5C8NA

Egfr kinase domain mutant "tmlr" with compound 23
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
324
structure length
300
Chain Sequence
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELTSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYDMDDVVDADEYLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 300
sequence length 324
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c8nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c8nA01
4EZ3A 5HTCA 4GG7A 3PY0A 4MD9E 3LJ0A 5I9XA 4O6LA 2FA2A 4Q9SA 4G31A 3C4FA 4QT1A 4AW1A 5E8TA 3NWWA 5I9VA 3NEWA 3Q52A 5IKWA 4DGMA 3W2QA 5DH3A 3KXHA 2JC6A 2WMRA 3ROCA 4Z16A 3G6GA 4GVJA 1U59A 4MNEA 4V01A 4AGUA 5HEZA 5GZ8A 2UV2A 4P2KA 4W9WA 4D1ZA 5CALA 5AV3A 3BWJA 3F5PA 3DZQA 3KCKA 4GUEA 1Y57A 1FOTA 4CVAA 4O7VA 1STCE 3OEZA 1L8TA 3ORPA 2HZ0A 4ID7A 3CC6A 3LQ8A 4PPAA 5HCXA 3TZMA 3BU6A 4QMLA 4BFMA 3G33A 4BCQA 2I1MA 2QOBA 5A9UA 1YHSA 1RDQE 1OECA 1KE9A 4G3FA 3TIZA 4KA3A 3ZO4A 2R3FA 2QOFA 3EMGA 3OCBA 2GHGA 3OZ6A 4HJOA 1UVRA 4PPCA 2LAVA 4F09A 5IH5A 4K77A 4RJ3A 1WBPA 2ZAZA 4I6FA 5EW9A 3VBWA 3ET7A 4ZLYA 1QL6A 4QTBA 2REIA 3CIKA 4M8TA 2B55A 4Y46A 3VW8A 2ETKA 2CGXA 2AUHA 2BHEA 3K5VA 4RIWA 1F3MC 4C57A 4F9BA 1P2AA 1V0PA 5DMZA 3MV5A 5BVKA 4L01A 4HYIA 2XIZA 4HGSA 2UZVA 5LVLA 2VN9A 3VUHA 3ZBXA 2PK9A 4R3RA 1BI7A 3COMA 3R73A 3FC1X 1QMZA 3VO3A 2WTDA 3QTRA 4EK6A 4GFGA 5FP6A 3D5WA 3UP7A 5E9EA 1IRKA 3KY2A 4OTDA 4QYGA 3OEFX 4BHZA 5AUUA 4I0TA 1Q99A 3ZOSA 4TWOA 1FVTA 5E4HA 3VJNA 3R1QA 4L3JA 4GKHA 2BCJA 5AA8A 4M69B 3IW7A 4J53A 3HV6A 2W5AA 4AT4A 4ZLOA 3HMOA 4AQCA 3A7HA 2W1GA 3L8SA 4ZSJA 3UP2A 4MYGA 4NCTA 4M0ZA 2QOIA 3A8WA 4OTPA 2IVSA 4FSRA 5IQEA 2YM3A 3QCSA 3LJ1A 3DKOA 4JAIA 4PMTA 3T3UA 4AZVA 2XH5A 3FLQA 3DTCA 3Q9WA 3T9IA 3UG1A 3VBQA 2ETRA 5E90A 5CEKA 4EBVA 3OW4A 4QMVA 3BYUA 3QQGA 2XJ1A 5EOLA 1P4FA 2JFMA 5IMXA 4XG6A 2OO8X 4FNXA 3C1XA 4QOXA 2R3IA 5K4IA 2IZUA 4MWHA 2PE0A 3EQGA 4NL0A 4DLIA 3NNXA 3QD0A 3VUMA 4FKPA 3UC3A 3THBA 5H9BA 3UG2A 5I9YA 2C1AA 3HAVA 4EONA 1OIRA 2ITUA 4ZEGA 5J7BA 3NUAA 3RAKA 4PDPA 2EB2A 2BAKA 5AUWA 3F7WA 3QYWA 4MD7E 5FD2A 5B0XA 4D1XA 3RJCA 3I79A 3QA8A 3LFEA 5F1ZA 4ZTNA 1TQPA 3DB6A 3VNTA 2XBJA 5EYCA 3UC4A 5E91A 4QP2A 5ANKA 2X0GA 1M17A 3O7LD 1LEZA 4JR3A 4FGRA 3A7FA 3EKKA 3VBXA 3WIGA 4BKJA 4G6OA 4UY9A 4QTDA 4XBRA 1HOWA 3SW4A 4FKOA 4XEYA 3DDQA 4MVFA 4C4FA 5A6OA 3HV7A 5HIEA 2Q0BA 4RIXA 3FUPA 1OPJA 4BDJA 3FXZA 5ETIA 3RM6A 3ODZX 4BYJA 3O8PA 4AF3A 2XM9A 1OIQA 3H9FA 4JR7A 3LCDA 3S0OA 3GU7A 4IBMA 4S34A 3UQCA 1B38A 4FT5A 4CKRA 2PPQA 5GZ9A 3C4XA 1H27A 4MBJA 4YURA 4WSYA 1OM1A 4OTGA 4APCA 4OTFA 1PXLA 2CJMA 2WPAA 4EK5A 3VHKA 4E93A 2GNHA 3NDMA 3F88A 5BVOA 2C6OA 4FEUA 5ANGA 1MUOA 3Q5IA 5B2LA 3HDMA 2X9EA 3C50A 4M7IA 1NA7A 4Z55A 4RVLA 5FGKA 4I23A 2ITPA 4BZOA 4O7SA 4W8DA 1KE5A 2BFXA 3KL8A 3LMGA 4MNEB 4N57A 3F2AA 5TT7A 2FB8A 2B9HA 4DH5A 4EHGA 3NX8A 3BELA 3RBWA 1OITA 3P7AA 2F7XE 3TNHA 5HNBA 3LFFA 4LV8A 3GC9A 2VTHA 5H8BA 1P5EA 4WOVA 4PRJA 5HBJA 5IZFA 2XNMA 2FSMX 4H58A 5HO7A 3ORTA 4FV0A 4RJ4A 4YPDA 3QYZA 3PP0A 5HG8A 3VBVA 5G1XA 2YWVA 2PZ5A 4B6LA 3MTLA 3N9XA 3CQWA 4NH1A 2ZB1A 3PVUA 4YNEA 5I3RA 4MEDA 3UYTA 4TRLA 4TT7A 3C5UA 1ZZ2A 3EQPA 3MPTA 4FG9A 5L6PA 3UIXA 4I6HA 4BR3A 3QAME 2O64A 4MXCA 3RGFA 1H1PA 2W05A 4YP8A 5IA3A 1URWA 4JIAA 4DH7A 5AP7A 2OZOA 4FNZA 3FL5A 3OCGA 2RF9A 4OBPA 4FKQA 5CF8A 2YACA 3QGYA 5H8EA 4BVUA 4DH1A 4BBMA 4LGGA 5DYJA 4BRXA 2VX1A 3BGQA 3ZXZA 4MH7A 4RA5A 2W4OA 1YXSA 1XKKA 3EOCA 5KKRB 3L8VA 3ZBFA 4XOYA 3R8MA 2I40A 2EU9A 3FAAA 1OL5A 3FLSA 3I6UA 3KRWA 4PQNA 4M84A 2V22A 5EG3A 3ZSHA 4UZHA 1X8BA 3FMHA 5DEYA 4H36A 2VTJA 4CFFA 4D2RA 5J95A 5IA1A 4RJ6A 4YZDA 3AC3A 1VYWA 3SV0A 2WQMA 2J0IA 3POOA 5EI2A 5HBHA 4DG2E 5CEMA 3TUCA 3CJGA 4O7NA 2XRWA 3FI4A 4G17A 2OF2A 4X3JA 4GV1A 1ZMVA 4QMPA 5TO8A 3ZSIA 5FXQA 4S31A 2C68A 4QPAA 3D94A 3Q3BA 4LRKA 3V51A 1O9UA 4GIHA 2CN5A 3E7OA 4QP7A 3DLSA 3VBTA 3ZLSA 2EXCX 2ONLC 5AP3A 5J79A 4GKIA 4GJ2A 5L2WA 2AC3A 1U54B 4JDIA 3WZDA 3CPBA 3KULA 4FTUA 1Y6BA 3RINA 4FEWA 3EZVA 3QA0A 4BYIA 5M53A 1KE7A 1ZMWA 3F5GA 4IDVA 1YDTE 3DKFA 1PXNA 1W84A 1JAMA 4BN1A 3AMYA 4JI9A 4KIOA 3AQVA 3MB6A 4Y95A 1ZLTA 5KMMA 2C5XA 3WYXA 4ITJA 4L52A 5CT0A 4UB7A 5EM5A 5M06A 3KVXA 4V05A 3TXOA 4I24A 4O7LA 4HVSA 5BMSA 4EH9A 3E62A 3CD8A 4LOPA 4K2RA 4F7NA 4J8NA 2PYWA 4U3ZA 1PF8A 4AT5A 4BF2A 4AZEA 4U7ZA 4D58A 3VHEA 3O0GA 4BIDA 3AC5A 5FP5A 1PMVA 4WD5A 3UNJA 4GL9A 4NU1A 3HX4A 3TN8A 4EZ7A 4FKIA 5KE0A 3TDWA 3UNZA 5K3YA 3R7IA 3DJ5A 5HVYA 1PXMA 2PVRA 4WO5A 3CTQA 3B2WA 3UVPA 3W1FA 2B9IA 4GVAA 1KUTA 4DTAA 5IU2A 3KQ7A 4ZTLA 3R02A 5AR7A 3ZLXA 4QP8A 2YEXA 4X2NA 3TEIA 3GBZA 5L6WL 1SVGA 1Z9XA 5I0BA 3G6HA 3O2MA 4RIXB 3O50A 2UZUE 4JL9A 4BCOA 4IMYA 4E5AX 4EJ7A 4EOLA 4WSQA 4U45A 2A0CX 3PXFA 3ZUTA 4KBKA 3F3VA 4IM0A 3VUIA 4W4VA 3SXFA 4C0TA 2JBPA 2Y8OA 4ANSA 1Q8ZA 2F49A 3PA3A 3QKMA 4BZDA 4D55A 1OBGA 2WXVA 1YXTA 3A8XA 3COIA 3G90X 4FC0A 4FUXA 3NW5A 3OUNB 3AGLA 5CF6A 4YZBA 3QALE 2OIDA 1UKHA 3EQDA 4Y8DA 5ETFA 1PKGA 2IVUA 4HVIA 4FA2A 4PWNA 4QP6A 2C0IA 3LW0A 4EC8A 3BGPA 4LI5A 4B0GA 3D4QA 3SQQA 5AAFA 1LPUA 5CEPA 3HECA 2C3JA 1LUFA 2XMYA 3LHJA 5A4CA 