1JQHA

Igf-1 receptor kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
291
Chain Sequence
ADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords IGF-1 receptor kinase
publication title Crystal structure of bisphosphorylated IGF-1 receptor kinase: insight into domain movements upon kinase activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 291
sequence length 303
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jqhA01
1A06A 2ERKA 2X6EA 1B38A 4M97A 1AQ1A 4YC8A 4MK0A 1ZRZA 3SKCA 3LOKA 4L67A 4WUNA 4IM3A 1S9JA 2OW3A 4NW5A 1Q41A 4TKSA 2GNLA 3VS5A 3UIBA 2PUIA 4RPVA 3OCBA 2ACXA 2O2UA 3UYSA 4KBAA 5HNIX 3HUCA 3BU5A 2BHHA 3D0EA 5HE2A 5DNRA 3RM6A 2UW4A 1PKGA 2GTMA 2YEXA 3COMA 3PXZA 5EOBA 4CVAA 2PZYA 3QUPA 4CNHA 2C4GA 4KIQA 4PX6A 4EK4A 3EJ1A 3BE2A 3VAPA 4EH4A 4MTAA 4J52A 4FKOA 5FDXA 3PPJA 4AE6A 2DWBA 5AUXA 4GL9A 4NT4A 4Q2AA 4BBMA 3F82A 3OWJA 3V5TA 4BI1A 1STCE 3WYXA 4BDIA 3EQGA 4C33A 4RJ4A 3TM0A 3EQRA 5K0KA 2AC5A 4FV5A 5DN3A 3UOHA 3MIAA 3VBXA 3UDBA 2QOIA 4QRCA 5B2KA 3REPA 5I9ZA 4IC7A 2ZV7A 2Y8OA 3UJGA 3GB2A 3TTIA 1H4LA 4R1VA 4U3ZA 2F49A 5HO6A 5D9HA 5DA3A 5TT7A 4H05A 2WQOA 1K2PA 3GENA 3RK5A 3I4BA 5C26A 3DXPA 2UVYA 4FEXA 4QQJA 3ZRKA 3OXZA 2EXMA 5JH6A 3OXIA 4IB1A 3G15A 2EVAA 3FMDA 4F09A 5JEBA 4QYYA 5FM3A 4F0IA 4EH9A 1DM2A 3CBLA 4JDHA 5AV4A 1ZYDA 4RWLA 3SXSA 4CFXA 4CKIA 3O51A 2GFCA 4HYSA 5DR2A 3W2SA 4AT3A 1CSNA 1YOMA 3KXHA 2BKZA 3PZEA 4O6EA 1QCFA 4FUYA 4O7LA 4BDDA 3U8WA 4XG8A 4IANA 3SVVA 2J0IA 3GFWA 4G31A 4I24A 5JMSA 4ZMEA 3IDCA 4IDVA 1PY5A 2GQRA 4KKEA 5HHWA 4BDKA 4U9AA 5BUJA 3AMBA 5CF5A 3POOA 2IO6A 4QP9A 3GFEA 3UIMA 2UV2A 4BKYA 3TXOA 2PUPA 4MD7E 4GK2A 4XG7A 3RWQA 4CFFA 3EL7A 3OP5A 1OIUA 4DH5A 1BUHA 4OTHA 3H9FA 3U9CA 1U54A 4XBRA 3I1AA 4Y83A 4J7BA 2RF9A 3C0GA 3H4JA 3SD0A 3BEGA 3KREA 2GNFA 2UVXA 3R28A 4O7TA 4LI5A 2YCSA 3A2CA 4LMUA 1A9UA 1T45A 1X8BA 4IM0A 2PVMA 3DQXA 4JL9A 5IQCA 1HCLA 4C36A 4O84A 4F6WA 2W5BA 4F7NA 1LEZA 3NNVA 4RFYA 2IVVA 4HYUA 3ORLA 4J53A 4X6QC 4NUSA 5K9IA 4BHNA 5CQUA 2Q0BA 3IW4A 5BYLA 4EYMA 4Q5EA 2JDTA 3PLSA 4C3FA 4FV4A 3P0MA 5FTOA 4TWOA 5E8WA 4DEEA 3FC1X 4YMJA 5JGBA 3V51A 3RPVA 2BR1A 4C58A 4EBWA 2BKKA 2Q0NA 4ZTNA 3NYOA 3WIGA 2VO0A 2ITVA 4FIGA 4JRVA 4E5BA 4G17A 5EM6A 2O8YA 4PDYA 4RGJA 4F9CA 5JT2A 4XMOA 2C5OA 2JEDA 3GI3A 3O8UA 3DT1A 5JRSA 2B1PA 3QQKA 1P4FA 4FF8A 4ANBA 4BKJA 2VRXA 3KF4A 4BHZA 1KWPA 4FIIA 4NM7A 4QQTA 4NEUA 4D2TA 4ITHA 5CANA 4DC2A 5DG5A 4FSQA 3DZQA 2RIOA 4PDPA 1YW2A 4AE9A 2JD5A 4LV5A 2QODA 3CJFA 5DRDA 2EXEA 4BCMA 4ZAUA 4F64A 4AW5A 3VF8A 3KRRA 2VD5A 4F65A 4KA3A 1M2QA 3VS2A 3NDMA 4AW2A 5IA3A 4D1XA 2XK8A 4Z3VA 5IKWA 3ZBFA 2VWVA 4O6LA 2GNGA 2CHLA 5FP6A 4TT7A 5EH0A 3VS4A 2ITPA 4E6DA 4BF2A 3ODZX 4NL0A 1OL7A 2QURA 2XCHA 1DAYA 4NM5A 1YWNA 3FLSA 3ANRA 3H0YA 4NM0A 2EB2A 4FT0A 5F1ZA 4C4FA 4Q9SA 2CSNA 2W1DA 4K33A 3RMFA 5CU6A 4WA9A 2BDWA 2VGOA 4FKJA 3FEGA 2VAGA 4RMZA 1TVOA 3PXQA 3QHRA 4LRJA 1OI9A 5M4UA 4W4VA 4IX6A 3Q3BA 3FDNA 4TWNA 3IONA 1UU3A 1WBTA 4KBKA 3W32A 4CMUA 1GZKA 3ZTXA 2HW6A 4ZY4A 3TUBA 5F9EA 4ANSA 5IUIA 5M53A 3UTOA 5I3RA 3KXMA 2PVNA 3P1AA 3MI9A 4HGLA 2PVJA 4N6ZA 4PV0A 2X81A 3N4UA 1YRPA 4JAIA 2W4KA 2PVKA 1NA7A 3MPAA 3I0QA 3NEWA 4UWCA 3LJ2A 3VUGA 3BGQA 3WF9A 3ZLYA 4ASXA 4RC4A 1DI9A 1H25A 5BQ0A 5E8SA 2OF4A 4JT3A 3FLWA 2J51A 3EYGA 1KSWA 4ALUA 3QTUA 2IN6A 2R3OA 3HA6A 5JFSA 4GT5A 3A62A 2JGZA 2GNHA 2BIYA 1FVRA 4GUBA 4JIAA 4I1ZA 4O1OA 3LCDA 1YXTA 4D9TA 3F6XA 4G6LA 3LFQA 3MVJA 3R1SA 4IAZA 2V62A 5J8IA 5BVDA 3BI6A 3MGYA 3DBCA 3QQHA 4Y5HA 4I3ZA 3PWDA 3E7VA 4UY9A 2BRHA 5HE0A 2EU9A 4O38A 3P86A 3TL8A 4O7WA 3UP7A 1BLXA 2OXXA 2O0UA 2JFMA 1J91A 4C4GA 3EFJA 5FXRA 2A19B 4F9AA 5HTCA 4FSRA 2BCJA 3LM5A 2UVZA 3WZJA 2VX0A 2GS6A 4L6QA 2JDOA 3DZOA 4DBXA 2OH4A 4ZXTA 1PKDA 3SAYA 3QKLA 4AOTA 3BQCA 2C69A 3FI4A 5B2LA 1Y6BA 3EN4A 3MYGA 3PVWA 4FT5A 5EYMA 4FV0A 5CAPA 2VTTA 3UPXA 3V8TA 4AN9A 4AQCA 3AQVA 3H9RA 1LP4A 4NIFB 1TQMA 1PXMA 4XH6A 3QTWA 3ZSIA 5A4LA 1YHWA 5KKRC 3VRYA 2WMUA 5KMIA 3PJ2A 3IGGA 4C02A 1NXKA 3D5WA 5B2MA 1J1CA 4BDJA 3GU5A 3FXXA 3ZO4A 4IWDA 4P5QA 4K2RA 4QO9A 2JC6A 4FKQA 4AS0A 2YM4A 3GT8A 5AR4A 2YA9A 3TZMA 5L6PA 4LQMA 3G6HA 3T9TA 1H1PA 1VR2A 1XJDA 3ZBXA 3QZIA 2XJ2A 5HG7A 3VN9A 4BB4A 3QTQA 4CLIA 1J7IA 3OWPA 3LFDA 3BYSA 3OOGA 4AW0A 3DV3A 3DGKA 4NK9A 5CEMA 4NYEA 4RRVA 3QXOA 4I0RA 3AMYA 1Q8TA 4QMLA 5ETIA 5AV3A 2OXYA 4LRMA 4DAWA 5EDPA 4F08A 4BCQA 2VWIA 3NZ0A 4ZS4A 4WRSA 2Z02A 4PDOA 3BPRA 4A4OA 3OD6X 3B2WA 3PTGA 3D9VA 4L8MA 1OKWA 4UALA 3QWKA 2W7XA 4FL1A 2OBJA 2ITOA 4AA5A 4FTOA 2OJFE 3G90X 5GIPE 4F63A 3MH2A 3PXYA 3BBTB 4AUAA 2XK7A 3CY3A 2Z7SA 2CKOA 5LXMA 1O6KA 2WOUA 3R1YA 1YI4A 4LL5A 4DT9A 1JWHA 5EFQA 3QZFA 2ONLC 3HGKA 3OT8A 5IU2A 4BDBA 5J79A 3U55A 4IWQA 2ZB0A 3NUAA 3ETAA 4Z7GA 3GVUA 3FPMA 4EOJA 4O0RA 5E92A 4JX7A 3TCPA 2ZM4A 5HO8A 2GFSA 4YR8A 1B6CB 3PRFA 2V22A 3O7LD 3U51A 3UNZA 4O2ZA 1M2RA 1Q5KA 4QMPA 5IQFA 1BL6A 1GJOA 2WQEA 3D7TB 3FMLA 2Q83A 1ZYSA 2UW8A 3Q04A 4OTIA 3OCSA 3W2PA 3HMOA 4GKIA 2XM8A 4KB8A 4EHVA 5KMJA 5IQIA 5IA2A 2FO0A 1K9AA 1XKKA 3Q60A 4EOOA 1G5SA 4F1OA 3FMHA 2ERZE 3HA8A 5HIBA 4X3FB 2I0YA 4QQ5A 4F0FA 3NIEA 