1JQHA

Igf-1 receptor kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
291
Chain Sequence
ADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGF-1 receptor kinase
publication title Crystal structure of bisphosphorylated IGF-1 receptor kinase: insight into domain movements upon kinase activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 291
sequence length 303
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jqhA01
4EH4A 1OL5A 3FYKX 3KRJA 2R0IA 3H4JA 4DAWA 1ZMUA 5CSHA 3MPTA 3UNZA 3QCXA 4EOPA 3FC1X 4AFEA 3DLSA 1M2QA 2BFYA 3RTPA 4MNFA 1FPUA 2W1IA 5C8MA 2FA2A 2BFXA 2XKDA 1YKRA 5FQDC 3K5UA 4QTEA 2WTKC 2QG7A 5I3OA 4JG7A 5ANOA 4GT5A 4KNBA 4GUEA 4S34A 5EG3A 5J5TA 2J0LA 4YZCA 4OAVB 3R1YA 1WBPA 4NKSA 3I1AA 2QNJA 5DT0A 5CT0A 4BI2A 4F1TA 5CF4A 3QZIA 4CV8A 4BRXA 3WE4A 3AC4A 3O17A 3DQXA 5AR3A 4IWPA 4K2RA 3AC5A 3EFWA 2BZKB 4I22A 4L3JA 3OCSA 4W8EA 3P4KA 2ONLA 3GU6A 4JRNA 5J1WA 3R1NA 2VX0A 1XBBA 4FTTA 5JRSA 2XCHA 3PJ2A 4UN0C 4ITHA 4JAIA 2PE1A 5IQDA 3T8OA 3C9WA 4GUBA 3WF9A 4C8BA 3ORMA 5HQ0A 2HY0A 3DTCA 1WBNA 2XK4A 5CEMA 5J9LA 2C68A 1MRVA 4CFFA 2QOCA 4B8MA 4MD9E 5IDPA 5M57A 4XV1A 5EM7A 1R0PA 5ANKA 5HORA 2BZIB 4QTAA 3V5PA 3WYXA 5IEVA 3G9NA 4CMUA 3MVJA 2WEIA 3OBJA 3ETAA 1H01A 2Z2WA 5FDXA 3ORNA 4BBMA 4F0GA 5BVEA 2UZLA 3Q52A 5AJQA 5GZ9A 4ACMA 2C5NA 4D2PA 5IQAA 4PV0A 3ZTXA 4TPTA 2VNYA 5KKRB 4KD1A 3Q32A 4UY9A 4RA5A 1ZYCA 5FBOA 1KE6A 3EL8A 2OF2A 5CXZA 4LL0A 4IZAA 2ITUA 3ZO2A 3PVBA 4IB0A 3UMWA 3F6XA 1PXIA 3KA0A 3U6IA 1IRKA 4CKIA 3I6WA 3H0ZA 1J7LA 2O64A 2XCKA 4ALWA 2P2HA 5LVNA 2X8IA 2C0IA 5LMKC 4UMRA 4CT2A 1YI4A 3DK6A 1Q3WA 3NUYA 3OFMA 4ZY6A 3KULB 3UYTA 3NCZA 3DT1A 4FKPA 3GU4A 4I20A 4L9IA 3L9MA 5DNRA 3VN9A 3MH3A 1VJYA 2X39A 1KE5A 4BKYA 5J5SA 4FKVA 4YTIA 3QALE 4CRLA 4TNDA 4EL9A 1E9HA 3K54A 3O8UA 5FEQA 1M7QA 5IZFA 5C03A 5I9UA 4F9AA 5G1XA 4YGAA 4OTRA 2WMVA 4LMUA 1J91A 4I4FA 2BZHB 4QQCA 2BDFA 4W4YA 2YDJA 4I0TA 2F2UA 3HRBA 4CLJA 4R3CA 4XCUA 2OWBA 4PUZA 2VO7A 3VS0A 3LJ1A 1CM8A 1NY3A 5CT7A 2QI8A 4I5HA 1ZWSA 1ND4A 5H3QA 4BWKA 5HG7A 3PVWA 3O2MA 5DA3A 4NK9A 4F63A 5AUTA 3HMPA 4U41A 2GNLA 3VRYA 2PZ5A 1GZ8A 2YITA 3G9LX 4O84A 5LJJA 4PDYA 3LW0A 3C4FA 5DGZA 5AP7A 1FMKA 1WBWA 3QTWA 3DPKA 4L44A 3KFAA 3FLYA 3NZ0A 4FKRA 5CXHA 3SXRA 4FKWA 3RAWA 3W2RA 1Q8UA 3PG3A 2WMBA 3QTSA 4FX3A 3D7TB 2W0JA 4I41A 4JQ7A 2XNOA 1FINA 4AZEA 3LOKA 4DE4A 3E8DA 3SRVB 4JBPA 3BV2A 2YAKA 4FVRA 1H8FA 3QQUA 3NYNA 4J99A 5CF8A 1R1WA 2WTKB 5JN2A 3W2CA 3B2WA 2FB8A 2J9MA 3FBVA 4LGGA 5HI2A 4R7BA 4H3PA 4XUFA 2PVRA 3F69A 3K3JA 2V7OA 3T3UA 1STCE 4O1OA 4U0IA 3V6SA 4AZVA 2JKMA 3OG7A 4FYNA 3AQVA 2ITTA 5L8JA 4TYHA 3ZSHA 4P4CA 2BAQA 4ACGA 4AG8A 4EK8A 4ZZOA 2PU8A 2CN8A 5CU3A 3BYUA 3R2BA 1GIJA 4O0RA 4R3RA 4FVPA 3VBXA 2B0QA 3MBLA 3F7ZA 3PTGA 2JFLA 1V0PA 1XWSA 2OIDA 3E3PA 2W5HA 5CVFA 5DMZA 2V22A 3A8XA 1MRUA 3FKLA 5EKOA 3FYJX 3RP9A 4BICA 4UWBA 5HCYA 2A0CX 2WMQA 3R22A 5AP1A 4AN2A 4BL1A 3OXZA 4FZ6A 2VTIA 1ATPE 4UX9A 4O1PA 3ROYA 4GKHA 4DFBA 5AIKA 5A4EA 2VN9A 2P3GX 2PUUA 4Q9SA 5BUIA 1J7UA 4C4EA 3BBTB 3GCUA 3BE2A 4BZOA 2ITZA 3ZEWA 4FSWA 1M7NA 2Z7LA 4LM5A 1LEZA 4ENYA 2XUUA 3GOPA 1IG1A 1XQZA 3QCQA 4G2FA 5KO1A 4EK4A 3NUAA 3RZBA 3OCTA 5E4HA 3SGCA 5IH5A 2BVAA 4GCJA 3WOWA 2X6EA 4GH2A 4LMNA 5E8WA 4NTSA 4CYJA 2HELA 4ANOA 2BROA 1JKTA 1PXJA 4B6LA 4BYJA 5HG9A 4IX3A 2PWLA 2B7AA 3R73A 5CU6A 4FEXA 3PJ3A 4W4XA 5IA3A 4DN5A 2I0YA 4LOOA 3UNJA 3R63A 2HAKA 4DGNA 5H9BA 3UQCA 1K9AA 3Q4TA 4CKJA 1Y57A 3NUPA 4FNZA 4JJRA 3QF9A 4L53A 4R3PA 3ZU7A 2VO6A 4NCTC 5TKDA 3OWJA 3V5TA 3OOGA 4YP8A 2W1CA 2WOTA 4RFMA 3PWYA 4IDTA 3VBWA 5DRDA 5HVJA 3HMOA 5BYLA 5J1VA 4XS2A 4ZY5A 4O7ZA 3LMGA 4ASDA 4FTAA 4KRCA 4O7WA 4EH5A 2Y4IC 1OECA 1H26A 3EN7A 3AGLA 4M68A 4HPUE 4F7LA 2ERKA 2HXQA 2ZV8A 1JAMA 3AMBA 4M66A 4TWCA 4ZTSA 2W1GA 3H9OA 3OW3A 4M0YA 4Y46A 4RC4A 2GU8A 3WZJA 5FXQA 5HNGA 5KCVA 3VUGA 4XMOA 3OWKA 4EUUA 3B2TA 2B55A 3Q9WA 3V8SA 3KXMA 4B8LA 4QRCA 4O6LA 1WZYA 3PG1A 3QYWA 3GU5A 4QMVA 3QX2A 5EDQA 4DGLC 3V5WA 4AF3A 1QCFA 3DB8A 4L6QA 4RVLA 3GFEA 4U80A 4IVDA 4FL1A 2OLCA 3ODZX 2G2FA 4O82A 2CCIA 1CKJA 2XA4A 2Y8OA 2C6LA 4TXCA 1H1WA 3OC1A 3VQHA 4XG9A 3VUMA 5IMXA 3QGYA 4PP7A 5B2KA 4DGMA 5JQ8A 4A7CA 3QTUA 2QHMA 4XV9A 1TQIA 3MSSA 5A4TA 2PE0A 3WZUA 3UZPA 2O8YA 4ANMA 1DM2A 4IWQA 4QP6A 4E6AA 4JIKA 1A06A 1SMHA 4JLCA 4C62A 2GCDA 2QO2A 4ARKA 2WHBA 3OZ6A 3PJCA 3TNQB 1WBSA 4D0XA 3BX5A 4C2VA 2NNWB 4O22A 4BDCA 2ETMA 4ACCA 4EZ5A 2XNPA 2J4ZA 3LJ0A 1T46A 3KKVA 3V5QA 4FKLA 1JSVA 5HVKA 5CF5A 5E8ZA 2UW5A 3MJ1A 5IDNA 1VYWA 4L45A 1HCKA 3E8NA 4NFMA 4UMTA 4D58A 4QT1A 3ZEPA 2C3LA 4KS7A 3U9CA 5K4JA 2Z02A 4JNWA 2XVDA 3AD4A 4GFMA 4JQEA 3EH9A 3JXWA 4ZIMA 3UZRA 4NSTA 3KGAA 4Q5HA 2R3FA 1XH8A 2XNNA 5A14A 4BDBA 3PE2A 2A19B 2IZRA 4A9TA 2QLQA 2R3NA 1OKYA 3QRTA 5ETFA 4GKIA 4FSZA 2XEZA 1P4OA 1SNXA 3PXRA 4MNEB 4L67A 1JSTA 3IKAA 5G6VA 4MX9A 4CFUA 3FMMA 3CD8A 4FKIA 3E87A 2ZDUA 5AR4A 1AGWA 5TOZA 3ZMMA 3LJ2A 3TNPC 3LPBA 3VUIA 2XYNA 5H2UA 4F08A 2REIA 4QMOA 4PMMA 4BB4A 4GEOA 4MWHA 3Q4UA 4NJ3A 3N9XA 2XRWA 5B0XA 3VUKA 3BE9A 4FIGA 4DEDA 4D55A 5DVRA 3I0QA 3HRCA 2PMOX 3ZO3A 1G5SA 2VO0A 4D0WA 5FRIA 5HBHA 