1U4DA

Structure of the ack1 kinase domain bound to debromohymenialdisine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
258
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQDHYVMVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
publication title Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the Cdc42-associated Tyrosine Kinase ACK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 258
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u4dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u4dA01
2XRUA 3PXRA 4JT3A 2CCHA 2JAVA 2WELA 4J8NA 5HLNA 4IVCA 2ZVAA 3R7GA 4S33A 4HGLA 5HD4A 4PNIA 3U6HA 2OH4A 3LCKA 3ROCA 2VGOA 2H6DA 1QCFA 4XBRA 3CC6A 5IQHA 1PF8A 2W9ZB 4MXYA 3LQ5A 4A4OA 4BDCA 4RIYA 4RIYB 3VUHA 3Q60A 2C1AA 1DS5A 1YDSE 1J3HA 3QTWA 5CEQA 2W96B 1EH4A 3CTHA 5CT0A 4RVKA 3PXQA 4IANA 4U3ZA 4Q9ZA 3UNKA 4A9UA 4Y5QA 3PPKA 4IACA 5BUJA 2QQ7A 4QMNA 5TO8A 3TG1A 5L2TA 5IEXA 4DINA 3IONA 1IA8A 2E9VA 2ITQA 2E2BA 3E92A 4XUFA 2C47A 4ZTQA 4C36A 4UMRA 1CM8A 3Q4UA 3SGCA 2VWYA 4XG9A 4FG9A 2J50A 4W4WA 2QOIA 4E93A 1L8TA 1CKJA 4YTFA 2UVZA 5J79A 1OL5A 3FC1X 3PP0A 4GIIA 4D1XA 4ENXA 3PDTA 3MY5A 4DT9A 1U54A 2GS2A 3ZDUA 3A62A 1R0EA 4DEHA 4UX9A 1U59A 4OBOA 4IB3A 4N6ZA 3PG1A 1B39A 4IZAA 2PVFA 4XH6A 3LAUA 4YJQA 4USFA 3OCSA 5CSHA 1M52A 4BR3A 1O9UA 3QRUA 4TKSA 3ZSIA 3NAXA 4O7NA 2Z7SA 3KY2A 3MPAA 3RWPA 3SLSA 5L6OA 2BDJA 3LZBA 4JRNA 4I5MA 2UZLA 4FR4A 5HGIA 1KUTA 4IVDA 1W0XC 2YWPA 3AOXA 2C6OA 2O5KA 3P0MA 1ZMVA 3NW6A 1JOWB 4AOIA 4TPTA 4MXAA 5AA9A 4RA4A 3P79A 1XO2B 5JRSA 2Z7QA 3TV7A 3DBEA 2XMYA 3BLHA 4ZTRA 2P2HA 5CU3A 3R8PA 1BYGA 2YJRA 3PSDA 3P7AA 4K1BA 5HKMA 3T9TA 3QA8A 5ACBC 2C3JA 3MB7A 3AC4A 4ALVA 2WQMA 3QRKA 5FEQA 2NO3A 4HYIA 5HVJA 2JIUA 5ANDA 1W84A 1H00A 2WTVA 4FV2A 3BGZA 3TZMA 4ZK5A 3ZSHA 2X2MA 3R1SA 4HYSA 2J0IA 2UW8A 2OIBA 2XB7A 3MPMA 3R0TA 4JAJA 1NVQA 2WAJA 4IAZA 5BVDA 5BNJA 5L4QA 2PPQA 4FZ7A 2WIHA 1SZMA 2QCSA 2HAKA 3NW7A 5CAQA 4CD0A 3FZRA 2OFUA 3IW8A 4QQ5A 5EDRA 3N4TA 4R3RA 3VS5A 2XKDA 4BL1A 4FKQA 3SOCA 3HMNA 3ZM9A 4Y95A 4EOPA 1U5RA 3DNEA 1RJBA 3OS3A 4BI0A 5CEKA 5IQIA 4I41A 3COMA 3IOPA 3R30A 4KABA 1QPCA 3GP0A 1U5QA 4GG5A 4DF3A 4WA9A 3F5UA 1RDQE 3QLFA 4RA5A 4BDGA 2QG7A 3NYVA 3UVQA 2WEIA 4MBJA 3EQFA 5EKNA 4JIKA 3VBQA 5EHLA 3MIYA 4QMMA 5BQ0A 3DBQA 4GSBA 4WOVA 5ETFA 1ZOGA 2YA9A 1ZY4A 4YO6A 4F1OA 3M11A 2R9SA 1OL1A 1H24A 3D83A 4G3DA 3WZKA 1REKA 