3DKFA 3TNPC 3UOLA 4AZWA 5ANEA 4RJ3A 5EOLA 5EW9A 2OXDA 2YITA 4XG9A 1NT2A 1HCKA 3Q9ZA 1E9HA 5A46A 4G2FA 4GK4A 2BFYA 5EHYA 2BAQA 4FSYA 2C3IB 3C4ZA 5GJFA 4QYFA 2BRMA 5I5ZA 3DU8A 2OICA 4E3CA 2WELA 2E9NA 2YZLA 2UW5A 5IQAA 2IZRA 4E20A 1PXJA 3TKIA 1PMVA 2E9PA 4IWOA 4BI2A 2ZVAA 4DEBA 3BLRA 2C1BA 5I4NA 2BZHB 5E8YA 3C50A 4C59A 4GW8A 4RIXA 3FL4A 3VUMA 4XLIA 3SLSA 4AZFA 4YJPA 3E3BX 4NIFA 1UNGA 3D15A 3H3CA 4YO6A 5GJGA 2XH5A 2YDKA 3OUKA 5E9EA 4ASEA 2W1EA 2ITQA 1J7LA 5IQDA 4M84A 2QOBA 3F7ZA 3L9MA 4C8BA 2CNVA 4GMYA 1PYXA 4GFMA 2QLUA 4MXXA 4ZTRA 3MBLA 4DHFA 5J9ZA 4D2VA 4KAOA 2QQ7A 5ETAA 1Z9XA 2WMBA 4B0GA 3GGFA 4U42A 2R2PA 4XP2A 3UOKA 4F99A 4ZIMA 2OKRA 3A7JA 4DH3A 1BI7A 3MFRA 4EOIA 5C03A 1ZZ2A 2J0JA 2ETMA 2YM7A 4JG6A 4AZSA 3THBA 3WF8A 4DTKA 5AV2A 1ZYLA 4RIYA 5HI2A 3RPRA 5I9UA 3V5WA 3NSZA 4ERKA 4RVLA 4BBEA 2B52A 4BZOA 4BDFA 5JQ8A 4R78A 4QMOA 5J9YA 1IAHA 2BAKA 4PMMA 4O82A 2FVDA 3GCUA 4EQMA 3CGOA 4I22A 4U43A 2Z2WA 5KMMA 4FTCA 3ANQA 4X2KA 3E92A 3E7OA 3F88A 1UWJA 3TACA 3LLAA 3RHXA 3HP5A 5CTPA 3COHA 3LZBA 4Y85A 4DFLA 4ZZMA 3MH3A 3ORMA 3BLHA 4F1MA 3AD5A 3RI1A 5BMSA 2YACA 5B0XA 5IMEA 3C4EA 4Y8DA 3BYMA 1KE5A 4KNBA 3F5UA 2QOFA 3L9LA 3W33A 2QNJA 4I0SA 4TWCA 5EG3A 1WBSA 2QOQA 3B2TA 3H0ZA 3KULB 3MV5A 5AR7A 3R8LA 3CPBA 4C3PA 3MESA 1A48A 4ZSEA 4OTGA 3QCQA 3SC1A 3GBZA 5M07A 3CTJA 4YBJA 3ZLWA 3ZS5A 2UZEA 3CE3A 5L6OA 5C27A 5HIEA 2WAJA 3D4QA 4MQ2A 1R0EA 4F4PA 4C4EA 4ZZNA 4EI4A 5AUWA 5CVFA 4JVGA 4GEOA 1MP8A 1P2AA 4AX8A 1XO2B 3VBTA 3WIKA 1I09A 3MPTA 3BHVA 5J9LA 3NW5A 1WBVA 3KRLA 4C35A 3MY1A 2A4LA 3R00A 2R64A 2RL5A 2PK9A 2G2IA 2OSCA 5JFXA 3GCQA 3MTLA 5ITAA 5AADA 3CJGA 5EQPA 4FTAA 2JLDA 3DNEA 5AP3A 4FGRA 4XRJA 3DJ7A 4QPSA 3ZEWA 1W0XC 4DEGA 2OJ9A 4EOSA 4EQUA 5AP1A 2JKKA 3KGAA 2YHVA 4L46A 4IZ5A 4EJ7A 2QLQA 4U3YA 3CC6A 3LE6A 3NRMA 4PL5A 3QLGA 2OF2A 4FZDB 4QNAA 4CEGA 3O0GA 4F9YA 4R7BA 3MFTA 4RWKA 1YXVA 2QOHA 3ORKA 3RPOA 3SDJA 3EL8A 4QMTA 5FXQA 4GK3A 4MWHA 4DEIA 4RX9A 5IQBA 3HVCA 4FYOA 4GU9A 3NUYA 4JIKA 4D4YA 5GJDA 3ODYX 5JK3A 3K3IA 3HV3A 3EQBA 3TN8A 1YVJA 3HDMA 4ZJIA 3P5KA 1KE6A 4BRXA 5L2WA 2CDZA 4FTMA 4E5AX 1OKZA 4USEA 3DK3A 2JDVA 3MJ1A 5HE1A 3ULZA 5JSMA 5HU9A 2QOLA 4QMWA 1FVVA 3D14A 5LMBA 4KIPA 5L2QA 1ERKA 5M55A 4CRLA 2VO6A 3DPKA 2GQGA 3D83A 1LEWA 4CYIA 2YJRA 4I5MA 4S2ZA 4D1SA 3D5VA 3U6HA 5CSPA 2VTJA 4HZSA 3MTFA 2HENA 3TJDA 4X2FA 5HCZA 3QC9A 1CTPE 2VWUA 4Y72A 5ICPA 4QMUA 3NWWA 4FZ6A 3TIZA 3FKLA 3RK7A 2JBOA 2XCKA 4O21A 1BI8A 3PSBA 4KS7A 2UZLA 5CEPA 4GFGA 3DB8A 4G3DA 3R1NA 3QX2A 2CMWA 3QXPA 5D12A 4ZLOA 4P90A 4I6BA 3ZOSA 4EOLA 4GSBA 3A60A 3MDYA 4AZTA 1UKIA 4J8NA 3ZLSA 4Y95A 3LFSA 3OF0A 4RVTA 2W06A 2XIZA 3Q6WA 4WNPA 2BDFA 4C4JA 2GTNA 1Q8ZA 5HEZA 3S0OA 2UZVA 3FMJA 5DR9A 3PG3A 4LGHA 3UMXA 4IQ6A 3QRUA 4IFGA 4CZYB 5IEVA 4CSVA 3R2BA 2WMSA 4HCVA 2JITA 3LCTA 3PXFA 4BL1A 4YZNA 2YDIA 5CWZA 4G34A 2W1FA 4NTSA 4YTHA 5K4IA 3A4PA 3ZH8A 1GZ8A 4O1PA 4MF0A 3KN6A 3WF6A 5CAOA 3KMUA 2J50A 2J4ZA 4E6AA 3W2QA 4FR4A 3ZDUA 2HY0A 4U8ZA 2YM8A 4PPBA 1REJA 3LFFA 5CU0A 5CENA 3UO5A 3FPQA 3V8WA 1U5QA 4ENXA 3A8XA 2I7QA 3C5UA 1FOTA 3LKMA 1XBBA 4L3LA 4EOQA 3OTUA 3KY2A 3VBVA 4QYGA 1FMOE 2X8EA 1JBPE 4MVFA 1TKIA 3Q9XA 4FTQA 2LAVA 3ZO1A 3RINA 4R7HA 1NVSA 1JSVA 2XK3A 2F9GA 4EH7A 3IPHA 4BCNA 2GSFA 3PJ1A 1WBPA 3F3VA 5CF6A 2XNGA 4FG8A 4DH8A 4BGGA 1R78A 4XOYA 4FV1A 3VQUA 4EHGA 4FEQA 2UZWE 1Q99A 4QMNA 2HAKA 2ITTA 2PY3A 3LJ1A 4MBJA 1IA8A 4CTCA 4G3CA 3QD0A 4M0YA 2IZSA 4BDHA 2CKEA 4G3FA 4E93A 1UU7A 2QD9A 5DT3A 5HVYA 2QHMA 2XB7A 5A4QA 2FGIA 3FLNC 3LLTA 3ZFXA 5I9XA 3N4VA 1CKIA 4RSSA 1RQQA 3ZZEA 3ELJA 3E63A 4C38A 5HX8A 3QUEA 3T8OA 4EZ7A 2X9FA 2XNNA 5DT4A 4EHEA 4LGDA 4LOPA 4AT5A 1M52A 2GNJA 4IAKA 4V05A 2ONLA 3BRBA 3QC4A 5GZ8A 2CKQA 3QZGA 4B4LA 1OBGA 3QQGA 1H00A 1OIYA 4IAAA 4AP7A 2RG5A 3VS1A 2F57A 4YJRA 1SYKA 5AJQA 3C0IA 2WB8A 5HCXA 3VBQA 2XKEA 3QCXA 3R7EA 5JQ5A 2Y6OA 4OBOA 3AGLA 5A14A 5KMKA 5C1QB 3LQ3A 2C3LA 3N9XA 3UE4A 4K0YA 5TKDA 5E8VA 3LIJA 3COIA 3JS2A 4DINA 4MEDA 4G3EA 4BWKA 3O96A 4FA2A 4MXZA 3CSVA 4RT7A 2NP8A 2G15A 3GU7A 1Q8YA 4H1JA 5TF9A 4O2PA 3W2CA 3QZHA 5E8UA 2CGXA 3FMNA 5C8KA 2EWAA 3HRFA 3WARA 3E88A 4WOVA 5AUUA 3GC8A 3EFLA 2XA4A 4YTIA 1URCA 3GUBA 3IECA 2W99B 3KQ7A 3BCEA 3CP9A 4HNIA 4QNYA 2PMIA 3IOPA 4W4XA 4FV3A 4O83A 4FSMA 4R3CA 2NRUA 4JBQA 5M4FA 2W0JA 1I44A 5JFWA 4UEUA 2YERA 2R9SA 1BKXA 4K9YA 5HLPA 3QTRA 3GQLA 4CTBA 4FTLA 3II5A 2ITXA 4CGAA 3JPVA 2YJSA 1DS5A 1E1VA 2C3KA 4X2GA 4YZCA 3BHYA 3BIZA 2VTIA 2I40A 1G8AA 3RNYA 2ZV9A 4R5YA 3ATTA 3PWYA 2WMQA 3VW8A 4Z55A 4DITA 4AAAA 4LMNA 4H3QA 2X0GA 4HNFA 2WQBA 3KKVA 4RJ7A 5CZIA 3CQEA 4GU6A 3RNIA 4O81A 4D28A 5LMAA 2VTHA 3DBFA 5EDQA 1PXIA 3VUHA 4TNBA 3SX9A 2W5AA 4QP6A 4O27B 4MXCA 4YLJA 5KHXA 2CCHA 2P4IA 4F7LA 1U46A 3QKKA 4QMQA 4GVJA 4YZ9A 1GAGA 3Q4UA 3IOKA 3IDBA 4IZAA 2BHEA 4HYIA 2C6IA 1FVTA 3I81A 4W8EA 2BIKB 1K3AA 3ZFYA 4AZVA 4PTCA 1ND4A 5EQYA 5DBXA 1O6YA 3COKA 2BRGA 3A7IA 3C0HA 3HEGA 4GYGA 3TZ7A 4D5KA 4ANOA 3EKNA 4TPTA 3LVPA 4XG6A 3SOCA 5I3OA 4FC0A 5KBRA 3HMPA 4X3JA 3NYXA 4ITJA 3VUKA 5KUPA 2OZOA 5AX3A 5BMMA 4YJNA 4EZ3A 4RA5A 4DLIA 4FICA 4U44A 2XBAA 3P7BA 1GIIA 4XP3A 5HNBA 