5ETIA 4XV3A 4DINA 3SG9A 1UKHA 3BU3A 3FSKA 3QFVA 3WIGA 1SVHA 3OHTA 2UZUE 1FGKA 2WU6A 2GNGA 1WVWA 4AS0A 3LQ3A 4S30A 3FAAA 3R7VA 2CKEA 1NT2A 3CQEA 3DU8A 5A6NA 2YWVA 3QBNA 2OZOA 2IJMA 3R6XA 1MUOA 3ROCA 5I9ZA 4JQ8A 3HX4A 4Z9LA 3UE4A 2JKKA 4JVGA 3UTOA 2O5KA 4U97A 1Y8GA 2X2MA 2HOGA 3GFWA 4W4WA 4R7HA 2WIHA 4XYFA 1YI6A 5AAGA 5I0BA 5I9YA 3NVKI 2C1BA 2P33A 2UZNA 2OG8A 5J79A 1PRYA 2WMWA 1NXKA 2GHLA 3VBVA 4IB3A 4DEAA 4NM7A 3DLZA 4YJSA 1O6LA 2OJIA 2XKCA 3ANQA 4TYJA 3FXXA 5ANDA 3PE1A 4AW2A 4BHNA 4FTQA 4K77A 3GC0A 3WF6A 3ATTA 1J1BA 4L52A 1XJDA 4G5PA 4GT4A 4IH8A 3ET7A 2GNJA 2J6MA 5E8UA 5HBEA 1TVOA 4BBFA 1NW1A 4QTDA 3RPRA 1UNLA 4XX9A 2VWZA 2H8HA 2BIKB 3P86A 4FNWA 4OTHA 4D4YA 5M56A 4PP9A 3RK7A 1W82A 3RAHA 3NUSA 2YCFA 4BCHA 4EONA 1EH4A 3A7HA 3R30A 4YZMA 2G9XA 4BI0A 4C36A 3NEWA 1OL7A 3HA8A 1E1XA 5JFVA 2G2IA 2WQNA 3NYVA 1ZYSA 3KC3A 4J8MA 4WOVA 1JSUA 3QC9A 5HO7A 1PMVA 2OJJA 2PZRA 2XK7A 4GV1A 4JDIA 4ZSLA 3VS3A 3WBLA 5E8VA 4A4XA 4QMLA 3JY0A 3R8VA 3R8PA 4RG0A 4NU1A 1ZYLA 1Q3DA 2OIBA 5HE3A 3DK3A 5CAOA 3CSVA 2NRYA 3FMLA 4E6QA 4NWMA 4RLKA 4XG7A 4C4HA 4BWPA 3UIXA 5AEPA 5M53A 2OZAB 4GK4A 2EB3A 3W2QA 2OXYA 4I6QA 5FEDA 2G2HA 2WTVA 5LWMA 1OMWA 4FIHA 4CVAA 4FIFA 1IASA 3LQ8A 3QUEA 3P7CA 4F99A 3BEGA 4P5ZA 4FVQA 1BL7A 4XJ0A 5CU0A 2UUEA 3FZSA 3L1SA 2VTPA 4FT7A 5GZ8A 5HLWA 2YIYA 4HCUA 3W8QA 3A2CA 4EQCA 4A06A 3RM7A 4O7YA 3OBGA 3ULIA 5BVFA 2BRHA 1YHWA 3W2OA 3EJ1A 2C3IB 5E8SA 3HDMA 2C6EA 4UXLA 5BUEA 1RW8A 2W1ZA 3FZRA 3ORLA 4LRJA 5FTQA 5CS6A 1P2AA 3P5KA 4O7SA 3MW1A 4FV4A 3P23A 3VHKA 3WF8A 3BPRA 3HV3A 2YCQA 4BC6A 2CDZA 2F57A 3I60A 4QMTA 4QMPA 2R5TA 4RVMA 4XG8A 5K3YA 4BYIA 5CAVA 5JH6A 5AR5A 2BMCA 3HMIA 2EUFB 4A4LA 3Q9ZA 3AC8A 3UIUA 1OBDA 3EN6A 3MGYA 3G2FA 4TTHB 5FM2A 4RSSA 4HGLA 1FBNA 4Y5QA 4DHFA 2C5YA 4L7FA 1GY3A 3CJGA 3P08A 4YJRA 5CAPA 2VWIA 2Z7QA 2YM7A 3SA0A 4FICA 5KMKA 2X2LA 4F4PA 3SHEA 3GCPA 2I0HA 1H1QA 4BI1A 4QMUA 4BKZA 3VHEA 5BPYA 1ZARA 3R02A 2IW6A 3DS6A 4QPMA 3TUBA 5DR2A 2OICA 1MQBA 3QTQA 5LVPA 4Y8DA 3NCGA 1F5QA 3R2YA 5IMEA 5KUPA 5JEBA 5A46A 2HZNA 5HD4A 1GAGA 1UA2A 5L6PA 3HMNA 4YC3A 2B52A 5IA5A 4RWIA 2W4JA 5L2QA 3D5XA 4FTRA 5K9IA 4AE6A 2C6TA 5C9CA 3LLAA 1CDKA 2CLXA 1Z57A 4IE9A 4K1BA 3ZZWA 4ZAUA 3RNYA 3C13A 3DBEA 4DEHA 4AW1A 4RMZA 4NW6A 5CALA 1VYZA 2PZYA 2WMSA 5KZ0A 5BVOA 3UZTA 2W96B 3IGOA 4FZAB 3CXWA 3OT3A 3SX9A 4I24A 5CEKA 4A9SA 3RI1A 2VTHA 5C8KA 5D41A 2IWIA 3TIZA 3NNVA 4BCKA 3L9NA 4CNHA 5IISA 2HWOA 3KULA 4FV9A 3QQGA 5ANJA 2PVFA 2JFMA 5FTOA 4RX5A 3NNWA 4WRSA 4V05A 2QD9A 4ZTMA 1J3HA 3QTIA 4RQVA 4FTKA 3PSCA 3UO5A 4JT3A 2ITVA 3WF7A 2FSMX 2UZEA 4B9DA 3UOKA 5IA2A 2OH4A 4GL9A 1PW2A 3MPMA 2RFDA 3MB7A 4MTAA 3O51A 5AP0A 4XH6A 4C3FA 4X6RA 5L3AA 2F7ZE 4FC0A 4U43A 3QKMA 4C61A 5L4QA 3FZPA 3L9LA 4FGRA 4FV8A 4B0GA 4J97A 1NVSA 3QKKA 4TNBA 4AWIA 3DNEA 4FKUA 2W5AA 2EU9A 2QC6A 3H9FA 4I94A 2C6MA 5H8EA 4ZP5A 1VR2A 4ORKA 5KMOA 4WD5A 3MIYA 1ZZ2A 3MFUA 4HYSA 4LL5A 2GMXA 3EQBA 3LM5A 5DIAA 5AR7A 2YABA 4CCBA 3HRFA 4P5QA 1T45A 3MVHA 2YIXA 4QP8A 4PY1A 4LQMA 4E7WA 3AD6A 3DCVA 2WFYA 3HDNA 4I0SA 2IW9A 2QOIA 5HCXA 4X7QA 2WMXA 2GQRA 3QCYA 3ULZA 5HU9A 3VBYA 4DTAA 2WQBA 4O96A 3PRFA 1FVVA 4GIIA 5ACBC 3BRBA 5KX8A 4G31A 2QR8A 3ORTA 3BCEA 3HV5A 3E88A 2EWAA 4YU2A 2QODA 3D7ZA 1OPJA 4ZY4A 1QPDA 3D7TA 1OL6A 3QD3A 5AIRA 5KBRA 3ZSGA 4M0ZA 2HW6A 3A7IA 1LUFA 3FLQA 3SRVA 1G8SA 4ZSGA 4ANLA 4PQNA 1XH7A 3AXWA 3F9NA 4KUJA 1Y6AA 3NW5A 4C34A 2XH5A 4LGHA 1U4DA 3UODA 4DH8A 5M4FA 3UMXA 4JR7A 2QQ7A 3OY1A 3BWFA 4O0TA 2YM4A 5IUIA 4DH7A 4XP0A 5HBJA 3UJGA 3D14A 2WEVA 4KIKB 3KF4A 5DLSA 3W55A 2GS7A 3ODYX 5AP2A 2RGPA 2DUVA 2BHEA 1LR4A 3LHJA 2PUIA 4W9WA 4C57A 5J7BA 1WBTA 5ETAA 2YM6A 5L2IA 5FGKA 3NNXA 4EH3A 3TKIA 4DT9A 2GHMA 2WIPA 4FV6A 5IQHA 4FSRA 1UU3A 4KBKA 4ZTQA 1BI7A 4IZ7A 4D4RA 3T9IA 3KRWA 2YM3A 3A8WA 1TQPA 4OTFA 5K4IA 3QUDA 3PIZA 2QCSA 3IOPA 2Z60A 4NM3A 5AUYA 1XH6A 3LFEA 4I21A 2PVYA 4IW0A 5KMJA 2BCJA 2CGWA 3NIEA 4FV3A 3VF8A 4F6WA 4AW0A 4NZWB 3EYHA 1RE8A 4OT5A 4BCIA 5ICPA 5AUVA 5CEQA 3KRXA 4RJ6A 4YJQA 4YNEA 3PIYA 1DAWA 5LMBA 4JX3A 2C69A 3L9PA 3GB2A 3EIDA 3BYSA 3E3BX 4XG6A 5J9ZA 2OW3A 3VQUA 3HUCA 3G90X 4LRMA 5FG8A 4CMTA 4EEVA 4F7JA 4O2PA 2RG5A 3E7OA 3C4WA 1U5QA 4X6QC 3LFBA 3K2LA 2F49A 2HCKA 1E1VA 5LMKA 1UVRA 1CKIA 2EXCX 3AMAA 3ZC6A 3TDVA 3LFFA 3EN5A 1RDQE 3KN5A 1W8CA 1H07A 4M7IA 3PSBA 4OTQA 4FK6A 3TUCA 1YDTE 3WF5A 3ORKA 5DI1A 5DT3A 4FSYA 3EB0A 4GVAA 5JGAA 1GJOA 1OI9A 3TZMA 4O7NA 4I23A 3IS5A 5CEPA 5TE0A 1ZYDA 2AC5A 4CZTA 4EH2A 2PMNX 5EYKA 1MP8A 2H9VA 4MYGA 5HTBA 3O7LD 3C0HA 4U45A 2WAJA 1O6KA 3OUNB 3ZUUA 4UWCA 2IW8A 3DJ5A 2B1PA 3PWDA 4ZMFA 2DYLA 5C26A 4Z55A 4PDSA 3IDPA 5B7VA 5M06A 3M11A 4ZXTA 3DY7A 3C4ZA 3G0EA 5LCJA 1WBOA 3UYSA 3WZDA 2GNHA 2RFNA 4ZLZA 2UZOA 3QUPA 4G6OA 3KREA 3FY0A 3PDTA 1JWHA 4G1WA 3GCQA 4NW5A 3OXTA 2QKRA 2QOHA 4O0YA 3V01A 3S95A 5BVWA 3RWPA 5IG1A 1SNUA 1A9UA 4A4OA 4R7IA 4GFGA 1J1CA 2BDWA 1VEBA 3TT0A 2BR1A 1QPEA 3AMYA 4CEGA 1U46A 2XF0A 2HYYA 3QRUA 3KXZA 2OI4X 2XEYA 1UWJA 5L6OA 5IEYA 5LQFA 1Q99A 3C0GA 4O38A 3WILA 1WMKA 3JPVA 2UW4A 1ZOHA 4I5CA 3QAME 5FXSA 5AX9A 4E20A 4U5JA 3ZLWA 4YTCA 5IQIA 4ZZNA 1W7HA 