4WRSA 5HX6A 1PY5A 2YIRA 3AC8A 4IX3A 4HCVA 5AV0A 3U8WA 4L3PA 4LUEA 2B9FA 4JXFA 1UWHA 1UU3A 5EHLA 4A06A 4JQ7A 3SLSA 4U43A 4IVBA 4XH6A 3FMMA 4I21A 3UIUA 3QZGA 5DHJA 5CANA 3AMBA 1GNGA 3KF4A 2XCHA 4FODA 4FTJA 5E1SA 4F63A 4BDDA 3LM5A 5H8GA 3VS5A 5A4TA 4K11A 4DGNA 2HYYA 5JZJA 4ASZA 5EYMA 3A4OX 5L2SA 4EWHA 5K5XA 3F3WA 1OVEA 3W2PA 4L43A 5I9ZA 4D4RA 3LXLA 4MTAA 4G1WA 1OUYA 2YM6A 3QWJA 3Q04A 3ZRLA 2Z60A 4R5SA 4BKZA 4C38A 5HU3A 4MK0A 1FGIA 4D2PA 3N51A 3ULIA 4BICA 4UMTA 4J97A 4C4GA 1FMOE 2G15A 2HW6A 3FZOA 5DT0A 2CGUA 2VU3A 3ZFXA 5BNJA 1J7UA 2YA9A 4PDYA 2ZMDA 3TNWA 5ICPA 5JGDA 4X2GA 1YWVA 4ZS0A 1WBOA 1UV5A 4CG9A 4FT7A 2E9PA 3D2IA 3FKLA 4BDKA 3FZRA 4AA4A 2B54A 3Q4UA 4R7HA 4FYNA 2PUNA 3NUXA 3HV5A 2Y4IB 3PZEA 3JVSA 5CSWA 3DGKA 4W4XA 3F66A 3A60A 3ZEPA 3U6JA 1ZOHA 3I6WA 3QTZA 4QNAA 1FMKA 3UVQA 4C62A 2BIYA 2HENA 3CR0A 2EVAA 3I5NA 4EOOA 2GS6A 2X6EA 2GHMA 2X7OA 2YM8A 4AFEA 4EQMA 1ZOGA 5F20A 5IQHA 4EHZA 3RI1A 4F0FA 3R00A 4IZYA 3IOPA 4MF1A 3KULB 4H05A 5KBQA 4DEIA 2JIUA 5AP5A 3FBVA 5HD7A 4FL2A 3FQEA 3UE4A 2RG6A 4DH8A 2FH9A 4FSWA 2IO6A 4GFOA 1PMNA 3FC2A 4WA9A 2QHNA 4C2WA 3IW4A 4IX5A 3COKA 2BAQA 3ZZWA 4AE9A 1NW1A 1WMKA 4MQ2A 4UEUA 2YM4A 1K2PA 3VW6A 3SHEA 5CX9A 4FNWA 2A2AA 3B8RA 4N70A 3VQUA 1YOJA 5J5SA 3VS1A 4JIKA 3Q9XA 4G6NA 2NNWB 2EWAA 5DLSA 1YOMA 5HU9A 5ANIA 1XBCA 4BCMA 4JAJA 2XB7A 3IW6A 4RC3A 3ZFMA 2FSTX 3DFCB 5HG9A 4QNYA 3BU5A 2W5BA 4BI1A 2GU8A 2VTLA 5CAQA 4PMSA 3R22A 3CP9A 4IZAA 5AP1A 2Z8CA 2OXYA 3O51A 3OROA 3COHA 5CQUA 5DBXA 3UOLA 4PTCA 4YGAA 4BHNA 3KMWA 4RX5A 3W2RA 1BKXA 4RJ5A 3PJ2A 5HESA 3AC2A 4JT3A 3E88A 4X2JA 3RZFA 4TYGA 4L9IA 1JLUE 3RAWA 5CVFA 3LIJA 4V04A 4C59A 4XCUA 3MH3A 3DLZA 5IH4A 3ZHPC 4YMJA 3TUBA 4JBVA 1JKKA 2C30A 3WF9A 3QTSA 1JWHA 4BTKA 3BPRA 2R64A 1CMKE 2BRHA 4KS8A 2ZV2A 1YVJA 4D5KA 4E1ZA 2BZIB 2YN8A 1UWJA 3C0GA 4DEAA 4AWIA 1TKIA 3PPKA 4AGDA 3F61A 5JRQA 4UWBA 4IB1A 4YC8A 5DRBA 2YISA 3DAJA 4EUTA 1OPKA 2A1AB 3UNKA 2C5OA 3GCVA 4RT7A 5LMAA 1W98A 3H0ZA 3WF5A 4FE2A 1HCLA 1JQHA 2PUPA 3EL8A 2UZLA 4J8MA 4S32A 4UMQA 4YJQA 3RNIA 4J7BA 2C5VA 2PWLA 5I9UA 4YTIA 3JY9A 3TZ9A 5J9YA 3V5JA 4DFNA 2UVZA 3GCUA 4YU2A 2XK9A 3S00A 4AW5A 4J95A 2PULA 3BQRA 3BCEA 5DEWA 3DAEA 4HPUE 4U44A 3MFSA 4J52A 5GIPE 3S3IA 3MN3A 3P23A 4FTRA 4FOCA 4BDEA 5JH6A 4G9RA 4ITHA 5IUIA 3W2SA 2W4KA 2VX0A 4IWOA 5HE0A 3V04A 1IG1A 3QCQA 3HRFA 3GQIA 4O1PA 4JRNA 2C6EA 5HORA 4WUNA 5CNOA 1IA8A 3WF7A 4X21A 4BGGA 4O7ZA 3NPCA 2GPHA 4PF4A 3N4VA 3ZDUA 3DOGA 1UU7A 4A4OA 4CFNA 4EUUA 2PZYA 3CS9A 3AT3A 2GCDA 4X3FC 4XUFA 3W8LA 1XH4A 4DAWA 4I3ZA 3R7OA 3TWJA 1YRPA 2OJGA 1R1WA 3TKUA 4C36A 3ORZA 2WTIA 4TKSA 4YNOA 4EOPA 3H9OA 3D83A 4TWCA 2Z2WA 5KNJA 5LWNA 4AZFA 4Y85A 3CTHA 4TYJA 2YZAA 4O1OA 5CU2A 4WG5A 4AG8A 3G15A 3WOWA 5M4IA 2W06A 2V55A 4I5CA 4AGWA 4L45A 3MIYA 1SYKA 4P5QA 1UNHA 5E8SA 5DN3A 3TDVA 2QR7A 3K54A 2J5EA 2WU7A 4JBQA 3HYHA 4H1JA 3ROYA 4E4MA 1WBWA 1SVEA 3D0EA 3FI8A 4IZ5A 2CNQA 5EK7A 4OTWA 2VTSA 4QP3A 5CAVA 5AP6A 3R9NA 5HX8A 4KB8A 2BIKB 3VWAA 3Q53A 1H0VA 2HW7A 3I1AA 4RVMA 4F9CA 4BI0A 3DJ7A 1CTPE 3ZRMA 3C9WA 5E92A 1TQMA 1Q24A 1KSWA 5M4CA 2J5FA 3DA6A 3NS9A 4GH2A 2R4BA 5DR2A 4ACHA 1CM8A 3ZXTA 1LP4A 2O5KA 1YQJA 1FBNA 4QQTA 3FSFA 4KS7A 4MNFA 3IG7A 2F7EE 5E8YA 4ZSGA 1Q5KA 3FE3A 3D15A 2PL0A 3ZUVA 3F69A 4FVQA 5HKMA 4E3CA 3G0EA 4RLKA 4CFXA 5T6KA 4GUBA 3NNVA 4YUQA 3VIDA 5F4NA 3LXKA 4LRJA 3UZRA 4XNEA 2R2PA 2UZOA 3GGFA 5AWMA 4QQJA 3SA0A 4RSSA 4GT4A 1OPLA 2B1PA 2OIBA 2W17A 3G51A 3QHRA 4QP1A 3HAMA 3RK9A 4CT1A 4TTHB 3CGFA 4FGBA 1H24A 2VO0A 3UIBA 3W10A 1YOLA 4L68A 3DBFA 3DJ6A 4IHPA 2ITQA 3UPZA 3E5AA 3QBNA 5JGAA 3PIZA 2WO6A 4DLJA 4BDGA 2VTOA 4ANBA 2WMQA 2WQEA 4FMQA 2JKMA 3WE4A 5AV4A 2W1FA 5D10A 3FYKX 5LVOA 2OSCA 4RVKA 4RQVA 2C47A 2VZ6A 2WU6A 4IFCA 5FM2A 1OKZA 4I92A 5CAUA 3ALNA 2P0CA 3F5UA 1JVPP 3FSKA 4BCNA 3F6XA 3R7VA 5KMNA 2VGOA 5AM7A 3TNQB 4AA0A 4IAKA 2NRUA 2HXQA 3R7GA 3EQBA 4MXYA 1U4DA 3OTVA 2J7TA 5JRSA 3ORMA 3V6SA 4CKJA 3V01A 1PXOA 4XP3A 3BE2A 4FTIA 2YDJA 4NFNA 4RX9A 4A9YA 3MA3A 2OH0E 3BLHA 4ZTHA 4MHAA 5L3AA 4XV1A 4FKRA 4FZAB 3NCGA 4I6BA 4EL9A 3DXQA 3QTIA 4IX6A 4EC9A 2XK3A 2YIQA 2WMWA 2WQOA 4FV6A 3UODA 3SG9A 3CQEA 4TWPA 4TNBA 2F7ZE 3KVWA 4A9RA 3P0MA 3VC4A 3KXNA 1YXXA 4D4VA 4OGRA 4ASEA 4W8EA 3AMAA 4G6LA 4PY1A 5AADA 4D0WA 1AQ1A 1CKJA 4E4LA 2HOGA 2YDKA 3B2TA 3C4CA 1T46A 3RHXA 1H4LA 3DXNA 1OB3A 4UMUA 1DS5A 4FTMA 1OKYA 3L1SA 4QP4A 3W2OA 4RG0A 4A9UA 3ZO2A 4EOSA 2XKDA 2OJFE 4IJ9A 2JKOA 2O8YA 2PVHA 3P78A 2Q0NA 3BQCA 3QX4A 3NAYA 2R9SA 3SVVA 3PRIA 1CDKA 5EDRA 3HL7A 1SMHA 2GTNA 3FMJA 3CCNA 4FVRA 4PTGA 4RX7A 2Y6OA 5HVJA 4AT3A 4E6QA 2WMBA 4IADA 4IDTA 1GOLA 3VS7A 3ANQA 3DBDA 3HNGA 2YFXA 4I0SA 3NNUA 5JFXA 2W1IA 2UVXA 4QMUA 4ZTSA 5AX3A 3R1SA 4NSTA 4ANLA 4QD6A 4DFBA 2WMSA 5FEEA 3PVBA 5IQDA 3O8UA 3PXRA 3VS3A 3E87A 4O96A 4DG3E 2C6LA 1J91A 2C4GA 4Y73A 4FV2A 3H0YA 3IONA 4FKTA 4CZYB 4E8AA 3D5XA 3LFSA 5HNIX 2PU8A 3EIDA 4B8LA 1REJA 2C6KA 4K18A 2I0EA 3OC1A 2XK8A 4HGTA 4O0VA 4CNHA 2P2IA 2SRCA 5A54A 2WEVA 5BYZA 4ITIA 4N6ZA 2F9GA 4GK2A 4RWIA 4XBUA 5E8UA 3AC1A 4R78A 3ETAA 1YXUA 2ZVAA 4DITA 3RAIA 3S1HA 1Q8YA 2ITNA 3E93A 1V1KA 3FPQA 1KWPA 