5IUGA 1G8SA 3RGFA 3T9IA 2P3GX 3K3IA 2W5BA 1W82A 3R73A 2HXLA 3R01A 3QCXA 4IJ9A 4L00A 4XV3A 3R2YA 4KRDA 4C59A 4EUTA 5M51A 4FV5A 5DT4A 3VBWA 3WIGA 4F7JA 4YZMA 3PA4A 3ANRA 5BMMA 3KKVA 3VUKA 1KSWA 4H58A 4JAIA 2W4KA 4U80A 3RPSA 4M14A 3V5PA 4Z55A 5E8YA 4L68A 5JFXA 4DITA 5D1JA 2RF9A 3G6GA 5CALA 2UVYA 2ZV7A 1ZYCA 4DYMA 2YIXA 3BU3A 4FTAA 3EMGA 3PPZA 4P4CA 4C3FA 4FTNA 5IQGA 2JAMA 2WMXA 4C4EA 4M67A 4QP1A 5CVHA 4TTHB 3GU4A 3N9XA 2QURA 1HCKA 3QRTA 3IS5A 4IAYA 3RAHA 4B8MA 5B7VA 2OSCA 2B9JA 3F9NA 3DK7A 3JVSA 2FA2A 4ZSJA 3TKIA 4F64A 4ACMA 5JEBA 4J97A 2QOQA 4FTTA 4IHPA 1STCE 4UN0C 4MCVA 2BVAA 2WTJA 5DA3A 3AC2A 3TTIA 1M7NA 5DVRA 3Q53A 3ZRMA 3I0QA 3FYKX 3IGOA 4IM0A 4LRMA 2QO2A 3NGAA 4RC3A 4IC7A 5HG7A 3MVLA 4IDVA 3ORTA 3MSSA 1LUFA 2CGUA 3VULA 3R7OA 5M06A 3D94A 3F7ZA 4L8MA 4PDYA 5ANOA 1G3NA 1GZNA 4NJDA 3HMMA 4V04A 4O38A 5D7VA 3S1HA 5HIEA 3JR1A 3GEQA 2FSOX 1ZMWA 2B52A 3UYSA 3CSVA 1WBNA 2YLFA 4RPVA 5DOSA 2IN6A 3I7CA 5DEYA 3IDBA 3NW5A 5AV3A 5J1VA 3HP5A 1JVPP 3OWPA 3RZBA 3NNUA 2CCIA 2XK9A 3VAPA 1URCA 4DFLA 4FKUA 4GJ2A 3FPQA 3TZ8A 2YCRA 4MHAA 3RCJA 4D4RA 3VS6A 3VF9A 2QOFA 2JITA 4W9WA 2F49A 4GVAA 1Z57A 3PFQA 3TNHA 4E4LA 4YR8A 5HQ0A 3VW8A 3JY0A 5CTPA 3OCGA 2IW9A 4FEWA 2VUWA 3ORXA 3OHTA 3MB6A 3EQPA 3SXSA 4FV8A 1Q24A 3QGYA 1GIJA 4NU1A 2OJGA 2Q0NA 5H3QA 3ZYAA 4L3LA 3C5UA 4Y5HA 2JFLA 2B9HA 3LIJA 2RFNA 4N57A 4DBXA 3QC4A 1XKKA 4XHKB 5HNGA 2I40A 2E9PA 4IX4A 3RTPA 1L3RE 4CG9A 5G1XA 4JBPA 4HZSA 1S9JA 3MA6A 5L2SA 3EHAA 2XYNA 4FIEA 5M09A 4G17A 3GUBA 4CKRA 4NW5A 4GW8A 1WBVA 3PWYA 4TYHA 2UZTA 3U6JA 3QBNA 2XKFA 4MNEA 5LARA 2OXYA 3WZDA 3TTJA 4E6CA 3Q04A 4ZJVA 3QA0A 5HBJA 4YGAA 3Q2MA 4M13A 4AN2A 2EB2A 2IZRA 3AC8A 4I94A 4LM5A 3CQEA 3VN9A 3BE2A 5AUTA 3WI6A 4BDDA 4FTQA 4RT7A 4YURA 3PVWA 3KMMA 3L9PA 1RQQA 5EYDA 5DR2A 5ANIA 4AZVA 3TXOA 2JGZA 4BZNA 2PE0A 3COKA 2OWBA 2X7FA 3QTZA 4E4NA 3F7WA 2GMXA 3O23A 5A3XA 5AP1A 1U4DA 4FSYA 5AX3A 4RMZA 4LG4A 4QOXA 5FTOA 1H1RA 3ZO4A 2WMUA 4RVLA 3RBWA 5J9ZA 3QQJA 3ZZEA 4RZWA 4XX9A 3H9FA 4FUXA 3TNPC 1Q62A 3VUMA 5EW3A 3SVVA 2PYWA 2XK6A 2DUVA 5EI6A 3CCNA 4Q9SA 3T8OA 5J5SA 3OTUA 5FM3A 3ATTA 2RKUA 3GENA 4E4MA 5JSMA 2UW3A 1YXVA 4K33A 3QAME 5DN3A 4H3BA 5I9WA 2HXQA 5EG3A 4BDAA 4F09A 3EJ1A 5BVKA 4H1JA 2G1TA 4M8TA 4B7TA 5EDPA 3WBLA 3CY2A 5DPVA 1DM2A 3E93A 1YOJA 4N0SA 4C2WA 2Z7RA 4C61A 3LXKA 5ICPA 4CV8A 2IVTA 3DK6A 3LFEA 4KKEA 3EQBA 4QP2A 5BVEA 3UC4A 1TQPA 2YWVA 2PK9A 