2BTSA 2P4IA 4F70A 5DG5A 4FKJA 5M09A 4E5AX 4C7TA 4FEQA 3GVUA 3AD5A 4KAOA 3LXLA 4QYEA 3I7BA 5CY3A 2W17A 3BQRA 1YWRA 2C5XA 5A3XA 4AFJA 5IQBA 4YO4A 2PYWA 3V8TA 3SLSA 4FNXA 4XRLA 1TQMA 3KY2A 3PY3A 4FZDB 5CF6A 5M4UA 4FR4A 5DEYA 3TEIA 2B9HA 3BI6A 2JKQA 2R7BA 3BGQA 1YXUA 5T6KA 3VO3A 5CAUA 3FJQE 4HOKA 5IF1A 4KS8A 4D2WA 3Q96A 4MNEA 4U3ZA 1YXXA 5LVMA 1PMEA 2B9IA 4E3CA 2WQOA 5CAQA 4F7SA 5DR9A 2C1AA 2R3PA 3P9JA 1YDRE 2YDKA 1Y8YA 4IZYA 3FMNA 1Q4LA 4OAUC 4O7TA 1M2PA 4PNKA 4C35A 5F9EA 4NL0A 4QMXA 2HIWA 4I5MA 3H0YA 5EFQA 2VZ6A 3I81A 4F9YA 4USDA 2PSQA 5AV3A 3NYXA 3VJOA 2OIQA 3E7VA 5LVOA 2WMUA 3Q6UA 4S32A 3FPQA 4ZLYA 4FV5A 3HAMA 3M1SA 2OXDA 4G9CA 1X8BA 5HG5A 4D2VA 1UNHA 2A2AA 2YLEA 1ZY5A 2GTNA 3IO7A 5DYJA 4BTFA 4JS8A 3CQUA 4M13A 4YTHA 3CE3A 3COMA 3FLZA 2XK3A 3CTHA 3B8QA 2Y6OA 3FMDA 2YFXA 2VWBA 3BHVA 4MBLA 3I0OA 2FYSA 2W4KA 3VUHA 3QQLA 1YDSE 3THBA 2XJ2A 3LFQA 2ONLC 5F4NA 2JITA 3O7LB 5EQEA 2YDIA 3GQLA 5I4NA 4FIJA 3Q4ZA 4UEUA 4OTPA 3UQGA 3D15A 2X6DA 3W10A 2IZTA 3KVXA 3R01A 4O7VA 4CGAA 4L68A 1JKLA 3AGMA 4IDVA 3SKCA 4TZRA 4AGWA 2ITNA 5GHVA 4GU6A 1JKSA 3LM0A 4QO9A 2YJRA 3WZEA 4K11A 1DS5A 4QYYA 5HIBA 1XBAA 3VJNA 4WA9A 2ITOA 5EQPA 4DT8A 3M2WA 1PXKA 2XMYA 4R8QA 3PPKA 1APME 4YPDA 2YIQA 2UZBA 1ZOEA 2WTCA 3ENHA 3FY2A 4RIWB 4ERWA 3N4VA 4D9UA 3EQFA 2XBJA 2ETRA 2X9EA 3FXWA 2E2BA 4P2KA 5DOSA 5K0XA 4F0FA 4FSTA 4QP9A 3IECA 4BZDA 4K6ZA 4U7ZA 5FXRA 1Q5KA 4HNFA 5CANA 5A4LA 4MQ1A 4TT7A 3CC6A 2BALA 2PZIA 3N4UA 3KL8A 4IAIA 4YJUA 1CMKE 3JVRA 3FL5A 4EH6A 4R77A 4FSUA 2XNBA 4RWJA 3OEZA 5AM7A 1WAKA 3HGKA 4AT3A 4AX8A 3OROA 4YUQA 4NT4A 5HCZA 2XBAA 3KEXA 3BU5A 3FMJA 4L43A 4ZSAA 2IVUA 3PLAE 3DXQA 2R4BA 1SVEA 2XP2A 5EI8A 2OZAA 4F09A 4J98A 5HLPA 4AQCA 4DFXE 2RKUA 4N70A 3LXKA 5A4QA 4EHZA 4YR8A 3QTXA 3VF9A 3LFSA 3C5UA 2XS0A 3QC4A 3Q2JA 3RJCA 4UMQA 4F6UA 3OOMA 3TTIA 5CU2A 4BDGA 3SXFA 3DAJA 3N51A 2QOBA 1Q97A 3OD6X 5HD7A 4NKAA 3KF7A 3MFTA 1Z9XA 4L00A 4BBEA 3LMIA 3EYGA 4UZHA 4EQMA 2Q0NA 4EZ7A 5AP4A 4AGDA 3PP1A 4F6SA 2JDRA 4ITIA 2X8EA 3V8WA 4YZ9A 5BVNA 2WQEA 4FKGA 5BMMA 3W16A 4E73A 4EZ3A 1L8TA 4W9XA 2ITPA 1WVYA 4M84A 5DEWA 3CKWA 4BDFA 3F2NA 4IAYA 3CQWA 4AACA 5E1SA 4F65A 1GNGA 3MA3A 1OITA 5JK3A 1V1KA 4GJ3A 4RFZA 3JR1A 3R1QA 4M12A 2QO9A 3GCVA 3MTLA 4WUNA 3BLHA 1YW2A 4RJ8A 3V3VA 3O71A 2I40A 2JDOA 4MBJA 4RQKA 2X2KA 2OFVA 4N57A 4GSBA 4GJ2A 4XG3A 2XIRA 4GYGA 1P5EA 5GJDA 1FGIA 3D2IA 4EOKA 3BGZA 2Z7SA 2X0GA 2YISA 3QQFA 3BU6A 4C38A 5CTPA 3FV8A 4E5BA 4BY9E 1H0VA 5HLNA 3DAKA 2YEXA 3PP0A 4PPAA 3NAXA 4KABA 4GS6A 4KINA 1XH9A 2QOKA 4RLLA 3OS3A 4AU8A 4QMWA 2R3RA 2WD1A 3ZZEA 2CKPA 4EOQA 1OL1A 1NA7A 3TTJA 2GS6A 5HEZA 2FO0A 5F1ZA 2C5VA 4KKGA 4PWNA 4NM0A 5CLPA 3Q9XA 2DS1A 4KIOA 1OBGA 4MH7A 3PLSA 4MVFA 4ONAA 3RM6A 3A99A 3QZFA 5JSMA 3FZOA 3CTJA 4FG9A 3F5PA 4PRJA 4U79A 4ENXA 4H1MA 4V0GB 3S0OA 4YMJA 2C5OA 4FL2A 3BHUA 4Y95A 2EXMA 2QOFA 1O6YA 5BVKA 2C3JA 2BILB 2XB7A 3D2KA 3KRLA 4YTFA 5BYZA 3FC2A 1GIIA 4OW8A 1AD5A 2C0TA 3DBQA 3SD0A 4AZTA 3H10A 4EOLA 5LARA 2VO3A 4FE2A 2C47A 3N4TA 3MTFA 4NEUA 4QMNA 4RJ7A 3BHHA 3COHA 2X4ZA 4AOTA 2FSOX 2ETKA 3KK9A 3R9RA 4L46A 4MEDA 2W99B 2C30A 1KV1A 2O3PA 3GBZA 4O0XA 4ZTHA 5AX3A 2BAKA 1REJA 5C4LA 4G9RA 2CKOA 2E9OA 4D1XA 1W98A 3DKGA 1HOWA 3MA6A 5AA9A 4NIFB 1BI8A 3UIBA 2VAGA 1KUTA 2GNIA 5AP3A 2B9JA 4FEVA 2BPMA 4FT3A 4O21A 4IWOA 3UDBA 3HNGA 1OUKA 4DH1A 4PL5A 4CTCA 3DNDA 1YOJA 2R3QA 3LCTA 4CD0A 3OWLA 1P4FA 4YJVA 4DG2E 3Q4CA 3UP7A 2E9NA 3DBCA 4OTWA 4X3FC 2UZVA 5L8LA 1KOBA 4H58A 3GCSA 4R1VA 4YZNA 4AAAA 4UYAA 4QQ5A 5M55A 4FA2A 4DTBA 2B9FA 5AR2A 2BIYA 4D2SA 4G3FA 5ETCA 3R71A 5KMLA 4X2GA 5ACKA 2RSVA 5DHJA 5JMSA 4EUTA 5AMNA 3FMKA 4HNIA 5EI6A 3GOKA 4RJ5A 2JKOA 4ZK5A 4IQ6A 1IA9A 2JD5A 3KCFA 5C27A 5DPVA 3SV0A 1O9UA 3FQHA 1URWA 4ZS4A 4XLIA 2C6DA 3KU2A 4AGUA 4EQUA 4PMPA 3BGPA 4E4NA 4ZS0A 3KMWA 4IX5A 1F0QA 2Y4IB 2QHNA 5JT2A 2GTMA 2CGVA 3REPA 4TKSA 4RPVA 1PXNA 4KIKA 5GINE 2UZDA 4ZOGA 3FEGA 3Q60A 3DXNA 3CY2A 4Y5HA 4D4SA 2BRNA 4DFLA 3KB7A 5CI6A 4AZFA 2XJ0A 4U81A 5HIDA 3RBWA 4OGRA 4C3RA 1Y91A 3Q9YA 4QQTA 3GEQA 3H3CA 3WZKA 3CP9A 4HYIA 2HWPA 1I44A 4F1OA 3VRZA 5L2TA 1YQJA 3O96A 3DK7A 3PY1A 3ITZA 3OVVA 2C4GA 1Q24A 2X7GA 3FDNA 4IC8A 4I3ZA 1IAJA 2R9SA 3QQKA 5IUHA 2VGOA 3DKCA 3QD2B 1KV2A 5E8TA 1REKA 5DN3A 3D5UA 4Q2AA 4YLJA 5H8BA 3UVQA 3TNHA 3QA0A 5ANEA 3COKA 3A7GA 4OR5A 3RINA 2G15A 4RIXB 2HENA 3F7WA 2GSFA 4CQEA 1S9JA 3F3WA 3ALOA 3KN6A 3NRMA 4O0VA 5ITAA 2J7TA 1KE9A 4GYIA 4E8AA 1PMUA 4IWDA 5CQUA 4TW9A 3DBFA 4XHKB 3TNIA 2QR7A 4XEYA 4PMSA 2IZUA 4DBNA 4R1YA 4S33A 2YIWA 3QXPA 2QG5A 3E8CA 3RPYA 3EQRA 5HE2A 1TKIA 2JIUA 4O2ZA 5AUXA 2NO3A 5TR6A 3S2PA 3Q04A 1WCCA 4A9YA 1OKVA 4E26A 4E4XA 4IVCA 1Q8TA 1PMNA 3GNIB 1BMKA 1YWNA 5DT4A 2I6LA 5EDRA 4OTIA 4Z7GA 4HGSA 4DA5A 4WKQA 4A07A 3ZRKA 3FI4A 3HYHA 3RWQA 3V04A 4KWPA 3MV5A 4TL0A 4OLIA 3KRRA 3ID6C 1H25A 2XNEA 4QTCA 4PPCA 4BCNA 4DITA 4AA5A 2W9FB 2VTOA 3E62A 3VS4A 4XG2A 5GJGA 3CGFA 3GQIA 4FTUA 4RRVA 1PXMA 1UV5A 2X81A 3F3TA 4I6FA 3F2AA 4APCA 5HIEA 4ERKA 3DZOA 3MVMA 3OP5A 4FT9A 4DYMA 4LYNA 2NP8A 3FUPA 5L6WL 1RQQA 2ZVAA 2Q83A 4ZJVA 5HX6A 5IH6A 2C0OA 3NS9A 4JBQA 3UGCA 4CT1A 3R28A 