1IAHA 2BUJA 3BHUA 4MWIA 2UW4A 2VWXA 2WGJA 2V0DA 2HCKA 3IOKA 2QKRA 1A9UA 2C0TA 4Q5HA 5HVKA 4XG4A 2PTKA 4E73A 5M56A 3SX9A 2J0JA 1GZKA 4CMOA 5KMLA 1O6KA 1XH6A 4IAAA 4ACMA 3UDBA 5C8NA 1OI9A 3EYHA 3FI2A 3U4WA 4APPA 2F4JA 3MFRA 4WG4A 5AR5A 5DRDA 4C3FA 4I4FA 1WCCA 2EXEA 3EN5A 1ZARA 3NUYA 5FDXA 4ZJIA 4OTQA 1ZRZA 1Q3WA 4IAYA 3UQFA 3DKGA 4E7WA 4OBQA 4EH7A 3Q2JA 3LE6A 4FIHA 3DK6A 2E9OA 4PL4A 4TNDA 3GENA 4YJVA 4FKVA 2E9NA 3HA6A 3FYJX 4FV9A 5HCZA 3PA4A 2BFYA 3NRMA 4DGOA 3O96A 2F2UA 3PY3A 3H9RA 4JNWA 3QFVA 2QHMA 4EEVA 4F0IA 5A4QA 3D14A 4EKKA 4NW5A 4PUZA 5AUZA 4MX9A 3R8ZA 2B52A 3RALA 4NIFA 5L8KA 4DBNA 4O7RA 5A6NA 1KE6A 4RZWA 3IDPA 4BTJA 4MQ1A 3HKOA 3A7IA 3RPRA 3R9OA 3TACA 3K3JA 3SRVA 2PUUA 4BIBA 2CHLA 3NYOA 3DTWA 4Z7HA 2VTPA 4ALUA 1H00A 3BGZA 2CN8A 5CTPA 4K0YA 4FKGA 3OWLA 3QKKA 3F3UA 4CTBA 1BYGA 2R3HA 3WILA 3HEGA 4R7BA 4IANA 3U51A 4D2SA 5JN2A 5GINE 4L7FA 1PXKA 1OZ1A 5CI6A 2YCSA 3OXIA 1H0WA 5FRIA 4AFJA 4PP7A 5CF5A 5KZIA 3G9LX 4G5PA 3BHVA 3PA5A 5ACBC 2W9FB 2GNFA 4C37A 4YO4A 3KXZA 4Y83A 5BVFA 5KBRA 3CQUA 2QURA 1UNGA 2ERKA 4FZFB 3LLTA 5AA9A 3EHAA 3MFTA 3QQLA 2VO3A 3KN5A 1Q8TA 4DEEA 2W1CA 4ZSAA 5M4FA 4F9WA 2RFDA 4AA5A 3Q32A 3GUBA 1M2RA 3CTJA 4Y5HA 3FL4A 4O6EA 4CYJA 4RMZA 5IDNA 5GNKA 5AAEA 2J2IB 3QRTA 4JQ8A 3KK8A 3NYNA 2X9FA 4XP0A 4AOJA 1FGKA 2VTRA 3C4EA 5HG7A 5HI2A 5EQYA 3D9VA 4X2FA 5M57A 4WBOA 1A06A 4N0SA 3Q4TA 4KSPA 3C5IA 2XNEA 2IW8A 4BCPA 4J98A 2ERZE 4HZRA 4XYFA 4LMNA 4QPSA 2JITA 3FMDA 3TJCA 4CFMA 4M97A 5BQ0A 1UU8A 4U79A 2XJ2A 4DCEA 3I5ZA 3UOHA 1SNUA 4I93A 5J1VA 4YHTA 1V0OA 3AGMA 3L9PA 4FT9A 5AR4A 3KA0A 3HV3A 4QMOA 4RIWB 3KKVA 1J7LA 2IWIA 5E8WA 2AC5A 2Z7LA 5BPYA 1YDRE 1JOWB 2C6IA 3IECA 2WTJA 2QD9A 4QYEA 5HZNA 4F0GA 3BE9A 5KUPA 4ONAA 3LFBA 5GHVA 3UVRA 2ITTA 4GS6A 1LEWA 4PDSA 3LOKA 5DIAA 2C5NA 3BI6A 2UZWE 5T3QA 4FV7A 4DC2A 2OFVA 2PY3A 1DI8A 1ZAOA 4YJUA 5AEPA 5KO1A 3BV3A 3W18A 2G01A 4ZIMA 4DEHA 2WKMA 2YERA 1SVHA 3DY7A 3FLNC 4WUAA 4C35A 5IH6A 3PUPA 4O91A 3CBLA 4IW0A 4YJRA 1ZY4A 3LQ5A 2BKZA 5IEYA 5M51A 1YI4A 4BL1A 4IC8A 1PKDA 1BL7A 3P5KA 2Q83A 3PSDA 3VQHA 3PE2A 2KULA 4NFMA 4FZ6A 4KRDA 4K8AA 1M14A 3EQRA 3P7BA 1I44A 5ANDA 4AOTA 4RFYA 3I0QA 1BUHA 2J6MA 3L9MA 3GC0A 4NT4A 4GYIA 5I3OA 2F2CB 3VUKA 4BIEA 4KBCA 5F95A 3H30A 4AW2A 5IQFA 2GNGA 2E2BA 4L46A 5CF4A 2HXLA 3AG9A 1VJYA 5A4LA 5CASA 2Y6MA 4YPSA 4ARKA 4AZWA 3U9CA 3V8WA 4HNIA 2OF4A 2W1ZA 4RGJA 5CLPA 3BU3A 1KOBA 1YHVA 4FYOA 4FSQA 4NIFB 4ANMA 5IF1A 2ETMA 4O7TA 3NCZA 2C3LA 5HOAA 3QD3A 4L7SA 3BBTB 3PSBA 1PMUA 2PVLA 4G16A 4RX8A 5ANJA 1BI8A 2FSOX 3EN4A 3SRVB 2QG7A 3O23A 3FWQA 3KRRA 1RW8A 4L00A 2WMUA 4ZLZA 1KV1A 5IEXA 5AUVA 2JGZA 3TG1A 4AUAA 4E26A 4JS8A 2OJJA 3R7YA 2XKCA 4YLLA 3VAPA 3FLZA 4KD1A 3LM0A 4XG7A 3TNPC 3R21A 4EH8A 1WAKA 4YLKA 1K9AA 5IUGA 2RSVA 3CE3A 4OW8A 2X81A 4EH3A 2VTTA 4UWYA 3ITZA 3FMLA 3QCYA 5L2TA 2JDOA 4QP9A 5JT2A 3BZ3A 3PLAE 1XBAA 2A27A 3ZH8A 5B2MA 5C03A 3ZO1A 1GZNA 2X8DA 3QHWA 3R8PA 5DT3A 1M2PA 3ZYAA 1SNXA 2R5TA 4FEXA 3UPXA 3VVHA 1IA9A 5DOSA 1OKWA 3T3VA 5C26A 2VWUA 4DTBA 3MWUA 2CLQA 3WZUA 3GOKA 4BI2A 2QU5A 2CCIA 3ZC5A 2JAMA 2QONA 4ZY4A 4ZZMA 2UZTA 3GNIB 2JD5A 3UBDA 3AXWA 4EH2A 2JEDA 2R3LA 1XJDA 2C0OA 3FMEA 3POZA 3PWYA 2JAVA 1UA2A 5CY3A 3UGCA 3LVPA 1GAGA 5CU6A 4TL0A 3JVRA 3F7ZA 3GP0A 3KXXA 1WBVA 3F2NA 4S33A 4XJ0A 2I0VA 5JKGA 3GU6A 2GNLA 5LOHA 4HOKA 1QPEA 4UV0A 3FZPA 2UW5A 1GIIA 5CZHA 2XS0A 4ZTQA 1NVRA 2BRNA 2ZV7A 3REPA 5J5TA 2GQRA 3TM0A 3Q6UA 3NUUA 4H3PA 2OU7A 5C8MA 4LUDA 5HGIA 3UOKA 5BVDA 3I7BA 4FTCA 5IEVA 3W55A 4L44A 3MIAA 3MVLA 3MH0A 3TZ8A 4BDFA 4EKLA 2PVFA 2R7BA 2X4FA 4UN0C 3CGOA 1JKLA 3JYAA 4IB3A 3W16A 4A9SA 4F08A 3RKBA 4EK4A 4E6CA 2GNJA 2UW3A 5I9WA 4C33A 3M1SA 4R7IA 5BYLA 2Z7RA 4FBXA 5EFQA 2Z7SA 3DCVA 3GOPA 2JKKA 2V5QA 3O7LB 4H3BA 3RVGA 1R3CA 2WTKB 5JFVA 4F6WA 3FEGA 4O2PA 4UYNA 4YSMA 3G2FA 3GU5A 4XRJA 4I22A 4FTTA 3Q4ZA 2X6DA 4LV5A 3DV3A 4AXAA 4IEBA 2PUIA 4L3LA 5TOZA 2IZSA 3NZ0A 5CU3A 3RCJA 4F7JA 5IA2A 3GT8A 4GG5A 3GC8A 4LGHA 2EB3A 4FTOA 5ETAA 4WBBB 4AN9A 3L8PA 4ZP5A 2ZOQA 4RIYA 3E8DA 4FTQA 5C1QB 2QG5A 3DFAA 4FG7A 2GFCA 1EH4A 1PMEA 2WOUA 2YIWA 3DDPA 4FIJA 2YJSA 4TZRA 4EK8A 5M55A 2RFEA 3QQJA 4GU9A 3QZHA 4DFZE 2BRBA 2WELA 3F3ZA 4U81A 4ENXA 4U80A 2CGVA 4BCHA 5EM6A 4IVCA 2X39A 4GU6A 4CV8A 5A46A 5KCVA 5LVPA 2UZBA 4BCIA 3ZM9A 2HZNA 4MXZA 3R83A 4I6QA 3MY1A 1QCFA 2O63A 3DPKA 4TYEA 4EH6A 5CQWA 2HWOA 4IM3A 4ERKA 5HQ0A 5HG5A 4XV3A 4USDA 5ANOA 3P79A 3V5WA 3RPOA 4DEDA 3LZBA 1WVXA 5KMKA 3VS6A 4CSVA 3QC4A 3QU0A 1VR2A 4FIIA 2CNVA 2WMAA 4TYIA 4JG8A 2R3RA 4J1RA 1TVOA 3GI3A 3OF0A 5FEQA 2FSLX 3GB2A 5K0KA 5K5NA 4D4YA 5LVMA 4FOBA 3EWHA 4YHFA 4EHVA 3NR9A 4PTEA 4HYSA 2YABA 5FTGA 1O6LA 4IAFA 4CCBA 4O83A 3NUSA 5IQGA 3A62A 4JBPA 4KNBA 4S2ZA 5CVHA 3OS3A 4D5HA 4W9XA 3IPHA 1S9IA 5LJJA 2W4JA 3LCKA 4A4XA 3UOJA 2ITZA 1YKRA 2R3QA 4CXAA 2OG8A 5L8JA 3MW1A 5DWRA 5HE1A 1G8AA 3AD4A 4YJSA 4EORA 3P4KA 3EFWA 2X4ZA 3DU8A 3PJ8A 2WHBA 4J99A 2YLFA 1UNLA 3UZPA 4FKUA 5JQ5A 5JMSA 3CPCA 4EI4A 2FUMA 1ZYLA 3LJ2A 3MVJA 3KF7A 5DNRA 4EYJA 4XLVA 3QXPA 5FTOA 4RIOA 5EKOA 4OLIA 1XO2B 4MXAA 3LFAA 2UVYA 4RJ7A 5FQDC 3A4PA 4FIEA 5KHXA 3LQ3A 3KN6A 3N4TA 