4O21A 4MYGA 3RM7A 3GFEA 5KUPA 1OKWA 1CTPE 3GT8A 2OGVA 1PXJA 4KNBA 1IR3A 3FI4A 3GB2A 4NKAA 1LPUA 3QX2A 3FI3A 2PZYA 2UW4A 3BU6A 4RJ6A 4NFNA 5J9LA 3G15A 2ETRA 2E9NA 2QLQA 3LM0A 1V0BA 5L2WA 3SRVA 4EOIA 1T46A 3UGCA 2VN9A 2Y4IC 2UW5A 2PVYA 3ODZX 2J0LA 4HGSA 3TACA 3SG8A 2YHVA 5AM6A 4ZEGA 5AV0A 2XNNA 4ITIA 5DLSA 1YHWA 3EYGA 3AMAA 5H9BA 4Z3VA 2KTYA 4Q5HA 3N51A 1FINA 2WMVA 4X7QA 4QTDA 3N4UA 4AN9A 5DR6A 3WF9A 2G15A 1GZ8A 3OTVA 1ZOEA 2VTSA 3DK3A 2Z7LA 3F6XA 3HRBA 5EQPA 4NL0A 4FKJA 2R3IA 2XJ2A 3F5XA 3PTGA 4IWDA 5EW9A 3T3VA 4FIJA 4OAVB 1YXTA 4PTGA 2R3HA 3BWJA 3QTQA 3VQUA 3ULZA 4A06A 1PRYA 4O0YA 3C13A 4ANSA 1V0PA 2UUEA 2YM5A 4WSQA 2ITNA 3PJCA 5EKOA 3EKKA 3LFSA 1XBAA 3BYMA 2G2IA 2IZSA 4AZSA 4QMOA 4GVJA 1UKHA 1UNHA 3F88A 4QP3A 3D7ZA 3PPJA 4BBFA 4C57A 5IA1A 2JDSA 3GNIB 3MH1A 3TUDA 1M17A 5L6PA 3GCVA 3TNIA 2ETKA 4GFMA 2VTRA 4RWKA 4E73A 3QC9A 3S00A 3DU8A 4EWHA 5AP7A 1FVVA 3Q9XA 3H9RA 4KS7A 1LR4A 2QLUA 3R1NA 4BTFA 4ZLYA 3HAVA 4HVGA 2X1NA 4GYGA 5HESA 4H1MA 2CLXA 1IASA 4RJ3A 3W2RA 1JKKA 1JBPE 2W1HA 2XUUA 4E6AA 2OJFE 4E7WA 4ALUA 3B8RA 2BZJA 5K5XA 4EKKA 4DH7A 2BILB 3LMGA 3K2LA 3Q3BA 3PYYA 4NEUA 4AT3A 3PP1A 4FSNA 5K0KA 3PVUA 5D9HA 1T45A 3FBVA 5CU0A 3NNXA 5E7RA 4B4LA 3Q52A 1GNGA 4JRVA 4PMPA 2QONA 4BZDA 2C0TA 2YM4A 4A4LA 4CT1A 3H4JA 3GI3A 4R3PA 4FNZA 4JXFA 1GJOA 4QP4A 4S32A 5EI2A 1J7IA 1FGKA 2Y4PA 3FC2A 4DFUA 3ZXTA 3FWQA 4C58A 4MWIA 3DGKA 3P78A 2YM8A 4BYIA 2OF2A 3HUBA 3TM0A 3MI9A 4PL4A 2CKQA 3UP2A 5FP5A 4JI9A 4PY1A 2JIIA 2A2AA 3RPVA 4O0WA 5CZIA 2QOLA 3OXIA 2I0EA 4DEBA 5LCKA 2ONLC 2C5XA 3P23A 5TOZA 1V1KA 3BV3A 4HVIA 3MPTA 4JG8A 4PWNA 4FNWA 2ITOA 2ZV2A 3R63A 1E1XA 4WBBB 3FZ1A 2G9XA 3IPHA 3UOHA 4NM5A 5A4LA 3DBDA 5J7BA 4CYJA 2C3IB 4QQJA 5TT7A 5LVOA 2JC6A 4XP2A 5TR6A 5LCJA 1BLXA 2GHGA 4FIIA 3WF5A 5TKDA 5FBOA 3ZOSA 4BYJA 2CKOA 4D5KA 2B9FA 3EIDA 4IMYA 2VV9A 2R3NA 4C33A 4DC2A 2OW3A 4FSQA 2J0KA 2XEYA 3PJ3A 4FIFA 4CXAA 4CKJA 4D0WA 5IDPA 4IZYA 3H0YA 3W33A 1M7QA 1BL6A 2QOCA 2A1AB 3NVMB 2B0QA 5DNRA 2W5AA 3HMOA 4YJNA 5FM2A 5BYZA 4FKPA 5E4HA 4FTRA 4AP7A 3VW6A 4UBAA 3FSFA 4OTPA 3WILA 3FUPA 4S2ZA 3CP9A 4NH1A 4Z7GA 3TUCA 3MFTA 2ERZE 4BI2A 1JWHA 2Y0AA 2ITPA 4AACA 5KCVA 1GAGA 5ACKA 2PZ5A 4FSWA 3GCUA 2J51A 3PXYA 1Q99A 2BUJA 2R0UA 3O71A 4RFZA 3Q6WA 3ZEWA 3QQHA 4QRCA 2XP2A 2VTMA 3PUPA 5CF5A 3Q9WA 5DEWA 4IC8A 4JL9A 4R8QA 3MY0A 1Y91A 2BHHA 3LFCA 4P5QA 4G3EA 1Q8TA 4M66A 2ZYBA 3IDCA 5FEDA 