2J6MA 5C8NA 4OW8A 4QP4A 4CQGA 4I94A 2WTIA 2FSMX 5HG5A 2WTVA 5AR5A 1XQZA 4OT5A 4C4IA 5AP4A 2I0EA 2HCKA 4FSTA 1GOLA 3TUCA 4YZDA 1SVGA 4XV9A 4ACCA 4YTCA 4OBQA 3CQUA 1Q62A 2QO2A 2O63A 3Q4CA 1RW8A 3EMGA 5J1VA 3NLBA 2HZ0A 3ZUUA 1HOWA 4AFEA 4FKUA 1JNKA 4QP2A 4WD5A 2QKRA 4BIEA 4FT3A 1PMUA 3LAUA 3OFMA 4D2RA 4CT2A 1CKPA 1H0WA 5AP0A 3KK9A 2Y6MA 4ZJJA 2Z60A 3ACKA 3JY9A 4L3PA 1OECA 5AP5A 4CKJA 3LJ0A 3UZRA 3NPCA 4IDTA 2C1AA 4DFBA 2C6KA 3AOXA 3SRVA 4PMPA 3FE3A 2ZDTA 3KRXA 2XYUA 5D11A 3RTPA 4DFNA 4B8LA 5M4CA 3TTJA 4EK6A 5GNKA 3JUHA 3IKAA 2OGVA 3LPBA 3ORPA 4KABA 2W9FB 1OL1A 4WIHA 5EW8A 4CQEA 2RFNA 4RIOA 3PJ8A 3D7ZA 4RFMA 4BC6A 5E1SA 2C5XA 4UBAA 5CEKA 3LFAA 3EOCA 4ZSLA 3FSKA 1OL5A 5BVKA 2HZ4A 2PE2A 3C4WA 1SNXA 5KZIA 5HG9A 4JBPA 3KCKA 3NYNA 3T3UA 1Y8YA 3EFWA 3R9DA 3CCNA 2R3LA 2B54A 4FOCA 4Q5HA 4NH1A 5BVNA 4J99A 4PP7A 3MA6A 4F9BA 2RFDA 1M17A 4DEDA 3E87A 2DUVA 4CCBA 4MD9E 2JIUA 4PL3A 4X3FC 5ANOA 4QTBA 3RAWA 5KMOA 2R3HA 4A4LA 5CI6A 3G6GA 4O0WA 1OPKA 4OTDA 5CVGA 5DHJA 4D0XA 1AD5A 4PWNA 3FWQA 3ZSGA 4BTKA 4IX4A 4DFXE 1XH7A 3CD3A 4R6VA 2IVUA 1ZYJA 2R3RA 3EFKA 2B7AA 3A8WA 3BWJA 4O0VA 5FM2A 3WILA 2UW3A 5M57A 3BX5A 3I5ZA 5CU3A 1PF8A 1UU9A 2WMVA 2R3NA 2XF0A 3HL7A 5LCKA 3C5IA 2OFUA 5D7AA 4GCJA 2PE1A 2QG5A 1W8CA 4KSQA 3UYTA 3VULA 2WZJA 2WD1A 3ZZWA 2C0IA 4UWBA 3WZEA 1ATPE 4U6RA 3UG2A 4DT8A 2PWLA 4IJ9A 3R63A 4NCTC 2XIRA 4FIFA 2WPAA 4OT6A 4QMZA 1ZARA 4XBUA 4E4LA 2GHLA 4C2WA 5J7BA 2W9ZB 4XEYA 1FQ1B 2QO7A 4HYHA 1R1WA 3QTXA 4QMXA 2YM3A 3S4QA 2YCFA 4J71A 3GQIA 3ZUVA 2LGCA 5HE3A 4YC6A 5L6WL 3NYVA 1CM8A 3ORIA 4FT9A 1YWVA 3QYWA 4CFMA 1JKTA 4YHFA 1JPAA 3C1XA 3PE1A 1H27A 5K5XA 4IW0A 5AFVA 4P7EA 3KL8A 5E91A 3HMNA 3WF7A 4B9DA 5IEXA 5M4IA 2VTQA 4QTAA 4UX9A 3U54A 4HVGA 5CNNA 3R30A 3GU8A 2RFSA 2BUJA 4N57A 2W1IA 3Q9WA 2AUHA 3AD6A 4O91A 4PNIA 5AP2A 2X7OA 3IW6A 2WXVA 4QTDA 2R3JA 3EHAA 3MW1A 3SQQA 3BQRA 3WOWA 4EC9A 4FVQA 3F2RA 2ZOQA 4JXFA 2BRBA 4ANNA 2FH9A 4OTWA 2ZMCA 4PPCA 2RG6A 3O2MA 3W18A 2ZM3A 5CSXA 1Y8GA 4AFJA 3QD2B 3Q5ZA 3PA4A 5EI6A 4BCHA 4J96A 4G5PA 3Q6UA 3C51A 2YABA 4L53A 3VS3A 2X4FA 1KV1A 2P2HA 4MKCA 5ANGA 3FLQA 3K3JA 3ZXTA 2PZPA 4AGCA 4YPDA 2X2LA 3LHJA 2PTKA 4OBPA 4ZTLA 3PPZA 2J2IB 2JAVA 3O7LB 4UXQA 5CY3A 2FSLX 3UPZA 5DR6A 4UMUA 4P4CA 4EH3A 1IR3A 1OUKA 3U4UA 2YDJA 2YLFA 4CT1A 3FV8A 3FQSA 3F3WA 4M69B 3NAYA 3RZBA 2W4JA 4FT7A 4UXLA 4XS2A 4YJQA 4BCIA 4CG9A 2Z8CA 4ZP5A 3EZRA 4IJPA 5JRQA 3F5XA 3PY1A 3I79A 4PF4A 4KBCA 2WGJA 4QYHA 3EZVA 3I6UA 2A27A 4OTPA 4D4VA 5L4QA 4DCAA 2BPMA 4MF1A 1OB3A 2VTLA 5LMKC 2X8DA 2XNPA 1O6LA 3TNQB 4PP9A 4IVBA 4RX8A 4RZWA 4RVKA 3F2NA 3FC2A 3R04A 3WI6A 4TYEA 4DG0E 3DXNA 1ZOEA 3EN6A 4C2VA 2X39A 2VUWA 3HMMA 2J0MB 1YDTE 3TI1A 5HD7A 2PZ5A 4WSYA 4WNKA 3VO3A 3EQHA 1JSUA 2YM6A 1R0PA 2YAAA 3MB7A 3HX4A 4PRJA 1G8SA 5J1WA 2BALA 3MSSA 1MRYA 1YWRA 2ZAZA 5BX0A 4ARKA 3BV2A 4O7YA 4ZY5A 4L01A 4J98A 2OIQA 4YJVA 2VX1A 3UG1A 2C5VA 4WSQA 3F9NA 5F4NA 3UQFA 5K3YA 2PVRA 3LCSA 3FY2A 2XKCA 5ANJA 2HK5A 2XVDA 3DAJA 4HCUA 3LMGA 4JR7A 4XHKB 2C47A 4EKLA 3QQLA 3DB6A 3FI8A 2C6EA 4FKVA 3C13A 3C9WA 5HG8A 1IASA 3PP1A 4L00A 3AMAA 4ZMFA 1Q61A 2C3JA 3RM7A 4HJOA 1F3MC 3MVHA 4NFMA 4EEVA 3DAKA 5JGAA 4EONA 5ACKA 3NMUF 3A99A 1H07A 5BYZA 2C0TA 3D2KA 3U9NA 3HV6A 1L3RE 4GJ2A 4CMOA 3AC2A 5I0BA 1OZ1A 2UW0A 5LQFA 3UO4A 1IG1A 2ESMA 3DLZA 5GZ9A 5HKMA 3KXGA 1MQBA 1WMKA 3GOPA 4YLLA 4BVUA 5LVNA 2O65A 3UNJA 3DKOA 3WZKA 3SG8A 4LFIA 3IG7A 3VQHA 5CLPA 4F0GA 2XIXA 4L9IA 1QMZA 4QMSA 4QYEA 5F95A 4C37A 3I60A 3QAME 3NCZA 3R6XA 5KHWA 4OUCA 3VUDA 3MH1A 5FEEA 5EKOA 1LPUA 2C6LA 2A0CX 5LCJA 2YISA 3PG1A 3V5LA 4WKQA 4NU1A 1H8FA 4JI9A 4FNYA 3EKKA 4B8MA 3KN5A 3ORNA 4UB7A 4JX3A 4R8QA 2PPQA 2Y9QA 1WZYA 4A9YA 2XP2A 3L1SA 2ZV8A 4UMRA 3TG1A 2VTPA 5IUHA 4ASDA 1GZNA 5GIOE 3IDPA 4FG9A 4XUFA 4HZRA 4N4SA 1UA2A 3NNWA 4YURA 2PMLX 2IPXA 1FGKA 3U4WA 3Q32A 3NNXA 3R9NA 4YZMA 5FG8A 2RSVA 2Z7LA 5HORA 4XNEA 4GIIA 5J5SA 1YQJA 3U6IA 3UQCA 4NJ3A 5CSVA 2ZJWA 4DH1A 5HD4A 2XKDA 4K1BA 4YLKA 5C4KA 4Y5QA 2IW9A 4UMPA 5I9YA 3L9PA 4OAVB 2XJ1A 4H3PA 3JVSA 4YJOA 1BMKA 5HCYA 4M69A 5K4JA 3NS9A 3R71A 1JLUE 3ALOA 3R8ZA 4NZWB 4BDCA 5AEPA 3R2YA 3DY7A 5G1XA 4AT4A 4RQVA 3UZTA 3DLSA 3O71A 4MNEB 5A54A 3OEZA 5CALA 5DWRA 4EQCA 3ET7A 3FZTA 1Y6AA 3DK7A 3I5NA 3QQUA 3VS7A 3WZUA 3FYKX 5K5NA 3Q4TA 3LFNA 4QPMA 2OK1A 3BEAA 4CG8A 4R3PA 3UGCA 4ZSGA 4LV8A 3V5QA 1XR1A 4WBBB 2C6DA 4E4MA 4EOMA 4U5JA 5E90A 1R3CA 1RE8A 3PIYA 5LOHA 2B9IA 2H6DA 4O0UA 3C4CA 2B9FA 2GS7A 4FL2A 5HLWA 4RVMA 2XRUA 4O0XA 3G0FA 3R9HA 3VJNA 2OJGA 1PXKA 4J95A 4NTTA 5AV0A 1M7QA 2BILB 1V0OA 2W4OA 4I92A 1FMKA 1PXPA 1U59A 2BZIB 4RFZA 2G2FA 3NIZA 4MQ1A 4ZTSA 4CFUA 3R73A 5CF4A 4KUJA 5A4CA 1BL7A 4KWPA 5BVEA 1JOWB 3MWUA 4IM2A 2JDSA 4H1MA 4L3JA 2W1ZA 4FODA 1YXXA 5CYIA 4JDKA 3FZOA 5EW3A 5J5TA 3SW7A 4XYFA 4G6OA 2V55A 5FXSA 1MUOA 4QTCA 2UW6A 2I6LA 3DBEA 4Y46A 3NUNA 4DF3A 5CASA 2C30A 2X4ZA 2VN9A 4YGAA 2KULA 2XZSA 4ZK5A 3F3UA 4H58A 2XIKA 3HV7A 2W17A 3HNGA 4B6LA 5AIKA 1GIJA 3QRKA 5IH6A 3C4XA 3L8PA 4UN0C 2R5TA 2YWPA 3G9NA 3VRZA 4MBIA 3HUBA 2XIYA 3TNHA 3UOJA 3DS6A 3VIDA 4HVIA 2VZ6A 4BFMA 3ZUTA 1QL6A 3ZCLA 3G51A 2P2IA 