1VYZA 4F70A 4J96A 2C6TA 5EOBA 1WZYA 1XH5A 3MJ1A 3T9TA 3MJ2A 2QNJA 3JY0A 2BRMA 2HWPA 2UZNA 2WQNA 3ANRA 3OWJA 2VWIA 3HRBA 3M2WA 4O27B 3WE8A 5GZAA 3UZTA 4FI1A 3MYGA 3P9JA 3BIZA 5BUJA 4AS0A 4C4IA 4L67A 5D7VA 3C0HA 4MBLA 1Q3DA 4AOIA 4KKEA 4JDKA 4EBWA 1H1QA 3D7TA 2ZJWA 3C4WA 4N4SA 4F1OA 4F65A 5KX8A 5AAGA 2HZ4A 5AJQA 3FXXA 2PSQA 1M7QA 3PVGA 1Q8UA 3HZTA 3GVUA 4D1SA 4OAVB 4OT6A 2C3KA 4WNKA 2R3GA 4KWPA 2R3OA 3EL7A 3R8VA 4BZNA 5B2KA 4F7SA 4IB5A 4DF3A 4EOIA 2OLCA 2XK6A 2OI4X 1Y8YA 2W1EA 3GQLA 4GJ3A 2PE2A 4HCTA 2VO7A 1CKIA 1PXIA 2ZV8A 3IGGA 3KXGA 3U6HA 2CDZA 4XS2A 3FKNA 4OT5A 4I0RA 5CVGA 3OCSA 4BWKA 4USFA 5EQPA 4FTLA 1JKSA 3R2YA 4C3RA 4V0GA 2XIYA 3BEGA 3G5DA 4X3FA 1BMKA 3AOXA 5DA3A 4H39A 4WT6A 3D5UA 2QR8A 2WOTA 3IS5A 4EH4A 4JBOA 3QTQA 4R77A 2QODA 4HGLA 3MA6A 2QOLA 4QPMA 4ZTRA 3FLYA 4AZTA 3R04A 4GEOA 3PFQA 1BX6A 1JNKA 2Y9QA 5EM7A 4QTCA 3EQIA 4G3GA 4YO6A 3WZJA 4CT2A 4A7CA 5FXSA 2VTMA 4M14A 1GIJA 4AE6A 3A2CA 3LPBA 2BALA 2R7IA 4ZXTA 3TNIA 4YJNA 2BKKA 3RP9A 2IG7A 5L4QA 4WNMA 4IJPA 4O82A 4GSBA 2C3IB 4D4SA 1E1XA 1W8CA 5E8ZA 5EQEA 2JFLA 3P08A 2P33A 4RIYB 4QTEA 1A48A 4QRCA 2OJIA 3FY2A 5JFSA 3SW7A 3NGAA 3F5XA 3MVHA 4BCGA 4DT8A 4GT5A 4H3QA 4YJOA 1FVVA 2OXXA 5CAPA 2QU6A 5AUXA 4CQEA 3V8SA 2ZB0A 3ACKA 3QQUA 4JX3A 3DBQA 3F9NA 1SM2A 2H34A 4OR5A 4NM0A 1WFCA 3BWFA 4LL0A 3P7CA 5EI6A 3OXTA 4ZJVA 4TXCA 4D2TA 3L9LA 4RLLA 3HUBA 4FL1A 4QMWA 3DAKA 2W7XA 2UUEA 3PSCA 4MXXA 1JKTA 3LMHA 3QRIA 1PYXA 4FVPA 3FDNA 5ETCA 3QKLA 4FV4A 2UZDA 3PP1A 3QF9A 4O0UA 1XH7A 2IVTA 1KV2A 4IIRA 4IQ6A 3ULZA 2R0UA 4O38A 5CXHA 1E1VA 4YTHA 5G6VA 3TJDA 3E8CA 4RFZA 2QLUA 2XNBA 2ZDTA 4L53A 4O0RA 5T68A 2HY81 3ZRKA 4ANOA 2AYPA 5GJGA 3CKWA 1G3NA 2A4LA 2O65A 4OUCA 4FV3A 4EQUA 4HW7A 2XM8A 2J0KA 2XUUA 2BROA 4FV1A 4O0TA 3IKAA 3VF8A 4BDIA 4XHKB 3WARA 3PPZA 5IA5A 2H96A 4JX7A 5LMKC 4XV9A 4CFUA 3M11A 2UW8A 1WVWA 3EN6A 3OUKA 3KB7A 4F4PA 3PG3A 3E63A 4A9TA 3D2KA 2BMCA 1RJBA 4LM5A 1XHAA 3NAXA 2W5HA 5EW8A 3HDNA 4I1ZA 2PVNA 5CNNA 1OL2A 4U8ZA 5CI7A 3UTOA 3NSZA 3VJOA 5BVWA 2WIHA 5J8IA 1YXVA 2J50A 4Z9LA 3QGWA 4E5BA 2HAKA 4KIPA 4PMPA 4R8QA 5M44A 1L3RE 4K33A 4PP9A 1H1WA 5FM3A 2B0QA 4UALA 4NUSA 3R9HA 3ZM4A 5TF9A 2BDWA 4AN3A 3R28A 2JDVA 3U87A 2YIYA 5D1JA 3QZFA 2WMVA 1GZOA 5J87A 1ZMUA 4L42A 2YHVA 1H07A 4QQCA 2GNIA 3TT0A 3GCSA 4HPTE 3WYYA 2QOQA 5JZNA 5CSXA 4MCVA 5LVNA 2XP2A 3E3PA 5KMOA 2PMIA 3FKOA 3FQHA 2QI8A 3MGYA 1J3HA 3NW7A 4S30A 1G8SA 4USEA 3MSSA 4BDCA 5IPJA 3Q2MA 5KMJA 5IQIA 2W9ZB 4U41A 3D7TB 1OIUA 5BMMA 4BCFA 4IWPA 2DQ7X 4UZDA 3NUPA 3KEXA 3R7UA 4DTKA 3IW8A 2WD1A 3BYSA 4R1VA 3PRFA 1J7IA 4DFUA 2CCHA 4KKGA 5AIRA 3ZCLA 5HBEA 2PVMA 2RL5A 3PE1A 3BYOA 1ZWSA 4ZSEA 2X8EA 4I41A 3BKBA 2VUWA 4R6VA 3P1AA 3RWQA 5K0XA 1ZYDA 3KRJA 5KHWA 2VV9A 3OWKA 3ZTXA 5K4JA 2GSFA 1CSNA 2HY0A 4OAUC 4R3CA 3UO4A 1XWSA 2C6DA 3PG1A 3MS9A 5GJFA 3W33A 5CSPA 3N4UA 4EJNA 3MH2A 4FSYA 2F57A 4D28A 2VWWA 3A7JA 2XNOA 2ACXA 3DQWA 4CMUA 4UMRA 4FSMA 4RVTA 3FMNA 3MVMA 4V0GB 1MQ4A 4X3FB 4CMTA 4FT3A 4NEUA 2UW9A 2YM5A 4RFMA 4XOZA 3ZS5A 2RFSA 1XH8A 2QO2A 4ACDA 4JVGA 3DB8A 3BRBA 4ZY6A 1IAJA 3KFAA 3OCTA 5EM8A 5BYYA 2G2IA 2PVKA 2PMNX 3ELJA 5EDPA 1OL1A 3QUDA 2RIOA 4C4HA 2J51A 1P4OA 4H1MA 1AD5A 2ITVA 3ERKA 4QQ5A 3UMXA 4P90A 2XCKA 4ENYA 4EOMA 4FTNA 4FK3A 4WKQA 5I4NA 3DK3A 3OY1A 5D11A 1WVYA 5AR8A 3S4QA 5CSHA 3VS2A 3VUDA 3LFCA 4GFMA 4KSQA 3BX5A 3NNWA 3FHRA 5BUIA 4WIHA 2DWBA 1NY3A 2X7GA 1ZYCA 4G5JA 1JSVA 3R9DA 3TUDA 4PDOA 3UMWA 4RZVA 4FTKA 4M66A 4UWCA 1Q62A 2ZDUA 3HMPA 1W82A 4NYEA 4QO9A 2BZJA 2VTNA 5AR2A 3SAYA 2Y4PA 4JJRA 2XNGA 4D9TA 4E4XA 3BHTA 1VEBA 3RPSA 3AD5A 1H25A 2XIKA 3ENHA 3KU2A 2VAGA 5CSVA 2X8IA 5CU0A 5KKRC 3OOMA 1S9JA 4RA4A 5IQCA 4YZNA 3EJ1A 1DI9A 2BZHB 3DS6A 3Q4CA 4U97A 1OBDA 1XH9A 3KGAA 3EQHA 5FLFA 3QD4A 5HE2A 4IZ7A 3HGKA 2JDTA 5HHWA 2WTVA 4DA5A 4JOAA 3IGOA 4NTTA 3E7VA 1Y8GA 2NP8A 2XNPA 5AP0A 5FBOA 1ZZLA 4O0SA 5HNGA 4K9YA 4Y5QA 3VRZA 2G9XA 2XBAA 4DEGA 4DGGA 5L6OA 2WTCA 5IDPA 2R0IA 2R3KA 5J7HA 4KRCA 4NKAA 4TWNA 4YR8A 4JRVA 1APME 2FO0A 1PYEA 4PNIA 5HD4A 3ZLWA 4C4JA 4EH5A 4XMOA 5IISA 3ACJA 4NCTC 3ALOA 1U54A 4PL5A 5HLWA 4GRBA 2CMWA 3CY3A 1U5RA 1WBSA 1WBNA 1GY3A 4W4YA 3RNYA 1Q41A 2OK1A 4GW8A 3TIYA 5DR6A 3AC4A 3PXQA 5HLPA 1RE8A 4AX8A 2HELA 2RGPA 5GJDA 4WNPA 5FBNC 3EYGA 5C8KA 3V3VA 3K3IA 2XIRA 2W1HA 3L8XA 4PMMA 4B7TA 2FGIA 2O2UA 2XRUA 2XYNA 2GMXA 4E20A 4M0YA 2YCRA 2I7QA 4WHZA 3H10A 3E64A 3FI3A 3NYXA 3U9NA 1OL7A 4DYMA 4QMNA 4FV5A 3JUHA 5EHOA 4WG3A 4BKYA 5EDQA 2WFYA 4YC6A 4FR4A 4BBEA 1B39A 4C34A 4F9YA 4M15A 1PW2A 2XEZA 2QOCA 2VO6A 3GU8A 3OOGA 4YBKA 3ZO3A 4ANNA 3QQKA 4L6QA 2OJ9A 5AUYA 3JS2A 1FQ1B 1Q8WA 3B8QA 2QQ7A 3R30A 1OIYA 3PVWA 2C5YA 3SD0A 3VRYA 3ORNA 2B4SB 4Z3VA 4TPTA 5F9EA 3LMIA 1BLXA 3SGCA 1V0BA 4DT9A 4MXOA 5GIOE 4XP2A 2WTWA 3GU4A 4LFIA 4NZWB 5M4UA 3A61A 4O21A 2V62A 4MF0A 3NVMB 2WMXA 2WAJA 3WIKA 4QMXA 3H3CA 4FL3A 1U5QA 4RC4A 4GYGA 4DCAA 3KMMA 4X2KA 4CTCA 4EWQA 3MFUA 3OTUA 5DT4A 5EH0A 4U5JA 3FY0A 3MY5A 4F7LA 1PXJA 3ATSA 2XIXA 3MH1A 5IQAA 1WBTA 3PZHA 5H2UA 2NRYA 1SZMA 1VZOA 5TKDA 3ENMA 3QUEA 3F2RA 2VD5A 3OBGA 2BHHA 5KZ0A 2KTYA 3MI9A 2GQGA 3ZSGA 2YIXA 2YLEA 5CWZA 5AUTA 