2R3GA 2R7IA 2YHVA 3LXPA 3BWJA 4BFMA 2BKZA 4M3QA 4JOAA 4RIYB 2JAVA 3EFLA 4IAKA 4O81A 2Y6MA 3LQ5A 3ZCLA 5JQ5A 1ZY4A 3L8SA 3ZLXA 4IEBA 2V55A 5I5ZA 4FV7A 2O0UA 4LGDA 5JGBA 4WO5A 1XKKA 4BWXA 4AZWA 2EVAA 3RHXA 3NDMA 1YI3A 2V62A 1MRYA 4RJ4A 3GU7A 4IHPA 4F0IA 3DFCB 5CQWA 3CTQA 4CMOA 3UG2A 3RPOA 4YPSA 4D2RA 2W5BA 4IB5A 4I92A 3WIKA 4EBVA 4C4JA 4EH8A 4A9UA 2OU7A 4M69B 3W2SA 3G6GA 4G3DA 3FI8A 3I79A 4FIIA 4X2FA 2CSNA 2RIOA 3IOKA 2R3KA 3WARA 5BMSA 5A9UA 2JEDA 2I0VA 3BIZA 1JQHA 4OUCA 4QYGA 4XOYA 1OIUA 2RF9A 3EWHA 4CFMA 3I4BA 3OTUA 2XK9A 2O65A 2X9FA 3E8EA 4JX7A 5E92A 4BIEA 3ZH8A 4APPA 5CSWA 5AFVA 4BR3A 2I1MA 2FVDA 4YBJA 3IPHA 4CSVA 1JLUE 3CKXA 4M14A 4BGHA 4KIQA 3LCDA 3QD4A 2VWVA 4K33A 3PZHA 3ORZA 4TYEA 5AR8A 2ITQA 3ALNA 3O8TA 1YOLA 3QTZA 4IAAA 4WG3A 4R6VA 3F3VA 4IM0A 4ZTNA 2JIVA 2VU3A 2IN6A 1Q41A 4QP4A 3E92A 4LOQA 5D1JA 3DJ6A 4JG8A 3T3VA 3NUNA 2OO8X 5AV1A 3D0EA 1R0EA 3D5WA 1H08A 2HZIA 2QO7A 3EHAA 2VTTA 3MY5A 4HZSA 3C0IA 5HE1A 3G15A 1M52A 2R3JA 1PF8A 3S1HA 5JZJA 3FMHA 5M51A 2J0IA 4G16A 1YVJA 1B38A 5FBNC 3EKNA 2Y0AA 3UVPA 4ZSJA 5JGDA 3TKUA 5IA1A 4WT6A 4W4VA 5HE0A 4C4GA 4QP7A 4HCVA 4BTKA 4NYEA 2C6OA 3TNWA 4C3PA 1YXSA 3A62A 5KHWA 2XIKA 4BDDA 1M14A 3OTVA 3A7FA 4IVAA 4JL9A 2R3MA 3R83A 3HUBA 4BCGA 4BDAA 1H28A 4OBQA 4IACA 3IW8A 3LFDA 4E5WA 5EDPA 2JBOA 3RALA 4E4LA 3F61A 2W1DA 1R78A 2IZSA 3UC4A 2GFSA 3W32A 3SC1A 3PPJA 4KRDA 1Q8ZA 4HVIA 2WPAA 1JOWB 4PTEA 4ZTLA 4BCPA 3QQHA 4UYNA 4DCAA 4EYMA 3EKKA 4J1RA 3TACA 5HESA 3TIYA 2RL5A 5FP6A 4I5PA 1BKXA 3QCSA 3II5A 2HW7A 3Q53A 4BDEA 3F3UA 1LEWA 2XM8A 2F7XE 4DFNA 3NLBA 4YLKA 3ZFYA 1SZMA 5T68A 1UU9A 2R0UA 2VWUA 2OH0E 4FG7A 4FTJA 4DEGA 5E1EA 3VS2A 4LFIA 3ZM9A 4JBVA 3PA5A 3EZVA 1KWPA 2VTRA 2XNGA 3A4PA 2XJ1A 4IADA 3PA3A 4J53A 3G33A 4XRJA 3R8UA 1OZ1A 1H00A 4AGCA 4DC2A 4EK5A 3DDQA 3TDWA 4OBPA 2LGCA 2WKMA 4DEEA 3FXZA 3TI1A 3QKLA 3R00A 4HGTA 3OMVA 2UZTA 2YCRA 3BYVA 4RIWA 4EKKA 1OM1A 4C02A 3DB6A 4I1ZA 5KKRC 5B2MA 3SQQA 3HV4A 4CFVA 5EM5A 4ID7A 4HJOA 1QPCA 2PL0A 3TZ8A 5E90A 4OT6A 3DFAA 2WXVA 5EYMA 4D2TA 4FTLA 2AC3A 4QMSA 2BHHA 5IQGA 4PL4A 2J0MB 3UIMA 3BBWA 3ANRA 2PTKA 3RMFA 2YA9A 4BGQA 4TWNA 2WMTA 3PXKA 3LAUA 2PVMA 2UV2A 3HKOA 4JI9A 3LLTA 4EK3A 2H34A 3JS2A 2C3KA 4HGEA 4WBBB 3L8VA 5E9EA 1KE7A 3UP2A 1PXLA 2J51A 3HMMA 3IW7A 1CSNA 3ENMA 4WNOA 5LMAA 1G3NA 3S3IA 5EKNA 1Q61A 2KTYA 4RX9A 4WIHA 5KHXA 3QHRA 4JBOA 1K3AA 3I5NA 4FK3A 3ZDIA 3NW6A 2NRUA 5EM6A 4C33A 2W1FA 4RJ3A 3E93A 2PUPA 2XKEA 3OW4A 5CENA 2PVJA 3HA6A 5KMMA 1XH5A 1URCA 3EFKA 4BVUA 4UMUA 5KNJA 1R3CA 5HICA 2VX3A 2YJSA 4MK0A 4DH5A 4F7NA 4M8TA 4QYFA 5LCKA 4BIDA 3P0MA 4PPBA 3POOA 5HO6A 1YRPA 3RK9A 4HYHA 4EBWA 2W4OA 4PNIA 2QLUA 3OWPA 2A27A 4G3GA 3P1AA 3ZSIA 4QMMA 4E6DA 4YJNA 3VS1A 4O0WA 1GZOA 2X1NA 2J90A 4MHAA 3Q2MA 3FSFA 4PTCA 3EQHA 3FI2A 3F82A 4IAZA 3UQFA 2P0CA 4M67A 5F95A 4KBAA 4GW8A 5E91A 3MY1A 3NPCA 1OIRA 1HCLA 3DGKA 4TRLA 2OJGA 4FTCA 2YAAA 3MJ2A 3TV7A 4O27B 2WOUA 4II5A 3VBTA 1H1SA 5AAFA 3R9DA 5DWRA 2XRUA 4BF2A 4YNOA 5CEOA 3QQJA 3GT8A 2XK6A 5EOLA 3MB6A 1XBCA 3PRIA 2B53A 3CBLA 5IEXA 3ZFXA 3BLRA 4AN9A 2XIYA 3G51A 3R7UA 2OGVA 3UBDA 3UC3A 4UMPA 3QLFA 2PK9A 3W1FA 3LCSA 3NR9A 2VTMA 4MXZA 3C1XA 1CTPE 1LPUA 3HECA 2ZM3A 3MH2A 4ZTRA 4X2KA 2O2UA 3ZXTA 3ATSA 4CZUA 2UW9A 4C58A 3BKBA 3GUBA 1H27A 2J0JA 3FMEA 5FTGA 3IDCA 5K0KA 4YSMA 4IIRA 5D9HA 4JR3A 5AP5A 2WU7A 3FKOA 4ALUA 3MDYA 2GS2A 3EFJA 1JPAA 4EHGA 5IA4A 1H1PA 4C2WA 3OEFX 4D5KA 3U54A 2Y7JA 3G6HA 2PVKA 5AADA 3AC1A 5D11A 2OK1A 3HV7A 3C5IA 4FTOA 3SAYA 4QMZA 3OF0A 3CLYA 4FUYA 3VS6A 4V0GA 2XZSA 4G6NA 5CZHA 4G17A 1U54B 4PL3A 4BCJA 1K2PA 1OKZA 1QMZA 2R3LA 4K9YA 4MWIA 4ANQA 5M08A 3PSDA 3G0FA 5CVGA 2VX1A 3FPMA 4L8MA 2QOQA 4XP3A 5DE2A 4EOSA 3ACKA 4FZFB 4N0SA 5HG8A 4MXCA 2VWYA 5I9XA 4QD6A 4ZEGA 4ZZMA 3ZO4A 2XKFA 4DFZE 4YHTA 4WNKA 1PKGA 3KXNA 1ZOGA 3DZQA 4DH3A 3OXIA 3QHWA 3KMMA 2ACXA 2ZM4A 3F66A 4HCTA 4K0YA 3EQIA 2JIIA 2QONA 4NIFA 1I09A 4L7SA 1KE8A 3ZDUA 4FYOA 3JY9A 4LG4A 5GNKA 1BX6A 3FL4A 2ZJWA 5KMIA 3A60A 4P90A 5EI2A 2W05A 3S4QA 2CNVA 3RZFA 5E8YA 4HVHA 3RAIA 3AOXA 3IONA 5IUGA 2IG7A 2W1EA 5M07A 1BLXA 3FQEA 3CPBA 4LRKA 1H24A 3VNTA 4BDJA 2ZV9A 3R8ZA 2HZ0A 2FSTX 2WMRA 1FVRA 3ORIA 4WNPA 2VRXA 4S2ZA 1YWVA 5AWMA 5BYYA 3PPZA 3R1SA 3U4WA 3RK5A 1GOLA 4FODA 3PXYA 4D1ZA 2C6KA 2QOLA 1JNKA 4EK6A 5LOHA 1L3RE 3ZRLA 2GQSA 5T3QA 3TZ9A 4G3CA 2Y9QA 5IQEA 2ITWA 4FTIA 4WG4A 4FSMA 4EOOA 4BKJA 5K5XA 4XOZA 3FZTA 3KK8A 5E7RA 1UWHA 1U59A 3P7AA 3P79A 1QL6A 2RFSA 4J71A 5AM6A 5J95A 3RCJA 2IVSA 3H30A 3BYOA 3GC8A 5JFSA 3UPZA 3FI3A 4IJ9A 3MH1A 4NCTA 4AZSA 5CASA 3PUPA 1ZZLA 4FV1A 1NVRA 2X7OA 4QNAA 5JFWA 3RCDA 3DXPA 2WMAA 5EYCA 3F2RA 3K3IA 5DRBA 2XIXA 3R7IA 2WZJA 2Y4PA 4RBLA 3LKMA 3F5UA 2UW8A 3W18A 3MFRA 3IQ7A 1OPLA 3PFQA 3QX4A 4RZVA 4B4LA 2OJ9A 4Q9ZA 2CPKE 1OIYA 3F88A 3MWUA 3QZHA 4NH1A 3R7OA 3AT4A 4L42A 3RPSA 3VUDA 3OCBA 4YURA 3DKFA 4FOCA 3TL8A 5FWKK 1PJKA 3HEGA 3V5JA 2X7FA 3PJ8A 1OPKA 4EI4A 4XBUA 4PDPA 4DF3A 3E5AA 2JGZA 3AG9A 3EQPA 3WI6A 3LIJA 2WTIA 5HTIA 1ZMWA 3TZ7A 4NFNA 2DWBA 1DAYA 5FUTA 4GU9A 4O91A 4C4IA 3BYMA 3ZOSA 1ZAOA 4RC3A 3FLWA 4C4FA 4F9WA 1YOMA 5JKGA 4U3YA 4IM3A 