5A 3DAJA 3UIMA 4E6AA 4XYFA 4IDVA 3CS9A 3KREA 3VS0A 4O84A 3PXYA 5T68A 4FTIA 4M7IA 2JITA 5DE2A 2AYPA 2YJSA 4W4VA 3THBA 3R73A 4XUFA 5JRQA 2YCQA 4BCOA 3HLLA 3CQUA 4KRCA 2IW9A 4P90A 4RFYA 5I9ZA 4I5MA 2QLQA 2GDOA 4APPA 2IVVA 2BIYA 3NNXA 3TN8A 3ZFMA 4DEGA 3TV6A 1SNXA 2UW5A 5AX3A 3O7LB 2OLCA 4EHGA 2ITOA 5DT4A 2ITZA 1BLXA 4FUXA 2BRMA 3OWKA 2FB8A 4A4LA 4OUCA 5CSHA 4BKJA 3VF9A 4NIFB 4C33A 4DN5A 4MHAA 4EJNA 1OKVA 3LFDA 4EL9A 4LV5A 4ZZNA 4AQCA 1OKZA 4TYHA 3C5UA 3DPKA 3FI4A 3QTQA 4DTBA 4EH5A 1ZOGA 5DI1A 3C5IA 3LFAA 4QMXA 2JFMA 3ULZA 3C0GA 5F4NA 1ND4A 4IWDA 2X9FA 4V0GB 4TYGA 1YOLA 4O1PA 4UV0A 5AUZA 4DEIA 3EN4A 4I23A 1UNGA 2CLXA 4QQCA 2X2LA 4EOMA 4ACMA 4CFUA 3NCGA 4FIJA 2C3LA 2UZDA 5GIOE 4HYUA 4GIHA 3H0ZA 4C4GA 2YZAA 1O6LA 4ZK5A 1U5QA 3LM0A 4MBLA 4TNDA 3NUXA 3FMDA 3QALE 3UC3A 3ORMA 3MFRA 5AIKA 4G31A 4QP9A 2GNJA 1K2PA 3BKBA 4FOBA 4FIHA 1WBVA 1YI4A 1PKGA 4ZSGA 4C0TA 3MESA 3PSDA 2W9ZB 3DBQA 3KXXA 4XG4A 4PV0A 4WG4A 2YCRA 2Q83A 1W0XC 3N4UA 1S9JA 2YIXA 5FP5A 2F9GA 5AEPA 1RDQE 4FL1A 3VC4A 3ORTA 4IWPA 4PWNA 3ZRKA 3DKGA 5BUJA 2G2HA 1IRKA 3EN9A 3HRFA 1Q5KA 4JNWA 5AP2A 3VUDA 3ZLXA 4EBWA 5KHXA 3ATTA 4GRBA 4IAFA 2ZB0A 3Q6WA 3UGCA 4QT1A 1PXMA 2PVHA 4ZXTA 4TZRA 2WFYA 4O7TA 5CF4A 3AG9A 1ERKA 3GU8A 2XK4A 3PUPA 4YJPA 4C4HA 2J2IB 3KGAA 1URWA 2VZ6A 4R3PA 4CKRA 1A9UA 3AC3A 5IDPA 2CPKE 3LCDA 4J7BA 3HA8A 1XH8A 2QO9A 5EHOA 5BVDA 1GNGA 5KMKA 5CNNA 3SKCA 4NTSA 2WOUA 3D2IA 2C1BA 2EU9A 3P0MA 4MK0A 3IW5A 4BGGA 3WZUA 3WF8A 4YJNA 3WARA 1MQ4A 1U59A 4EK8A 3T8OA 5A6NA 2Y7JA 4NKSA 1R39A 4I4EA 5E8WA 3K2LA 5BPYA 3UP2A 4C8BA 3KMUA 3U4WA 3R8PA 3PJ2A 3A61A 2GQRA 4I92A 2YEXA 3RPOA 1ZRZA 3BEGA 3FV8A 3ORPA 2XP2A 4M97A 4F65A 5DR6A 4ORKA 3RVGA 2ACXA 3Q96A 4QP4A 5CF6A 5TOZA 3ANQA 3D15A 2RL5A 5HVJA 1ZY5A 4EKLA 3FYJX 4R7BA 3K3IA 2JAVA 2XNOA 2W0JA 4KBAA 4CTBA 5AUYA 5TR6A 4O7YA 4UXLA 4NM3A 4OR5A 4ZMFA 4KIQA 3O8PA 3HP2A 1KE5A 1WBNA 3QX2A 4U40A 4BI1A 4ID7A 3R04A 4WRGA 3JY0A 5TF9A 3AQVA 5J8IA 5DLSA 1FMOE 3O71A 1RJBA 4FTRA 2VWWA 3GFEA 4K33A 4RPVA 1F0QA 4AT5A 4ASDA 4PDSA 1U54A 5EDRA 5I9YA 5EQYA 2NPQA 1CKPA 2J0MB 5AR2A 5HG5A 2VGOA 3EQIA 5C8MA 2WZJA 3IK3A 3H4JA 4BDKA 3QF9A 3OCSA 4X2FA 4O7ZA 3TNQB 5JFXA 5E4HA 5L2WA 4F9YA 3LXLA 2RFDA 3QTZA 2UZOA 2E2BA 3UIBA 2CDZA 4RZVA 2NP8A 3AT3A 4FX3A 4QP2A 5AAGA 3UIUA 1E1XA 5IEVA 1UWHA 5AM7A 2B54A 4USEA 4OTQA 4ANSA 3VS1A 1TKIA 4YZBA 5FTOA 3P1AA 3ENMA 1DI9A 1UA2A 5FEEA 2O64A 3A4OX 3WYXA 4ZEGA 3DA6A 2W9FB 1U4DA 3NR9A 4HNFA 4JBQA 2YLFA 4GYIA 3CBLA 4XNEA 4I0SA 2BKKA 3Q9ZA 3QQGA 2HZNA 2W1ZA 3EOCA 1ATPE 4X7QA 1FVTA 4U3ZA 4BDIA 3WZJA 5LMBA 3HNGA 1YWRA 2A19B 2QU6A 4W4YA 3C1XA 4S2ZA 4FEQA 5DRDA 1XH4A 4HYHA 3QCQA 2PVJA 5HLPA 4GUBA 1I09A 3VF8A 3CPBA 2XKCA 3GXLA 2W05A 3I1AA 4DGNA 4LRKA 5CAPA 5IH4A 1KE6A 3FMJA 4K11A 4TTHB 4C2VA 3GCSA 3I6WA 4BDEA 5IA3A 5JQ5A 4ZTHA 2XUUA 4YSMA 4NM7A 4R7HA 4XX9A 3HAMA 3SG8A 1OL1A 4OTHA 4CFNA 2G15A 3FZOA 3ODYX 4ANOA 4C35A 3SW7A 5D41A 4O7WA 1YRPA 1DAYA 2OO8X 2R3RA 5BUEA 4UXQA 4CNHA 1A48A 3U54A 3NVMB 2ITWA 1OGUA 5K0XA 1V1KA 4RBLA 3HDMA 3NYXA 3REPA 2RFNA 3VS3A 1GAGA 4DGOA 1VYZA 4O0UA 5IKWA 3FZSA 4DFXE 4E20A 4BY9E 5DYJA 1IASA 5ANJA 4B8MA 4USFA 1CKIA 2IW8A 2FO0A 2X39A 5EQEA 4QMQA 1H28A 3PRFA 1PKDA 3MPTA 2HZ4A 1PMVA 4K18A 5D12A 3UG2A 4K8AA 3ZBFA 4ZJVA 5CAUA 3F2RA 5J9LA 3QUEA 2C0OA 2VNYA 5AWMA 3R01A 3HV3A 2ITVA 2VTAA 2QR7A 4HJOA 4U97A 5AUVA 4HGEA 2JC6A 2GSFA 5KCVA 5L2TA 1X8BA 1QPJA 1PMUA 1PXPA 4FSQA 4UWYA 3GNIB 3W2PA 4FNWA 3PDTA 3IDPA 5K5XA 2WMSA 4ZLOA 5DEWA 4KKHA 3Q4ZA 1XBCA 4LM5A 3SOCA 1W7HA 3OWLA 3V5JA 3R7YA 4YMJA 2C5OA 1IA9A 4FG9A 4G5JA 5M4FA 3TNIA 3R9RA 4QP7A 1BX6A 1ZXEA 4DBXA 4RC4A 4RSSA 4MVFA 3NMUF 1CKJA 1IR3A 4GSBA 2GHMA 4IAKA 4KNBA 3ZONA 2P3GX 2XK7A 4AT3A 2B1PA 1LEZA 1MRVA 4RLLA 4ZOGA 3QHRA 4PPCA 4XG2A 2PE2A 3QZFA 5CWZA 4BZOA 3CD3A 2J4ZA 4NKAA 4PMTA 4EOJA 5GZAA 4I3ZA 3FYKX 2REIA 1PY5A 4NIFA 2HY0A 3QGYA 4BZNA 5JMSA 