4OT6A 4DG3E 3NZ0A 4P5ZA 5IUHA 3D5XA 5A14A 4BRXA 4B0GA 2YZLA 3ITZA 4GK2A 3A2CA 3FI8A 4XV1A 2OZOA 4BDEA 1BI7A 2IZUA 4RJ8A 5AIKA 4DH1A 3OUNB 1LEZA 2EWAA 2RG5A 3LKMA 4GJ3A 4QQTA 4MD7E 4EEVA 3FEGA 5JFWA 3A7HA 2WU7A 3CD3A 3FY0A 3MIAA 3HX4A 4I6HA 3WE8A 2VWBA 3PZEA 3RKBA 3ZLSA 5LMKA 5M08A 4WSYA 2OO8X 3UQGA 3VS4A 4FEUA 4RJ4A 2JDTA 2WGJA 4GU9A 4FZ6A 3QX4A 2IPXA 4DE4A 4CMUA 1PXPA 3FJQE 2XKEA 3O7LB 4IB1A 3CLYA 3FZOA 3MBLA 2XIKA 3DKOA 4KA3A 4FUYA 4O6LA 5DIAA 2QOBA 4FVRA 4IAKA 4GT5A 4I0SA 1LEWA 4LUEA 4NKSA 3RJCA 4B8LA 4F9AA 5BVNA 1R0PA 4WRSA 4BIBA 5A9UA 5IH4A 4M12A 1B6CB 3A4PA 4D1ZA 3MVHA 4CRLA 3EQDA 1J1BA 3UVRA 3KULB 5HZNA 3NUUA 4H36A 4YHFA 3F82A 3EN5A 5AX9A 3V5WA 2VU3A 5AUXA 3MESA 4YNEA 4IWPA 3PY1A 5FEEA 5IISA 5CQUA 4OGRA 3IW6A 3R1QA 4IM2A 3QD0A 2C6IA 3E87A 3RVGA 4LGGA 3BX5A 3V5JA 5AWMA 5EHOA 3OC1A 3L8VA 4FL1A 5DT0A 2BDWA 2EXEA 3A61A 3DXNA 3L8SA 2XF0A 1IA9A 4AGWA 4NFMA 5IQAA 3O2MA 2WO6A 3DPKA 3ZTXA 3BHTA 1I44A 2CJMA 2SRCA 3MH3A 3DB6A 4U79A 3NUNA 4IX5A 4I92A 4ANLA 4DCAA 3FLZA 2H9VA 3ERKA 4PV0A 4XYFA 4EC9A 3O51A 3BBTB 2BFYA 4RG0A 4XV2A 3C4ZA 4EL9A 4WKQA 5HVYA 1Q8UA 3F3VA 3Q4ZA 4DGLC 4APPA 4B99A 2C3LA 3KQ7A 3PRFA 3NAYA 3OVVA 4BKZA 2HOGA 5JN2A 5DE2A 4KIOA 4O82A 3QUPA 2XK7A 4CFFA 4KUJA 1VR2A 2VWUA 3E63A 3RNIA 1BL7A 1YI3A 3BGQA 4UB7A 4F0GA 2FYSA 2HK5A 3O50A 3SKCA 1ERKA 5CU6A 3MH2A 3AGLA 4FG7A 4YC3A 5ANJA 2OIQA 3KXMA 1J7UA 1PYEA 4BCOA 4HJOA 3VHEA 1DAYA 4NTSA 3U4WA 4OAUC 3A7JA 5FRIA 4ACCA 3O96A 5C26A 3AGMA 1QPJA 4OW8A 2VRXA 4AUAA 5EQYA 5AUWA 4DGGA 2PWLA 3HV4A 4EJ7A 3FDNA 2R3OA 4J53A 4CG8A 3S0OA 3UDBA 2NRUA 5H8GA 2OZAA 2OZAB 2OBJA 3GU5A 3KA0A 2R7IA 3LVPA 4BGQA 3P1AA 3KXGA 3DKCA 4UMPA 5HU3A 2YIYA 1UKIA 2HY0A 3NUXA 3QF9A 5I3OA 2WMBA 3TWJA 3MVJA 4S31A 4MVFA 2GHMA 4Z9LA 3WYYA 3V5TA 5LVMA 3UBDA 4DLJA 3E8CA 4RX5A 3VS7A 2P0CA 5JRQA 3ZCLA 5IA2A 5JK3A 4MNFA 3E62A 3R28A 4QD6A 3S3IA 1XH8A 3SW7A 5D11A 3DZOA 3RPOA 4JG7A 2GCDA 5CEPA 4FKGA 1SMHA 3JXWA 3MW1A 4XS2A 5HD7A 3TJCA 3VWAA 5IEYA 1ND4A 3ID6C 4DA5A 3FMKA 3F2RA 2RL5A 2HIWA 5C8MA 3D0EA 4PMMA 3TZ7A 5F95A 1UWHA 3R8MA 4DN5A 4YC8A 2O0UA 3EH9A 4CTBA 2GPHA 3FZSA 5KNJA 3FYJX 2BZKB 2J0MB 4APCA 2GQRA 4M0ZA 1IRKA 5IDNA 3N4VA 4CMOA 3DAJA 4MQ1A 2CNQA 4BTJA 1Q8ZA 2FSMX 2QOHA 3PWDA 4FX3A 4YJOA 3KRRA 3I5NA 4LMNA 1H1QA 5CLPA 4BCFA 2RGPA 2Y9QA 4FI1A 4MTAA 3DLZA 5DMZA 4RZVA 3R83A 3UPXA 4YTIA 4BDFA 4UMTA 3ORNA 2HENA 4BCIA 4F9CA 4KIQA 4L53A 