2RG6A 1H0WA 2UW3A 4MXYA 4I93A 1ZRZA 5GJFA 4IMYA 3UVRA 3GXLA 4FSNA 4IB1A 3NW7A 4KKEA 4O7LA 2VUWA 3FQSA 2GPHA 4PF4A 4X3JA 3ZRMA 4C37A 2R64A 3I5ZA 4RX8A 3FLNC 5EW3A 3GENA 2GFCA 3QL8A 4U6RA 3BELA 4IX6A 2R3OA 3PJ1A 2VGPA 2WTDA 4RIXA 2F7EE 3NUXA 4AA0A 4RFYA 1OB3A 1FOTA 5IKWA 4H39A 5HX8A 5IPJA 1IAHA 2CNQA 2CN5A 4F1MA 4PDOA 5EHOA 3O8PA 3ZC5A 3QZGA 4YHJA 1GIHA 3MYGA 1QPJA 5HTCA 3TCPA 3LFNA 4YZBA 5CNOA 3AC3A 4KB8A 5EK7A 4CKRA 5GZAA 5M4IA 4GMYA 2R3HA 3DTWA 2IVVA 5LXMA 3QWJA 3EN9A 4WG5A 2VTAA 3R9NA 3FE3A 3NWWA 3R9HA 2I0EA 4IVBA 4H05A 3C51A 1F3MC 2OXXA 3H9RA 4X21A 5EHYA 1OKWA 1M17A 2J2IB 4N4SA 4WHZA 4GVJA 3UPXA 1CKPA 3R8LA 2F4JA 4CZYB 5BUJA 3A4OX 5D7AA 2JDTA 4BZNA 1BUHA 3VWAA 4CLIA 3OT8A 5FD2A 4WUAA 1BYGA 3D9VA 3ZBFA 3GC9A 4ZLOA 4YJPA 3IGGA 5JRQA 3UOLA 4Y73A 4YC8A 5DFPA 4JDJA 3M42A 3UO6A 4USEA 4EJ7A 3MY0A 5CSXA 4MQ2A 5CWZA 3R04A 4E93A 2XYUA 4WBOA 1XO2B 4HZRA 5L8KA 3LCOA 2PVLA 3FHIA 2PMIA 2X8DA 5JFXA 2ZV2A 3PY0A 3Q5ZA 4IZ5A 5AP6A 4RIYA 1V0BA 2YN8A 3GC7A 2VTSA 3L8XA 1Q8YA 3R21A 4FKQA 5D12A 4F64A 3NMUF 3U9NA 5E8XA 4X3FA 4RC2A 4EYJA 4UZDA 1XHAA 4IANA 4U40A 5M44A 2XNMA 4DEBA 3PVGA 4EC8A 4ZSEA 4S31A 2J5FA 4ITJA 4R5SA 4EHEA 3LMHA 2KULA 4MD7E 5CI7A 3OUKA 3TXOA 4MXXA 2JAMA 4CG9A 3CS9A 4J52A 3SXSA 4BCQA 2UVZA 4FV2A 4DFYA 4BDKA 3MVLA 1Y6BA 5HNIX 4U44A 2PZPA 4H3BA 4J96A 2NPQA 3MS9A 4HVDA 4B7TA 3QRJA 2HZ4A 4M69A 2SRCA 5DBXA 5FEEA 2OSCA 2H96A 2FH9A 2VTNA 3E64A 3R7GA 4G6LA 1UU7A 4PX6A 5A6OA 4MF0A 2WELA 4BTMA 4CTBA 4CYIA 4GK2A 2DQ7X 3NVMB 4AN3A 3NSZA 4EORA 1GZNA 4QP1A 3TG1A 4Y85A 3DAEA 3ZHPC 2E9VA 4D28A 4FT0A 4D9TA 5CU4A 4B99A 4UBAA 1OUYA 3QLGA 1YHSA 4GT3A 5CEIA 1Z5MA 4UB7A 3CEKA 4YHFA 3ZXZA 3I6UA 1Q62A 1SM2A 4UXQA 3RVGA 5FLFA 1J7IA 3R8MA 4L3PA 5EM8A 2UVYA 3BZ3A 3FZ1A 3LE6A 4RIOA 2ZV7A 3TN8A 1JBPE 2PULA 4IFGA 3O0GA 2E9UA 2WNTA 1G8AA 2ZM1A 3U55A 2JBPA 4LUEA 1WBVA 4D4VA 3LZBA 5K5NA 4AP7A 4MCVA 3ZLSA 4MXAA 3U6JA 4QPSA 3VBQA 4EOJA 1IA8A 3MH0A 4L3LA 4Y72A 4MKCA 5D7VA 2PPQA 4QPAA 2ZMDA 1FVTA 4FEUA 4RWKA 3IW4A 3DOGA 4G3EA 2BRBA 4FL3A 2E9PA 3AT3A 4H1JA 3BLQA 3L8PA 4IX4A 4KA3A 3UNKA 3RKBA 3IDBA 5LVLA 3HV6A 4QP3A 2LAVA 2VD5A 2CLQA 4J7BA 4DLIA 5EQYA 2QVSE 2ZDTA 4IJPA 3HAVA 3EZRA 4EKLA 3RHKA 1GZKA 1MQ4A 4UALA 4GG5A 2PMLX 5AAEA 2CMWA 3FHRA 3ORPA 5IU2A 3PXFA 3ZFMA 5KMNA 4ACDA 3VC4A 2CKQA 3PVUA 5AV2A 4E4MA 4JAJA 5AUZA 3CY3A 3IW6A 2V0DA 3KQ7A 4U42A 2CGXA 3UOJA 4X2NA 3CCNA 1UKIA 3RNIA 1SVGA 4FNYA 4IC7A 3F5GA 2R3IA 2HY81 3ZUVA 5EYDA 4CRSA 4JG6A 3SOAA 4R5YA 4HYUA 4GG7A 5AUWA 5J8IA 3SOCA 3A61A 2BAJA 1WVXA 5IH4A 4FUXA 4HVGA 2H6DA 1RJBA 4DEIA 3NNUA 5J9YA 2CNUA 1FQ1B 2CHLA 2P2IA 4PTGA 3SDJA 3ZM4A 3EL7A 4FT5A 3R0TA 4YSJA 4XV2A 5D10A 2HK5A 2VNWA 5EW9A 4UWYA 4DTKA 2ZYBA 3ZLYA 3VS5A 1YXTA 4CXAA 3F5XA 3LFCA 5HGIA 4RX7A 4RWLA 4BDIA 3ZO1A 5TO8A 5F20A 4FSQA 4ACHA 3LFAA 4ZMEA 4TY1A 5HVYA 2JDVA 2WTJA 3HP5A 3CD3A 2BDJA 5HKMA 2YZAA 4LI5A 3IW5A 3A7JA 4AA4A 3U4UA 3DA6A 1ZXEA 4YZDA 5GIPE 4OTDA 3NUUA 3V51A 4FKSA 1PHKA 4BN1A 4XBRA 3U6HA 1FMOE 3SW4A 4FV0A 4FTMA 2YERA 3POZA 1IR3A 4QNYA 3BHYA 1H4LA 3CR0A 5EHLA 3Q6WA 4KKHA 4FZ7A 3U51A 4FEWA 4RZWA 4BTJA 5DH3A 2W9ZB 5FDPA 4W8DA 2AYPA 2FSLX 4EOMA 4TYHB 2BTRA 4L01A 1DI9A 3BHTA 2B54A 4XNEA 1KSWA 4J95A 2ITYA 4IXPA 1LP4A 5I9VA 3BQCA 5AV0A 4BCFA 3QRIA 5CSVA 1PYEA 2F9GA 2YCSA 3FKNA 2W06A 3QRKA 4FI1A 3R9OA 3TKHA 2YACA 3DKOA 3PZEA 2ZMCA 4ALVA 3MIAA 2PVHA 3DDPA 2RFEA 2JLDA 4MAOA 4EOIA 4I4EA 4O6EA 3MFSA 1JKKA 5M4CA 2GQGA 4TYIA 4QP2A 5J87A 3TV4A 4FG8A 3KXHA 4CQGA 1H1RA 3RGFA 4NJDA 4AXAA 3PYYA 4V01A 4N6ZA 4XP2A 4ANBA 5CZIA 2B4SB 4I0RA 4DFUA 3QD0A 3HP2A 1R39A 4ANSA 4JXFA 5JZNA 4FKTA 3QYZA 4FIEA 4OBOA 5HHWA 2BKKA 2W7XA 2IO6A 2G1TA 4ASEA 4BHZA 2YZLA 1NVQA 5A54A 3ZONA 5IQFA 1ERKA 3GGFA 3KMUA 4LUDA 3T9TA 3EQCA 2YM5A 3C4XA 4EWHA 5BNJA 5IA0A 3BV3A 4FF8A 3VUTA 3V6RA 3WYYA 5FP5A 3CPCA 4MBIA 1P14A 3IG7A 3NAYA 2OFUA 4EJNA 3LCKA 5BVDA 1AQ1A 4BGGA 1OVEA 4IFCA 3JUHA 5HOAA 4I6HA 3SG8A 2UVXA 4QMQA 4XG4A 2G01A 2V5QA 4RVKA 5BX0A 4JDHA 1Q8WA 3ELJA 3LVPA 2XIZA 2YM8A 3ORXA 4X3FB 1W83A 3OY3A 2CCHA 2GHGA 2QURA 1KOAA 4TN6A 3R7EA 2PE2A 3KXXA 4G5JA 1U5RA 2VV9A 4WNMA 3QU0A 4E6CA 2BZJA 4YC6A 4G34A 2P55A 1B39A 2AUHA 5CSPA 2PUNA 3OCGA 1ZMVA 4DG3E 2QKWB 1XR1A 3DQWA 4JDKA 4C0TA 1S9IA 4Z3VA 3VAPA 4UV0A 3ERKA 3MPAA 3NYOA 4MD8E 2A4LA 1PXOA 4U8ZA 4JIAA 4TYGA 3P78A 2WB8A 3DV3A 5L2SA 4HPTE 4ANNA 2Z7RA 3WE8A 4AOIA 5EW8A 4GK3A 3C50A 4M97A 4D5HA 3HLLA 4IM2A 4DCEA 4ZJJA 1U54A 4DBXA 3VULA 4HVSA 2BRMA 3NGAA 4NUSA 5DR6A 4LV5A 2EXEA 4QTBA 1ZLTA 5CYIA 1YHVA 2UZWE 1YXVA 3Q5IA 1SYKA 4R78A 2I7QA 4U9AA 2OJFE 5CX9A 5IQCA 3MI9A 4FTNA 5FM3A 4QQJA 2QOOA 3QXOA 1JVPP 5J7HA 1IEPA 3TV6A 4JRVA 2BUJA 4MF1A 3HZTA 4PMTA 4AT4A 4MXOA 4TWPA 3TJDA 2CGUA 5C8NA 2WO6A 4O0SA 1XH4A 3EQGA 2R2PA 4YO6A 5A4CA 1WFCA 4FOBA 4Z16A 1BL6A 3VIDA 3VW8A 4USFA 4NM5A 4QOXA 4GIHA 5KE0A 4C59A 4CCUA 4D1SA 3TUDA 2YLFA 5AV4A 1OL2A 4IAFA 4OTGA 4EWQA 4YJOA 3KCKA 2GNFA 2IVTA 2VTJA 2IPXA 4KSQA 1W0XC 3CIKA 4FMQA 4Z7HA 3DJ7A 3PXQA 4KSPA 4ASXA 5HZNA 3S00A 4RA4A 1PYXA 3V5LA 4O83A 2ERZE 4RT7A 3QTRA 2ESMA 3UOHA 4X0MA 5LWNA 3GP0A 3Q3BA 4P7EA 3JYAA 3O50A 