4M67A 3GCVA 4J53A 4ZY4A 2Z8CA 3HX4A 1BI8A 4A9UA 4O0WA 4I24A 3UO4A 4D2VA 2R3IA 3VNTA 2ZJWA 4ZTLA 1J91A 1WBWA 3LM5A 3QTRA 4LGHA 1UVRA 3G6HA 4GU9A 4V0GA 3RINA 4TXCA 5K9IA 3EQGA 1M17A 2F2CB 3TXOA 4EORA 4IJPA 4LMNA 1DAWA 4E1ZA 3L9NA 4MX9A 5CZHA 4ZZOA 4LQMA 2EB3A 5FLFA 5KMNA 4DHFA 5AP5A 2HWPA 1ZMUA 3PXKA 4ANMA 3JUHA 4KBCA 4WRSA 4F4PA 2PZRA 4JG8A 3HMPA 2OIDA 1Q24A 2HXQA 3GBZA 4U8ZA 5CANA 5EKNA 5JK3A 5HO6A 2BRBA 3QD3A 1PHKA 4FT5A 4KSQA 1SM2A 4XP0A 5IEYA 4Q9SA 5FD2A 5HG7A 4D4YA 5HLWA 3FQHA 3GI3A 3ZLSA 4BIDA 5GIPE 4GYGA 4AW0A 4FIGA 2OI4X 3DLSA 3E62A 4JXFA 3VO3A 3SRVB 3ZMMA 2VO6A 3PA4A 5EW3A 3FBVA 4YZMA 2B9FA 4KWPA 5ANOA 2BZIB 4YJQA 4BBEA 5CF5A 5ITAA 2ZDTA 4R3CA 3PWYA 4TWPA 2JBPA 3DNEA 4OBQA 2Y0AA 3FLNC 2PVFA 5IMEA 2UW9A 4CFMA 4PP7A 4U79A 1OKYA 2XIKA 3R83A 5IQDA 5HE1A 3ZSHA 3OY3A 4X2JA 3TNPC 2ZVAA 4IC7A 3EKKA 3OXTA 1U46A 1CM8A 3BGZA 4IZ5A 3H9OA 3K5VA 4CT2A 3G2FA 3S3IA 4AZTA 5H3QA 1PF8A 4EYMA 3QGWA 5LVMA 3E8DA 3BLRA 4JIKA 4U43A 1FINA 1QCFA 3BYOA 3QRKA 2OW3A 4QMSA 4BDFA 5IUGA 3DB6A 3O2MA 4HVSA 3GOKA 1Q3WA 3DBEA 5CY3A 4IH8A 2BHHA 2IN6A 2PTKA 4YC6A 4LGDA 2WD1A 3MSSA 4UWCA 5EW8A 3HP5A 4HPUE 3KA0A 2CKOA 4Q9ZA 3PXQA 4BI2A 3KF4A 1H08A 2ZM1A 1UU9A 4IZAA 3V04A 4AGWA 3IW7A 4PPAA 3RI1A 3I6UA 3LPBA 5EHYA 5BMMA 4L00A 2X4FA 2RF9A 1OUKA 5CI6A 3MA6A 3BWJA 3CJFA 3PG3A 1P4OA 1F5QA 5J9YA 3P78A 1H00A 5L2SA 4JOAA 3QZIA 4PL3A 3I60A 3TT0A 4BR3A 2W99B 5JEBA 2VX0A 3IQ7A 3OOGA 3BGQA 2EWAA 2OBJA 4OT6A 4ZTQA 2IWIA 4S33A 4ARKA 5DVRA 3R7UA 1Q99A 4TWOA 3R8UA 3QQLA 4XG7A 3Q4CA 4F0IA 4YJVA 4CFFA 4IVCA 3LMIA 2HY81 4C4JA 2V0DA 3QCYA 1R78A 4FK6A 1YOMA 1OL2A 2Y4PA 3BU5A 4ZAUA 4FSRA 4D2SA 2XNPA 3IPHA 2RFEA 4O0RA 4UWBA 5C26A 3IGOA 4CYJA 3NDMA 2AUHA 4FV6A 4TWNA 3AMBA 4RVMA 3FHIA 3ORXA 3ZHPC 2UV2A 4DLJA 2WHBA 3FQSA 3PVBA 5CNOA 3KC3A 4UMUA 4MBIA 4O7SA 5FWKK 3FPMA 5LXMA 1OPLA 5EQPA 3L8PA 1J3HA 3KXMA 3QTUA 4V05A 3IOPA 1T46A 1Z57A 4CQEA 4F09A 4AA5A 4D4VA 4FC0A 3VJNA 3ORKA 3ZEWA 4R77A 2ONLC 3DFAA 1YWNA 3I0OA 3DXPA 1H8FA 4E4MA 4AOJA 1YHVA 5D9HA 2X1NA 1YQJA 4AXAA 3P7CA 2VTIA 1PXLA 4K0YA 3CPCA 4S32A 4B99A 1ZY4A 5ACKA 3A7HA 3R9OA 1BL7A 4Y73A 4F7JA 3MFSA 5DN3A 4MXXA 3A60A 5FTGA 3UBDA 4BDHA 4HVHA 4XG9A 4J52A 5T6KA 2VRXA 3PSCA 1UU3A 1YW2A 2VO3A 1V0OA 3DZOA 3KK8A 4O6EA 4FBXA 4DYMA 2VX1A 2BZHB 4F0FA 3VHEA 5FEDA 3VBTA 2BFXA 4FZ6A 5CASA 5KHWA 4RZWA 4MXYA 1FQ1B 3IGGA 3KRLA 4ANNA 2OG8A 5J1WA 3ZCLA 4BKYA 1PXOA 3G33A 4R6VA 1PYEA 4BRXA 3PZHA 4FV4A 4ERKA 5IA4A 4AT4A 2VTTA 3JXWA 4EUUA 2NRYA 4U80A 5DRBA 4MF0A 3KXGA 3VBWA 5M4IA 2GQGA 3V5TA 4EJ7A 2JBOA 3OTUA 3FLZA 1OM1A 3RAWA 5TT7A 3C4WA 2PE1A 3M11A 2IZRA 4RLKA 4FSNA 4ZS0A 2PUUA 2I1MA 4G6NA 4F9AA 3QAME 2SRCA 4WO5A 5J9ZA 4BIBA 3G51A 1MP8A 4NH1A 4IHPA 4D9UA 4ZS4A 2ITPA 4BDGA 2EXCX 3FY2A 5CENA 1YHWA 1L8TA 4ANLA 2PL0A 2XNBA 4QP8A 4IB1A 2ITQA 2X8IA 2YDJA 4FODA 3NGAA 5L8LA 3QQHA 2Z7LA 4GUEA 2E9NA 3L8SA 3A8XA 4KINA 5CQUA 2GNIA 4X3JA 4A07A 3LFSA 1FMKA 3HRBA 5IG1A 4MCVA 2XNEA 3H10A 5AP6A 3PA3A 1APME 3KRJA 4PL4A 1Y91A 1NY3A 1FVRA 2JLDA 2ZV7A 3MW1A 3MH0A 4FVRA 4TYEA 3B2WA 2W1HA 3SD0A 4EOSA 3C4XA 3KRWA 4YC8A 5AV2A 4D2PA 2W5HA 3U55A 1H01A 2EXEA 4AFJA 3RM7A 3CSVA 3F7WA 2VTJA 1SVHA 4BDBA 3BE2A 4C57A 3AC8A 3L9MA 1URCA 3WE4A 3FLYA 4BKZA 2WGJA 5LVOA 5I5ZA 2OKRA 1BUHA 4FIEA 3FJQE 1TQIA 5IISA 3QTWA 2BROA 2HOGA 3ZZEA 3ACKA 4H1JA 3C4FA 4JRVA 5LJJA 3KXHA 3CCNA 5HNGA 3BX5A 2OK1A 3PIZA 2XK8A 3NNWA 3SRVA 3FXWA 3FKLA 3R02A 3Q04A 5EM5A 3QCSA 3PA5A 2DS1A 1MQBA 3VIDA 1JQHA 2R3LA 4HCVA 5EM6A 4QMMA 4L3LA 3D5UA 1GZKA 3P86A 4WNPA 4C4EA 4F08A 4BHZA 4F0GA 2FYSA 5AUXA 3HGKA 4C58A 2DQ7X 5HLNA 3GC0A 4IZ7A 4RIYB 5F95A 4A9SA 1VZOA 3DCVA 2IJMA 3VS5A 2OGVA 3R8VA 3AD5A 5ICPA 5HIEA 4GS6A 3OCBA 4DH7A 3PP0A 4JAJA 5LQFA 4DEAA 3FL5A 4IAAA 5AV4A 3TACA 4OAUC 3TZ8A 2IW6A 4QMYA 1SMHA 3FLSA 5K4JA 3GENA 4ZTSA 2B9HA 4ALVA 1RW8A 3EZVA 5KE0A 4JLCA 2VTOA 1WMKA 4I1ZA 2Z7SA 3R7VA 3AD4A 