4RQVA 4TYGA 4IW0A 3VO3A 2Q83A 1KE5A 2FB8A 3VBVA 3UYTA 3SG9A 2R3KA 4PP9A 3MYGA 4Y85A 5HOAA 3ANQA 5B0XA 3PE1A 4X3FA 4X3FB 2VTLA 3LFQA 5EFQA 3OEZA 3Q4TA 4FF8A 3VF8A 4C37A 5IQFA 4MBLA 4XEYA 1OB3A 3I6WA 1IAHA 1JSVA 5HEZA 4PDSA 4TRLA 3KC3A 5CANA 4O86A 4F63A 1OVEA 2AC5A 3VUIA 2G01A 1Q4LA 4KIPA 4JJRA 5TE0A 3RK9A 4D1SA 4I3ZA 5IA0A 1ZYSA 3CY3A 3R8UA 4CFVA 4F70A 4A7CA 1KV1A 4C3RA 2R7BA 3PY3A 4YJUA 5EM6A 1U54B 2KULA 2YM3A 4CTCA 4EH5A 5C03A 2A0CX 3HDMA 1A06A 1OKVA 4M68A 2QD9A 2CN5A 3F3WA 2PVKA 4H3PA 2WTCA 3KCFA 4I4FA 1NVRA 3I5ZA 2UVXA 2VTAA 3K54A 5F9EA 1ZWSA 1CSNA 2HZ4A 2O3PA 1CMKE 1I09A 4TYEA 2UZDA 2PSQA 5LVLA 3EN6A 1BX6A 3D7TA 4BWKA 2YEXA 4OT5A 3QTIA 3Q96A 5EOLA 4ZTLA 3VBXA 2W5HA 3C4WA 4YLLA 3VBYA 4EZ3A 3HAMA 5HORA 5HCXA 3BLQA 4N6YA 4UZDA 5IG1A 1YW2A 4J99A 5D41A 3KRLA 3KRXA 4CGAA 2OFVA 4ANQA 2YN8A 4FZAB 3W2PA 4I5HA 1H1SA 4EWQA 2H34A 4BICA 3TJDA 4QNAA 2GQSA 3IQ7A 3TIYA 5CSPA 5DR9A 3VBTA 1ZMUA 1WMKA 2FH9A 4JQ7A 1Q97A 3CGFA 2DWBA 4WG5A 3BI6A 3CPBA 1VYWA 4EHZA 2ITUA 1YXXA 2DS1A 4G5JA 4A07A 5LMAA 3HRFA 3R8ZA 3ZRKA 3GGFA 2QO9A 2YLEA 2IW8A 2ZMCA 4YP8A 2WFYA 2DQ7X 3P5KA 3QTXA 4AA0A 2C6LA 3SD0A 4CZTA 2IVSA 2YACA 4ARKA 3UIMA 3F5PA 2PUNA 4YBJA 1MP8A 1ZXEA 3LJ2A 3MJ1A 1QPEA 5JH6A 3ZRLA 5ANKA 1XBBA 4D28A 4DH5A 5CSWA 4ZLOA 4MX9A 3LHJA 4PMSA 4RFYA 1PY5A 2V62A 4EOOA 2C0IA 3QYZA 4FKOA 2P55A 4CFWA 5AR3A 3C0GA 1IG1A 2BAJA 3GOPA 3HV5A 4OTWA 5HG8A 3TIZA 5HO6A 3WOWA 2X6EA 1P4OA 4O1PA 4AA4A 4EOQA 4Q2AA 4PP7A 3LFFA 3ZUUA 2JD5A 5CAOA 5EM8A 5BYLA 3MN3A 2QI8A 3PA5A 2CMWA 2PMOX 1ZAOA 2R3PA 4HGTA 3CTQA 3LCTA 3CQUA 3U4UA 3EN4A 3H0ZA 3KB7A 3A7GA 2YITA 4CMTA 4QP8A 5HTIA 5ITAA 4AGDA 3E7VA 3E7OA 2XS0A 1E1VA 1UNLA 2X39A 5JMSA 2PTKA 3MTFA 3GVUA 5EHYA 5BYYA 4I93A 4PMTA 3UE4A 4F9WA 3UOKA 2PVJA 4ZOGA 3SX9A 3ZO1A 3OG7A 4YPSA 4CKIA 2PULA 2XIYA 4RIXA 4NCTA 3FMMA 4C4FA 4FBXA 4L6QA 5FDXA 3VS0A 2B1PA 3OF0A 4EK6A 2PE1A 2GU8A 4JG6A 2X8DA 4TYJA 2CSNA 4XMOA 4WRGA 2ACXA 1R3CA 3QWKA 5E8SA 2VTQA 2XK3A 4PTCA 4Y72A 2W1IA 3FLSA 4M0YA 1PMNA 5CI7A 4QYEA 4CLIA 3OMVA 4BGGA 3M42A 4J7BA 5CX9A 2WEVA 4MD8E 3B8QA 3BYOA 4FKIA 3QWJA 4X2FA 4ZTSA 2PVHA 3MGYA 4G9RA 4G3GA 4RX9A 4ACGA 5KMJA 4JLCA 2BFXA 1YDTE 4X21A 5FXSA 2HWOA 4QMLA 4X2NA 4D2TA 4WT6A 1AQ1A 4QPAA 3RALA 4HPTE 3E8DA 3EQRA 2UV2A 4FT3A 3NLBA 3BGPA 2YDJA 4H39A 4RVTA 4JBOA 5CEMA 1KE7A 1Z5MA 3L8XA 5IMXA 1OKYA 4O7RA 2BR1A 2YJSA 4ZMFA 3U6IA 3F69A 4AZTA 4AGUA 