5DPVA 2YJRA 4AZSA 5IA0A 3OXZA 4FX3A 4XG3A 2X2KA 5JQ8A 2G2FA 3R2BA 3EKNA 3VF9A 2ITWA 5CZIA 3DNDA 4GK3A 4BDAA 2NO3A 5LCKA 3CSVA 1OMWA 3BHYA 4RRVA 4I20A 2BAJA 3PWDA 5EW3A 2CNUA 1H8FA 3LFQA 4G3EA 4HCUA 3BYMA 2YDIA 1U46A 3CY2A 1JSTA 1OUKA 5CEIA 2ESMA 4JLCA 4DINA 2EUFB 4HGEA 4RPVA 1YI6A 4EOKA 3GC7A 3R1NA 3RZBA 2B9JA 4U3YA 1QPJA 3NIEA 5J9ZA 4HVHA 2O3PA 1KOAA 4JDHA 3PIYA 3QZIA 4X6QC 3ZLYA 3EN9A 2V7AA 4TN6A 2CSNA 2FVDA 3FZSA 4P4CA 5AR3A 5L8LA 4KABA 4F6SA 5CAOA 3BLQA 4O86A 4N6YA 5A3XA 3E92A 3OY3A 4IM2A 2BVAA 1P14A 3WF6A 4A07A 1RQQA 5AP4A 4JDJA 5HE3A 1IASA 1YI3A 2BTSA 2DUVA 1CKPA 2A19B 3R63A 5ACKA 2QOKA 4OTHA 3E8EA 3UQGA 4GMYA 3WZEA 4IFGA 3LKMA 1YWNA 2PMOX 2UZEA 4YTCA 2BDJA 4YJPA 5FG8A 4F1TA 5IMEA 3PIXA 3VUGA 3D7ZA 1GJOA 1W7HA 2WNTA 3KCFA 5B7VA 3DNEA 2PHKA 2GDOA 3ZDIA 2X2LA 4UYAA 5FEDA 2ONLA 1MRYA 4ZZOA 1DAYA 2GHLA 3KRLA 4YZCA 4EOQA 4I94A 3K2LA 3T8OA 1PXPA 2WTKC 4JQEA 4CLIA 3VULA 5EKNA 4R3PA 4CKIA 4O7YA 1NXKA 2H9VA 3NUNA 3ATTA 2JDSA 5IG1A 1IEPA 3TL8A 2YM7A 1YW2A 1ZXEA 2QO9A 2J0LA 2WEIA 2Z02A 3FZTA 5CT7A 3ZZEA 3E3BX 2Y4IC 5EYKA 3RPYA 5DE2A 4QMMA 2OIQA 4DHFA 1NVSA 3QRKA 4G3CA 1W0XC 3EFJA 2R3PA 3TV6A 1ERKA 3VS4A 4B99A 5KMIA 3KMUA 4UXLA 4F6UA 5FDPA 4CFWA 2BPMA 3CKXA 1ZYJA 5CS6A 4B8MA 2Z7QA 4BY9E 1Y6AA 3UO5A 2R3MA 3WBLA 5LCJA 4BB4A 3HVCA 2WMTA 4FUYA 3W32A 5DFPA 3UIMA 4YSJA 4FF8A 2ZMCA 3E8NA 1OGUA 4F99A 2I6LA 1ZY5A 2I0YA 1W83A 3TTJA 4RC2A 3M42A 3CD3A 4HNFA 4TY1A 4F64A 4YJTA 3ID6C 3O17A 4QMYA 3LCTA 4IVAA 2P2HA 1AGWA 1Q61A 1HCKA 4DEBA 1T45A 2BDFA 4HVGA 3LCSA 4KIKA 3QD2B 4G2FA 4IAIA 4YZMA 3ZONA 4K6ZA 4IH8A 3R01A 3NMUF 4FKWA 3RK5A 2ITYA 3SG8A 2B7AA 5HICA 3DBCA 3PJ3A 1H01A 4DN5A 4ZK5A 5I5ZA 2VGPA 2BTRA 3ORKA 2GS2A 4YC3A 5J1WA 1MQBA 5D7AA 4PNKA 4EK3A 2HK5A 5BUEA 3DXPA 4XG8A 2GTMA 2C1BA 5TE0A 3NLBA 3R9RA 4DGLC 4ERWA 3LAUA 3R8UA 3C0IA 1E9HA 2VWZA 3S2PA 4IAZA 4CRSA 3QLFA 3EFLA 3LCOA 3QL8A 3ZU7A 2GS7A 3IQ7A 3Q60A 4TYHA 3KXMA 4R1YA 5AIKA 4AP7A 3RHKA 3RK7A 1MP8A 2VRXA 2YAKA 2ZM4A 2E9UA 5CYIA 3TI1A 1IR3A 5LWMA 4Y72A 4HZSA 3ORXA 3MTFA 5AP2A 4BCKA 5HIBA 3C13A 4BDBA 3GFWA 3EN7A 5EHYA 3FHIA 2JLDA 2O0UA 2RG5A 2I0HA 3SXRA 2B53A 1H28A 3I7CA 2OGVA 5ITAA 4WRGA 4X6RA 5LMBA 3OBJA 4Z7GA 4Q5EA 3PXKA 2CGWA 2XKEA 4CD0A 4GIIA 1JSUA 3MESA 1UU9A 3FXWA 4QYFA 4MKCA 4PPBA 3LXPA 4RWLA 2HZIA 3DKCA 4QMZA 4IACA 5C27A 2OICA 2W0JA 4FT0A 4YTFA 4O2ZA 4C7TA 4O81A 3AT4A 1PRYA 4IX4A 4AU8A 3RTPA 4JG7A 1Q97A 3MY0A 4I5HA 3I81A 3V5QA 3OP5A 2IPXA 4AAAA 3S95A 3SC1A 4O0YA 4BBFA 3MPAA 3DT1A 3IO7A 5EI8A 5LQFA 1I09A 2LGCA 5EYDA 1H26A 2WZJA 3HUCA 3GFEA 5AM6A 2PZRA 3HRCA 4QMQA 4DG0E 5C9CA 3EB0A 4ASXA 1K3AA 2VX3A 3NYVA 1R39A 3Q96A 4M13A 4ZAUA 1B6CB 3VS0A 3C51A 3BYVA 4ALWA 3AD6A 2IJMA 3LXNA 2VNWA 4OTRA 3ZC6A 3NVKI 2CPKE 4FKSA 1R0EA 4QTAA 3HMIA 3QTXA 4I5PA 4O0XA 2XYUA 3TTIA 5AFVA 2VTAA 3HP2A 3LFDA 5HLNA 5CENA 3ZUUA 3C4ZA 3QC9A 4HYHA 4HYUA 4RWJA 4QMTA 3OHTA 3I0OA 4K1BA 2BRGA 4CFVA 4E6DA 3R71A 4P5ZA 4FTAA 5HO8A 4D9UA 4U9AA 2EXMA 5HTBA 1J1CA 4B9DA 2P55A 1ZYSA 3U6IA 3ZEWA 4C4EA 2YAAA 4HVDA 2R3JA 4EOJA 4IE9A 1NVQA 4RWKA 3A7GA 2UW7A 3SXSA 3TV4A 4WNOA 3V5TA 4Q9ZA 4NJ3A 4LOOA 3UJGA 5FXRA 4O84A 1Z5MA 3LLAA 3FPMA 3QX2A 4G34A 4GT3A 4M67A 2PE1A 3FZ1A 3PJCA 4FICA 1ATPE 1GIHA 3K5UA 4YBJA 4X0MA 4UMPA 4BGQA 2JIIA 1Y91A 3O8TA 2IW9A 2W1DA 4G9CA 2JDRA 4C8BA 4U40A 5ANEA 4DE4A 4CGAA 3I4BA 4F1MA 1URCA 4P7EA 3HA8A 4KAOA 5CU4A 5HTIA 3F3TA 5C01A 3GCPA 4NM3A 2BILB 2G2HA 2IVVA 2YCQA 4QMSA 3BHHA 2WQBA 2H8HA 2Y7JA 3IW5A 4I5MA 3II5A 2J90A 3OT8A 3OT3A 4II5A 4ZS4A 4ZOGA 3U4UA 4FZDB 3TKHA 3MPMA 3KC3A 3PY1A 5F94A 2ZYBA 5HIDA 3DQXA 4QYHA 5JGBA 3PTGA 4DBXA 4O22A 4UBAA 3PLSA 2RFNA 3QWKA 4FSNA 3QQHA 2XKFA 4IC7A 4W4WA 4CG8A 4XV2A 1ND4A 5JK3A 3EH9A 3UYSA 2J4ZA 3FV8A 4CZUA 2E9VA 4KIKB 2OFUA 5M07A 3HP5A 4G3DA 4M3QA 4YZ9A 2OH4A 3WZKA 5LXMA 4ZMEA 3QRJA 2PVYA 4U6RA 5DI1A 5BX0A 5BVEA 3V6RA 2NPQA 3I60A 3RAHA 1XBBA 4U42A 5HO6A 4EYMA 5HCYA 2W96B 4FK6A 4UX9A 4FZ7A 2PMLX 4E5WA 4LYNA 5J9LA 4CQGA 1R78A 2VNYA 2R3NA 3L9NA 3QUPA 5D41A 3RPVA 4ZZNA 2VWYA 3QTUA 2ZV9A 2C69A 4C3PA 4OTIA 3R7EA 3PDTA 5D9HA 1QPDA 3G9NA 4MD8E 3SOAA 4XX9A 3KRXA 2XK4A 3HMNA 4NK9A 3OVVA 3ORIA 3GCQA 3HV4A 4BC6A 4TYHB 2P3GX 5AV1A 2JIVA 1R0PA 3OD6X 3V5PA 2IW6A 2YZLA 3JPVA 5JFWA 1REKA 4D2WA 4CYIA 4M12A 4ZTMA 5L2QA 1O6YA 3R6XA 5DVRA 3KREA 4AGCA 1MRVA 1J1BA 4FKLA 2J9MA 3DBEA 4FNYA 1H1SA 4IB0A 4NM5A 4BWPA 2OZAA 5K9IA 1PHKA 1UKIA 3OG7A 4KUJA 4CCUA 1KE8A 4O0WA 5FUTA 3FQSA 3PJ1A 3QRUA 4DFXE 2V7OA 4ZY5A 3W8QA 1F0QA 3VUTA 3WI6A 4EZ5A 2CLXA 4LRMA 2QCSA 5IUHA 4KINA 5FWKK 4FKJA 2XNNA 4NKSA 3D5VA 2QC6A 1YDSE 5TR6A 4ZSLA 3SOCA 4GCJA 1F5QA 3BLRA 1Z57A 3P86A 2VWBA 1PJKA 3RM7A 4C58A 4BTFA 2OW3A 4LMUA 4CLJA 5JEBA 2QOHA 4KKHA 3IDBA 5E8VA 3EQFA 4LGDA 3TZ7A 3R8LA 2PZPA 3CXWA 2QKWB 3TCPA 3VN9A 4PX6A 2XVDA 4XG9A 5M09A 2CKEA 4EQCA 4ASDA 4FIFA 4BGHA 5D12A 2XJ0A 3NW6A 2G1TA 4FSZA 4X7QA 4D0XA 2OBJA 1XR1A 2IN6A 5C4KA 2YCFA 3PYYA 1FPUA 4BWXA 5CEOA 5E7RA 1G5SA 2BR1A 5AMNA 2RKUA 2JBOA 3TV7A 2H6DA 1JBPE 3A99A 3BBWA 3C7QA 4O7WA 4XG2A 3OMVA 5DGZA 2UW6A 4FEVA 2J0MB 1BL6A 4NM7A 4R5YA 3R0TA 3CEKA 1XQZA 4KIQA 2UW0A 2QLQA 