5BYLA 4MNEB 4XRJA 4FSUA 4HPTE 3UZRA 1OB3A 4USDA 4FSWA 2OXYA 2OXXA 4FKVA 1E1VA 4L53A 3QQJA 4FEWA 2P2IA 3KMMA 3S95A 5KX8A 3QC9A 3RCJA 4XLIA 4FTQA 2OSCA 4A9TA 4CZTA 1TQMA 3U8WA 3ETAA 2W1EA 2IVSA 2VWYA 4RJ4A 4HVDA 2UZVA 4GV1A 3ZUTA 3T3UA 5FBOA 4Z7GA 4GG5A 4AN3A 3EFKA 4FTCA 4WHZA 5EW9A 2C6KA 3DFCB 5AR8A 4FSZA 4YNOA 2WTCA 3FMLA 4XV9A 3BU3A 4IX6A 4YO6A 5AR5A 5A4CA 5IZFA 3UNKA 5E92A 3RM6A 4ASEA 3MY0A 4R3RA 4CG9A 1YDTE 1YI3A 2HIWA 1Y57A 1H0VA 4QRCA 4JDKA 3ZXZA 2GS6A 2QONA 5JFVA 4FV2A 3PE1A 2WMWA 4X21A 2V55A 1GZNA 1O6KA 4BYIA 4FICA 5JKGA 2PUPA 3ZBXA 4BCQA 4TYJA 5EG3A 1I44A 3ROCA 1XBBA 1WBTA 4I5HA 3PVGA 1P5EA 4LOOA 2F4JA 5CU4A 3UZPA 4RJ8A 2WQOA 3LKMA 3PG1A 4BBMA 3SGCA 3DK3A 4I6QA 3CQEA 2UZTA 3UYTA 1OMWA 4AGDA 4I93A 2PMLX 3EYHA 2ZOQA 2YM8A 4UALA 3MVLA 3UTOA 2CKPA 5JFSA 2X7GA 3P08A 2C68A 4JR3A 4XG8A 1ZLTA 5ETFA 3R9NA 4PX6A 3ORIA 3P4KA 3ENHA 3DB8A 3EN6A 3L1SA 3SHEA 3R2YA 3W18A 2VWZA 3FUPA 3KKVA 3PXZA 4XBUA 5AUUA 4YPDA 4Z7HA 5BVWA 4ALWA 1JAMA 2IVUA 2WQNA 3NCZA 5IQHA 2W1FA 5F94A 4ONAA 4MQ2A 3LVPA 4A4XA 3OCGA 4E5WA 3TKHA 4AZVA 2WIHA 3BLQA 5CXZA 4AGUA 2QVSE 5EYDA 3MBLA 2OFVA 4PDPA 4LOPA 3NUSA 4D1SA 4D9TA 3DU8A 4MWHA 3ZXTA 4RJ3A 1BKXA 3AT4A 4YJRA 3DKOA 5DA3A 3VBXA 5ANIA 5BNJA 4UBAA 4J99A 4YLLA 3RALA 2YIRA 1JKKA 4LUDA 4MEDA 3BYVA 5A14A 3DZQA 2VO0A 3GCUA 5LOHA 3I5ZA 3SXRA 4DH3A 5IH6A 1WVYA 3WILA 4AA4A 4CD0A 3TJCA 3WF6A 1KE9A 5HBHA 2ITTA 2C5NA 3KK9A 3RNIA 5HU3A 4FTNA 1XWSA 4R5SA 1P2AA 3C4ZA 3LQ8A 4FT3A 3UMWA 2HW6A 3R0TA 5G6VA 4QMNA 3DDPA 2VWUA 2V22A 3I7CA 2R3KA 4B6LA 3E8EA 4DFUA 2R3OA 3IS5A 3L8VA 3NUNA 4TY1A 4EQCA 4D4RA 3F82A 4EOLA 1LPUA 4PMMA 4A9YA 4FKSA 5E8YA 2J9MA 4DEEA 3EQRA 4TN6A 3KL8A 4YSJA 3BU6A 1CSNA 4IMYA 4NSTA 3FZ1A 2HXLA 3DXQA 3ZRMA 2OZOA 3LJ2A 4D0XA 2QOQA 3D2KA 3E64A 4EH3A 1REJA 2H6DA 2A2AA 4NZWB 5FXSA 3V5QA 3BYUA 4FT9A 2O5KA 3ZDIA 5DR9A 5FUTA 4MD9E 4O22A 2OICA 4UZDA 3W32A 4D28A 5EYMA 3JR1A 2RG6A 3F5PA 4JT3A 3EIDA 3MYGA 5H2UA 2QR8A 4DE4A 1LUFA 4GK4A 2WTKB 2BR1A 3LQ5A 2BRHA 2V7OA 4RFMA 4OTRA 3VUMA 4DFLA 3L8XA 3VS7A 1YVJA 4LUEA 3RP9A 2IPXA 5K4IA 2ZV2A 1IG1A 5E8ZA 2ERZE 3LXKA 2UZUE 3Q32A 2A27A 2R7IA 4JS8A 3F9NA 3VHKA 5LVPA 1Q8WA 3I7BA 5FRIA 2XZSA 3NNUA 3PIXA 3R6XA 1Q61A 2O2UA 2XK3A 3R8MA 3TTJA 4C34A 4M14A 5IH5A 4G34A 5AX9A 5JGBA 2Y8OA 3UDBA 3M42A 1JOWB 3IW8A 3TM0A 4QTAA 3RBWA 4JL9A 4U42A 4O27B 5CAOA 4M15A 2XJ1A 3NW7A 2C3JA 4GJ3A 4RQKA 5E1EA 4B4LA 5JN2A 2GHGA 3IG7A 5CSWA 5L6PA 3I0QA 4YC3A 1TQPA 2FGIA 4YU2A 3IW6A 1WBSA 3V01A 4W8DA 4ACCA 4NEUA 3QUDA 5FG8A 2ERKA 3HEGA 4RJ5A 3OVVA 3P9JA 5EI6A 5HQ0A 5HX6A 4D4SA 3Q60A 4IWOA 2WMBA 3E3BX 3O0GA 5CX9A 2ONLA 2WPAA 4HVGA 2X7OA 4W4XA 2EXMA 3OC1A 1IAJA 3E7OA 3HKOA 3KCFA 2XBJA 2P2HA 4YJOA 2W4JA 4L45A 4F1OA 3ROYA 5AAEA 4FEUA 4ZSAA 4E4LA 2C0IA 2VX3A 3FMKA 4YZNA 3CC6A 2F7ZE 4IB5A 2ZB1A 1LP4A 4DTKA 3AC5A 2R3QA 2GFSA 2BVAA 5EK7A 5AFVA 2J0KA 1OIQA 3GU5A 4J95A 4XEYA 4HGSA 1NVRA 3SQQA 3PYYA 4AP7A 1QMZA 3KMWA 1SYKA 1M2RA 4YGAA 5LCJA 4IX5A 3BGPA 4FI1A 4QTDA 2CNUA 5BVEA 2BZJA 4IX3A 4RIYA 3ERKA 3JPVA 4QYEA 5ETIA 4CRSA 4ZIMA 2QOLA 5AIRA 3KRXA 4KUJA 3DQWA 3W2RA 5M4UA 2CLQA 2OFUA 3GC7A 4QYFA 5IA5A 4EI4A 3TJDA 2WKMA 4GFOA 3Q9YA 2ZM4A 3DBDA 4RJ6A 4WNKA 4BTMA 4EK5A 5LWMA 5FDXA 3SDJA 4NJDA 3OCTA 2FVDA 3Q9XA 3R00A 5EFQA 5CVFA 4DGGA 3GVUA 2QC6A 4MNEA 1XH9A 1YHSA 4YTFA 4XG6A 4PRJA 4KS8A 2O0UA 4F9CA 4LV8A 2WU7A 3ZM4A 1FVVA 2OXDA 4XV1A 5ANDA 2EB2A 2ZMCA 3RZBA 1DS5A 5ACBC 4BC6A 3A8WA 1M7QA 1Q3DA 2YIYA 3CGFA 4FKGA 4FV1A 4PL5A 4GL9A 3ZU7A 4N57A 3G0EA 4I21A 2X6DA 3IKAA 2ITYA 1PMNA 3D4QA 4IWQA 4LGGA 5CT7A 3A62A 3ZH8A 3F61A 3DAKA 2QOOA 3LFCA 1JWHA 3F3WA 4DGMA 4BZDA 4BHNA 3EWHA 1B38A 3KCKA 2VTRA 3OS3A 3PJ1A 3DGKA 4IW0A 3O50A 4M84A 5GNKA 2BUJA 3R1QA 4XCUA 5AP7A 4FTKA 2R2PA 3D9VA 3TCPA 1JSTA 1H1QA 3P7BA 4B7TA 4P5QA 4DBNA 4FE2A 5FDPA 2WMRA 1YDRE 2BZKB 3LFFA 3MN3A 1NXKA 3MPMA 4FF8A 1F3MC 4L3PA 4OLIA 4Q5HA 