2Y7JA 5CNOA 3OY3A 4S30A 4FIHA 5D41A 3VS0A 4L42A 2P33A 3EQIA 2WMWA 1MRVA 4A9UA 2HWPA 3LM0A 2PZRA 2QU5A 2R3FA 3VF9A 3D7TA 4V04A 1U5RA 3R22A 3R8PA 3RPSA 2ITZA 3LFEA 4PUZA 4BI0A 4A9TA 3MVLA 4R3RA 4MD8E 4FUXA 3CLYA 4M67A 4GFOA 4FEWA 1KOBA 5IA0A 4J1RA 1XH4A 4QTEA 5A4EA 4X3FA 4WO5A 4G9RA 1FPUA 3FKOA 4FTJA 4L52A 4UWYA 4L7FA 2QC6A 4BTJA 4HOKA 5DOSA 3LW0A 1ZMUA 4YTFA 2BZKB 2F4JA 3QWJA 2OFVA 4EH2A 4GT4A 2Z7QA 2FA2A 1R39A 5J87A 4D2WA 3QRIA 4TW9A 4GYIA 5EM8A 4KKHA 4WG3A 2PU8A 1GNGA 4ASZA 2CCIA 2OIDA 3E8NA 4WNOA 5HX6A 4UYAA 3OT3A 4KD1A 2V5QA 4KRDA 4CXAA 3OWKA 2EB3A 3QRJA 3FKNA 4J8MA 4KIKB 2WTCA 3ZO2A 1PYEA 4HVDA 5AUTA 1UWHA 3L8SA 4O0SA 2OU7A 4WNMA 5BVFA 5A4TA 2OH0E 5E8TA 5HICA 4NCTA 4XG3A 4IX3A 4DEAA 3HKOA 4A9SA 4RX7A 4ZLZA 2IVSA 4MNEA 2PL0A 3ENHA 3OHTA 4RC2A 5AAGA 3CGFA 5KMLA 5L8LA 5LJJA 3AD4A 2PVLA 3DTWA 3M11A 3CPCA 4PL4A 3BZ3A 5LVLA 3ZRMA 1DI8A 3CEKA 3BGZA 3PJCA 4JRNA 4IBMA 2OG8A 1G3NA 4QT1A 5CVHA 3LXKA 2VO7A 4I41A 1JQHA 2FSTX 4J97A 4M14A 4FNXA 2I1MA 3SV0A 4BYIA 3EQFA 4NSTA 5HBHA 2PMNX 2W96B 5EK7A 5FBOA 3VUIA 4F9WA 2BAJA 2ZM1A 4I20A 5IDNA 3BYUA 4GJ3A 2W5HA 3D2IA 1OGUA 3KRJA 4EOKA 3OC1A 4WRGA 2X2MA 4XRLA 3ULIA 5I9VA 4CRSA 3FI2A 3BE9A 3BGPA 3GNIB 4HGEA 5C01A 4O7ZA 2QU6A 4EWQA 4RA4A 3U6JA 1OVEA 1OM1A 5A9UA 3ID6C 4DGLC 3HMIA 4AZEA 3MY0A 5HBEA 5EYDA 3PSCA 4O7SA 1H01A 2GHMA 2YIXA 3I0OA 1YKRA 3PFQA 4E6CA 5IA1A 3AC4A 2R4BA 1T46A 3NUUA 4USDA 3GU6A 2VV9A 5HZNA 4XLVA 3PJ3A 5EQEA 4GVAA 3TUDA 5EI8A 2JBPA 2QCSA 4UZDA 4CFNA 2EXCX 3KXNA 1SNUA 1W83A 1VYZA 1YOJA 2VTRA 4B99A 4E6QA 3KULA 5A6OA 3PY0A 5ANDA 3KC3A 2E9UA 4D2SA 3UBDA 4CFWA 3EH9A 3AC5A 3DA6A 4EL9A 2FSOX 1W82A 1WAKA 3KVXA 5DMZA 3M1SA 3K5VA 3DFAA 3RAHA 2GNIA 1KUTA 2J0LA 2AYPA 4I5PA 3R7UA 4ALVA 2H9VA 3ROCA 2WU6A 3KMMA 5H9BA 3AT3A 2X1NA 5LMKA 3TWJA 1Q8UA 4RLKA 1OL2A 1JAMA 3E3PA 3KXZA 2XEZA 4FNZA 3HYHA 4M66A 4K8AA 3TNIA 1ZAOA 2V0DA 4W9XA 4TWPA 2VO3A 3JVRA 4Y73A 2F7XE 3NNUA 5FP5A 3R7VA 4U7ZA 2ZB1A 4DFZE 1XH5A 4RZVA 2IW8A 5GINE 5ETFA 3TNWA 2BVAA 1KE8A 5L2SA 2C6TA 4BZDA 5AR3A 5G6VA 3G5DA 3AT2A 2JDRA 4AA0A 4I23A 1H28A 3O8PA 4LUDA 4IVAA 4TYHB 4XX9A 5DT0A 3V01A 3QFVA 4BZNA 3DKGA 4GIHA 4E1ZA 4YSJA 4CLJA 4A06A 3FMMA 4M15A 4OTFA 4U41A 3QX4A 4I93A 4A9RA 3RKBA 1WVYA 2WEVA 2WIHA 3QLFA 4FI1A 2WMTA 4X6RA 3CR0A 3CTQA 5DVRA 5AP7A 2ZV2A 3HECA 4ZLYA 5M51A 1PW2A 4ORKA 3ZMMA 5AM6A 4YJUA 5FEDA 3KEXA 2WNTA 3ZM4A 4AGUA 5AA8A 4FTRA 1ZOGA 3I7CA 1P14A 1YHSA 3R02A 3ATSA 2YIYA 1E1XA 4ERWA 4GS6A 5HO7A 3LMIA 4ANLA 5H3QA 4N6YA 4YSMA 4F70A 3E5AA 4FKTA 4YO4A 5J95A 4AA4A 4EBVA 4G3GA 4BCGA 3GP0A 3R9RA 5LVOA 1LUFA 4L7SA 3F3TA 3G2FA 4CV9A 5H8GA 1XHAA 4KINA 4AACA 3HP2A 3R8VA 2O64A 3FHRA 2CGVA 3PDTA 3RAIA 4QP7A 5CX9A 2UW9A 3A4OX 1OITA 2HW7A 5IZFA 1XBAA 4OTQA 4GT3A 4QQCA 3E64A 1U54B 4FMQA 4EUTA 5A6NA 4UV0A 1YI3A 3GC9A 3MFSA 1Y57A 3B8QA 5AAEA 3FZ1A 5HESA 1H0VA 3FL5A 2QI8A 3P7AA 4YP8A 4L68A 5ACBC 4DE4A 4BDGA 3BKBA 1IA9A 4IADA 4DFUA 4S32A 4C4HA 3UC3A 3EQCA 3SW4A 1KE7A 2CLQA 5L2IA 5AR2A 3I6WA 5BVOA 3TIYA 3R9OA 3ZSHA 3MS9A 3RHKA 2PHKA 2G1TA 3QKMA 3FAAA 4DGGA 3KVWA 5EDRA 4FKGA 4FZFB 5DGZA 3FJQE 4FTKA 2HZNA 1OIQA 5IQGA 4U45A 2YIQA 4KS8A 4IH8A 2R3GA 3S95A 1QPCA 2JKOA 3NUSA 4EH6A 5FWKK 3DJ5A 3RAKA 3DBQA 4FKRA 2OI4X 4R77A 2PUNA 4FIJA 4FZ7A 3ALNA 4IEBA 1UV5A 5E7RA 4DFYA 2C6OA 3OTVA 3OG7A 3MJ2A 2WHBA 2XRWA 5BUEA 5KNJA 2UZUE 3MFUA 4HPUE 4BY9E 3MIYA 4XV2A 4QP1A 2OIBA 4FKPA 1KOAA 2NNWB 3TV7A 2QVSE 4TYJA 5BNJA 4EOPA 2YFXA 4XP0A 1OUYA 2IJMA 4TTHB 3CKXA 4JDJA 3H30A 2XNMA 4YJTA 3UVQA 2ZMDA 4D4SA 4OLIA 2WMRA 1Q3WA 1M2PA 4BGHA 5FD2A 4FE2A 3TKHA 4FKWA 1UNLA 4HCTA 3FLYA 3IO7A 3S2PA 3SHEA 3K5UA 4AG8A 5E4HA 2YIRA 3LCKA 4JQ7A 4QOXA 3TJCA 2H96A 2W1GA 4TYHA 2PYWA 3SG9A 3ROYA 3KMWA 3POZA 5DH3A 2VGPA 4C0TA 4WHZA 2ETRA 4FL3A 2PZIA 2I0VA 3V8SA 1RJBA 4GH2A 5EYCA 4E5WA 3NR9A 1QPJA 5FQDC 1F0QA 2QR7A 2XEYA 4E8AA 5HOAA 1OKVA 1QPDA 2J90A 3N51A 4C3RA 3T3VA 5AR8A 5AIRA 2J5EA 3FZPA 1REKA 2IG7A 4LUEA 3W2OA 5DEWA 5IH4A 5IQEA 4CFVA 1XWSA 3V6RA 4I4FA 1OPLA 3P78A 3UVPA 3R21A 3TDVA 2H8HA 2R7IA 4FNWA 3LFBA 4FV6A 4BCJA 4WG4A 4S34A 3F2AA 4XOZA 2SRCA 5HNGA 3UIXA 3ZO3A 4B7TA 4FZAB 4XG2A 4O86A 3A61A 2JFLA 4EKKA 4AF3A 3QQJA 4FSZA 4YHTA 4EK8A 3IK3A 3DNDA 5EHLA 3QGYA 4M12A 3ZONA 1APME 3GEQA 3ORZA 3IGOA 3EQDA 4YNOA 2F2UA 4I5HA 1Q4LA 2A2AA 4TYIA 4FEUA 3JY0A 4WUAA 3R8MA 3V04A 4C34A 4D58A 2FUMA 4JLCA 3F69A 5CSWA 3EWHA 3VVHA 4AN3A 4PQNA 1GIHA 3BWFA 4PPAA 1XH8A 4UYNA 4NW6A 5CSHA 5FBNC 4R5SA 4XV3A 5T68A 4QP3A 3ZDIA 4C61A 5IUGA 5J7HA 2CKPA 2UZDA 3IW5A 5BVWA 5JN2A 4U97A 2DYLA 3TZ8A 3MN3A 3OS3A 4BTFA 4D2PA 3GU4A 4IX5A 2GU8A 4ZTHA 2R0IA 3W55A 1WVWA 3LQ5A 1U4DA 2DQ7X 3DK6A 2F7ZE 3QTIA 4XG4A 3OXTA 1TQPA 3JR1A 1ZOHA 3R7IA 1BYGA 2ZDUA 3GXLA 4FK3A 1J1BA 3PSDA 2QO9A 3PA5A 3LMHA 3QQFA 4IWPA 3WE4A 3A7FA 3L9NA 1W84A 4FVPA 3ZHPC 5FDPA 4NM3A 3RGFA 3SA0A 2QG7A 2BMCA 2HZIA 2GPHA 3QCYA 3PY3A 1PHKA 2UW7A 4N0SA 2JAMA 5IA4A 3W8LA 3OOMA 4JJRA 4X21A 2OJIA 3KU2A 4K18A 3L8XA 1Q3DA 3ZC6A 5BUIA 3T9IA 2WMAA 4HW7A 5KBQA 2PULA 1WFCA 3DTCA 4N70A 4ZSAA 5FUTA 4FBXA 4DTAA 2VNYA 3QTZA 3WBLA 4CD0A 3H9OA 2YN8A 4MBLA 5FRIA 2WO6A 4II5A 