5JQ8A 3VC4A 2Z8CA 2OG8A 3SDJA 2JFMA 4QTBA 2QO7A 4IQ6A 5LQFA 2VWXA 2RFDA 4BWXA 2B9IA 3F3UA 4RQKA 1G5SA 3HMPA 2VWVA 2WQEA 4L7SA 5KMKA 3A60A 4KSPA 2FO0A 4B9DA 4EK8A 4LGDA 3HP2A 4F99A 2FSLX 4W8DA 1PXKA 3BCEA 5AR5A 3TL8A 2W4OA 4FNYA 4V05A 2BTSA 2UZVA 3O8PA 3RAKA 3OCBA 4O84A 1ZRZA 5CAPA 4PUZA 5AR4A 1BUHA 4X2KA 5BMSA 5HLWA 1FQ1B 3FMLA 3O17A 2LGCA 4O0SA 2ERKA 5KMOA 3E88A 4QMZA 4YNOA 4KSQA 2OKRA 4MH7A 4U40A 4O0RA 1XJDA 1LP4A 3MY1A 5CVFA 2YAAA 3CJGA 4HPUE 5AIRA 3RMFA 1H1PA 4ZY5A 4KINA 4UY9A 1OIYA 3LJ1A 3FPMA 4D9TA 1W98A 4B6LA 3QKMA 5HO7A 4QP6A 3B2WA 3BE9A 1Y8YA 2O64A 3UPZA 3DA6A 5HTCA 4ZY6A 1VEBA 4D4VA 2GDOA 5M55A 3NR9A 5M56A 4MF1A 3UQFA 5FUTA 5J9YA 2FGIA 5E8VA 4TYHB 3R22A 3RAWA 3ENMA 4FK3A 1O6KA 4MNEB 3U8WA 4O7ZA 2QVSE 4ZZOA 5D7AA 5CVGA 2WTKC 4WBOA 2W0JA 3A7IA 2WKMA 3OXZA 4NUSA 3CD8A 3UODA 3P4KA 1PMEA 4D58A 1SNUA 2CLQA 1WCCA 5CI6A 4AZEA 3DY7A 3C1XA 4JIAA 3U55A 4LV8A 3C4EA 3BHVA 4QTCA 4CZUA 3OOGA 1F3MC 4G5PA 1UWJA 4XG8A 4BF2A 1JKLA 4GUBA 5LXMA 3HLLA 1SNXA 4EQUA 2EU9A 1H27A 3EZRA 1FVRA 3DCVA 4AZWA 4HVSA 4ORKA 4XG6A 1Q3WA 3ALNA 4XG3A 4CZYB 3VUGA 3GC7A 5HVKA 2C1BA 5LWMA 2AC3A 3QUEA 2YDIA 4JR3A 4NTTA 3ORZA 4DFNA 4ZIMA 5IQBA 1TVOA 4MQ2A 4BI1A 1W7HA 2FVDA 4FL2A 5KKRB 4U45A 2W1EA 4QTEA 4RIOA 5H8EA 5HICA 3NSZA 2ZM1A 3LFDA 3KXXA 1JAMA 3Q32A 3T3UA 3ZC5A 1YVJA 3II5A 1R1WA 4FTIA 3FKNA 1HOWA 3MFUA 3FHIA 4WNKA 4G9CA 2CDZA 2WQOA 1H08A 3BEAA 4QP9A 4RJ7A 5H2UA 4FKSA 2CGVA 3IW4A 5EM7A 2X0GA 4GH2A 3W2QA 4O7YA 3EB0A 4FEVA 1DI9A 2V7AA 1Y57A 4H05A 1IAJA 4AZFA 3KRJA 3KXNA 3ZZWA 5C1QB 2ZMDA 3G9LX 4O91A 2PUIA 1W8CA 4OTIA 4RWJA 1YWRA 3SRVB 4E20A 2UW0A 2WMSA 2JBPA 2VTOA 3VJOA 3R7YA 1JKSA 4BKJA 2UZNA 2XBAA 4IWOA 3ZBFA 4E6QA 4JBVA 4I22A 2W1CA 4GKIA 3ORMA 1OL7A 3ZFMA 5HTBA 2C30A 1J7LA 5JFSA 3TEIA 5M07A 1Y6BA 4E4XA 1KE9A 3G90X 1M14A 2C5NA 2GNFA 3A99A 1F0QA 3QCQA 4N4SA 5C8NA 4C4IA 2XJ1A 4XOYA 3D15A 5HNBA 5AR7A 3UJGA 4LV5A 3KEXA 3KN6A 3TDVA 4LRKA 3W2SA 2ZDUA 3M1SA 3QXOA 3G33A 4K8AA 5AUYA 4EYJA 2WOUA 3PXKA 4L43A 4BKYA 5HHWA 3AC3A 2OXXA 4R6VA 2ZM4A 2NNWB 3FKLA 3JYAA 4C2VA 4PDOA 4WNPA 4EK3A 5K4IA 4BDIA 2FUMA 2QOOA 5E8WA 3GXLA 4K2RA 3ZEPA 4AU8A 1VZOA 3QL8A 2I0HA 4RX7A 4FTLA 1G8AA 1R39A 4UMQA 2BRHA 2C68A 4FSMA 4Y83A 4D9UA 1JNKA 3TZ9A 5AA8A 4GKHA 5JZNA 4OTGA 1JLUE 2CGXA 1UU3A 5CEOA 4ZP5A 4D2PA 4ANNA 3DNDA 2GHLA 1OIQA 3VRZA 2A19B 3LMHA 3EFKA 3OT8A 4OTRA 5EYMA 3R8VA 2XJ0A 2Q0BA 2B55A 