5C01A 3MN3A 5ANGA 4O7RA 4EH9A 4LV8A 2FGIA 2XM9A 2J5EA 4QMYA 4H36A 5C1QB 2YWPA 3I7CA 4BIBA 5HU3A 4I6BA 4BCMA 3MESA 3KVWA 2QU5A 3D4QA 4YBKA 1M2RA 3EQDA 4F9CA 5TF9A 4CFWA 5I9WA 1DI8A 3HVCA 3F3ZA 4ZJIA 3ZS5A 1W84A 4EH7A 4FKOA 3ACJA 4KIPA 3AT2A 5GIOE 3TJCA 4GRBA 1OGUA 2F2CB 4RVTA 1V0OA 2WTWA 2J50A 3JVSA 3R7YA 4AOJA 2JDSA 2OKRA 2VWXA 3U87A 2UW0A 3UO4A 3W2PA 3RAKA 2Q0BA 3O23A 2ZOQA 3VVHA 5I3RA 2C6IA 4K18A 2PVNA 5HNBA 5HO8A 4YJTA 4N6YA 4FBXA 4HW7A 4BCOA 5B2LA 3SVVA 3FWQA 3P7BA 3GI3A 1B6CB 3DBDA 3PXZA 4AUAA 4CV9A 3K5VA 2WQMA 2A1AB 3QWKA 5CNNA 4FGBA 4YLLA 4WSYA 3PIXA 4CFNA 3COIA 1OIQA 2ITXA 2PY3A 4DGOA 4EC9A 3C4EA 3TM0A 2V7AA 2UW7A 4CFXA 3LXNA 3VW6A 5EH0A 5F94A 5L2WA 2Z8CA 2CJMA 1PKDA 3GU8A 4V04A 4E1ZA 4A9RA 4KBCA 2XK8A 1UU8A 2EB2A 2OF4A 4WSQA 4RGJA 4QYHA 2VTLA 3C7QA 3EN4A 5AA8A 1PXPA 4J8NA 5KZIA 2HXLA 3TWJA 4AT5A 4DLJA 3NIZA 2YIRA 3UG1A 3QA8A 3U8WA 1PY5A 2VWWA 2W1HA 2GDOA 3HL7A 2JC6A 1UNGA 3CJFA 2QU6A 4ASZA 4XLVA 4DGGA 2BRGA 3RPVA 3ZUTA 4DG0E 3PA4A 4TWOA 3VS7A 3EMGA 4GFOA 4O86A 4AE9A 3D83A 3C4CA 5TT7A 1A48A 1VZOA 2PHKA 3EOCA 3FLSA 2OBJA 3G5DA 4M15A 3BEAA 2ZAZA 3W33A 3ZYAA 4AW5A 5C4KA 3D94A 5CVHA 4EHVA 2FUMA 3SW7A 5KBQA 3QGWA 3AC2A 4IBMA 1ZYJA 4Y83A 4WRGA 3NX8A 3E63A 2J0KA 2X4FA 2ZB1A 4X2JA 4LOPA 2UW6A 4BDHA 4F9BA 5BQ0A 5AUUA 4Q5EA 3CGOA 4CG8A 4NTTA 2O63A 3IK3A 3KXGA 2VTQA 3W8LA 3ZBXA 3D5VA 5H8GA 4H3QA 4K8AA 4O0UA 2ZB0A 2WGJA 3B8RA 5EOBA 5ANIA
chains in the Genus database with same CATH superfamily
4EH4A 1OL5A 3FYKX 3KRJA 2R0IA 3H4JA 4DAWA 4DHIB 1ZMUA 5CSHA 3MPTA 3UNZA 3QCXA 4EOPA 3FC1X 4AFEA 3DLSA 1M2QA 2BFYA 3RTPA 4MNFA 1FPUA 2W1IA 5C8MA 2FA2A 2BFXA 2XKDA 1YKRA 5FQDC 3K5UA 4QTEA 2WTKC 2QG7A 5I3OA 4JG7A 5ANOA 4GT5A 4KNBA 4GUEA 4S34A 5EG3A 5J5TA 2J0LA 4YZCA 4OAVB 3R1YA 1WBPA 4NKSA 3I1AA 2QNJA 5DT0A 5CT0A 4BI2A 4F1TA 5CF4A 3QZIA 4CV8A 4BRXA 3WE4A 3AC4A 3O17A 3DQXA 5AR3A 4IWPA 4K2RA 3AC5A 3EFWA 2BZKB 4I22A 4L3JA 3OCSA 4W8EA 3P4KA 2ONLA 3GU6A 4JRNA 5J1WA 3R1NA 2VX0A 1XBBA 4FTTA 5JRSA 2XCHA 3PJ2A 4UN0C 4ITHA 4JAIA 2PE1A 4LV7A 5IQDA 3T8OA 3C9WA 4GUBA 3WF9A 4C8BA 3ORMA 5HQ0A 2HY0A 3DTCA 1WBNA 2XK4A 5CEMA 5J9LA 2C68A 1MRVA 4CFFA 2QOCA 4B8MA 4MD9E 5IDPA 5M57A 4XV1A 5EM7A 1R0PA 5ANKA 5HORA 2BZIB 4QTAA 3V5PA 3WYXA 5IEVA 3G9NA 4CMUA 3MVJA 2WEIA 3OBJA 3ETAA 1H01A 2Z2WA 5FDXA 3ORNA 4BBMA 4F0GA 5BVEA 2UZLA 3Q52A 5AJQA 5GZ9A 4ACMA 2C5NA 4D2PA 5IQAA 4PV0A 3ZTXA 4TPTA 2VNYA 5KKRB 4KD1A 3Q32A 4UY9A 4RA5A 1ZYCA 5FBOA 1KE6A 3EL8A 2OF2A 5CXZA 4LL0A 4IZAA 2ITUA 3ZO2A 3PVBA 4IB0A 3UMWA 3F6XA 1PXIA 3KA0A 3U6IA 1IRKA 4CKIA 3I6WA 3H0ZA 1J7LA 2O64A 2XCKA 4ALWA 2P2HA 5LVNA 2X8IA 3NFGB 2C0IA 5LMKC 4UMRA 4CT2A 1YI4A 3DK6A 1Q3WA 3NUYA 3OFMA 4ZY6A 3KULB 3UYTA 3NCZA 3DT1A 4FKPA 3GU4A 4I20A 4L9IA 3L9MA 5DNRA 3VN9A 3MH3A 1VJYA 2X39A 1KE5A 4BKYA 5J5SA 4FKVA 4YTIA 3QALE 4CRLA 4TNDA 4EL9A 1E9HA 3K54A 3O8UA 5FEQA 1M7QA 5IZFA 5C03A 5I9UA 4F9AA 5G1XA 4YGAA 4OTRA 2WMVA 4LMUA 1J91A 4I4FA 2BZHB 4QQCA 2BDFA 4W4YA 2YDJA 4I0TA 2F2UA 3HRBA 4CLJA 4R3CA 4XCUA 2OWBA 4PUZA 2VO7A 3VS0A 3LJ1A 1CM8A 1NY3A 5CT7A 2QI8A 4I5HA 1ZWSA 1ND4A 5H3QA 4BWKA 5HG7A 3PVWA 3O2MA 5DA3A 4NK9A 4F63A 5AUTA 3HMPA 4U41A 2GNLA 3VRYA 2PZ5A 1GZ8A 2YITA 3G9LX 4O84A 5LJJA 4PDYA 3LW0A 3C4FA 5DGZA 5AP7A 1FMKA 1WBWA 3QTWA 3DPKA 4L44A 3KFAA 3FLYA 3NZ0A 4FKRA 5CXHA 3SXRA 4FKWA 3RAWA 3W2RA 1Q8UA 3PG3A 2WMBA 3QTSA 4FX3A 3D7TB 2W0JA 4I41A 4JQ7A 2XNOA 1FINA 4AZEA 3LOKA 4DE4A 3E8DA 3SRVB 4JBPA 3BV2A 2YAKA 4FVRA 1H8FA 3QQUA 3NYNA 4J99A 5CF8A 1R1WA 2WTKB 5JN2A 3W2CA 3B2WA 2FB8A 2J9MA 3FBVA 4LGGA 5HI2A 4R7BA 4H3PA 4XUFA 2PVRA 3F69A 3K3JA 2V7OA 3T3UA 1STCE 4O1OA 4U0IA 3V6SA 4AZVA 2JKMA 3OG7A 4FYNA 3AQVA 2ITTA 5L8JA 4TYHA 3ZSHA 4P4CA 2BAQA 4ACGA 4AG8A 4EK8A 4ZZOA 2PU8A 2CN8A 5CU3A 3BYUA 3R2BA 1GIJA 4O0RA 4R3RA 4FVPA 3VBXA 2B0QA 3MBLA 3F7ZA 3PTGA 2JFLA 1V0PA 1XWSA 2OIDA 3E3PA 2W5HA 5CVFA 5DMZA 2V22A 3A8XA 1MRUA 3FKLA 5EKOA 3FYJX 3RP9A 4BICA 4UWBA 5HCYA 2A0CX 2WMQA 3R22A 5AP1A 4AN2A 4BL1A 3OXZA 4FZ6A 2VTIA 1ATPE 4UX9A 4O1PA 3ROYA 4GKHA 4DFBA 5AIKA 5A4EA 2VN9A 2P3GX 2PUUA 4Q9SA 5BUIA 1J7UA 4C4EA 3BBTB 3GCUA 3BE2A 4BZOA 2ITZA 3ZEWA 4FSWA 1M7NA 2Z7LA 4LM5A 1LEZA 4ENYA 2XUUA 3GOPA 1IG1A 1XQZA 3QCQA 4G2FA 5KO1A 4EK4A 3NUAA 3RZBA 3OCTA 5E4HA 3SGCA 5IH5A 2BVAA 4GCJA 3WOWA 2X6EA 4GH2A 4LMNA 5E8WA 4NTSA 4CYJA 2HELA 4ANOA 2BROA 1JKTA 1PXJA 4B6LA 4BYJA 5HG9A 4IX3A 2PWLA 2B7AA 3R73A 5CU6A 4FEXA 3PJ3A 4W4XA 3NFFB 5IA3A 4DN5A 2I0YA 4LOOA 3UNJA 3R63A 2HAKA 4DGNA 5H9BA 3UQCA 1K9AA 3Q4TA 4CKJA 1Y57A 3NUPA 4FNZA 4JJRA 3QF9A 4L53A 4R3PA 3ZU7A 2VO6A 4NCTC 5TKDA 3OWJA 3V5TA 1TFFA 3OOGA 4YP8A 2W1CA 2WOTA 4RFMA 3PWYA 4IDTA 3VBWA 5DRDA 5HVJA 3HMOA 5BYLA 5J1VA 4XS2A 4ZY5A 4O7ZA 3LMGA 4ASDA 4FTAA 4KRCA 4O7WA 4EH5A 2Y4IC 1OECA 1H26A 3EN7A 3AGLA 4M68A 3W0QA 4HPUE 4F7LA 2ERKA 2HXQA 2ZV8A 1JAMA 3AMBA 4M66A 4TWCA 4ZTSA 2W1GA 3H9OA 3OW3A 4M0YA 4Y46A 4RC4A 2GU8A 3WZJA 5FXQA 5HNGA 5KCVA 3VUGA 4XMOA 3OWKA 4EUUA 3B2TA 2B55A 3Q9WA 3V8SA 3KXMA 4B8LA 4QDVA 4QRCA 4O6LA 1WZYA 3PG1A 3QYWA 3GU5A 4QMVA 3QX2A 5EDQA 4DGLC 3V5WA 4AF3A 1QCFA 3DB8A 4L6QA 4RVLA 3GFEA 4U80A 4IVDA 