4R1YA 1OIRA 4DG3E 5DYJA 2E2BA 2J7TA 3ZEPA 5DEYA 1ZY4A 2B53A 1JVPP 4S31A 4ID7A 2XK6A 2UZOA 3KB7A 2ITWA 4EK3A 2GDOA 3A7HA 4MNFA 3G33A 4CV8A 2VTSA 3IW8A 5KCVA 4BCOA 4FK6A 2B4SB 2XYNA 2R3IA 4O96A 3NVMB 2B0QA 2FYSA 4BDAA 4U0IA 1URWA 2HY81 3BLQA 5IA5A 4BCFA 5E8XA 3AC1A 2GHGA 4G5JA 4W4WA 2NPQA 3P9JA 3ZRLA 1PMEA 4D4RA 3VBWA 4DH7A 3ZU7A 3A7GA 4YPSA 2OZAB 5TR6A 4USFA 2C5NA 3WF5A 3ZXZA 4JG8A 4F7SA 4IVDA 4C57A 3LXLA 3Q52A 4EH8A 5L8KA 4A4XA 5L2TA 3FMEA 4PTGA 3W10A 2CPKE 3D5UA 3ZFMA 5D7VA 4CKRA 4XCUA 3UIUA 2E9OA 5CS6A 4MCVA 4PNKA 4O7VA 4RJ5A 1KE9A 4DYMA 4R7IA 3C7QA 4DGMA 5EM7A 2WMXA 3MVMA 5KZ0A 5T6KA 3KA0A 3OCTA 1L8TA 3LFCA 3VC4A 3F5PA 3NGAA 3EIDA 3NW7A 5F94A 4W4YA 5AWMA 2WKMA 5BYYA 4CYJA 3IS5A 2VWXA 1J3HA 2P55A 1OPJA 4I4EA 4BBFA 4E7WA 2QOOA 1GZOA 1WBWA 4IAYA 2WTJA 3BYOA 4X0MA 4F6SA 5M09A 4E26A 1ZMWA 4FYNA 4OAUC 3Q2JA 4FKSA 5HIDA 4MH7A 1ZWSA 3NUPA 3TT0A 1MRUA 3Q9YA 2WIPA 2XBJA 3NW6A 1CMKE 3MY5A 4DGNA 5F20A 4U79A 2ZYBA 1YDSE 3ACJA 3V6SA 4NWMA 3O8TA 4U80A 3V5PA 1H24A 1V0BA 4BKZA 3FZRA 1QPEA 1SVEA 3KK8A 4EWHA 3HRCA 5FTQA 2Y4PA 2R3MA 4PMSA 4E73A 1S9IA 1XH9A 1H1QA 2UUEA 2Y0AA 3PPKA 5DE2A 2CJMA 2UZBA 1FBNA 4FTIA 5EYKA 2BZJA 3G9LX 5AV1A 3AGMA 3D5XA 4RIXB 4RWJA 5DIAA 4AW1A 4BDEA 4IHPA 1ZYCA 3ZLXA 4KKGA 4MYGA 4F1TA 2I0HA 2JIIA 2CN8A 1H08A 2J9MA 3OEFX 4RJ6A 3SXRA 4FIEA 2O3PA 2C6MA 3CD8A 3TDWA 4BR3A 4IXPA 2F7EE 4EH5A 5EM5A 4EHZA 5FTGA 3P79A 1MQ4A 4BTMA 5KE0A 3IQ7A 2JKQA 5BPYA 1UNHA 3HDNA 4PTEA 3BU3A 3E93A 2C68A 2BFXA 5IMXA 3CS9A 4Z7HA 2QR8A 2XNOA 3OMVA 4AN2A 5TOZA 4CMTA 4G9CA 4RX5A 3HZTA 5A3XA 3BHHA 3OUNB 4TXCA 3P08A 1OKYA 4NJDA 4ACGA 2XKFA 3R1QA 3AC3A 3P4KA 3LQ8A 4IZ7A 2BDJA 2RFEA 3BYVA 5CAUA 1P5EA 2VX3A 4ZJVA 4RIYB 5CAQA 4DG2E 4O7RA 4FOBA 5AP6A 2CGWA 2DS1A 2PMOX 5EHOA 5JZNA 1IAJA 4O7NA 3SGCA 2R3QA 3W1FA 4BCPA 4IB3A 3BHUA 3GC0A 2VWBA 1Q97A 3P7CA 4M3QA 3F66A 3NAXA 5LVPA 2VWWA 3L8VA 4PY1A 5HQ0A 5M06A 2OZAA 1TQIA 3NX8A 2HELA 3MB6A 4KIOA 4TN6A 3RPYA 3U87A 2VTMA 3R7OA 3DXQA 3PA3A 2NO3A 5DFPA 2WTDA 4YU2A 4AWIA 4DA5A 2WQNA 1F5QA 2YIWA 4D55A 2X7FA 4RG0A 2HIWA 4M0ZA 4APCA 2ETKA 4XJ0A 3ORXA 2BTRA 3C4FA 4I21A 3VHKA 3TKUA 4ACHA 3HAVA 3FMKA 4LRKA 3SXFA 2H34A 3QGWA 4QMVA 2BROA 4QP8A 2CNUA 2PVYA 2V7OA 3OW4A 4FSWA 2IVTA 3QL8A 5DRBA 4BN1A 4NFNA 5EI2A 4JS8A 5C8MA 5CZHA 3BHTA 2XUUA 1OBDA 3QF9A 1Q8WA 3PLAE 4IC8A 5DLSA 3F5GA 4MAOA 5JZJA 3FI3A 5AUYA 1JKSA 2UZTA 4W9WA 4YBKA 3FSFA 3S3IA 3DCVA 4FG7A 5CU2A 4IVCA 4BGQA 3TV4A 3JXWA 4QD6A 2IZUA 2C0OA 5K0XA 3GCVA 4FV9A 4RQKA 4ZTQA 5IDPA 3UVRA 3OY1A 4V0GB 3CQWA 4BCKA 3JYAA 4FEVA 5IQHA 1PXLA 3FY0A 4ANQA 1NVRA 3OCGA 4H39A 4BYJA 3VS6A 5L3AA 3DQWA 4MXYA 3OBGA 1ZMVA 3MPMA 5KX8A 4W8DA 4WBOA 5JFVA 1ZZLA 3K54A 4EK5A 3E8CA 4U40A 1DAWA 2F2CB 4I6HA 3OZ6A 4FSNA 4GRBA 5B7VA 4GG5A 4JR3A 5AX9A 2W1HA 3GCPA 3K2LA 5M08A 2RGPA 3QBNA 3FXWA 3AC8A 4IB5A 5FEQA 3ZM9A 5C4LA 5IH5A 2CN5A 5IISA 4IMYA 5FLFA 3DBDA 4IAFA 4MWIA 5CT7A 3UZPA 4AOIA 3SOAA 2VWZA 1V1KA 1H26A 1Y91A 2WTKC 1RDQE 3QA0A 3UO6A 4K6ZA 4FKIA 2PSQA 4ZTMA 4UMQA 4JDIA 3FQHA 4QPAA 2R3KA 3E8EA 4BIBA 5IPJA 4D0WA 3ORTA 3PZHA 2PE0A 2XK4A 4DCEA 4ZS0A 4FTUA 3W2RA 5AMNA 2JKMA 4DLJA 4EC8A 2ITYA 4JBOA 3UQGA 3FUPA 4JAJA 2G01A 3RJCA 5AA9A 4F7JA 2B9HA 1W7HA 1BX6A 4L44A 3QHWA 4GG7A 4FV2A 2BRNA 3E8DA 2HOGA 1Q24A 4RJ8A 4EORA 5EKNA 4ZSJA 2VTOA 5LVMA 3QRTA 3BELA 4ENYA 4G16A 3ENMA 5IF1A 2XJ0A 5C9CA 3LXPA 3F61A 2CNQA 3PUPA 2EUFB 3FYJX 4X7QA 3PYYA 4U81A 4P5ZA 1EH4A 2RKUA 2VNWA 4Z16A 2O5KA 4FV8A 1XH6A 4LYNA 1VEBA 2E9VA 4GUEA 1FGIA 3R7GA 4RWIA 4S33A 3HAMA 1JSTA 4H36A 4O0TA 2HXLA 3VJOA 3V5JA 4ZZOA 3KRWA 1Z57A 3QUDA 4IAIA 3FQEA 4RC3A 4XV1A 3DKCA 3Q96A 3LCOA 2FB8A 3DJ6A 4LG4A 5CT0A 4EUUA 1CDKA 2V7AA 2P0CA 3BU6A 1SVHA 3RCJA 2WFYA 4JG7A 5HVJA 4LM5A 4OR5A 2B55A 2PVFA 4TNDA 3H10A 4GV1A 3PIZA 4AXAA 3M42A 4ZOGA 3UMWA 2NRYA 3NCGA 3TEIA 4MXAA 4YZBA 3WYYA 2XM9A 4ALWA 3BV3A 3HV5A 3QU0A 4I6QA 5KKRB 2YWVA 2W1CA 5ANIA 4Q9ZA 4AGWA 4WG5A 1YI6A 3VBYA 2Y4IC 2X6DA 2YM5A 1ZY5A 3PVBA 4RLLA 3FBVA 3RALA 4HPTE 2QKWB 3QCSA 4A07A 3Q53A 3GC7A 4V01A 2J5FA 3PXKA 1ZXEA 2XNEA 2WEIA 2YCRA 3G0EA 4ACMA 3WZDA 4V0GA 3RCDA 3AT4A 2WQMA 2GCDA 3HV4A 3TV6A 5GHVA 3NVKI 5HTBA 5HLNA 4NKAA 3UNKA 5IEYA 1NY3A 4M68A 2QOCA 4UZHA 4QMYA 4DN5A 5TO8A 4FV7A 1O9UA 3KCFA 1UVRA 1WBOA 2R7BA 5DI1A 5AUVA 3O23A 3UC4A 2KTYA 5CEQA 1WCCA 1GY3A 5GZAA 4ANMA 1IRKA 2ITNA 2YLEA 2VU3A 4UMTA 2IWIA 4IFCA 3R83A 3UP2A 4C7TA 3TZ9A 1IEPA 1YOLA 4JQEA 5LWNA 2VTNA 3AG9A 5AM7A 5ETCA 4CCUA 4DEHA 3LXNA 4O0YA 3EN7A 1FINA 4ZY6A 2HYYA 3PIXA 5CXHA 2WOTA 4L45A 4AOJA 4DBNA 4YJSA 4PDSA 2OJJA 3F7WA 2REIA 2XNBA 3DAEA 4ONAA 5JGDA 1PJKA 3EQPA 3EN5A 2CLXA 2QONA 4I6FA 3S1HA 4RIWB 2GMXA 5LWMA 3DDQA 3QD3A 2AC3A 3S00A 4TYGA 5KO1A 2JIVA 3N4TA 3BBWA 1SZMA 3QD4A 2CGUA 1H1WA 3CTHA 5JKGA 4O22A 5FGKA 3CKWA 3QA8A 4ACDA 4I5CA 3FHIA 1KV2A 3IW7A 4Z9LA 4HGTA 5T3QA 2OLCA 5HU3A 4APPA 2UZNA 5AAFA 1J7UA 4L43A 4AU8A 3FZSA 4JNWA 3DFCB 3Q4ZA 5CU4A 4BWXA 1YXSA 1VJYA 2X7GA 3MH0A 1PRYA 3PXRA 1OMWA 4IZYA 5I9WA 1SM2A 4TRLA 1Z5MA 2W05A 3EYHA 5D10A 1LR4A 1WVXA 3WE8A 4LOQA 3R01A 1YXUA 4FSUA 1UKHA 3OVVA 5L8JA 3PP0A 2IZTA 5M44A 3OROA 1VYWA 