3UC3A 1XWSA 3NYNA 2UZOA 4AFEA 4FKWA 1OL6A 3QTRA 5KE0A 5I9XA 2JLDA 4FIGA 3GOKA 5GJDA 3I7BA 4TWPA 3ODYX 4C62A 2V55A 3K5UA 5I3RA 3DQXA 5FXRA 4PPBA 5IA5A 5J7HA 4WD5A 3EQCA 2BCJA 3FMNA 3W55A 4BVUA 5A4CA 1PXMA 4FICA 3MFSA 3UIUA 4F9BA 4CCUA 3ROYA 2WXVA 2VTHA 4DG0E 2E9OA 3S95A 2UW9A 4WIHA 5AP4A 4DGOA 2C5OA 3QQFA 2ZDTA 4FTMA 2YIRA 4RSSA 4GRBA 1YKRA 2GS6A 4ZS0A 3ZLWA 4DFZE 2QODA 3LM5A 3PVGA 2I1MA 1CDKA 4C7TA 4O22A 5M4UA 2X8EA 4CCBA 5A4QA 3QYWA 4D0XA 2VD5A 4E5BA 3DS6A 3L9MA 3PXFA 2PL0A 4IB0A 2PZIA 3HA8A 5GHVA 4LL0A 3KF7A 3R7VA 4BCHA 2PVMA 2BTRA 1OIUA 4A9YA 4RWIA 3TDWA 3KREA 3I6UA 3NRMA 3OW3A 3PG3A 3COHA 3D5WA 3QGWA 3QHRA 4U3YA 1PMUA 3OXTA 4PL5A 5M4FA 3UIXA 3V01A 3HNGA 4YHJA 1XH4A 4O1OA 4OTQA 1OBDA 3LJ0A 4U8ZA 3JS2A 2YM7A 3ZLXA 3PRIA 3UP7A 1JSUA 4LI5A 4EI4A 1B38A 3FQSA 3FMHA 4IZ7A 2XNGA 5KBRA 4KBCA 4G1WA 1U46A 2J5FA 4L44A 4AA5A 3UZRA 3PIZA 1OZ1A 4KBAA 1PXLA 2J7TA 2I7QA 2JKQA 2X9EA 3VHKA 4QMQA 2C6EA 3DLSA 2J2IB 3P7CA 3G0EA 3ACKA 4QMVA 5GIPE 4HYHA 4BCMA 5E1SA 4I0RA 4XNEA 2ZV8A 4DGNA 3U9NA 2XH5A 5JT2A 2ZAZA 1FMKA 2XIZA 2XIRA 3QQKA 5EYCA 2BRMA 1H8FA 2VO6A 5E8ZA 5FBNC 4CVAA 5AR2A 1H28A 3S4QA 5IKWA 2PUPA 1WVWA 3DJ5A 3ACJA 3KGAA 2C5YA 3EQGA 3BYSA 2PY3A 3ZH8A 3COIA 2UZBA 3WYXA 3MH0A 2P33A 3AD5A 3KMWA 4IFCA 2BZIB 4M7IA 2A4LA 4BGHA 4K9YA 4BCPA 5KZ0A 2X7OA 4Z16A 5M53A 2YERA 3WF6A 1KWPA 2XEZA 3QQUA 3VS1A 3ZDIA 4M69A 5FWKK 1A48A 4M69B 4AW1A 3E8NA 4MAOA 3VS2A 3F5GA 3CTJA 4IE9A 3IGGA 3K3JA 2F2CB 3W18A 1WBOA 4AGCA 5CEIA 4RC4A 4GU6A 4C4GA 5IQEA 4OUCA 4YTHA 1XR1A 2I0VA 1A9UA 3LQ8A 3R6XA 3RHKA 5EH0A 3OP5A 4WG4A 4F6SA 3NMUF 4ZJJA 3Q6UA 2W1ZA 3NYXA 3ZUVA 2FSTX 4BCGA 4HNFA 4I24A 4KWPA 2BHEA 4UXQA 1OKZA 2BPMA 3PSCA 5KMLA 2GFSA 3SA0A 4GFGA 1E9HA 3KF4A 2F7XE 3AXWA 4QYGA 5I9UA 3QZHA 5EW8A 3SW4A 3C51A 3FI2A 4W4XA 4ASDA 2O8YA 4C34A 4II5A 1FVTA 2C5VA 3G2FA 4AAAA 3E64A 2WTWA 3EQHA 4I5PA 2XNBA 4XCUA 5CF4A 4HZRA 5KMIA 4X6RA 5EDQA 3OBJA 4R1VA 5D12A 3HYHA 1OPJA 3HV3A 2W1GA 3AT2A 5L8KA 2NP8A 1YWNA 5FGKA 1UNGA 3V5QA 4HOKA 4J98A 3JVRA 3OUKA 4TY1A 4EBWA 3HUCA 2ITZA 3P08A 1WBSA 2OJIA 2QNJA 5LWNA 5CENA 3C4FA 5F1ZA 4AFJA 4AE6A 4FZFB 4V0GA 5HIBA 5C4LA 4IDTA 5BX0A 4R7BA 3BPRA 4FT7A 5H8BA 4YUQA 5AM7A 3NCZA 3NPCA 3NIEA 4UMUA 5DGZA 3I79A 4FV0A 1H25A 2XYUA 4UWBA 4U5JA 4NM0A 2C3KA 3NNWA 4Y73A 3QCYA 4FT5A 4F0FA 5CAVA 2OJ9A 3W10A 5KZIA 2IVUA 4JOAA 3PY0A 4YHTA 5J87A 4XP0A 2R64A 1H4LA 4FTJA 4X2GA 2XZSA 