4FL1A 2OLCA 3ODZX 2G2FA 4O82A 2CCIA 1CKJA 2XA4A 2Y8OA 2C6LA 4TXCA 1H1WA 3OC1A 3VQHA 4XG9A 3VUMA 5IMXA 3QGYA 4PP7A 5B2KA 4DGMA 5JQ8A 4A7CA 3QTUA 2QHMA 4XV9A 1TQIA 3MSSA 5A4TA 2PE0A 3WZUA 3UZPA 2O8YA 4ANMA 1DM2A 4IWQA 4QP6A 4E6AA 4JIKA 1A06A 1SMHA 4JLCA 4C62A 2GCDA 2QO2A 4ARKA 4BJJB 2WHBA 3OZ6A 3PJCA 3TNQB 1WBSA 4D0XA 3BX5A 4C2VA 2NNWB 4O22A 4BDCA 2ETMA 4ACCA 4EZ5A 2XNPA 2J4ZA 3LJ0A 1T46A 3UDZA 3KKVA 3V5QA 4FKLA 1JSVA 5HVKA 5CF5A 5E8ZA 2UW5A 3MJ1A 5IDNA 1VYWA 4L45A 1HCKA 3E8NA 4NFMA 4UMTA 4D58A 4QT1A 3ZEPA 2C3LA 4KS7A 3U9CA 5K4JA 1G8JA 4JNWA 2Z02A 2XVDA 3AD4A 4GFMA 4JQEA 3EH9A 3JXWA 4ZIMA 3UZRA 4NSTA 3KGAA 4Q5HA 2R3FA 1XH8A 2XNNA 5A14A 4BDBA 3VONA 3PE2A 2A19B 2IZRA 4A9TA 2QLQA 2R3NA 1OKYA 3QRTA 5ETFA 2NYAA 4GKIA 4FSZA 2XEZA 1P4OA 1SNXA 3PXRA 4MNEB 4L67A 1JSTA 3IKAA 5G6VA 4MX9A 4CFUA 3FMMA 3CD8A 4FKIA 3E87A 2ZDUA 5AR4A 1AGWA 5TOZA 3ZMMA 3LJ2A 3TNPC 3LPBA 3VUIA 2XYNA 5H2UA 4F08A 2REIA 4QMOA 4PMMA 4BB4A 4GEOA 4MWHA 3Q4UA 4NJ3A 3N9XA 2XRWA 5B0XA 3VUKA 3BE9A 4FIGA 4DEDA 4D55A 5DVRA 3I0QA 3HRCA 2PMOX 3ZO3A 1G5SA 2VO0A 4D0WA 5FRIA 2AEGA 5HBHA 5ETIA 4XV3A 4DINA 3SG9A 1UKHA 3BU3A 3FSKA 3QFVA 3WIGA 1SVHA 3TMOA 3OHTA 2UZUE 1FGKA 2WU6A 2GNGA 1WVWA 4AS0A 3LQ3A 4S30A 3FAAA 3R7VA 2CKEA 1NT2A 3CQEA 3DU8A 5A6NA 2YWVA 4AQKA 3QBNA 2OZOA 3TYKA 2IJMA 3R6XA 1MUOA 3ROCA 5I9ZA 4JQ8A 3HX4A 4Z9LA 3UE4A 2JKKA 4JVGA 3UTOA 2O5KA 4U97A 1Y8GA 2X2MA 2HOGA 3GFWA 4W4WA 4R7HA 2WIHA 4XYFA 1YI6A 5AAGA 5I0BA 5I9YA 3NVKI 2C1BA 2P33A 2UZNA 2OG8A 5J79A 1PRYA 2WMWA 1NXKA 2GHLA 3VBVA 4IB3A 4DEAA 4NM7A 3DLZA 4YJSA 1O6LA 2OJIA 2XKCA 3ANQA 4TYJA 3FXXA 5ANDA 3PE1A 4AW2A 4BHNA 4FTQA 4K77A 3GC0A 3WF6A 3ATTA 1J1BA 4L52A 1XJDA 4G5PA 4GT4A 4IH8A 3ET7A 2GNJA 2J6MA 5E8UA 5HBEA 1TVOA 4BBFA 1NW1A 4QTDA 3RPRA 1UNLA 4XX9A 2VWZA 2H8HA 2BIKB 3P86A 4FNWA 4OTHA 4D4YA 5M56A 4PP9A 3RK7A 1W82A 3RAHA 3NUSA 2YCFA 4BCHA 4EONA 1EH4A 3A7HA 3R30A 4YZMA 2G9XA 4BI0A 4C36A 3NEWA 1OL7A 3HA8A 1E1XA 5JFVA 2G2IA 2WQNA 3NYVA 1ZYSA 3KC3A 4J8MA 4WOVA 1JSUA 3QC9A 5HO7A 1PMVA 2OJJA 2PZRA 2XK7A 4GV1A 4JDIA 4ZSLA 3VS3A 3WBLA 5E8VA 4A4XA 4QMLA 3JY0A 3R8VA 3R8PA 4RG0A 4NU1A 1ZYLA 1Q3DA 2OIBA 5HE3A 3DK3A 5CAOA 3CSVA 2NRYA 3FMLA 4E6QA 4NWMA 4RLKA 4XG7A 4C4HA 4BWPA 3UIXA 5AEPA 5M53A 2OZAB 4GK4A 2EB3A 3W2QA 2OXYA 4I6QA 5FEDA 2G2HA 2WTVA 5LWMA 1OMWA 4FIHA 4CVAA 4FIFA 1IASA 3LQ8A 3QUEA 3P7CA 4F99A 3BEGA 4P5ZA 4FVQA 1BL7A 4XJ0A 5CU0A 2UUEA 3FZSA 3L1SA 2VTPA 4FT7A 5GZ8A 5HLWA 2YIYA 4HCUA 3W8QA 3A2CA 4EQCA 3AKKA 4A06A 3RM7A 4O7YA 3OBGA 3ULIA 5BVFA 2BRHA 1YHWA 3W2OA 3EJ1A 2C3IB 5E8SA 3HDMA 2C6EA 4UXLA 5BUEA 1RW8A 2W1ZA 3FZRA 3ORLA 4LRJA 5FTQA 5CS6A 1P2AA 3P5KA 4O7SA 3MW1A 4FV4A 3P23A 3VHKA 3WF8A 3BPRA 3HV3A 4AXEA 2YCQA 4BC6A 2CDZA 2F57A 3I60A 4QMTA 4QMPA 2R5TA 4RVMA 4XG8A 5K3YA 4BYIA 5CAVA 5JH6A 5AR5A 2BMCA 3HMIA 2EUFB 4A4LA 3Q9ZA 3AC8A 3UIUA 1OBDA 3EN6A 3MGYA 3G2FA 4TTHB 5FM2A 4RSSA 4HGLA 1FBNA 4Y5QA 4DHFA 2C5YA 4L7FA 1GY3A 3CJGA 3P08A 4YJRA 5CAPA 2VWIA 2Z7QA 2YM7A 3SA0A 4FICA 5KMKA 2X2LA 4F4PA 3SHEA 3GCPA 2I0HA 1H1QA 4BI1A 4QMUA 4BKZA 3VHEA 5BPYA 1ZARA 3R02A 2IW6A 3DS6A 4QPMA 3TUBA 5DR2A 2OICA 1MQBA 3QTQA 5LVPA 4Y8DA 3NCGA 1F5QA 3R2YA 5IMEA 5KUPA 5JEBA 5A46A 2HZNA 5HD4A 1GAGA 1UA2A 5L6PA 3HMNA 4YC3A 2B52A 5IA5A 4RWIA 2W4JA 5L2QA 3D5XA 4FTRA 5K9IA 4AE6A 2C6TA 5C9CA 3LLAA 1CDKA 2CLXA 1Z57A 4IE9A 4K1BA 3ZZWA 4ZAUA 3RNYA 3C13A 3DBEA 4DEHA 4AW1A 3KIOC 4RMZA 4NW6A 5CALA 1VYZA 2PZYA 2WMSA 2A98A 5KZ0A 5BVOA 3UZTA 2W96B 3IGOA 4FZAB 3CXWA 3OT3A 3SX9A 4I24A 2ZFYA 5CEKA 4A9SA 3RI1A 2VTHA 5C8KA 5D41A 2IWIA 3TIZA 3NNVA 4BCKA 3L9NA 4CNHA 5IISA 2HWOA 3KULA 4FV9A 3QQGA 5ANJA 2PVFA 2JFMA 5FTOA 4RX5A 3NNWA 4WRSA 4V05A 2QD9A 4ZTMA 1J3HA 3QTIA 4RQVA 4FTKA 3PSCA 3UO5A 4JT3A 2ITVA 3WF7A 2FSMX 2UZEA 4B9DA 3UOKA 5IA2A 2OH4A 4GL9A 1PW2A 3MPMA 2RFDA 3MB7A 4MTAA 3O51A 5AP0A 4XH6A 4C3FA 4X6RA 5L3AA 2F7ZE 4FC0A 4U43A 3QKMA 4C61A 5L4QA 3FZPA 3L9LA 4FGRA 1TZDA 4FV8A 4B0GA 4J97A 1NVSA 3QKKA 4TNBA 4AWIA 3DNEA 4FKUA 2W5AA 2EU9A 2QC6A 3H9FA 4I94A 2C6MA 5H8EA 4ZP5A 1VR2A 4ORKA 5KMOA 4WD5A 3MIYA 1ZZ2A 3MFUA 4HYSA 4LL5A 2GMXA 3EQBA 3LM5A 5DIAA 5AR7A 2YABA 4CCBA 3HRFA 4P5QA 1T45A 3MVHA 2YIXA 4QP8A 4PY1A 4LQMA 4E7WA 3AD6A 3DCVA 2WFYA 3HDNA 4I0SA 2IW9A 2QOIA 5HCXA 4X7QA 2WMXA 2GQRA 3QCYA 3ULZA 5HU9A 3VBYA 4DTAA 2WQBA 4O96A 3PRFA 3BLAA 1FVVA 4GIIA 5ACBC 3BRBA 5KX8A 4G31A 2QR8A 3ORTA 3BCEA 3HV5A 3E88A 2EWAA 4YU2A 2QODA 3D7ZA 1OPJA 4ZY4A 1QPDA 3D7TA 1OL6A 3QD3A 5AIRA 5KBRA 3ZSGA 4M0ZA 2HW6A 3A7IA 1LUFA 3FLQA 3SRVA 1G8SA 4ZSGA 4ANLA 4PQNA 1XH7A 3AXWA 3F9NA 4KUJA 1Y6AA 4QEBA 3NW5A 4C34A 2XH5A 4LGHA 1U4DA 3UODA 4DH8A 5M4FA 3UMXA 4JMQA 4JR7A 2QQ7A 3OY1A 3BWFA 4O0TA 2YM4A 5IUIA 4DH7A 4XP0A 5HBJA 3UJGA 3D14A 2WEVA 4KIKB 3KF4A 5DLSA 3W55A 1W2DA 2GS7A 3ODYX 5AP2A 2RGPA 2DUVA 2BHEA 1LR4A 3LHJA 2PUIA 4W9WA 4C57A 5J7BA 1WBTA 5ETAA 2YM6A 5L2IA 4O4CA 5FGKA 3NNXA 4EH3A 3TKIA 4DT9A 2GHMA 2WIPA 4FV6A 5IQHA 4FSRA 1UU3A 4KBKA 4ZTQA 1BI7A 4IZ7A 4D4RA 3T9IA 3KRWA 2YM3A 3A8WA 1TQPA 4OTFA 5K4IA 3QUDA 3PIZA 2QCSA 3IOPA 2Z60A 4NM3A 5AUYA 1XH6A 3LFEA 4I21A 2PVYA 4IW0A 5KMJA 2BCJA 