2ITUA 3R7YA 3D94A 3O17A 5CAVA 3VUTA 4P2KA 4JQ8A 3EB0A 3RP9A 3V3VA 4I0TA 4YNEA 2R3PA 3OWLA 2XS0A 4D1ZA 3GOKA 2OWBA 3QTSA 1W98A 5CEOA 2YZAA 3Q2MA 4IE9A 3UODA 3VW6A 3DOGA 3VHEA 2G2HA 5LARA 2A1AB 2YAKA 3MA3A 4OTRA 2X8IA 1WBNA 3RWPA 2YCQA 2WTKB 4HGSA 5E1EA 4HVSA 1OL6A 4K77A 1PMNA 4RBLA 5HBJA 4WT6A 4C62A 3KFAA 4KIKA 2GQSA 4PMTA 2J0KA 2WU7A 3VWAA 2R0UA 3OW3A 4M13A 3VNTA 4GKHA 2XMYA 5H8BA 4X2JA 1UU8A 3ERKA 3W16A 4ZEGA 1NVQA 3ZYAA 4BIDA 4H3BA 5HGIA 4LL0A 1ZLTA 2PVHA 4TY1A 4E4NA 2X9EA 1H1SA 4K11A 5AUZA 2G9XA 5H8EA 3R0TA 4NKSA 1M7NA 3FLZA 3QALE 3QYZA 4G6NA 1NW1A 2IW6A 4EZ5A 3M2WA 4CZUA 4ITIA 1JKLA 3CXWA 3GCSA 2BTSA 2QOKA 3NUXA 1V0PA 4X2NA 4A7CA 1AGWA 2HXQA 1VZOA 4TL0A 4YC3A 4JOAA 4AGDA 4BICA 3DDPA 4EJNA 4LGGA 1PXOA 3ITZA 4YHJA 4CZTA 1M14A 5CI7A 1H1RA 3AXWA 4YUQA 2VWYA 3O50A 4IIRA 1CKJA 1YDRE 2OO8X 3EN9A 5CEIA 2XK9A 3RBWA 4IACA 2GS2A 3ZC5A 5H2UA 4FTTA 3CY2A 4DGOA 3KXXA 3HLLA 1JKKA 3OBJA 4EYJA 2Z7RA 5CF8A 3CIKA 4MHAA 5CXZA 2X2KA 5IG1A 4HVHA 5D1JA 5HVKA 3PVUA 3E62A 3B8RA 5KMNA 3KF7A 3FXZA 1P4OA 3P23A 4G1WA 3I7BA 2WTWA 4DTBA 4FKLA 3RZFA 4E4XA 5M56A 4KSPA 4QMMA 2PUUA 4IB0A 4TZRA 4FVRA 4LOOA 4MXOA 4D5HA 1XBCA 4FX3A 4F6UA 2C5YA 4RIWA 1YHVA 3F3ZA 5CQWA 3PRIA 4M8TA 3R8UA 3PVGA 3W8QA 4BWPA 1SMHA 2QHNA 5HTIA 4M7IA 5E8ZA 4FTNA 3RVGA 4D9UA 3SRVB 4OGRA 2VTAA 1PXNA 2HWOA 3PE2A 3Q5IA 2B9JA 4JBVA 4MX9A 5TE0A 1B39A 5ANKA 3HRBA 4KRCA 4FGBA 3RK9A 2P3GX 2Y4IB 5DPVA
chains in the Genus database with same CATH superfamily
1A06A 2ERKA 2X6EA 1B38A 4M97A 1AQ1A 4YC8A 4MK0A 1ZRZA 3SKCA 3LOKA 4L67A 4WUNA 4IM3A 1S9JA 2OW3A 4NW5A 1Q41A 4TKSA 2GNLA 3VS5A 3UIBA 3AKKA 2PUIA 4RPVA 3OCBA 2ACXA 2O2UA 3UYSA 4KBAA 5HNIX 3HUCA 3BU5A 2BHHA 3D0EA 5HE2A 5DNRA 3RM6A 2UW4A 1PKGA 2GTMA 2YEXA 3COMA 3PXZA 5EOBA 4CVAA 2PZYA 3QUPA 4CNHA 2C4GA 4KIQA 4PX6A 4EK4A 3EJ1A 3BE2A 3VAPA 4EH4A 4MTAA 4J52A 4FKOA 5FDXA 3PPJA 4AE6A 2DWBA 5AUXA 4GL9A 4NT4A 4Q2AA 4BBMA 3F82A 3OWJA 3V5TA 4BI1A 1STCE 3WYXA 4BDIA 3EQGA 4C33A 4RJ4A 3TM0A 3EQRA 5K0KA 2AC5A 4FV5A 5DN3A 3UOHA 3MIAA 3VBXA 3UDBA 2QOIA 4QRCA 5B2KA 3REPA 5I9ZA 4IC7A 2ZV7A 2Y8OA 3UJGA 3GB2A 3TTIA 1H4LA 4R1VA 4U3ZA 2F49A 5HO6A 5D9HA 5DA3A 5TT7A 4H05A 2WQOA 1K2PA 3GENA 3RK5A 3I4BA 5C26A 3DXPA 2UVYA 4FEXA 4QQJA 3ZRKA 3OXZA 2EXMA 5JH6A 3OXIA 4IB1A 3G15A 2EVAA 3FMDA 4F09A 5JEBA 4QYYA 5FM3A 4F0IA 4EH9A 1DM2A 3CBLA 4JDHA 5AV4A 1ZYDA 4RWLA 3SXSA 4CFXA 4CKIA 3O51A 2GFCA 4HYSA 5DR2A 3W2SA 4AT3A 1CSNA 1YOMA 3KXHA 2BKZA 3PZEA 4O6EA 1QCFA 4FUYA 4O7LA 4BDDA 4DHJA 3U8WA 4XG8A 4IANA 3SVVA 2J0IA 3GFWA 4G31A 4I24A 5JMSA 4ZMEA 3IDCA 4IDVA 1PY5A 2GQRA 4KKEA 5HHWA 4BDKA 4U9AA 5BUJA 3AMBA 5CF5A 4MUQA 3POOA 2IO6A 4QP9A 3GFEA 3UIMA 2UV2A 4BKYA 3TXOA 2PUPA 4MD7E 4GK2A 4XG7A 3RWQA 4CFFA 3EL7A 3OP5A 1OIUA 4DH5A 1BUHA 4OTHA 3H9FA 3U9CA 1U54A 4XBRA 3I1AA 4Y83A 4J7BA 2RF9A 3C0GA 3H4JA 3SD0A 3BEGA 3KREA 2GNFA 2UVXA 3R28A 4O7TA 4LI5A 2YCSA 3A2CA 4LMUA 1A9UA 1T45A 1X8BA 4IM0A 2PVMA 3DQXA 4JL9A 5IQCA 1HCLA 4C36A 4O84A 4F6WA 2W5BA 4F7NA 1LEZA 3NNVA 4RFYA 2IVVA 4HYUA 3ORLA 4J53A 4X6QC 4NUSA 5K9IA 4BHNA 5CQUA 2Q0BA 3IW4A 5BYLA 4EYMA 4Q5EA 2JDTA 3PLSA 4C3FA 4FV4A 3P0MA 5FTOA 4TWOA 5E8WA 4DEEA 3FC1X 4YMJA 5JGBA 3V51A 3RPVA 2BR1A 4C58A 4EBWA 2BKKA 2Q0NA 4ZTNA 3NYOA 3WIGA 2VO0A 2ITVA 4FIGA 4JRVA 4E5BA 4G17A 5EM6A 2O8YA 4PDYA 4RGJA 4F9CA 5JT2A 4XMOA 2C5OA 2JEDA 3ML1A 3GI3A 3O8UA 3DT1A 5JRSA 2B1PA 3QQKA 1P4FA 4FF8A 4ANBA 4BKJA 2VRXA 3KF4A 4BHZA 1KWPA 4FIIA 4NM7A 4QQTA 4NEUA 4D2TA 1W2FA 4ITHA 4DC2A 5CANA 5DG5A 4FSQA 3DZQA 2RIOA 4PDPA 1YW2A 4AE9A 2JD5A 4LV5A 2QODA 3CJFA 5DRDA 2EXEA 4BCMA 4ZAUA 4F64A 4AW5A 3VF8A 3KRRA 2VD5A 4F65A 4KA3A 1M2QA 3VS2A 3NDMA 4AW2A 5IA3A 4D1XA 2XK8A 4Z3VA 5IKWA 3ZBFA 2VWVA 4O6LA 2GNGA 2CHLA 5FP6A 4TT7A 5EH0A 3VS4A 2ITPA 4E6DA 4BF2A 3ODZX 4NL0A 1OL7A 2QURA 2XCHA 1DAYA 4NM5A 1YWNA 3FLSA 3ANRA 3H0YA 4NM0A 2EB2A 4FT0A 5F1ZA 4C4FA 4Q9SA 2CSNA 2W1DA 4K33A 3RMFA 5CU6A 1G8KA 4WA9A 2BDWA 2VGOA 4FKJA 3FEGA 2VAGA 4RMZA 3PUFC 1TVOA 3PXQA 3QHRA 4LRJA 1OI9A 5M4UA 4W4VA 4IX6A 3Q3BA 3FDNA 4TWNA 3IONA 1UU3A 1WBTA 4KBKA 2X0PA 3W32A 4CMUA 1GZKA 3ZTXA 2HW6A 4ZY4A 3TUBA 5F9EA 4ANSA 5IUIA 5M53A 3UTOA 5I3RA 3KXMA 2PVNA 3P1AA 3MI9A 4HGLA 2PVJA 4N6ZA 4PV0A 2X81A 3N4UA 1YRPA 4JAIA 2W4KA 2PVKA 1NA7A 3MPAA 3I0QA 3NEWA 4UWCA 3LJ2A 1ST4A 3VUGA 3BGQA 3WF9A 3ZLYA 4ASXA 4RC4A 1DI9A 1H25A 5BQ0A 5E8SA 2OF4A 4JT3A 3FLWA 2J51A 3EYGA 1KSWA 4ALUA 3QTUA 2IN6A 2R3OA 3HA6A 5JFSA 4GT5A 3A62A 2JGZA 2GNHA 2BIYA 1FVRA 4GUBA 4JIAA 4I1ZA 4O1OA 3LCDA 1YXTA 4D9TA 3F6XA 4G6LA 3LFQA 3MVJA 3R1SA 4IAZA 2V62A 5J8IA 5BVDA 3BI6A 3MGYA 3DBCA 3QQHA 4Y5HA 4I3ZA 3PWDA 3E7VA 4UY9A 2BRHA 5HE0A 2EU9A 4O38A 3P86A 3TL8A 4O7WA 3UP7A 1BLXA 2OXXA 2O0UA 2JFMA 1J91A 4C4GA 3EFJA 5FXRA 2A19B 4F9AA 5HTCA 4FSRA 2BCJA 3LM5A 2UVZA 3WZJA 2VX0A 2GS6A 4L6QA 2JDOA 3DZOA 4DBXA 2OH4A 4ZXTA 1PKDA 3SAYA 3QKLA 4AOTA 3BQCA 2C69A 3FI4A 5B2LA 1Y6BA 3EN4A 3MYGA 3PVWA 4FT5A 5EYMA 4FV0A 5CAPA 2VTTA 3UPXA 3V8TA 4AN9A 4AQCA 3AQVA 3H9RA 1LP4A 4NIFB 1TQMA 1PXMA 4XH6A 3QTWA 3ZSIA 5A4LA 1YHWA 5KKRC 3VRYA 2WMUA 5KMIA 3PJ2A 3IGGA 4C02A 1NXKA 3D5WA 5B2MA 