3DK7A 3IDCA 4ACGA 2PVJA 4AN2A 4XRLA 4C2VA 1LR4A 1M2QA 4XLIA 2CKPA 4MAOA 4CZTA 2ZM1A 1M7NA 3PXZA 4FV8A 1FINA 4NW6A 4PV0A 4A4LA 4ORKA 4FSTA 1GZ8A 5H3QA 4U0IA 3UO6A 3JR1A 5BVNA 2XK7A 4LL5A 3QQFA 3OWPA 1Q4LA 5IA4A 3WF8A 3U54A 4CV9A 4BTMA 2ITOA 4KBAA 4D2VA 1OL6A 5JSMA 3U55A 2W99B 4BCJA 3TKIA 3Q5ZA 3FMKA 4ZMFA 1OKVA 2OXDA 3O71A 3Q6WA 5AV2A 3MB7A 4BDHA 4CEGA 4I4EA 4IVDA 3ORLA 4AACA 4B4LA 5A14A 4ACCA 4EHEA 5E8XA 5DR9A 4LG4A 4CRLA 3Q9ZA 3GEQA 4RQKA 4E6AA 2QOOA 4M69A 4IXPA 4TW9A 5CXZA 3EFKA 3F82A 2C6MA 3EQCA 3LFNA 2DYLA 3CLYA 5AX9A 2JKQA 2GQSA 2VTQA 3DZOA 1H1RA 2X2MA 2BZKB 2XEYA 2GFSA 1QPCA 2XZSA 4DH3A 5LMKA 1H08A 3HLLA 3QXOA 4E4NA 4IWQA 1TQIA 3KK9A 4MBIA 2HIWA 3ZFYA 5CEQA 1FVRA 2IZTA 3AT2A 3EZRA 4OBOA 4IWDA 3JXWA 4AW0A 3ODYX 3MBLA 2XF0A 3FLWA 3BV2A 5L2IA 5A4EA 1NT2A 2VWVA 3QLGA 4ZJJA 3SDJA 4C02A 3MDYA 2VTIA 2X7FA 2QVSE 3RWPA 2QO7A 2X1NA 3GXLA 3ZMMA 4NTSA 2ITXA 4L8MA 3Q9YA 2OWBA 2OKRA 5M08A 2WIPA 1DM2A 3PXYA 4LOQA 3NIZA 2FYSA 3OFMA 3RCDA 3PPJA 3R1YA 5C4LA 2CKOA 4J71A 3OW3A 4NWMA 4ANQA 3QCXA 4QYYA 3QTWA 1M52A 1YHWA 4NJDA 4FIGA 4ALVA 1JPAA 4FSUA 4YLJA 5E1EA 2IZRA 4DFYA 5DG5A 3BEAA 4F9AA 4GK4A 4M68A 2WB8A 4RBLA 3CJFA 4DFLA 2YITA 3H4JA 3FJQE 3IK3A 4YHJA 5FTQA 2CKQA 4LQMA 1YWRA 4Q2AA 4RJ8A 3V8TA 4PL3A 4JG6A 1ZOEA 3V5LA 4FEQA 1DAWA 2ZM3A 2OZAB 3W2CA 4C61A 4UXQA 3RMFA 4FG8A 3VBYA 2P4IA 2PZIA 3HMMA 2XA4A 2YWPA 3G0FA 3SKCA 2DS1A 5IQBA 5LARA 1MRUA 2Y0AA
chains in the Genus database with same CATH superfamily
4EZ3A 5HTCA 4GG7A 3PY0A 4MD9E 3LJ0A 5I9XA 4O6LA 2FA2A 4Q9SA 4G31A 3C4FA 4QT1A 4AW1A 5E8TA 3NWWA 5I9VA 3O5AA 3BLAA 3NEWA 3Q52A 5IKWA 4DGMA 3W2QA 5DH3A 3KXHA 2JC6A 2WMRA 3ROCA 4Z16A 3G6GA 4GVJA 1U59A 4MNEA 4V01A 4AGUA 5HEZA 5GZ8A 2UV2A 4P2KA 4W9WA 4D1ZA 5CALA 5AV3A 3BWJA 3F5PA 3DZQA 3KCKA 4GUEA 1Y57A 1FOTA 4CVAA 4O7VA 1STCE 3OEZA 1L8TA 3ORPA 2HZ0A 4ID7A 3CC6A 3LQ8A 4PPAA 5HCXA 3TZMA 3BU6A 4QMLA 4BFMA 3G33A 3AKKA 4BCQA 2I1MA 2QOBA 5A9UA 1YHSA 1RDQE 1OECA 1KE9A 4G3FA 3TIZA 4KA3A 3ZO4A 2R3FA 2QOFA 3EMGA 3OCBA 2GHGA 3OZ6A 4HJOA 1UVRA 4PPCA 2LAVA 4F09A 5IH5A 4K77A 4RJ3A 1WBPA 2ZAZA 4I6FA 5EW9A 3VBWA 3ET7A 4ZLYA 1QL6A 4QTBA 2REIA 3CIKA 4M8TA 2B55A 4Y46A 3VW8A 2ETKA 2CGXA 5L8LA 2AUHA 2BHEA 3K5VA 4RIWA 1F3MC 4C57A 4F9BA 1P2AA 1V0PA 5DMZA 3MV5A 5BVKA 4L01A 4HYIA 2XIZA 4HGSA 2UZVA 5LVLA 2VN9A 3VUHA 3ZBXA 2PK9A 4R3RA 1BI7A 3COMA 3R73A 3FC1X 1QMZA 3VO3A 2WTDA 3QTRA 4EK6A 4GFGA 5FP6A 3D5WA 3UP7A 5E9EA 1IRKA 3KY2A 4OTDA 4QYGA 3OEFX 4BHZA 5AUUA 4I0TA 1Q99A 3ZOSA 4TWOA 1FVTA 5E4HA 3VJNA 1XMMA 3R1QA 4L3JA 4GKHA 2BCJA 5AA8A 4M69B 3IW7A 4J53A 4MUQA 3HV6A 2W5AA 4AT4A 4ZLOA 3HMOA 4AQCA 3A7HA 2W1GA 3L8SA 4ZSJA 3UP2A 4MYGA 4NCTA 4M0ZA 2QOIA 3A8WA 4OTPA 2IVSA 4FSRA 5IQEA 2YM3A 3QCSA 3LJ1A 3DKOA 4JAIA 4PMTA 3T3UA 4AZVA 2XH5A 3FLQA 3DTCA 3Q9WA 3T9IA 3UG1A 3VBQA 2ETRA 5E90A 5CEKA 4EBVA 3OW4A 4QMVA 3BYUA 3QQGA 2XJ1A 5EOLA 1P4FA 2JFMA 5IMXA 4XG6A 2OO8X 4FNXA 3C1XA 4QOXA 2R3IA 5K4IA 2IZUA 4MWHA 2PE0A 3EQGA 4NL0A 4DLIA 3NNXA 3QD0A 3VUMA 4FKPA 3UC3A 3THBA 5H9BA 3UG2A 5I9YA 2C1AA 3HAVA 4EONA 1OIRA 2ITUA 4ZEGA 5J7BA 3NUAA 3RAKA 4PDPA 2EB2A 2BAKA 5AUWA 3F7WA 3QYWA 4MD7E 5FD2A 5B0XA 4D1XA 3RJCA 3I79A 3QA8A 3LFEA 5F1ZA 4ZTNA 1TQPA 3DB6A 3VNTA 2XBJA 5EYCA 3UC4A 3UDTA 5E91A 4QP2A 5ANKA 2X0GA 1M17A 3O7LD 1LEZA 4JR3A 4FGRA 3A7FA 3EKKA 3VBXA 3WIGA 4BKJA 4G6OA 4UY9A 4QTDA 4XBRA 1HOWA 3SW4A 4FKOA 4XEYA 3DDQA 4MVFA 4C4FA 5A6OA 3HV7A 5HIEA 2Q0BA 4RIXA 3FUPA 1OPJA 4BDJA 3FXZA 5ETIA 3RM6A 3ODZX 4BYJA 3O8PA 4AF3A 2XM9A 1OIQA 3H9FA 4JR7A 3LCDA 3S0OA 3GU7A 4IBMA 4S34A 3UQCA 1B38A 4FT5A 4CKRA 2PPQA 5GZ9A 3C4XA 1H27A 4MBJA 4YURA 4WSYA 3W0MA 1OM1A 4OTGA 4APCA 4OTFA 1PXLA 2CJMA 2WPAA 4EK5A 3VHKA 4E93A 2GNHA 3NDMA 3F88A 5BVOA 2C6OA 4FEUA 5ANGA 1MUOA 3Q5IA 5B2LA 3HDMA 2X9EA 3C50A 4M7IA 1NA7A 4Z55A 4RVLA 5FGKA 4I23A 2ITPA 4BZOA 4O7SA 4W8DA 1KE5A 2BFXA 3KL8A 3LMGA 4MNEB 4N57A 3F2AA 5TT7A 2FB8A 2B9HA 4DH5A 4EHGA 3NX8A 3BELA 3RBWA 1OITA 3P7AA 2F7XE 3TNHA 5HNBA 3LFFA 4LV8A 3GC9A 2VTHA 5H8BA 1P5EA 4WOVA 4PRJA 5HBJA 5IZFA 2XNMA 2FSMX 4H58A 5HO7A 3ORTA 4FV0A 4RJ4A 4YPDA 3QYZA 3PP0A 5HG8A 3VBVA 5G1XA 2YWVA 2PZ5A 3TDVA 4B6LA 3MTLA 3N9XA 3CQWA 4NH1A 2ZB1A 3PVUA 4YNEA 5I3RA 4MEDA 3UYTA 4TRLA 4TT7A 3C5UA 1ZZ2A 3EQPA 3MPTA 4FG9A 5L6PA 3UIXA 4I6HA 4BR3A 3QAME 2O64A 4MXCA 3RGFA 1H1PA 2W05A 4YP8A 5IA3A 1URWA 4JIAA 4DH7A 5AP7A 2OZOA 4FNZA 3FL5A 3OCGA 2RF9A 4OBPA 4FKQA 5CF8A 2YACA 3QGYA 5H8EA 4BVUA 4DH1A 4BBMA 4LGGA 5DYJA 4BRXA 2VX1A 3BGQA 3ZXZA 4MH7A 4RA5A 2W4OA 1YXSA 1XKKA 3EOCA 5KKRB 3L8VA 3ZBFA 4XOYA 3R8MA 2I40A 2EU9A 3FAAA 1OL5A 3FLSA 3I6UA 3KRWA 4PQNA 4M84A 2V22A 5EG3A 3ZSHA 4UZHA 1X8BA 3FMHA 5DEYA 4H36A 2VTJA 4CFFA 4D2RA 5J95A 5IA1A 4RJ6A 4YZDA 3AC3A 1VYWA 2IEWA 2WQMA 3SV0A 2J0IA 3POOA 5EI2A 5HBHA 4DG2E 5CEMA 3TUCA 3CJGA 4O7NA 2XRWA 3FI4A 4G17A 2OF2A 4X3JA 4GV1A 1ZMVA 4QMPA 5TO8A 3ZSIA 5FXQA 4S31A 2C68A 4QPAA 3D94A 3Q3BA 4LRKA 3V51A 1O9UA 4GIHA 2CN5A 3E7OA 4QP7A 3DLSA 3VBTA 3ZLSA 2EXCX 2ONLC 5AP3A 5J79A 4GKIA 4GJ2A 5L2WA 2AC3A 1U54B 4JDIA 3WZDA 3CPBA 3KULA 4FTUA 1Y6BA 3RINA 4FEWA 3EZVA 3QA0A 4BYIA 5M53A 1KE7A 1ZMWA 