5HGIA 3PY3A 5EI2A 4KAOA 3VS6A 4AZWA 3HA6A 5KBRA 2YWVA 3LFEA 2X8EA 2R0IA 3GEQA 3LXPA 2CGUA 4DC2A 2HW7A 4EYJA 4AWIA 2BRGA 4CZUA 5J87A 1ZMWA 1WCCA 4FKWA 4TWCA 3NSZA 3PIYA 2JFLA 1CMKE 4FG8A 1WAKA 4WIHA 3VUKA 3MA3A 3KFAA 5CEQA 5AR3A 5HO8A 2VTLA 4GCJA 1QPCA 4BTJA 3OWPA 3NPCA 3S1HA 2IZTA 2VU3A 3RZFA 2C47A 3PVUA 4NJ3A 2YCFA 3H30A 5HD4A 2PWLA 3BBTB 4R1VA 2WMAA 3MFTA 2I0HA 4X3FB 1K3AA 2HZ0A 2YDKA 1XH7A 4WA9A 4BTFA 5CEIA 4DCAA 3TL8A 1W8CA 3EQHA 4ZZMA 4IBMA 2P55A 4AGCA 5F9EA 3DBFA 1B6CB 5E8UA 2WTDA 3B8RA 4HCUA 1AQ1A 3D5VA 3O8UA 3QRJA 4LMUA 5LMAA 4EEVA 3E88A 3KRRA 5D7AA 4RWKA 3NW5A 4RFZA 3PPKA 3UQCA 2BAKA 4FZFB 1WBPA 4FMQA 5D7VA 3BQRA 2W5BA 3F3VA 5AP3A 3ZFYA 4FEXA 3L9PA 3CD8A 1XJDA 5H8EA 4G3GA 4WSYA 4FV5A 3UPXA 3F3ZA 2OF2A 1J7UA 3COIA 2R4BA 3QXOA 4FTLA 3W10A 4BCJA 4O86A 1YI6A 2QG5A 3O17A 4CTCA 4D1XA 4DT8A 4CMTA 2WQBA 5HOAA 3F3TA 2FSLX 4M13A 2ETMA 3NRMA 4QMOA 3QQUA 4MXCA 4QMWA 4QYGA 5LVLA 3WE8A 3HVCA 3FI8A 1G3NA 3WZKA 4BN1A 4EH8A 4D1ZA 3R7OA 2ZYBA 5B2MA 3Q5IA 2XF0A 4JDHA 3LMHA 2GQSA 2GHLA 3VUHA 5J79A 4GKHA 4IQ6A 4WNOA 4WNMA 5G1XA 4ANBA 5ANKA 4EOQA 3COMA 2PMOX 4L6QA 5CU2A 2BDJA 4HVIA 2Z02A 2V5QA 4C38A 4ZSLA 1R0EA 3KQ7A 4EZ5A 1XR1A 2PK9A 2ZDUA 4YZ9A 4XHKB 3SW4A 2JD5A 3FAAA 2AC5A 3F66A 1H26A 1OPJA 1GJOA 3VQHA 4H58A 3IECA 1J7IA 4NL0A 4WG3A 4KD1A 5CU6A 4GW8A 2WXVA 3E87A 4MD7E 2DYLA 2GTNA 4FKRA 1P4FA 4Y5HA 5FXQA 5IQBA 2J0JA 5L4QA 1YXTA 3G9NA 5HORA 1XQZA 3I79A 3UOHA 4E8AA 3II5A 2NO3A 3E93A 4O0VA 4D0WA 3GOPA 3R30A 4C02A 3FMMA 3WIKA 2W4OA 1ZZ2A 3WZDA 3UPZA 3FLQA 4GK3A 2QHNA 4PMSA 4E4XA 4EQMA 5DBXA 4DF3A 3COKA 2WEVA 3HMOA 4WT6A 3OBJA 2J5EA 2PSQA 4FKUA 3HV5A 5HI2A 3U6IA 2C6TA 4NCTA 3VUGA 3WOWA 4K1BA 4I6BA 4BTKA 4DH8A 1B39A 4FV8A 3R1SA 3R22A 5IQIA 4J96A 4NWMA 4RGJA 4YURA 4RIWB 3BHHA 3RNYA 3UE4A 3ZFXA 4PDYA 1UKIA 4AE9A 2QOKA 3FMEA 5HE2A 3CEKA 5D11A 4FKLA 4WKQA 4EH9A 3C0IA 4I6HA 3S0OA 3NYNA 4EZ7A 2W5AA 1FGKA 3RK9A 2UW3A 2UW4A 4BCPA 5CEKA 4YJTA 2QLUA 4MWIA 4F64A 1PXKA 3RPRA 3D5WA 4FEVA 1E9HA 3EFLA 4ASXA 3PSBA 5HVYA 2J7TA 1OZ1A 4ZTNA 4PY1A 5KKRC 2BIKB 5K0KA 2WTVA 5FEQA 4OAVB 1M14A 4QNYA 5IQGA 2ZV8A 3QKLA 4IM3A 4E93A 3QTXA 3HZTA 3V3VA 3PXRA 4RRVA 3LW0A 3FSKA 3PFQA 4S34A 3TI1A 1UWJA 3FC1X 4WD5A 3TUBA 4O82A 4P4CA 3WBLA 3LQ3A 4JQEA 3W2SA 1RQQA 3CE3A 4CFXA 1K9AA 1UU7A 5IA2A 4U41A 3DK6A 2XIRA 3JY9A 3F5XA 3FY0A 4O1OA 2X4ZA 4MKCA 4I0TA 3AMAA 3BEAA 4IIRA 3NAXA 4I94A 5M07A 4JJRA 4PTCA 3Q2MA 4RX9A 2WTIA 2R3GA 3LFBA 4K2RA 4Y8DA 2ITNA 5IQAA 2YN8A 4G3DA 4NU1A 2VTMA 3DJ7A 3N51A 4LFIA 1OIUA 4P5ZA 2J51A 2HENA 3MIAA 3MB7A 4RIOA 4GKIA 4W8EA 4FVQA 2J90A 2UZLA 3KF7A 3VAPA 2QOFA 1JBPE 4PNIA 4KRDA 3V51A 1Y6BA 4ZY6A 2F7XE 3DV3A 4ZJJA 4X2NA 2E9UA 5HU9A 2CKEA 3UO5A 4QYYA 4I5CA 3E5AA 4IVBA 5J7BA 1CDKA 4RA5A 4D2TA 2CHLA 2XNGA 1ZAOA 2A1AB 4RX8A 4M0YA 2UVYA 2PVKA 5LWNA 4O7NA 1XBAA 1OL6A 5HD7A 4QTEA 3MH1A 2QKWB 4FTTA 5CU3A 5BVKA 5M4CA 4G17A 4L67A 2UZNA 5HG8A 5I0BA 3G6GA 4XBRA 4IM0A 2VAGA 3U6JA 3QUPA 2JKKA 4WBBB 4XH6A 3ZDUA 4QTCA 4C62A 4AAAA 2UVXA 4KS7A 1Q62A 4G3FA 4OTFA 4WSQA 4XS2A 5DGZA 1OECA 3QXPA 5HNIX 1ZYSA 3FI3A 2PMIA 4BWKA 3PVWA 3VBQA 3R21A 3RPSA 4HYSA 4CGAA 3ZO1A 2OZAB 3W55A 3OZ6A 4BIEA 4DCEA 5I9XA 3U87A 5HE0A 1QPEA 3FQEA 2B53A 2PHKA 5HKMA 4AS0A 5I3OA 4CG8A 5EDQA 4U5JA 2BAJA 3Q4TA 2H96A 4F6SA 1STCE 3VBVA 1OKWA 4ZMEA 2I40A 2WELA 2VTQA 3ZLWA 1LEWA 2V7AA 4XOYA 3VUTA 5J5SA 3G9LX 5AA9A 4C37A 3NUPA 4HZSA 2XYUA 4FV9A 3MH3A 4LI5A 3OMVA 1NT2A 5HICA 3HECA 3ZO2A 4AA0A 3PPJA 1BL6A 2PUNA 2R3JA 3OW4A 4CCUA 1R3CA 1WVXA 2O3PA 2IG7A 4NTTA 2OU7A 5KKRB 2ETKA 2R9SA 3VULA 4ENXA 4FZ7A 3NS9A 4PF4A 3MTLA 3C13A 4UYNA 1J1BA 3KY2A 4Y83A 5CS6A 1GOLA 2W96B 4M8TA 3R8ZA 4QO9A 4UMRA 5DMZA 2YM3A 3WF9A 5CSXA 3UQFA 2DUVA 4PTEA 5CEOA 1OITA 5EM8A 4AW2A 5B2LA 3LE6A 4X3FA 4UB7A 3F6XA 5IQCA 1WVWA 2JKMA 4O0XA 3QCXA 4YHJA 3ZM9A 2J50A 3CTQA 3WF7A 4H36A 4CSVA 2QI8A 2XMYA 4FTUA 5CEPA 4EONA 3C9WA 