1J1CA 4BDJA 3GU5A 3FXXA 3ZO4A 4IWDA 4P5QA 4K2RA 4QO9A 2JC6A 4FKQA 4AS0A 2YM4A 3GT8A 5AR4A 2YA9A 3TZMA 5L6PA 4LQMA 3G6HA 3T9TA 1H1PA 1VR2A 1XJDA 3ZBXA 3QZIA 2XJ2A 5HG7A 3VN9A 4BB4A 3QTQA 4CLIA 1J7IA 3OWPA 3LFDA 3BYSA 3OOGA 4AW0A 3DV3A 3DGKA 4NK9A 5CEMA 4NYEA 4RRVA 3QXOA 4I0RA 3AMYA 1Q8TA 4QMLA 5ETIA 5AV3A 2OXYA 4LRMA 4O4DA 5EDPA 4DAWA 4F08A 4BCQA 2VWIA 3NZ0A 4ZS4A 4WRSA 2Z02A 4PDOA 3BPRA 4A4OA 3OD6X 3B2WA 3PTGA 3D9VA 4L8MA 1OKWA 4UALA 3QWKA 2W7XA 4FL1A 2OBJA 2ITOA 4AA5A 4FTOA 2OJFE 3G90X 1VLRA 5GIPE 4F63A 3MH2A 3PXYA 3BBTB 4AUAA 2XK7A 3CY3A 2Z7SA 2CKOA 5LXMA 1O6KA 2WOUA 3R1YA 1YI4A 4LL5A 4DT9A 1JWHA 5EFQA 3QZFA 2ONLC 3HGKA 3OT8A 5IU2A 4BDBA 5J79A 3U55A 4IWQA 2ZB0A 3NUAA 3ETAA 4Z7GA 3GVUA 3FPMA 4EOJA 4O0RA 5E92A 4JX7A 3TCPA 2ZM4A 5HO8A 2GFSA 4YR8A 1B6CB 3PRFA 2V22A 3O7LD 3U51A 3UNZA 4O2ZA 1M2RA 4O4BB 1Q5KA 4QMPA 5IQFA 1BL6A 1GJOA 2WQEA 3D7TB 3FMLA 2Q83A 1ZYSA 2UW8A 3Q04A 4OTIA 3OCSA 3W2PA 3HMOA 4GKIA 2XM8A 4KB8A 4EHVA 5KMJA 5IQIA 5IA2A 2FO0A 1K9AA 1XKKA 3Q60A 4EOOA 1G5SA 4F1OA 3FMHA 2ERZE 3HA8A 5HIBA 4X3FB 2I0YA 4QQ5A 4F0FA 3NIEA 3DKFA 3TNPC 3UOLA 4AZWA 5ANEA 4RJ3A 5EOLA 5EW9A 2OXDA 2YITA 4XG9A 1NT2A 1HCKA 3Q9ZA 1E9HA 5A46A 4G2FA 4GK4A 2BFYA 5EHYA 2BAQA 4FSYA 2C3IB 3C4ZA 5GJFA 4QYFA 2BRMA 5I5ZA 3DU8A 2OICA 4E3CA 2WELA 2E9NA 2YZLA 2UW5A 5IQAA 2IZRA 4E20A 1PXJA 3TKIA 1PMVA 2E9PA 4IWOA 4BI2A 2ZVAA 4DEBA 3BLRA 2C1BA 5I4NA 2BZHB 5E8YA 3C50A 4C59A 4GW8A 4RIXA 3FL4A 3VUMA 4XLIA 3SLSA 4AZFA 4YJPA 3E3BX 4NIFA 1UNGA 3D15A 3H3CA 4YO6A 5GJGA 2XH5A 2YDKA 3OUKA 5E9EA 4ASEA 2W1EA 2ITQA 1J7LA 5IQDA 4M84A 2QOBA 3F7ZA 3L9MA 4C8BA 2CNVA 4GMYA 1PYXA 4GFMA 2QLUA 4MXXA 4ZTRA 3MBLA 4DHFA 5J9ZA 4D2VA 4KAOA 2QQ7A 5ETAA 1Z9XA 2WMBA 4B0GA 3GGFA 4U42A 2R2PA 4XP2A 3UOKA 4F99A 4ZIMA 2OKRA 3A7JA 4DH3A 1BI7A 3MFRA 4EOIA 5C03A 1ZZ2A 2J0JA 2ETMA 2YM7A 4JG6A 4AZSA 3THBA 3WF8A 4DTKA 5AV2A 1ZYLA 4RIYA 5HI2A 3RPRA 5I9UA 3V5WA 3NSZA 4ERKA 4RVLA 4BBEA 2B52A 4BZOA 4BDFA 5JQ8A 4R78A 4QMOA 5J9YA 1IAHA 2BAKA 4PMMA 4O82A 2FVDA 2X0QA 3GCUA 3CGOA 4I22A 4U43A 2Z2WA 4EQMA 5KMMA 4FRFA 4FTCA 3ANQA 4X2KA 3E92A 3E7OA 3F88A 1UWJA 3TACA 3LLAA 3RHXA 3HP5A 5CTPA 3COHA 3LZBA 4Y85A 4DFLA 4ZZMA 3MH3A 3ORMA 3BLHA 4F1MA 3AD5A 3RI1A 5BMSA 2YACA 5B0XA 5IMEA 3C4EA 4Y8DA 3W0MA 3BYMA 1KE5A 4KNBA 3F5UA 2QOFA 3L9LA 3W33A 2QNJA 4I0SA 4TWCA 5EG3A 1WBSA 2QOQA 3B2TA 3H0ZA 3KULB 3MV5A 5AR7A 3R8LA 3CPBA 4C3PA 3MESA 1A48A 4ZSEA 4OTGA 3QCQA 3SC1A 3GBZA 5M07A 3CTJA 4YBJA 3ZLWA 3ZS5A 2UZEA 3CE3A 5L6OA 5C27A 5HIEA 2WAJA 3D4QA 4MQ2A 1R0EA 4F4PA 4C4EA 4ZZNA 4EI4A 5AUWA 5CVFA 4JVGA 4GEOA 1MP8A 1P2AA 4AX8A 4AAYA 1XO2B 3VBTA 3KIOC 3WIKA 1I09A 3MPTA 3BHVA 5J9LA 3NW5A 1WBVA 3KRLA 4C35A 3MY1A 2A4LA 3R00A 2R64A 2RL5A 2PK9A 2G2IA 2OSCA 5JFXA 3GCQA 3MTLA 5ITAA 5AADA 3CJGA 5EQPA 4FTAA 2JLDA 3DNEA 5AP3A 4FGRA 4XRJA 3DJ7A 4QPSA 3ZEWA 1W0XC 4DEGA 2OJ9A 4EOSA 4EQUA 5AP1A 2JKKA 3KGAA 2YHVA 4L46A 4IZ5A 4EJ7A 2QLQA 4U3YA 3CC6A 3LE6A 3NRMA 4PL5A 3QLGA 2OF2A 4FZDB 4QNAA 4CEGA 3O0GA 4F9YA 4R7BA 3MFTA 4RWKA 1YXVA 2QOHA 3ORKA 3RPOA 3SDJA 3EL8A 4QMTA 5FXQA 4GK3A 4MWHA 4DEIA 4RX9A 5IQBA 3HVCA 4FYOA 4GU9A 3NUYA 4JIKA 4D4YA 2ZFYA 5GJDA 3ODYX 5JK3A 3K3IA 3HV3A 3EQBA 3TN8A 1YVJA 3HDMA 4ZJIA 3P5KA 1KE6A 4BRXA 5L2WA 2CDZA 4FTMA 4E5AX 1OKZA 4USEA 3DK3A 2JDVA 3MJ1A 5HE1A 3ULZA 5JSMA 5HU9A 2QOLA 4QMWA 1FVVA 3D14A 5LMBA 4KIPA 5L2QA 1ERKA 5M55A 4CRLA 2VO6A 3DPKA 2GQGA 3D83A 1LEWA 4CYIA 2YJRA 4I5MA 4S2ZA 4D1SA 3D5VA 3U6HA 5CSPA 2VTJA 4HZSA 3MTFA 2HENA 3TJDA 4X2FA 5HCZA 3QC9A 1CTPE 2VWUA 4Y72A 5ICPA 4QMUA 3NWWA 4FZ6A 3TIZA 3FKLA 3RK7A 2JBOA 2XCKA 4O21A 1BI8A 3PSBA 4KS7A 2UZLA 5CEPA 4GFGA 3DB8A 4G3DA 3R1NA 3QX2A 2CMWA 3QXPA 5D12A 4ZLOA 4LDTA 4P90A 4JMQA 4I6BA 3ZOSA 4EOLA 4GSBA 3A60A 3MDYA 4AZTA 1UKIA 4J8NA 3ZLSA 4Y95A 3LFSA 3OF0A 4RVTA 2W06A 2XIZA 3Q6WA 4WNPA 2BDFA 4C4JA 2GTNA 1Q8ZA 5HEZA 3S0OA 2UZVA 3FMJA 5DR9A 3PG3A 4LGHA 3UMXA 4IQ6A 3QRUA 4IFGA 4CZYB 5IEVA 4CSVA 3R2BA 2WMSA 4HCVA 2JITA 3LCTA 3PXFA 4BL1A 4YZNA 2YDIA 5CWZA 4G34A 2W1FA 4NTSA 4YTHA 5K4IA 3A4PA 3ZH8A 1GZ8A 4O1PA 4MF0A 3KN6A 3WF6A 5CAOA 3KMUA 2J50A 2J4ZA 4E6AA 3W2QA 4FR4A 3ZDUA 2HY0A 4U8ZA 2YM8A 4PPBA 1REJA 3LFFA 5CU0A 5CENA 3UO5A 3FPQA 3V8WA 1U5QA 4ENXA 3A8XA 2I7QA 3C5UA 1FOTA 3LKMA 1XBBA 4L3LA 4EOQA 3OTUA 3KY2A 3VBVA 4QYGA 1FMOE 2X8EA 1JBPE 4MVFA 1TKIA 3Q9XA 4FTQA 2LAVA 3UDSA 3ZO1A 3RINA 4R7HA 1NVSA 1JSVA 2XK3A 2F9GA 4EH7A 3IPHA 4BCNA 2GSFA 3PJ1A 1WBPA 3F3VA 5CF6A 2XNGA 4FG8A 4DH8A 4BGGA 1R78A 4XOYA 4FV1A 3VQUA 4EHGA 4FEQA 2UZWE 1Q99A 4QMNA 2HAKA 2ITTA 2PY3A 3LJ1A 4MBJA 1IA8A 4CTCA 4G3CA 3QD0A 4M0YA 2IZSA 4BDHA 2CKEA 4G3FA 4E93A 1UU7A 2QD9A 5DT3A 5HVYA 2QHMA 2XB7A 5A4QA 2FGIA 3FLNC 3LLTA 3ZFXA 5I9XA 3N4VA 1CKIA 4RSSA 1RQQA 3ZZEA 3ELJA 3E63A 4C38A 5HX8A 3QUEA 3T8OA 4EZ7A 2X9FA 2XNNA 5DT4A 4EHEA 4LGDA 4LOPA 4AT5A 1M52A 2GNJA 4IAKA 4V05A 2ONLA 3BRBA 3W0RA 3QC4A 5GZ8A 2CKQA 3QZGA 4B4LA 1OBGA 3QQGA 1H00A 1OIYA 2AQXA 4IAAA 4AP7A 2RG5A 3VS1A 2F57A 4YJRA 1SYKA 5AJQA 3C0IA 4FJVA 2WB8A 5HCXA 3VBQA 2XKEA 3QCXA 3R7EA 5JQ5A 2Y6OA 4OBOA 3AGLA 5A14A 5KMKA 5C1QB 3LQ3A 2C3LA 3N9XA 3UE4A 4K0YA 