2CGWA 3NIEA 4FV3A 3VF8A 4F6WA 4AW0A 4NZWB 3EYHA 1RE8A 4OT5A 4BCIA 5ICPA 5AUVA 5CEQA 3KRXA 4RJ6A 4YJQA 4YNEA 3PIYA 1DAWA 5LMBA 4JX3A 2C69A 3L9PA 3GB2A 3EIDA 3BYSA 3E3BX 4XG6A 5J9ZA 2OW3A 3VQUA 3HUCA 3G90X 4LRMA 5FG8A 4CMTA 4EEVA 4F7JA 4O2PA 2RG5A 3E7OA 3C4WA 1U5QA 4X6QC 3LFBA 3K2LA 2F49A 2HCKA 1E1VA 5LMKA 1UVRA 1CKIA 2EXCX 3AMAA 3ZC6A 3TDVA 3LFFA 3EN5A 1RDQE 3KN5A 1W8CA 1H07A 4M7IA 3PSBA 4OTQA 4FK6A 3TUCA 1YDTE 3WF5A 3ORKA 5DI1A 5DT3A 4FSYA 3EB0A 4GVAA 5JGAA 1GJOA 1OI9A 3TZMA 4O7NA 4I23A 3IS5A 5CEPA 5TE0A 1ZYDA 2AC5A 4CZTA 4EH2A 2PMNX 5EYKA 1MP8A 2H9VA 4MYGA 5HTBA 3O7LD 3C0HA 4U45A 2WAJA 1O6KA 3OUNB 3ZUUA 4UWCA 2IW8A 3DJ5A 2B1PA 3PWDA 4ZMFA 2DYLA 5C26A 4Z55A 4PDSA 3IDPA 5B7VA 5M06A 3M11A 4ZXTA 3DY7A 3C4ZA 3G0EA 5LCJA 1WBOA 3UYSA 3WZDA 2GNHA 2RFNA 4ZLZA 2UZOA 3QUPA 4G6OA 3KREA 3FY0A 3PDTA 1JWHA 4G1WA 3GCQA 4NW5A 3OXTA 2QKRA 2QOHA 4O0YA 3V01A 3S95A 5BVWA 3RWPA 5IG1A 1SNUA 1A9UA 4A4OA 4R7IA 4GFGA 1J1CA 2BDWA 1VEBA 3TT0A 2BR1A 1QPEA 3AMYA 4CEGA 1W2FA 1U46A 2XF0A 2HYYA 4BJJA 3QRUA 3KXZA 2OI4X 2XEYA 1UWJA 5L6OA 5IEYA 5LQFA 1Q99A 3C0GA 4O38A 3WILA 1WMKA 3JPVA 2UW4A 1ZOHA 4I5CA 3QAME 5FXSA 5AX9A 4E20A 4U5JA 3ZLWA 4YTCA 1ST4A 5IQIA 4ZZNA 1W7HA 2BTSA 2P4IA 4F70A 5DG5A 4FKJA 5M09A 4E5AX 4C7TA 4FEQA 3GVUA 3AD5A 4KAOA 3LXLA 4QYEA 3I7BA 5CY3A 2W17A 3BQRA 1YWRA 2C5XA 5A3XA 2X0QA 4AFJA 4YO4A 4MUQA 2PYWA 5IQBA 3V8TA 3SLSA 4FNXA 4XRLA 1TQMA 3KY2A 3PY3A 4FZDB 5CF6A 5M4UA 4FR4A 5DEYA 3TEIA 2B9HA 3BI6A 2JKQA 2R7BA 3BGQA 1XMMA 1YXUA 5T6KA 3VO3A 5CAUA 3FJQE 4HOKA 5IF1A 4KS8A 4D2WA 3Q96A 4MNEA 4U3ZA 1YXXA 5LVMA 1PMEA 2B9IA 4E3CA 2WQOA 5CAQA 4F7SA 5DR9A 2C1AA 2R3PA 3P9JA 1YDRE 2YDKA 1Y8YA 4IZYA 3FMNA 1Q4LA 4OAUC 4O7TA 1M2PA 4PNKA 4C35A 5F9EA 4NL0A 4QMXA 2HIWA 4I5MA 3H0YA 5EFQA 2VZ6A 3I81A 4F9YA 4USDA 2PSQA 5AV3A 3NYXA 3VJOA 2OIQA 3E7VA 5LVOA 2WMUA 3Q6UA 4S32A 3FPQA 4ZLYA 4FV5A 3HAMA 3M1SA 2OXDA 4G9CA 1X8BA 5HG5A 4D2VA 3BL7A 1UNHA 2A2AA 2YLEA 1ZY5A 2GTNA 3IO7A 5DYJA 4BTFA 4JS8A 3CQUA 4M13A 4YTHA 3CE3A 3COMA 3FLZA 2XK3A 3CTHA 3B8QA 2Y6OA 3FMDA 2YFXA 2VWBA 3BHVA 4MBLA 3I0OA 2FYSA 2W4KA 3VUHA 3QQLA 1YDSE 3THBA 2XJ2A 3LFQA 2ONLC 5F4NA 2JITA 3O7LB 3W0NA 5EQEA 2YDIA 3GQLA 5I4NA 4FIJA 3Q4ZA 4UEUA 4OTPA 3UQGA 3D15A 2X6DA 3W10A 2IZTA 3KVXA 3R01A 4O7VA 4CGAA 4L68A 1JKLA 3AGMA 4IDVA 3SKCA 4TZRA 4AGWA 2ITNA 5GHVA 4GU6A 1JKSA 3LM0A 4QO9A 2YJRA 3WZEA 4K11A 1DS5A 4QYYA 5HIBA 1XBAA 3VJNA 4WA9A 2ITOA 5EQPA 4DT8A 3M2WA 1PXKA 2XMYA 4R8QA 3PPKA 1APME 4YPDA 3AKLA 2YIQA 2UZBA 1ZOEA 2WTCA 3ENHA 3FY2A 4RIWB 4ERWA 3N4VA 4D9UA 3EQFA 2XBJA 2ETRA 2X9EA 3FXWA 2E2BA 4P2KA 5DOSA 5K0XA 4F0FA 4FSTA 4QP9A 3IECA 4BZDA 4K6ZA 4U7ZA 5FXRA 1Q5KA 4HNFA 5CANA 5A4LA 4MQ1A 4TT7A 3CC6A 2BALA 2PZIA 3N4UA 3KL8A 4IAIA 4YJUA 1CMKE 3JVRA 3FL5A 4EH6A 4R77A 4FSUA 2XNBA 4RWJA 3OEZA 5AM7A 1WAKA 3HGKA 3P5JC 4AT3A 4AX8A 3OROA 4YUQA 4NT4A 5HCZA 2XBAA 3KEXA 3BU5A 3FMJA 4L43A 4ZSAA 2IVUA 3PLAE 3DXQA 2R4BA 1SVEA 2XP2A 5EI8A 2OZAA 4F09A 4J98A 5HLPA 4AQCA 4DFXE 2RKUA 4N70A 3LXKA 5A4QA 4EHZA 4YR8A 3QTXA 3VF9A 3LFSA 3C5UA 2XS0A 3QC4A 3Q2JA 3RJCA 4UMQA 4F6UA 3OOMA 3TTIA 5CU2A 4BDGA 3SXFA 3DAJA 3N51A 2QOBA 1Q97A 3OD6X 5HD7A 4NKAA 3KF7A 3MFTA 1Z9XA 4L00A 4BBEA 3LMIA 3EYGA 4UZHA 4EQMA 2Q0NA 4EZ7A 5AP4A 4AGDA 3PP1A 4F6SA 2JDRA 4ITIA 2X8EA 3V8WA 4YZ9A 5BVNA 2WQEA 4FKGA 5BMMA 3W16A 4E73A 4EZ3A 1L8TA 4W9XA 2ITPA 1WVYA 4M84A 5DEWA 3CKWA 4BDFA 3F2NA 2IF8A 4IAYA 3CQWA 4FJVA 4AACA 5E1SA 4F65A 1GNGA 3MA3A 1OITA 5JK3A 1V1KA 4GJ3A 4RFZA 3JR1A 3R1QA 4M12A 2QO9A 3GCVA 3MTLA 4WUNA 3BLHA 1YW2A 4RJ8A 3V3VA 3O71A 2I40A 2JDOA 4MBJA 4RQKA 2X2KA 2OFVA 4N57A 4GSBA 4GJ2A 4XG3A 2XIRA 4GYGA 1P5EA 5GJDA 1FGIA 3D2IA 4EOKA 3BGZA 2Z7SA 2X0GA 2YISA 3QQFA 3BU6A 4C38A 5CTPA 3FV8A 4E5BA 4BY9E 1H0VA 5HLNA 3DAKA 2YEXA 3PP0A 4PPAA 3NAXA 4KABA 4GS6A 4KINA 1XH9A 2QOKA 4RLLA 3OS3A 4AU8A 4QMWA 2R3RA 2WD1A 3ZZEA 2CKPA 4EOQA 1OL1A 1NA7A 3TTJA 2GS6A 5HEZA 2FO0A 5F1ZA 2C5VA 4KKGA 4PWNA 4NM0A 5CLPA 3Q9XA 2DS1A 4KIOA 1OBGA 4MH7A 3PLSA 4MVFA 4ONAA 3RM6A 3A99A 3QZFA 5JSMA 3FZOA 3CTJA 4FG9A 3F5PA 4PRJA 4U79A 4ENXA 4H1MA 4V0GB 3S0OA 4YMJA 2C5OA 4FL2A 3BHUA 4Y95A 2EXMA 2QOFA 1O6YA 5BVKA 2C3JA 2BILB 2XB7A 3D2KA 3KRLA 4YTFA 5BYZA 3FC2A 1GIIA 4OW8A 1AD5A 2C0TA 3DBQA 3SD0A 4AZTA 3H10A 4EOLA 5LARA 2VO3A 4FE2A 2C47A 3N4TA 3MTFA 4NEUA 4QMNA 4RJ7A 3BHHA 3COHA 2X4ZA 4AOTA 2FSOX 2ETKA 3KK9A 3R9RA 4L46A 4MEDA 2W99B 2C30A 1KV1A 2O3PA 3GBZA 4O0XA 4ZTHA 5AX3A 2BAKA 1REJA 5C4LA 4G9RA 2CKOA 2E9OA 4D1XA 1W98A 3DKGA 1HOWA 3MA6A 5AA9A 4NIFB 1BI8A 3UIBA 2VAGA 1KUTA 2GNIA 5AP3A 2B9JA 4FEVA 2BPMA 4FT3A 4O21A 4IWOA 3UDBA 3HNGA 1OUKA 4DH1A 4PL5A 4CTCA 3DNDA 1YOJA 2R3QA 3LCTA 4CD0A 3OWLA 1P4FA 4YJVA 4DG2E 3Q4CA 3UP7A 2E9NA 3DBCA 4OTWA 4X3FC 2UZVA 5L8LA 1KOBA 4H58A 3GCSA 4R1VA 4YZNA 4AAAA 4UYAA 4QQ5A 5M55A 4FA2A 4DTBA 2B9FA 5AR2A 2BIYA 4D2SA 4G3FA 5ETCA 3R71A 5KMLA 4X2GA 5ACKA 2RSVA 5DHJA 5JMSA 4EUTA 5AMNA 3FMKA 4HNIA 5EI6A 3GOKA 4RJ5A 2JKOA 4ZK5A 4IQ6A 1IA9A 2JD5A 3KCFA 5C27A 5DPVA 3SV0A 1O9UA 3FQHA 1URWA 4ZS4A 4XLIA 2C6DA 3KU2A 4AGUA 4EQUA 4PMPA 3BGPA 4E4NA 4ZS0A 3KMWA 4IX5A 1F0QA 2Y4IB