1KOAA 5IF1A 2JDOA 3VRYA 5DT3A 4G3CA 3POOA 3F5UA 3QD2B 1BMKA 3FMHA 3ORNA 4YLKA 5GINE 2JKQA 3TNHA 4H1MA 1ZWSA 5IUIA 2QOIA 2F2UA 4CMOA 4JR7A 4OTPA 5LMKC 4MAOA 1PXNA 2B55A 4FZDB 4IB0A 4RX7A 2WMXA 3KXZA 4K9YA 2W06A 5AV0A 3LFNA 4BB4A 3NNVA 4CRLA 2IZUA 3OWJA 3D5XA 2XVDA 2HZIA 2JDTA 2CSNA 2XK6A 3RHXA 2GS7A 3IDCA 2JEDA 4FTOA 4ACDA 5HBJA 2YERA 3UG1A 2VUWA 4O91A 3DK7A 2LGCA 2UZWE 4FKJA 3TEIA 3V8WA 4OTGA 4EKKA 5JZJA 3OY1A 5CYIA 3UYSA 4Y95A 1WZYA 3DDQA 3R1NA 4NK9A 5E1SA 3UP7A 2PULA 3TZ7A 4IFCA 4BI0A 2UUEA 4N6ZA 3PE2A 2WAJA 2XB7A 4FNZA 2GCDA 2YZLA 4IAYA 3ZYAA 4NW5A 2NNWB 1IAHA 1XHAA 5KMOA 2C6DA 3VN9A 4F9WA 4L9IA 5L2QA 3MS9A 3NEWA 4O2PA 4BICA 4BCMA 1YXXA 2FSMX 4WG5A 3DOGA 5BYZA 1VEBA 5F20A 3PY0A 2GNLA 3M2WA 3GGFA 1M2PA 1SVGA 3O7LD 4FGBA 4MXZA 4ZY5A 1KSWA 2PZYA 3QWKA 5BQ0A 1V0PA 4CYIA 1NA7A 4G2FA 4QYHA 4CQGA 1YXSA 3SXFA 3WYYA 2R3MA 4CEGA 4FT0A 3PWDA 4JX3A 2JIUA 3TKUA 4C3RA 4L44A 5FTQA 4EWQA 2GPHA 1H27A 4FK3A 5GHVA 3FEGA 4UMTA 2F7EE 4AF3A 3UZTA 1ZYLA 5DT0A 4NM0A 4FKTA 4ZLZA 4D2WA 4U7ZA 2OJ9A 4X6QC 4EK6A 2WTJA 3E7VA 1OL5A 4X6RA 3BHTA 3SOAA 2BALA 3QX4A 1ZYJA 4YHTA 3GC8A 4E4NA 5M53A 2WQMA 3F3UA 4RIWA 2Z60A 5FM2A 5M51A 5HVKA 2G2FA 2GNFA 3OBGA 3AC2A 2B7AA 3SAYA 3ZO3A 2XEYA 4V01A 4HOKA 4IEBA 4DA5A 3UIXA 4M3QA 4EHZA 4QQ5A 5KMLA 3O23A 3QTSA 4DFZE 2YITA 4DG0E 3Q2JA 3EH9A 4M12A 5C4KA 1YKRA 3N9XA 4MYGA 3ORZA 5H9BA 3V5LA 3VUIA 3WZEA 2VWIA 5M09A 4HGTA 4OW8A 5ANEA 3MV5A 4IB3A 5E7RA 3BBWA 5JH6A 4TPTA 4CT1A 4J1RA 4EH6A 5HX8A 4JQ8A 3QRIA 5D10A 4O7LA 4GIIA 5CVGA 4FG7A 1J1CA 3BRBA 2JDRA 4W4WA 3D7TB 4GT5A 3ATSA 3BE9A 2OJIA 2EVAA 3BV2A 4CV8A 2WTKC 3A7FA 3FMNA 3UODA 3GUBA 3S4QA 4F7NA 3RMFA 3ZRLA 4AZSA 4R78A 3EFJA 2O63A 3RWQA 2Q0BA 2OWBA 2VTPA 3MI9A 5EYKA
chains in the Genus database with same CATH superfamily
3GT8A 1JSUA 5ETAA 4U45A 3ZUUA 3QQFA 3UO6A 4DITA 5GZ9A 2ZMDA 2GMXA 1FOTA 2QCSA 3CP9A 4FUYA 4NCTC 4YO4A 4O7VA 2Y4IC 5I9WA 1GIHA 4S31A 2BPMA 2XM8A 5AJQA 2JKOA 4GT3A 4IAIA 4L42A 3V5PA 4B9DA 4RIXB 4S30A 2PYWA 1OI9A 2C5YA 4IDTA 4L46A 3W0SA 4UMQA 4DFNA 4D55A 4Z3VA 3NIEA 4JDJA 2XS0A 4XG3A 4F6UA 5IPJA 3MJ1A 4YTHA 2FSOX 5HE3A 3D94A 3NLBA 4IXPA 4BJJA 5KMIA 4Y46A 1H1PA 3M1SA 4KIKB 2PVYA 4NFMA 4QPMA 5IDNA 2X0GA 5CF8A 4M69B 2PU8A 5C01A 3FL4A 4X0MA 4FT7A 4O0TA 3AXWA 3E8NA 2UW6A 4FZAB 5L3AA 3MWUA 3HUBA 4NUSA 3MVJA 2BRNA 1Q41A 3F2NA 3GCQA 4I0RA 3A99A 5E8SA 3KB7A 4RG0A 2ZAZA 4BWXA 4BF2A 5TO8A 4DT9A 1ZOHA 3GU6A 3RPVA 4C4FA 3PLAE 4BCGA 4MTAA 5M55A 3TTIA 4EK4A 3VBYA 4Y85A 3KN5A 4JBPA 3BV3A 3TZ9A 4ENYA 4AZEA 1R1WA 3O96A 3HRCA 1M2QA 2OZAA 2C6IA 4D58A 5JT2A 5GJDA 4IJ9A 4NW6A 3QBNA 2GU8A 4OTDA 4BCHA 4G1WA 4G3EA 5ANGA 5M44A 3W2OA 1SVEA 3GU7A 3BI6A 3RAKA 5DNRA 3TV7A 2JIIA 5TE0A 3P5KA 1ZZLA 2J5FA 4NFNA 5B7VA 2CNVA 4PP9A 1GZ8A 2RIOA 3RCDA 3V8SA 4RC2A 4IAZA 1ZARA 4BCKA 1YXVA 5AV3A 5B0XA 2P4IA 5FP6A 2X81A 3HDNA 3Q5ZA 4XLVA 3AC4A 4E6QA 1Z5MA 5A3XA 5K3YA 5HCYA 4X2KA 1PJKA 1GIJA 4ITJA 2P33A 1KV2A 3UC4A 4RVTA 3H9RA 3WI6A 1HOWA 2X2KA 2R5TA 2F49A 4L7SA 3DS6A 4C3FA 4RWJA 2WU6A 4IM2A 3KEXA 4LRJA 2B4SB 2W1IA 1R0PA 3TKIA 4CFWA 2PZ5A 3CY3A 4U6RA 4ZTMA 5A46A 4QP3A 1JKSA 3TIZA 3RGFA 5C27A 2YAAA 3RAIA 5IU2A 4YZDA 3CKXA 2CMWA 3S00A 1O9UA 2ITUA 4KBKA 4DG3E 3DXNA 4XRLA 3MPAA 3LLTA 4TRLA 4DGLC 4OTIA 4ACHA 4WOVA 2VV9A 4Q2AA 3DKFA 1P14A 3KVXA 4U81A 3ZEPA 2Y4IB 3H0YA 2GS2A 3HMMA 5CZIA 4RWIA 4BGHA 4M68A 3CKWA 4D5KA 1YOJA 1NVSA 4EHVA 3AGMA 4AN2A 1PYXA 1XO2B 5M56A 3EYGA 1U5RA 1XH6A 5EDPA 1JVPP 4FTJA 2ETRA 4F6WA 2QNJA 4O21A 1W83A 4TNBA 2WMTA 5A4QA 4BWPA 2W17A 3IOKA 5BUIA 5C9CA 5DEYA 3F5GA 3ORLA 5DG5A 1M52A 2XIYA 2CJMA 2QODA 3NYVA 5CSVA 3OEFX 3SX9A 4EBVA 5KBQA 2WIPA 3Q4UA 4O38A 2CN5A 2YA9A 3C4CA 4JVGA 4EOKA 2HYYA 2BAQA 3G15A 2VGPA 4F99A 2QO2A 3P7AA 3WIGA 5CU0A 2FUMA 4YJSA 1MUOA 2QURA 4J8NA 3PRIA 2XJ0A 4TL0A 2UW8A 3CY2A 3CTJA 4GH2A 3QA0A 2YWPA 3W1FA 3Q6UA 1DI8A 5HZNA 1PXJA 4X3FC 3AT2A 