3F5GA 4IDVA 1YDTE 3DKFA 1PXNA 1W84A 1JAMA 4BN1A 3AMYA 4JI9A 4KIOA 3AQVA 3MB6A 4Y95A 1ZLTA 5KMMA 3PFYA 2C5XA 3WYXA 4ITJA 4L52A 5CT0A 4UB7A 4O4FA 5EM5A 5M06A 3KVXA 4V05A 3TXOA 4I24A 4O7LA 4HVSA 5BMSA 4EH9A 3E62A 3CD8A 4LOPA 4K2RA 4F7NA 4J8NA 2PYWA 4U3ZA 1PF8A 4AT5A 4BF2A 4AZEA 4U7ZA 4D58A 3VHEA 3O0GA 4BIDA 3AC5A 5FP5A 1PMVA 4WD5A 3UNJA 4GL9A 4NU1A 3HX4A 3TN8A 4EZ7A 4FKIA 5KE0A 3TDWA 3UNZA 5K3YA 3R7IA 3DJ5A 5HVYA 1PXMA 2PVRA 4WO5A 3CTQA 3B2WA 3UVPA 3W1FA 2B9IA 4GVAA 1KUTA 4DTAA 5IU2A 3KQ7A 4ZTLA 3R02A 5AR7A 3ZLXA 4QP8A 2YEXA 4X2NA 3TEIA 3GBZA 5L6WL 1SVGA 1Z9XA 5I0BA 1OGYA 3G6HA 3O2MA 4RIXB 3O50A 2UZUE 4JL9A 4BCOA 4IMYA 4E5AX 4EJ7A 4EOLA 4WSQA 4U45A 2A0CX 3PXFA 3ZUTA 4KBKA 3F3VA 4IM0A 3VUIA 4W4VA 3SXFA 4C0TA 2JBPA 2Y8OA 4ANSA 1Q8ZA 2F49A 3PA3A 3QKMA 4BZDA 4D55A 1OBGA 2WXVA 1YXTA 3A8XA 3COIA 3G90X 4FC0A 4FUXA 3NW5A 3OUNB 3AGLA 5CF6A 4YZBA 3QALE 2OIDA 1UKHA 3EQDA 4Y8DA 5ETFA 1PKGA 2IVUA 3VONA 4HVIA 4FA2A 4PWNA 4QP6A 2C0IA 3LW0A 4EC8A 3BGPA 4LI5A 4B0GA 3D4QA 3SQQA 5AAFA 1LPUA 5CEPA 3HECA 2C3JA 1LUFA 2XMYA 3LHJA 5A4CA 4WRSA 5HX6A 2X0OA 1PY5A 2YIRA 3AC8A 4IX3A 4HCVA 5AV0A 3U8WA 4L3PA 4LUEA 2B9FA 4JXFA 1UWHA 1UU3A 5EHLA 4A06A 4JQ7A 3SLSA 4U43A 4IVBA 4XH6A 3FMMA 4I21A 3UIUA 3QZGA 5DHJA 5CANA 3AMBA 1GNGA 3KF4A 2XCHA 4FODA 4FTJA 5E1SA 4F63A 4BDDA 3LM5A 5H8GA 3VS5A 5A4TA 4K11A 4DGNA 2HYYA 5JZJA 4ASZA 5EYMA 3A4OX 5L2SA 4EWHA 5K5XA 3F3WA 1OVEA 3W2PA 4L43A 5I9ZA 4D4RA 3LXLA 4MTAA 4G1WA 1OUYA 2YM6A 3QWJA 3Q04A 3ZRLA 2Z60A 4R5SA 4BKZA 4C38A 5HU3A 4MK0A 1FGIA 4D2PA 4I6LA 3N51A 3ULIA 4BICA 4UMTA 4J97A 4C4GA 1FMOE 2G15A 2HW6A 3FZOA 5DT0A 4JMQA 2CGUA 2VU3A 3ZFXA 5BNJA 1J7UA 2YA9A 4PDYA 2ZMDA 3TNWA 5ICPA 5JGDA 4X2GA 1YWVA 4ZS0A 1WBOA 1UV5A 4CG9A 4FT7A 2E9PA 3D2IA 3FKLA 4BDKA 3FZRA 4AA4A 2B54A 3Q4UA 4R7HA 4FYNA 2PUNA 3NUXA 3HV5A 2Y4IB 3PZEA 3JVSA 5CSWA 3DGKA 4W4XA 3F66A 3A60A 3ZEPA 3U6JA 1ZOHA 3I6WA 3QTZA 4QNAA 1FMKA 3UVQA 2X0PA 4C62A 2BIYA 2HENA 3CR0A 2EVAA 3I5NA 4EOOA 2GS6A 2X6EA 2GHMA 2X7OA 2YM8A 4AFEA 4EQMA 1ZOGA 5F20A 5IQHA 4EHZA 3RI1A 4F0FA 3R00A 4IZYA 3IOPA 4MF1A 3KULB 4H05A 5KBQA 4DEIA 2JIUA 5AP5A 3FBVA 5HD7A 4FL2A 3FQEA 3UE4A 2RG6A 4DH8A 2FH9A 4FSWA 2IO6A 4GFOA 1PMNA 3FC2A 4WA9A 2QHNA 4C2WA 3IW4A 4IX5A 3COKA 2BAQA 3ZZWA 4AE9A 1NW1A 1WMKA 4MQ2A 4UEUA 2YM4A 1K2PA 3VW6A 3SHEA 5CX9A 4FNWA 2A2AA 3B8RA 4N70A 3VQUA 1YOJA 5J5SA 3VS1A 4JIKA 3Q9XA 4G6NA 2NNWB 2EWAA 5DLSA 1YOMA 5HU9A 5ANIA 1XBCA 4BCMA 4JAJA 2XB7A 3IW6A 4RC3A 3ZFMA 2FSTX 3DFCB 5HG9A 4QNYA 3BU5A 2W5BA 4BI1A 2GU8A 2VTLA 5CAQA 4PMSA 3R22A 3CP9A 4IZAA 5AP1A 2Z8CA 2OXYA 3O51A 3OROA 3COHA 5CQUA 5DBXA 3UOLA 4PTCA 4YGAA 4BHNA 3KMWA 4RX5A 3W2RA 3UDZA 1BKXA 4RJ5A 3PJ2A 5HESA 3AC2A 4JT3A 3E88A 4X2JA 3RZFA 4TYGA 4L9IA 1JLUE 3RAWA 5CVFA 3LIJA 4V04A 4C59A 4XCUA 3MH3A 3DLZA 5IH4A 3ZHPC 4YMJA 3TUBA 4JBVA 1JKKA 2C30A 3WF9A 3QTSA 1JWHA 4BTKA 3BPRA 2R64A 1CMKE 2BRHA 4KS8A 2ZV2A 1YVJA 4D5KA 4E1ZA 2BZIB 2YN8A 1UWJA 3C0GA 4DEAA 4AWIA 1TKIA 3PPKA 4AGDA 3F61A 5JRQA 4UWBA 4IB1A 4YC8A 5DRBA 2YISA 3DAJA 4EUTA 1OPKA 2A1AB 3UNKA 2C5OA 3GCVA 4RT7A 5LMAA 1W98A 3H0ZA 3WF5A 4FE2A 1HCLA 1JQHA 2PUPA 3EL8A 2UZLA 4J8MA 4S32A 4UMQA 4YJQA 3RNIA 4J7BA 2C5VA 2PWLA 5I9UA 4YTIA 3JY9A 3TZ9A 5J9YA 3V5JA 4DFNA 2UVZA 3GCUA 4YU2A 2XK9A 3S00A 4AW5A 4J95A 2PULA 3BQRA 4QDEA 3BCEA 5DEWA 3DAEA 4HPUE 4U44A 3MFSA 4J52A 5GIPE 3S3IA 3MN3A 3P23A 4FTRA 4FOCA 4BDEA 5JH6A 4G9RA 4ITHA 5IUIA 3W2SA 2W4KA 2VX0A 4IWOA 5HE0A 3V04A 1IG1A 3QCQA 3HRFA 3GQIA 4O1PA 4JRNA 2C6EA 5HORA 4WUNA 5CNOA 1IA8A 3WF7A 4X21A 4BGGA 4O7ZA 3NPCA 2GPHA 4PF4A 3N4VA 3ZDUA 3DOGA 1UU7A 4A4OA 4CFNA 4EUUA 2PZYA 3CS9A 3AT3A 2GCDA 4X3FC 4XUFA 3W8LA 1XH4A 4DAWA 4I3ZA 3R7OA 3TWJA 1YRPA 2OJGA 1R1WA 3TKUA 4C36A 3ORZA 2WTIA 4TKSA 4YNOA 4EOPA 3H9OA 3D83A 4TWCA 2Z2WA 5KNJA 5LWNA 4AZFA 4Y85A 3CTHA 4TYJA 2YZAA 4O1OA 5CU2A 4WG5A 4AG8A 3G15A 3WOWA 5M4IA 2W06A 2V55A 4I5CA 4AGWA 4L45A 3MIYA 1SYKA 4P5QA 1UNHA 5E8SA 5DN3A 3KIOC 2QR7A 3K54A 2J5EA 2WU7A 4JBQA 3HYHA 4H1JA 3ROYA 4E4MA 1WBWA 1SVEA 3D0EA 3FI8A 4IZ5A 2CNQA 5EK7A 4OTWA 2VTSA 4QP3A 5CAVA 5AP6A 3R9NA 5HX8A 4KB8A 2BIKB 3VWAA 3Q53A 1H0VA 2HW7A 3I1AA 4RVMA 4F9CA 4BI0A 3DJ7A 1CTPE 3ZRMA 3C9WA 5E92A 1TQMA 1Q24A 1KSWA 5M4CA 2J5FA 3DA6A 3NS9A 4GH2A 2R4BA 5DR2A 4ACHA 1CM8A 3ZXTA 1LP4A 2O5KA 1YQJA 1FBNA 4QQTA 3FSFA 4KS7A 4MNFA 3IG7A 2F7EE 5E8YA 4ZSGA 1Q5KA 3FE3A 3D15A 2PL0A 3ZUVA 3F69A 4FVQA 5HKMA 4E3CA 3G0EA 4RLKA 4CFXA 5T6KA 4GUBA 3NNVA 4YUQA 3VIDA 5F4NA 1G8KA 3LXKA 4LRJA 3UZRA 4XNEA 2R2PA 2UZOA 3GGFA 5AWMA 4QQJA 3SA0A 4RSSA 4GT4A 1OPLA 2B1PA 2OIBA 2W17A 3G51A 3QHRA 4QP1A 3HAMA 3RK9A 4CT1A 4TTHB 3CGFA 4FGBA 1H24A 2VO0A 3UIBA 3W10A 1YOLA 4L68A 3DBFA 3DJ6A 4IHPA 2ITQA 3UPZA 3E5AA 3QBNA 5JGAA 3PIZA 2WO6A 4DLJA 4BDGA 2VTOA 4ANBA 2WMQA 2WQEA 4FMQA 2JKMA 3WE4A 5AV4A 2W1FA 5D10A 3FYKX 5LVOA 2OSCA 4RVKA 4RQVA 2C47A 2VZ6A 2WU6A 4IFCA 5FM2A 1OKZA 4I92A 4AXFA 5CAUA 3ALNA 2P0CA 3F5UA 1JVPP 3FSKA 4BCNA 3F6XA 3R7VA 5KMNA 2VGOA 5AM7A 3TNQB 4AA0A 4IAKA 2NRUA 2HXQA 3R7GA 3EQBA 4MXYA 1U4DA 3OTVA 2J7TA 5JRSA 3ORMA 3V6SA 4CKJA 3V01A 1PXOA 4XP3A 3BE2A 4FTIA 2YDJA 