5TKDA 5E8VA 3LIJA 3COIA 3JS2A 4DINA 4MEDA 3W0QA 4G3EA 4BWKA 3O96A 4FA2A 4MXZA 3CSVA 3VONA 4RT7A 2NP8A 2G15A 3GU7A 1Q8YA 4H1JA 5TF9A 4O2PA 3W2CA 3QZHA 5E8UA 2CGXA 3FMNA 5C8KA 2EWAA 3HRFA 3WARA 3E88A 4WOVA 5AUUA 3GC8A 3EFLA 2XA4A 4YTIA 1URCA 3GUBA 3IECA 2W99B 3KQ7A 3BCEA 3CP9A 4HNIA 4QNYA 2PMIA 3IOPA 4W4XA 4FV3A 4O83A 4FSMA 4R3CA 2NRUA 4JBQA 5M4FA 2W0JA 1I44A 5JFWA 4UEUA 2YERA 2R9SA 1BKXA 4K9YA 5HLPA 3QTRA 3GQLA 4CTBA 4FTLA 3II5A 2ITXA 4CGAA 3JPVA 2YJSA 1DS5A 1E1VA 2C3KA 4X2GA 4YZCA 3BHYA 3BIZA 2VTIA 2I40A 1G8AA 3RNYA 2ZV9A 4R5YA 3ATTA 3PWYA 2WMQA 3VW8A 4Z55A 4DITA 4AAAA 4LMNA 4H3QA 2X0GA 4HNFA 2WQBA 3KKVA 4RJ7A 5CZIA 3CQEA 4GU6A 3RNIA 4O81A 4D28A 5LMAA 2VTHA 3DBFA 5EDQA 1PXIA 3VUHA 4TNBA 3SX9A 2W5AA 4QP6A 4O4CA 4O27B 4MXCA 4YLJA 5KHXA 2CCHA 2P4IA 4F7LA 1U46A 3QKKA 4QMQA 4GVJA 4YZ9A 1GAGA 3Q4UA 3IOKA 3IDBA 4IZAA 2BHEA 4HYIA 2C6IA 1FVTA 3I81A 4W8EA 2BIKB 1K3AA 3ZFYA 4AZVA 4PTCA 1ND4A 5EQYA 5DBXA 1O6YA 3COKA 2BRGA 3A7IA 3C0HA 3HEGA 4GYGA 3TZ7A 4D5KA 4ANOA 3EKNA 4TPTA 3LVPA 4XG6A 3SOCA 5I3OA 4FC0A 5KBRA 3HMPA 4X3JA 3NYXA 4ITJA 3VUKA 5KUPA 2OZOA 5AX3A 3P5JC 5BMMA 4YJNA 4EZ3A 4RA5A 4DLIA 4FICA 4U44A 2XBAA 3P7BA 1GIIA 4XP3A 5HNBA 2J6MA 5C8NA 4OW8A 4QP4A 4CQGA 4I94A 2WTIA 2FSMX 5HG5A 2WTVA 5AR5A 1XQZA 4OT5A 4C4IA 5AP4A 2I0EA 2HCKA 4FSTA 1GOLA 3TUCA 4YZDA 1SVGA 4XV9A 4ACCA 4YTCA 4OBQA 3CQUA 1Q62A 2QO2A 2O63A 3Q4CA 1RW8A 3EMGA 5J1VA 3O5AA 3NLBA 2HZ0A 3ZUUA 1HOWA 4AFEA 4FKUA 1JNKA 4QP2A 4WD5A 2QKRA 4BIEA 4FT3A 1PMUA 3LAUA 3OFMA 4D2RA 4CT2A 1CKPA 1H0WA 5AP0A 3KK9A 2Y6MA 4ZJJA 2Z60A 3ACKA 3JY9A 4L3PA 1OECA 5AP5A 4CKJA 3LJ0A 3UZRA 3NPCA 4IDTA 2C1AA 4DFBA 2C6KA 3AOXA 3SRVA 4PMPA 4AXEA 3FE3A 2ZDTA 3KRXA 2XYUA 5D11A 3RTPA 4DFNA 4B8LA 5M4CA 3TTJA 4EK6A 5GNKA 3JUHA 3IKAA 2OGVA 3LPBA 3ORPA 4KABA 2W9FB 1OL1A 4WIHA 5EW8A 4CQEA 4DDIA 2RFNA 4RIOA 3PJ8A 3D7ZA 4RFMA 4BC6A 5E1SA 2C5XA 4UBAA 3TYKA 5CEKA 3LFAA 3EOCA 4ZSLA 3FSKA 1OL5A 5BVKA 2HZ4A 2PE2A 3C4WA 1SNXA 5KZIA 5HG9A 4JBPA 3KCKA 3NYNA 3T3UA 1Y8YA 3EFWA 3R9DA 3CCNA 2R3LA 2B54A 4FOCA 4Q5HA 4NH1A 5BVNA 4J99A 4PP7A 3MA6A 4F9BA 2RFDA 1M17A 4DEDA 3E87A 2DUVA 4CCBA 4MD9E 2JIUA 4PL3A 4X3FC 5ANOA 4QTBA 3RAWA 5KMOA 2R3HA 4A4LA 5CI6A 3G6GA 4O0WA 1OPKA 4OTDA 5CVGA 5DHJA 4D0XA 1AD5A 4PWNA 3FWQA 3ZSGA 4BTKA 4IX4A 4DFXE 1XH7A 3CD3A 4R6VA 2IVUA 1ZYJA 2R3RA 3EFKA 2B7AA 3A8WA 3BWJA 4O0VA 5FM2A 3WILA 2UW3A 4I6LA 5M57A 3BX5A 3I5ZA 5CU3A 1PF8A 1UU9A 2WMVA 2R3NA 2XF0A 3HL7A 5LCKA 3C5IA 4LV7A 2OFUA 5D7AA 4GCJA 2PE1A 2QG5A 1W8CA 4KSQA 3UYTA 3VULA 2WZJA 2WD1A 3ZZWA 2C0IA 4UWBA 3WZEA 1ATPE 4U6RA 3UG2A 4DT8A 2PWLA 4IJ9A 3R63A 4NCTC 2XIRA 4FIFA 2WPAA 4OT6A 4QMZA 1ZARA 4XBUA 4E4LA 2GHLA 4C2WA 5J7BA 2W9ZB 4XEYA 1FQ1B 2QO7A 4HYHA 1R1WA 3QTXA 4QMXA 2YM3A 3S4QA 2YCFA 4J71A 3GQIA 3ZUVA 2LGCA 5HE3A 4YC6A 5L6WL 3NYVA 1CM8A 3ORIA 4FT9A 1YWVA 3QYWA 4CFMA 1JKTA 4YHFA 1JPAA 3C1XA 3PE1A 1H27A 5K5XA 4IW0A 5AFVA 4P7EA 3KL8A 5E91A 3HMNA 3WF7A 4B9DA 5IEXA 5M4IA 2VTQA 4QTAA 4UX9A 3U54A 4HVGA 5CNNA 3R30A 3GU8A 2RFSA 2BUJA 4N57A 2W1IA 1OGYA 3Q9WA 2AUHA 3AD6A 4O91A 4PNIA 5AP2A 2X7OA 3IW6A 2WXVA 4QTDA 2R3JA 3EHAA 3MW1A 3SQQA 3BQRA 3WOWA 4EC9A 4FVQA 3F2RA 2ZOQA 4JXFA 2BRBA 4ANNA 2FH9A 4OTWA 2ZMCA 4PPCA 2RG6A 3O2MA 3W18A 2ZM3A 5CSXA 1Y8GA 4AFJA 3QD2B 3Q5ZA 3PA4A 5EI6A 4BCHA 4J96A 4G5PA 3Q6UA 3C51A 2YABA 4L53A 3VS3A 2X4FA 1KV1A 2P2HA 4MKCA 5ANGA 3FLQA 3K3JA 3ZXTA 2PZPA 4AGCA 4YPDA 2X2LA 3LHJA 2PTKA 4OBPA 4ZTLA 3PPZA 2J2IB 2JAVA 3O7LB 4UXQA 5CY3A 2FSLX 3UPZA 5DR6A 4UMUA 4P4CA 4EH3A 1IR3A 1OUKA 3U4UA 2YDJA 2YLFA 4CT1A 3FV8A 3FQSA 3F3WA 4M69B 3NAYA 3RZBA 2W4JA 4FT7A 4UXLA 4XS2A 4YJQA 4BCIA 4CG9A 2Z8CA 4ZP5A 3EZRA 4IJPA 5JRQA 3F5XA 3PY1A 3I79A 4PF4A 4KBCA 2WGJA 4QYHA 3EZVA 3I6UA 2A27A 4OTPA 4D4VA 5L4QA 4DCAA 2BPMA 4MF1A 1OB3A 2VTLA 5LMKC 2X8DA 2XNPA 1O6LA 3TNQB 4PP9A 4IVBA 4RX8A 4RZWA 4RVKA 3F2NA 3FC2A 3R04A 3WI6A 4TYEA 4DG0E 3DXNA 1ZOEA 3EN6A 4C2VA 2X39A 2VUWA 3HMMA 2J0MB 1YDTE 3TI1A 5HD7A 2PZ5A 4WSYA 4WNKA 3VO3A 3EQHA 1JSUA 2YM6A 1R0PA 2YAAA 3MB7A 3HX4A 4PRJA 1G8SA 1XMLA 5J1WA 2BALA 3MSSA 1MRYA 1YWRA 2ZAZA 5BX0A 4ARKA 3BV2A 4O7YA 4ZY5A 4L01A 4J98A 2OIQA 4YJVA 2VX1A 3UG1A 2C5VA 4WSQA 3F9NA 5F4NA 3UQFA 5K3YA 2PVRA 3LCSA 3FY2A 2XKCA 5ANJA 2HK5A 2XVDA 3DAJA 4HCUA 3LMGA 4JR7A 4XHKB 2C47A 4EKLA 3QQLA 3DB6A 2AEGA 2C6EA 4FKVA 3FI8A 3C13A 3C9WA 5HG8A 1IASA 3PP1A 4L00A 3AMAA 4ZMFA 1Q61A 2C3JA 3RM7A 4HJOA 1F3MC 4O4FA 3MVHA 4NFMA 4EEVA 3DAKA 5JGAA 4EONA 5ACKA 3NMUF 3A99A 5BV3A 1H07A 5BYZA 2C0TA 3D2KA 3U9NA 3HV6A 1L3RE 4GJ2A 4CMOA 3AC2A 5I0BA 1OZ1A 2UW0A 5LQFA 3UO4A 1IG1A 2ESMA 3DLZA 5GZ9A 5HKMA 3KXGA 1MQBA 1WMKA 3GOPA 4YLLA 3NFGB 4BVUA 5LVNA 2O65A 3UNJA 3DKOA 3WZKA 3SG8A 4LFIA 3IG7A 3VQHA 5CLPA 4F0GA 4DDGA 2XIXA 4L9IA 1QMZA 4QMSA 4QYEA 5F95A 4C37A 3I60A 3QAME 3NCZA 3R6XA 5KHWA 4OUCA 3VUDA 3MH1A 5FEEA 5EKOA 1LPUA 2C6LA 2A0CX 5LCJA 2YISA 3PG1A 3V5LA 4WKQA 4NU1A 1H8FA 4JI9A 4FNYA 3EKKA 4B8MA 3KN5A 3ORNA 4UB7A 4JX3A 4R8QA 2PPQA 2Y9QA 1WZYA 4A9YA 2XP2A 3L1SA 2ZV8A 4UMRA 3TG1A 2VTPA 5IUHA 4ASDA 1GZNA 5GIOE 3IDPA 4FG9A 4XUFA 4HZRA 4N4SA 1UA2A 3NNWA 4YURA 2PMLX 2IPXA