3CGOA 5HTBA 3DAEA 3NWWA 4MBJA 1H1RA 1WBOA 5E90A 4B8LA 2H9VA 4BCNA 2E9OA 4TYIA 3V6RA 5HTCA 1W2DA 3GQLA 4L8MA 3KU2A 2C0TA 3SVVA 2X9EA 5DOSA 2R0UA 5L6WL 2E9VA 4HW7A 3DLZA 4G9RA 5IUHA 1GIIA 3HUCA 4JIAA 1Y8GA 4FSMA 2UW7A 5BVNA 4YTCA 1OUYA 2C6OA 1Q8UA 3C51A 3P79A 1JPAA 2IVTA 3NAYA 3R2BA 4L01A 5CAVA 3BCEA 5DHJA 4ZP5A 3TG1A 2XCKA 5TKDA 3UNZA 3NX8A 3LCTA 4FV7A 4QMLA 3TUDA 2XCHA 4PNKA 3SA0A 2VWXA 1MRYA 3V5WA 3OW3A 2B52A 3W8LA 2R64A 4C3PA 2QU5A 3R7GA 3ZSGA 3OTVA 3OEZA 2V62A 3IO7A 4GJ2A 4MD8E 4N0SA 4MH7A 5CVHA 4BFMA 3FC2A 3O8TA 3BHYA 5AUWA 3B8QA 3MH2A 2AQXA 3TV4A 4EH4A 3COHA 4CMUA 4QQTA 1QL6A 2G1TA 4F1MA 2QOBA 3FDNA 4QMPA 5C03A 3ZTXA 3OXZA 4DFBA 4OBPA 2YM4A 5E8VA 4DH5A 3VW8A 3DNDA 1VJYA 4FA2A 4XP2A 1LR4A 2QOHA 3PJ3A 5AP1A 4H3PA 4UN0C 4FKPA 2C6EA 2R3PA 2UZEA 3CR0A 4QTBA 4Y5QA 5GZ8A 2YHVA 3BQCA 2JIVA 3LJ1A 3OD6X 3OHTA 3EZRA 4EOOA 3NUYA 4K77A 2BILB 4L3JA 2WMVA 1Q8TA 1H1SA 3AMYA 5LVNA 2QO7A 3F88A 2PMNX 2YM7A 3V6SA 5LMKA 1Q8YA 4FV3A 3W2CA 3UQGA 3RJCA 2YACA 3GB2A 4OBOA 5AM6A 3D7TA 4C59A 1SZMA 1GY3A 1KOBA 4I4FA 5HIBA 4R8QA 5H8BA 1TVOA 5AP0A 4ZLYA 3P23A 4II5A 3QRUA 1H24A 3MVMA 3GC9A 3K3JA 3EL8A 4FOCA 3MY1A 4JG7A 5AV1A 4QD6A 2C4GA 3EKNA 4GK2A 4F63A 5BX0A 4GFGA 3EB0A 4R5YA 1XKKA 2YIWA 2XA4A 4FNXA 4M66A 2H8HA 4XJ0A 4D2RA 4UMPA 1OBGA 1RE8A 4O0SA 2XK9A 3RK7A 2OIBA 1FGIA 3FHRA 4TKSA 2QG7A 2C3KA 4PTGA 3HYHA 1KV1A 1UNHA 2ITXA 3LCOA 4RVKA 3IONA 3FE3A 3W33A 3ELJA 4LG4A 1ZOEA 4IACA 4RIXA 4RWLA 3QZHA 4EH7A 5JQ8A 4GG7A 4KIOA 1OIYA 2O65A 2Z7RA 3R9HA 4CLJA 4GT4A 1VR2A 4FL2A 4KIKA 2XNNA 3EL7A 4P7EA 4RJ7A 4TT7A 5DH3A 3GU4A 4PMPA 5I9VA 3LLAA 4M69A 3QFVA 4IVAA 1UU8A 3QYWA 2KTYA 3FI2A 4ITHA 2OJFE 5E9EA 4F9BA 2PVMA 4YHFA 5L6OA 3RTPA 4C61A 5HCZA 1Q4LA 1AGWA 3LIJA 5B2KA 4E6DA 2CNQA 1YXUA 1ZYDA 2HAKA 4BYJA 5CAQA 4YNEA 3F69A 4EHEA 2YFXA 3O51A 2VWBA 1GZOA 3GP0A 5AP4A 4D5HA 2YABA 2Z2WA 4KKGA 3FKOA 3VQUA 3KIOC 3LOKA 4C36A 4EC9A 4IZYA 5CTPA 4CXAA 1G8AA 3E63A 3U4UA 3G5DA 3L9LA 4XOZA 4JX7A 4BCFA 1W84A 4Z55A 1REKA 5F1ZA 3MJ2A 3Q3BA 1OVEA 4I20A 3IW4A 2XRUA 3DJ6A 4IFGA 3DTWA 2XBAA 3FZPA 5DR2A 4CV9A 3HV6A 3MVHA 4N6YA 2CGVA 5CALA 4R1YA 1UV5A 3QWJA 3CIKA 3JYAA 3BPRA 1Y8YA 1T45A 3QD4A 3VS4A 4AN9A 2Y6OA 4Z9LA 4OGRA 3EQFA 3FPQA 2XKFA 3LHJA 3PPZA 4DAWA 4RX5A 2YLEA 3PJ8A 5C8KA 3EQBA 5IMXA 3ALNA 3DTCA 3LMGA 4YJUA 3A4PA 5HCXA 3LXNA 3JVSA 2RFSA 5KZ0A 1PMEA 2I0EA 4QEBA 3EHAA 4I6FA 3BWFA 5A54A 4O7RA 3K5UA 4JBVA 4OTWA 5CQWA 5EM7A 5D1JA 5KZIA 2FH9A 1ZYCA 3QKMA 3QC4A 5KO1A 5A4TA 3K54A 1MRUA 5AMNA 4E5AX 1H07A 3ZO4A 4U44A 1IA8A 1H4LA 3KN6A 3OOMA 3HMNA 5DPVA 5I4NA 2VTHA 4ITIA 1FBNA 3TZMA 4LL0A 4C7TA 5E8XA 3W0OA 4Q5EA 4JQ7A 2I6LA 4HGLA 3HL7A 2X0QA 2JGZA 3NIZA 4A4OA 4BL1A 4RT7A 1ZMVA 3BYMA 3LJ0A 1QPDA 1YWVA 2GFCA 2KULA 4J8MA 5CI7A 5HG9A 5J7HA 2LAVA 4BDCA 2Z7QA 5JGAA 4GEOA 5T3QA 3NFFB 5JFWA 2IZSA 2NRUA 5C4LA 4RQVA 2OH0E 2EUFB 3GCPA 2C6MA 1O6YA 2VTNA 5GJGA 4RC3A 4DG2E 1Z9XA 3QQKA 3NZ0A 3TNWA 2PPQA 2XKDA 3EQPA 3U51A 3RK5A 4O2ZA 3SV0A 3DKCA 4JRNA 4IC8A 3QRTA 3OG7A 3D0EA 3ULIA 2RG5A 1IEPA 3R63A 4LYNA 3SLSA 4H05A 4LRMA 2E9PA 3FXZA 3ZZWA 5AUTA 5EHLA 3F7ZA 4G9CA 3GQIA 1UKHA 3QKKA 1OPKA 4QMZA 5K5NA 4FSYA 4EZ3A 1OIRA 3R7IA 4L43A 3Q53A 3TDWA 3G0FA 2PZIA 5KNJA 5C1QB 2PVLA 3POZA 3A7JA 5HHWA 1JLUE 1H1WA 2P0CA 4HNIA 4ERWA 2J0LA 3FZRA 1DM2A 3PLSA 2YDIA 5EYCA 1HCKA 2BCJA 3UVRA 2XAOA 5C8NA 4E26A 5EI8A 3NW6A 3EJ1A 3QLFA 4WBOA 3TIYA 3W2QA 5IA1A 1TFFA 3ZLYA 4L68A 1OL7A 4BDDA 3OUKA 5JZNA 2XANA 2FA2A 3C4EA 3A7IA 2VD5A 5M57A 2XYNA 2VN9A 1J7LA 3ITZA 1KE7A 4FIIA 3UVQA 1AD5A 4EC8A 5BVOA 3RKBA 1KE8A 4WUNA 4CKJA 2J0IA 2RGPA 4JAIA 5H8GA 5AR4A 5HEZA 2R3NA 4G6LA 2YISA 3ACJA 1KWPA 3CTHA 4XV2A 4YR8A 2XRWA 3VJOA 2W1DA 2WOTA 3EMGA 5HNBA 3KVWA 4LOQA 5AA8A 1G5SA 4MQ1A 4BDAA 3I81A 2OIQA 2YM6A 4W9WA 3RAHA 2WQEA 4BVUA 4DH1A 4C4IA 4XV3A 3ID6C 2YM5A 4ZSJA 4N4SA 2BDFA 5E91A 3R7EA 2X7FA 1NVQA 3KULB 3PFYA 5M06A 1YDSE 