4NFNA 4RX9A 4A9YA 3MA3A 2OH0E 3BLHA 4ZTHA 4MHAA 5L3AA 4XV1A 4FKRA 4FZAB 3NCGA 4I6BA 4EL9A 3DXQA 3QTIA 4IX6A 4EC9A 2XK3A 2YIQA 2WMWA 2WQOA 4FV6A 3UODA 3SG9A 3CQEA 4TWPA 4TNBA 2F7ZE 3KVWA 4A9RA 3P0MA 3VC4A 3KXNA 1YXXA 4D4VA 4OGRA 4ASEA 4W8EA 3AMAA 4G6LA 4PY1A 5AADA 4D0WA 1AQ1A 1CKJA 4E4LA 2HOGA 2YDKA 3B2TA 3C4CA 1T46A 3RHXA 1H4LA 3DXNA 1OB3A 4UMUA 3W0OA 1DS5A 4FTMA 1OKYA 3L1SA 4QP4A 3W2OA 4RG0A 4A9UA 3ZO2A 4EOSA 2XKDA 2OJFE 4IJ9A 2JKOA 2O8YA 2PVHA 3P78A 2Q0NA 3BQCA 3QX4A 3NAYA 2R9SA 3SVVA 3PRIA 1CDKA 5EDRA 3HL7A 1SMHA 2GTNA 3FMJA 3CCNA 4FVRA 4PTGA 4RX7A 2Y6OA 5HVJA 4AT3A 4E6QA 2WMBA 4IADA 4IDTA 1GOLA 3VS7A 3ANQA 3DBDA 3HNGA 2YFXA 4I0SA 3NNUA 5JFXA 2W1IA 2UVXA 4QMUA 4ZTSA 5AX3A 3R1SA 4NSTA 4ANLA 4QD6A 4DFBA 2WMSA 5FEEA 3PVBA 5IQDA 3O8UA 3PXRA 3VS3A 3E87A 4O96A 4DG3E 2C6LA 1J91A 2C4GA 4Y73A 4FV2A 3H0YA 3IONA 4FKTA 4CZYB 4E8AA 3D5XA 3LFSA 5HNIX 2PU8A 3EIDA 4B8LA 1REJA 2C6KA 4K18A 2I0EA 3OC1A 2XK8A 4HGTA 4O0VA 4CNHA 2P2IA 2SRCA 5A54A 2WEVA 5BYZA 4ITIA 4N6ZA 2F9GA 4GK2A 4RWIA 4XBUA 5E8UA 3AC1A 4R78A 3ETAA 1YXUA 2ZVAA 4DITA 3RAIA 3S1HA 1Q8YA 2ITNA 3E93A 1V1KA 3FPQA 1KWPA 1IAHA 2BUJA 3BHUA 4MWIA 2UW4A 2VWXA 2WGJA 2V0DA 2HCKA 3IOKA 2QKRA 1A9UA 2C0TA 4Q5HA 5HVKA 4XG4A 2PTKA 4E73A 5M56A 3SX9A 2J0JA 1GZKA 4CMOA 5KMLA 1O6KA 1XH6A 4IAAA 4ACMA 3UDBA 5C8NA 1OI9A 3EYHA 3FI2A 3U4WA 4APPA 2XAOA 2F4JA 3MFRA 4WG4A 5AR5A 5DRDA 4C3FA 4I4FA 1WCCA 2EXEA 3EN5A 1ZARA 3NUYA 5FDXA 4ZJIA 4OTQA 1ZRZA 1Q3WA 4IAYA 3UQFA 3DKGA 4E7WA 4OBQA 4EH7A 3Q2JA 3LE6A 4FIHA 3DK6A 2E9OA 4PL4A 4TNDA 3GENA 4YJVA 4FKVA 2E9NA 3HA6A 3FYJX 4FV9A 5HCZA 3PA4A 2BFYA 3NRMA 4DGOA 3O96A 2F2UA 3PY3A 3H9RA 5BV3A 4JNWA 3QFVA 2QHMA 4EEVA 4F0IA 5A4QA 3D14A 4EKKA 4NW5A 4PUZA 4FRFA 5AUZA 4MX9A 3R8ZA 2B52A 3RALA 4NIFA 5L8KA 4DBNA 4O7RA 5A6NA 1KE6A 4RZWA 3IDPA 4BTJA 4MQ1A 3HKOA 3A7IA 3RPRA 3R9OA 3TACA 3K3JA 3SRVA 4DHZA 2PUUA 4BIBA 2CHLA 3NYOA 3DTWA 4Z7HA 2VTPA 4ALUA 1TFFA 1H00A 3BGZA 2CN8A 5CTPA 4K0YA 4FKGA 3OWLA 3QKKA 3F3UA 4CTBA 1BYGA 2R3HA 3WILA 3HEGA 4R7BA 4IANA 3U51A 4D2SA 5JN2A 5GINE 4L7FA 1PXKA 1VLRA 1OZ1A 5CI6A 2YCSA 3OXIA 1H0WA 5FRIA 4AFJA 4PP7A 5CF5A 5KZIA 3G9LX 4G5PA 3BHVA 3PA5A 5ACBC 2W9FB 2GNFA 4C37A 4YO4A 3KXZA 4Y83A 5BVFA 5KBRA 3CQUA 2QURA 1UNGA 2ERKA 4FZFB 3LLTA 5AA9A 3EHAA 3MFTA 3QQLA 2VO3A 3KN5A 1Q8TA 4DEEA 2W1CA 4ZSAA 5M4FA 4F9WA 2RFDA 4AA5A 3Q32A 3GUBA 1M2RA 3CTJA 4Y5HA 3FL4A 4O6EA 4CYJA 4RMZA 5IDNA 5GNKA 5AAEA 2J2IB 3QRTA 4JQ8A 3KK8A 3NYNA 2X9FA 4XP0A 4AOJA 1TZDA 1FGKA 2VTRA 3C4EA 5HG7A 5HI2A 5EQYA 3D9VA 4X2FA 5M57A 4WBOA 1A06A 4N0SA 3Q4TA 4KSPA 3C5IA 2XNEA 2IW8A 4BCPA 4J98A 2ERZE 4HZRA 4XYFA 4LMNA 4QPSA 2JITA 3FMDA 3TJCA 4CFMA 4M97A 5BQ0A 1UU8A 4U79A 2XJ2A 4DCEA 3I5ZA 3UOHA 1SNUA 4I93A 5J1VA 4YHTA 1V0OA 3AGMA 3L9PA 4FT9A 5AR4A 3KA0A 3HV3A 4QMOA 4RIWB 3KKVA 1J7LA 2IWIA 5E8WA 2AC5A 2Z7LA 5BPYA 1YDRE 1JOWB 2C6IA 3IECA 2WTJA 2QD9A 4QYEA 5HZNA 4LV7A 4F0GA 3BE9A 5KUPA 4ONAA 3LFBA 5GHVA 3UVRA 2ITTA 4GS6A 1LEWA 4PDSA 3LOKA 5DIAA 2C5NA 3BI6A 2UZWE 5T3QA 4FV7A 4DC2A 2OFVA 2PY3A 1DI8A 1ZAOA 4YJUA 5AEPA 5KO1A 3BV3A 3W18A 2G01A 4ZIMA 4DEHA 2WKMA 2YERA 1SVHA 3DY7A 3FLNC 4WUAA 4C35A 5IH6A 3PUPA 4O91A 3CBLA 4IW0A 4YJRA 1ZY4A 3LQ5A 2BKZA 5IEYA 5M51A 1YI4A 4BL1A 4IC8A 1PKDA 1BL7A 3P5KA 2Q83A 3PSDA 3VQHA 3PE2A 2KULA 4NFMA 4LDTA 4FZ6A 4KRDA 4K8AA 1M14A 3EQRA 3P7BA 1I44A 5ANDA 4AOTA 4RFYA 3I0QA 1BUHA 2J6MA 3L9MA 3GC0A 4NT4A 4GYIA 5I3OA 2F2CB 3VUKA 4BIEA 4KBCA 5F95A 3H30A 4AW2A 5IQFA 2GNGA 2E2BA 4L46A 5CF4A 2HXLA 3AG9A 4DDIA 4QDVA 1VJYA 5A4LA 5CASA 2Y6MA 4YPSA 4ARKA 4AZWA 3U9CA 3V8WA 4HNIA 2OF4A 2W1ZA 4RGJA 5CLPA 3BU3A 1KOBA 1W2FA 1YHVA 4FSQA 4FYOA 4NIFB 4ANMA 4AXCA 2ETMA 4O7TA 3NCZA 2C3LA 5HOAA 3QD3A 4L7SA 3BBTB 3PSBA 1PMUA 2PVLA 4G16A 4RX8A 5ANJA 1BI8A 2FSOX 3EN4A 3SRVB 2QG7A 3O23A 3FWQA 3KRRA 1RW8A 4L00A 2WMUA 4ZLZA 1KV1A 5IEXA 5AUVA 2JGZA 3TG1A 4AUAA 4E26A 4JS8A 2OJJA 3R7YA 2XKCA 4YLLA 3VAPA 3FLZA 4KD1A 3LM0A 4XG7A 3TNPC 3R21A 4EH8A 1WAKA 4YLKA 1K9AA 5IUGA 2RSVA 3CE3A 4OW8A 2X81A 4EH3A 2VTTA 4UWYA 3ITZA 3FMLA 3QCYA 5L2TA 2JDOA 4QP9A 5JT2A 3BZ3A 3PLAE 1XBAA 2A27A 3ZH8A 5B2MA 5C03A 3UDSA 3ZO1A 1GZNA 2X8DA 3QHWA 3R8PA 5DT3A 1M2PA 3ZYAA 1SNXA 2R5TA 4FEXA 3UPXA 3VVHA 1IA9A 5DOSA 1OKWA 3T3VA 3BL7A 5C26A 2VWUA 4DTBA 3MWUA 2CLQA 3WZUA 3GOKA 4BI2A 2QU5A 2CCIA 3ZC5A 4QEBA 2JAMA 2QONA 4ZY4A 4ZZMA 1ST4A 2UZTA 3GNIB 2JD5A 3UBDA 3AXWA 4EH2A 2JEDA 2R3LA 1XJDA 2C0OA 3FMEA 3POZA 3PWYA 2JAVA 1UA2A 5CY3A 3UGCA 3LVPA 3PUFC 3W0NA 1GAGA 5CU6A 4TL0A 3JVRA 3F7ZA 3GP0A 3KXXA 1WBVA 3F2NA 4S33A 4XJ0A 2I0VA 5JKGA 3GU6A 2GNLA 5LOHA 4HOKA 1QPEA 4UV0A 3FZPA 2UW5A 1GIIA 5CZHA 2XS0A 4ZTQA 1NVRA 2BRNA 2ZV7A 3REPA 5J5TA 2GQRA 3TM0A 3Q6UA 3NUUA 4H3PA 2OU7A 5C8MA 4LUDA 5HGIA 3UOKA 5BVDA 3I7BA 4FTCA 5IEVA 3W55A 4L44A 3MIAA 3MVLA 3MH0A 3TZ8A 4BDFA 4EKLA 2PVFA 2R7BA 2X4FA 4UN0C 3CGOA 1JKLA 3JYAA 4IB3A 3W16A 4A9SA 4F08A 3RKBA 4EK4A 4E6CA 2GNJA 2UW3A 5I9WA 4C33A 3M1SA 4R7IA 5BYLA 2Z7RA 4FBXA 5EFQA 2Z7SA 3DCVA 4AXEA 2AEGA 3GOPA 2JKKA 2V5QA 3O7LB 4H3BA 3RVGA 1R3CA 2WTKB 5JFVA 4F6WA 3FEGA 4O2PA 4UYNA 4YSMA 3G2FA 3GU5A 4XRJA 4I22A 4FTTA