4QMUA 3I5NA 1W2FA 3OT3A 2H34A 2XIZA 2CCIA 4M0ZA 4A06A 5GJFA 4AXCA 3I4BA 4RVLA 4AAYA 5DIAA 4IANA 2C1AA 5EKOA 3VW6A 3W16A 4HZRA 3FXXA 4QOXA 5FBNC 4L7FA 3HV4A 2JDVA 2B9JA 4E3CA 2W1CA 1Q8ZA 4JG6A 4LL5A 4JBOA 2CN8A 3BLHA 4EH2A 2UW0A 3EFWA 4NM5A 3E3PA 3OF0A 4KA3A 5CLPA 3R8LA 2G2IA 4J71A 5HO7A 2IO6A 3QZGA 4ZJIA 3NUAA 2VTSA 2W4KA 5M08A 4FTAA 5AAFA 4QNAA 3ET7A 1VYWA 3LZBA 3SC1A 3EN7A 4YPSA 5HBEA 4G5PA 3DQXA 4O0YA 3ZUVA 4B0GA 4AOIA 2BTSA 3LCSA 2CKQA 3MIYA 3EQDA 2HCKA 3DBCA 2YCSA 2WEIA 4TYHB 1BI7A 5HIDA 3G90X 3F2AA 2I7QA 4FJVA 3LCKA 2WB8A 3ZC5A 4IX4A 4FKQA 3VRZA 1Q97A 4O81A 5CXHA 4AQKA 4FKOA 4H39A 1L3RE 4MNFA 3AD6A 5I9UA 3BHVA 4DLIA 4AFEA 2YAKA 3BIZA 4FSTA 4HYIA 2BHEA 4QMVA 4O4CA 1PXIA 4U9AA 3Q9WA 4UY9A 5EOBA 3QL8A 3V8TA 3SXSA 4AUAA 4FR4A 5HESA 4C2WA 3BZ3A 4FL3A 4TW9A 5L8KA 1V0BA 1G8SA 2PZPA 4GFMA 4EQUA 3ALOA 2ZM3A 3QHWA 5BMSA 5EOLA 5CEMA 4O83A 2QHMA 2OJGA 3CLYA 2QKRA 4Z16A 4NT4A 2W1GA 3MFUA 3T3VA 2CGXA 4F7LA 4I5PA 5JSMA 4E5BA 1M7NA 2F57A 2I0YA 2QOCA 3MTFA 3OROA 4KKEA 3H9FA 4L52A 4ANQA 4ASZA 2B0QA 4MXAA 2Q0NA 4U0IA 4YBJA 4AE6A 4DEBA 1SNUA 3C7QA 1JKLA 3OP5A 3DT1A 3OUNB 4H3QA 4AX8A 3UMXA 4QMTA 3ZSIA 3FKNA 1Y6AA 1W2CA 2R3FA 4A7CA 3DY7A 4K6ZA 2CCHA 3PTGA 5LCKA 1EH4A 3U9NA 4JDIA 2XIXA 1W98A 4EOPA 2C5VA 5FM3A 4O96A 3OXIA 2O8YA 2C5XA 3D14A 3BHUA 5LARA 2C6LA 4F70A 4LDTA 4DEHA 1FPUA 2JDSA 4FVPA 2FSTX 1NW1A 2WMQA 3UOKA 3VVHA 2YIQA 3AC1A 3ZOSA 1JNKA 3BYSA 3MGYA 3D83A 2C69A 3ANRA 1JSVA 4I41A 4RA4A 1WFCA 3IDBA 3PP1A 5BYYA 3C50A 3A2CA 4KIPA 1JKTA 2VWVA 4NYEA 2R3HA 5BVFA 4V04A 2DWBA 3KXNA 3OFMA 3QTIA 4DEDA 3A7GA 4AG8A 3T9IA 2BDWA 4GU6A 3HMIA 5E8TA 1PW2A 2ZV9A 2PVRA 3E8CA 4J97A 4A9RA 2PE0A 3T9TA 4CZYB 5KUPA 3WF5A 3NUUA 4E6CA 4EK3A 4GMYA 4UZHA 5ETCA 5I3RA 2R7BA 4FYNA 3FWQA 3GFWA 2WTWA 2XM9A 2B9IA 3Q52A 5KMMA 3UOLA 4ALUA 4KSPA 4AU8A 5L8JA 2OF4A 4APCA 4ACGA 3FZTA 4PUZA 3DJ5A 4AW5A 2BKZA 3R1YA 3TUCA 3JVRA 4EUTA 3OT8A 3R71A 4KABA 4IVDA 2AC3A 2HELA 4ZTRA 4IE9A 3NYOA 1U54B 5CT0A 2GNHA 3RHKA 4CLIA 4EWHA 5IQFA 2WMUA 4AW1A 2XAMA 3MB6A 4YTIA 5J95A 2UZBA 4G6OA 2VO7A 4QPAA 5A4LA 5DFPA 3CXWA 2UVZA 5IA0A 2XH5A 4PQNA 2PY3A 5IEXA 5FGKA 3QU0A 3VS2A 4AACA 3UOJA 4MF1A 4P2KA 2Y6MA 1H25A 2I0VA 3B2TA 1S9IA 3FSFA 4GVJA 3RPYA 4DFYA 2JAMA 5J1VA 3R9DA 4HCTA 3CQWA 2PVNA 4RMZA 4DTAA 2CGWA 4XP3A 4F7SA 2A4LA 4YP8A 3EQCA 4QP6A 2BMCA 2XKEA 4I22A 2XEZA 4ZSEA 4FGRA 4CFVA 3PY1A 5KMJA 5HTIA 2X6EA 4AOTA 3QA8A 4MXOA 4QP1A 3PJCA 4YBKA 4DINA 5A4EA 3W0MA 3QD0A 1XH5A 2BTRA 4UEUA 4BGQA 3ODZX 2YJRA 2PUIA 4YZCA 3HV7A 2HWOA 4N70A 4UX9A 3R28A 3E92A 2C30A 4O4EA 3SG9A 4YUQA 3AOXA 2X2MA 5A6OA 2QQ7A 4AZFA 1HCLA 4PDOA 3U9CA 3HAVA 3U6HA 5A9UA 1UNLA 2OJJA 1W82A 3D7ZA 4EOIA 4U3YA 2G9XA 2XJ2A 4XMOA 3PXFA 3LFQA 2WNTA 5FQDC 4KB8A 4BDJA 1PRYA 3QLGA 5CSPA 4E7WA 4H3BA 2OH4A 2GNGA 3O5AA 5JGDA 3PZEA 4IADA 4JI9A 3LAUA 3TWJA 5AADA 5JRSA 2A0CX 5AR7A 4BBFA 2W7XA 4W9XA 4AXDA 1KUTA 4FV0A 3RWPA 4X2GA 3CJGA 1A06A 2RKUA 2G01A 4O6LA 5DWRA 4F1TA 1OBDA 4YLJA 2BFYA 4LV7A 1CTPE 4FYOA 4CVAA 3W8QA 5L2IA 4FIFA 4FNYA 3VWAA 4FTMA 3FLWA 4Y72A 4QQJA 4QPSA 4CCBA 1BYGA 2J6MA 3UJGA 2C3IB 2WO6A 4GVAA 4G16A 2ESMA 5IQEA 4FKIA 4BCIA 4UYAA 2GTMA 3H3CA 3N4TA 3C0HA 2X8DA 5EH0A 5J5TA 3QYZA 1VLRA 4CKIA 2RSVA 2XNMA 1H0WA 3S2PA 3UVPA 3EN5A 2QD9A 3AGLA 3MDYA 3N4VA 3ZC6A 3KULA 2Y9QA 3JS2A 4J98A 4R7IA 4PPBA 4WUAA 3UNJA 3ZS5A 4E73A 3BELA 2HK5A 3TDVA 3MY5A 5FXRA 3NVKI 2VNWA 4OT5A 3DAJA 3UIMA 4E6AA 4XYFA 4IDVA 3CS9A 3KREA 3VS0A 4O84A 3PXYA 5T68A 4FTIA 4M7IA 2JITA 5DE2A 2AYPA 2YJSA 4W4VA 3THBA 3R73A 4XUFA 5JRQA 2YCQA 4BCOA 3HLLA 3CQUA 4KRCA 2IW9A 4P90A 4RFYA 5I9ZA 4I5MA 2QLQA 2GDOA 4APPA 2IVVA 3W0NA 2BIYA 3NNXA 3TN8A 3ZFMA 4DEGA 3TV6A 1SNXA 2UW5A 5AX3A 3O7LB 2OLCA 4EHGA 2ITOA 5DT4A 2ITZA 1BLXA 4FUXA 2BRMA 3OWKA 2FB8A 4A4LA 4OUCA 5CSHA 4BKJA 3VF9A 4NIFB 4C33A 2A98A 4DN5A 4MHAA 4EJNA 1OKVA 3LFDA 4EL9A 4LV5A 4ZZNA 4AQCA 1OKZA 4TYHA 3C5UA 3DPKA 3FI4A 3QTQA 4DTBA 4EH5A 1ZOGA 5DI1A 3C5IA 3LFAA 4QMXA 2JFMA 3ULZA 3C0GA 5F4NA 1ND4A 4IWDA 2X9FA 4V0GB 4TYGA 1YOLA 4O1PA 4UV0A 5AUZA 4DEIA 3EN4A 4I23A 1UNGA 2CLXA 4QQCA 2X2LA 4EOMA 4ACMA 4CFUA 3NCGA 4FIJA 2C3LA 2UZDA 5GIOE 4HYUA 4GIHA 3H0ZA 4C4GA 2YZAA 1O6LA 4ZK5A 1U5QA 3LM0A 4MBLA 4TNDA 3NUXA 3FMDA 3QALE 3UC3A 3ORMA 3MFRA 5AIKA 4G31A 4QP9A 2GNJA 1K2PA 3BKBA 4FOBA 4FIHA 1WBVA 1YI4A 1PKGA 4ZSGA 4C0TA 3MESA 3PSDA 2W9ZB 3DBQA 3KXXA 4XG4A 4PV0A 4WG4A 2YCRA 2Q83A 1W0XC 3N4UA 1S9JA 2YIXA 5FP5A 2F9GA 5AEPA 1RDQE 4FL1A 3VC4A 3ORTA 4IWPA 4PWNA 3ZRKA 3DKGA 5BUJA 2G2HA 1IRKA 3EN9A 3HRFA 1Q5KA 4JNWA 5AP2A 3VUDA 3ZLXA 4EBWA 5KHXA 3ATTA 4GRBA 4IAFA 2ZB0A 3Q6WA 3UGCA 4QT1A 1PXMA 2PVHA 4ZXTA 4TZRA 2WFYA 4O7TA 5CF4A 3AG9A 1ERKA 3GU8A 2XK4A 3PUPA 4YJPA 4C4HA 2J2IB 3KGAA 1URWA 2VZ6A 4R3PA 4CKRA 1A9UA 3AC3A 5IDPA 2CPKE 3LCDA 4J7BA 3HA8A 1XH8A 2QO9A 5EHOA 5BVDA 1GNGA 5KMKA 5CNNA 3SKCA 4NTSA 2WOUA 3D2IA 2C1BA 2EU9A 3P0MA 4MK0A 3IW5A 4BGGA 3WZUA 3WF8A 4YJNA 3WARA 1MQ4A 1U59A 4EK8A 3T8OA 5A6NA 2Y7JA 4NKSA 1R39A 4I4EA 5E8WA 3K2LA 5BPYA 3UP2A 4C8BA 3KMUA 3U4WA 3R8PA 3PJ2A 3A61A 4JMQA 2GQRA 4I92A 2YEXA 3RPOA 1ZRZA 3BEGA 3FV8A 3ORPA 2XP2A 4M97A 4F65A 3NFGB 5DR6A 4ORKA 3RVGA 2ACXA 3Q96A 4QP4A 5CF6A 5TOZA 3W0RA 3ANQA 3D15A 2RL5A 5HVJA 1ZY5A 4EKLA 3FYJX 4R7BA 3K3IA 2JAVA 2XNOA 2W0JA 4KBAA 4CTBA 5AUYA 5TR6A 4O7YA 4UXLA 4NM3A 4OR5A 4ZMFA 4KIQA 3O8PA 3HP2A 1KE5A 1WBNA 3TMOA 3QX2A 4U40A 4BI1A 4ID7A 3R04A 4WRGA 3JY0A 5TF9A 3AQVA 5J8IA 5DLSA 1FMOE 3O71A 1RJBA 4FTRA 2VWWA 3GFEA 4K33A 4RPVA 1F0QA 4AT5A 4ASDA 4PDSA 1U54A 5EDRA 5I9YA 5EQYA 2NPQA 1CKPA 2J0MB 5AR2A 5HG5A 2VGOA 3EQIA 5C8MA 2WZJA 3IK3A 3H4JA 4BDKA 3QF9A 3OCSA 4X2FA 4O7ZA 3TNQB 5JFXA 5E4HA 5L2WA 4F9YA 3LXLA 2RFDA 3QTZA 2UZOA 2E2BA 3UIBA 2CDZA 4RZVA 2NP8A 3AT3A 4FX3A 4QP2A 5AAGA 3UIUA 1E1XA 5IEVA 1UWHA 5AM7A 2B54A 4USEA 4OTQA 4ANSA 3VS1A 1TKIA 4YZBA 5FTOA 3P1AA 3ENMA 1DI9A 1UA2A 5FEEA 2O64A 3A4OX 3WYXA 4ZEGA 3DA6A 2W9FB 1U4DA 3NR9A 4HNFA 4JBQA 2YLFA 4GYIA 3CBLA 4XNEA 4I0SA 2BKKA 3Q9ZA 3QQGA 2HZNA 2W1ZA 3EOCA 1ATPE 4X7QA 1FVTA 4U3ZA 4BDIA 3WZJA 5LMBA 3HNGA 1YWRA 2A19B 2QU6A 4W4YA 3C1XA 4S2ZA 4FEQA 5DRDA 1XH4A 4HYHA 3QCQA 2PVJA 5HLPA 4GUBA 1I09A 3VF8A 3CPBA 2XKCA 3GXLA 2W05A 3I1AA 4DGNA 4LRKA 5CAPA 5IH4A 1KE6A 3FMJA 4K11A 4TTHB 4C2VA 3GCSA 3I6WA 4BDEA 5IA3A 5JQ5A 4ZTHA 2XUUA 4YSMA 4NM7A 4R7HA 4XX9A 3HAMA 3SG8A 1OL1A 4OTHA 4CFNA 2G15A 3FZOA 3ODYX 4ANOA 4C35A 3SW7A 5D41A 4O7WA 1YRPA 1DAYA 2OO8X 2R3RA 5BUEA 4UXQA 4CNHA 1A48A 3U54A 3NVMB 2ITWA 1OGUA 5K0XA 1V1KA 4RBLA 3HDMA 3NYXA 3REPA 2RFNA 3VS3A 1GAGA 4DGOA 3AKJA 1VYZA 4O0UA 5IKWA 3FZSA 4DFXE 4E20A 4BY9E 5DYJA 1IASA 5ANJA 4B8MA 4USFA 1CKIA 2IW8A 2FO0A 2X39A 5EQEA 4QMQA 1H28A 3PRFA 1PKDA 3MPTA 2HZ4A 1PMVA 4K18A 5D12A 3UG2A 4K8AA 3ZBFA 4ZJVA 5CAUA 3F2RA 5J9LA 3QUEA 2C0OA 2VNYA 5AWMA 3R01A 3HV3A 2ITVA 2VTAA 2QR7A 4HJOA 4U97A 5AUVA 4HGEA 2JC6A 2GSFA 5KCVA 5L2TA 1X8BA 1QPJA 1PMUA 1PXPA 4FSQA 4UWYA 3GNIB 3W2PA 4FNWA 3PDTA 3IDPA 5K5XA 2WMSA 4ZLOA 5DEWA 4KKHA 3Q4ZA 1XBCA 4LM5A 3SOCA 1W7HA 3OWLA 3V5JA 3R7YA 4YMJA 2C5OA 1IA9A 4FG9A 4G5JA 5M4FA 3TNIA 3R9RA 4QP7A 1BX6A 1ZXEA 4DBXA 4RC4A 4RSSA 4MVFA 3NMUF 1CKJA 1IR3A 4GSBA 2GHMA 4IAKA 4KNBA 3ZONA 2P3GX 2XK7A 4AT3A 2B1PA 1LEZA 1MRVA 4RLLA 4ZOGA 3QHRA 4PPCA 4XG2A 2PE2A 3QZFA 5CWZA 4BZOA 3CD3A 2J4ZA 4NKAA 4PMTA 4EOJA 5GZAA 4I3ZA 3FYKX 2REIA 1PY5A 4NIFA 2HY0A 3QGYA 4BZNA 5JMSA 4M67A 3GCVA 4J53A 4ZY4A 2Z8CA 3HX4A 1BI8A 4A9UA 4O0WA 4I24A 3UO4A 4D2VA 2R3IA 3VNTA 2ZJWA 4ZTLA 1J91A 1WBWA 3LM5A 3QTRA 4LGHA 1UVRA 3G6HA 4GU9A 4V0GA 3RINA 4TXCA 5K9IA 3EQGA 1M17A 2F2CB 3TXOA 4EORA 4IJPA 4LMNA 1DAWA 2IEWA 4E1ZA 3L9NA 4MX9A 5CZHA 4ZZOA 4LQMA 2EB3A 5FLFA 5KMNA 4DHFA 5AP5A 2HWPA 1ZMUA 3PXKA 4ANMA 3JUHA 4KBCA 4WRSA 4F4PA 2PZRA 4JG8A 3HMPA 2OIDA 1Q24A 2HXQA 3GBZA 4U8ZA 5CANA 5EKNA 5JK3A 5HO6A 4AXFA