3CJFA 4XOZA 4CFMA 3F61A 5AP2A 3FQEA 2CNUA 5HX8A 4O27B 3IW7A 3UVPA 3PE2A 3H30A 3QLGA 2QKWB 4QMTA 1ZYDA 3MTLA 4EQCA 3EL8A 4G34A 1WAKA 3EFJA 1SVHA 3ALOA 5BVFA 3P9JA 4L3JA 3C9WA 4QT1A 4AX8A 1M2QA 3HV6A 3PLSA 4FGBA 5I9VA 4GUEA 4ITJA 4MWHA 2C6MA 4OR5A 3FKOA 4O7SA 4DEGA 4XRJA 2NRYA 4D2SA 3TV6A 4ZSAA 2V5QA 5I4NA 3GC8A 3ZFYA 2QHMA 4QMPA 5B2KA 2PVLA 3Q5ZA 5AADA 5K3YA 2VTJA 3EL7A 4I5CA 4RWLA 2PZRA 3ZM4A 3DT1A 1PKDA 3LOKA 5EYKA 1GOLA 4GK4A 3FSKA 2IVVA 4I6FA 2X8IA 2W17A 4WNOA 2ZOQA 3CIKA 2G2FA 4L9IA 3KXHA 3QKLA 4C02A 5IQDA 2XNMA 4LOPA 5HNIX 3POZA 1NA7A 3I81A 4GYIA 1OIRA 4EJNA 4FL3A 3A4OX 2VTNA 3FXXA 2HZ0A 4RIWA 4QMUA 4NK9A 5B2LA 2VNWA 4FTOA 3RM6A 4I21A 5FQDC 4BBMA 2O65A 3ET7A 2W99B 2B53A 3PZHA 2R3QA 4ASXA 4FV3A 5IF1A 4CFUA 4X0MA 3VUDA 3V3VA 1WBPA 4BN1A 5G6VA 4BB4A 4E5WA 1ZY5A 3V6RA 2QC6A 1WVYA 2YCQA 3BELA 3Q5IA 1Q5KA 1YXSA 3V8TA 3PJ2A 3R9DA 2BRGA 3VQHA 3UZTA 2I0YA 4I6BA 4ITHA 4EK5A 5HE1A 4R78A 2RSVA 4KAOA 4GCJA 4XBUA 4ZSEA 4MXOA 3R9NA 2ESMA 4HCUA 3QFVA 5C4KA 4V01A 1NW1A 1PJKA 4O6EA 4I6QA 3RHXA 3NYOA 4MKCA 1FMOE 4IH8A 4DG2E 4RVMA 2VO3A 3RWQA 2JKMA 2OI4X 3L1SA 5GZ9A 4F7SA 2Y4IB 2JEDA 4YC6A 5IUIA 4BC6A 4YZBA 1PKGA 4ZS4A 3LCSA 4QPMA 4NIFA 1JQHA 4EZ7A 1SM2A 2C6TA 3R04A 2RG6A 2HW7A 4ZXTA 1REJA 2XNPA 3TI1A 4BBEA 2JKKA 4EK4A 5L8LA 3AD6A 3MA3A 3R7UA 4F65A 5L3AA 5LVPA 5HE2A 4U44A 2EXMA 4IAAA 4BCQA 2XNEA 3HVCA 5CSXA 3G5DA 2QU5A 5C9CA 2YIQA 4FKTA 4P7EA 4IVBA 4QPSA 2X4ZA 3GCPA 4NT4A 2JIVA 2J90A 3FLNC 4IJPA 3VIDA 3U9CA 3VNTA 4EH4A 2VX3A 4Y8DA 2V7OA 2XKCA 4YSMA 4EYMA 3D14A 5IZFA 1QL6A 3BYUA 4I0TA 2R0IA 3VVHA 2EVAA 2BAQA 3R71A 4KB8A 4HCTA 4D5HA 4E5AX 2ZM3A 3FY2A 3BBWA 5HCZA 4XG2A 3RAIA 4JVGA 3P7BA 2UZUE 4K0YA 4CEGA 1ZZLA 3R1YA 4EOJA 3PJ1A 5BVWA 4A4XA 2PUUA 4O0TA 4FV6A 3BRBA 4XG7A 2Z60A 1MRUA 2IJMA 3H10A 4I1ZA 2VX1A 5AJQA 2RFEA 4DHFA 4EH3A 4CLJA 2OH0E 4M84A 1JSTA 4FSZA 2HZNA 4C4JA 3UTOA 3QQGA 1YI4A 5BUIA 5KMNA 4G3FA 2CGWA 2OK1A 4ZLZA 3IO7A 1F5QA 2ZJWA 4RJ5A 4ASEA 3FXZA 3UOLA 3UO5A 3BKBA 3DJ6A 5A54A 4O7TA 1H01A 4AE9A 3D7TB 3LFBA 4UYAA 1KE8A 2B7AA 3CKWA 3IDPA 4OBQA 3BZ3A 4BHNA 3OROA 5J95A 3AG9A 4YZ9A 5HI2A 4YZCA 2OU7A 4WUAA 1Z9XA 1UU9A 3TKHA 4ZY4A 1WZYA 2HCKA 3GQIA 4EORA 4G6NA 4YU2A 4HVHA 4NWMA 5EM5A 1XH7A 5AP6A 3TNWA 2V22A 3CS9A 2WQBA 4U81A 3EOCA 3S2PA 4XLVA 2PZPA 5JGDA 3GCSA 4NW6A 4FT9A 2Y6OA 5FDPA 5AP5A 3ORPA 3HDNA 4DTAA 4RLLA 4TT7A 4CSVA 4EQMA 4G3CA 2YCFA 3QXPA 4TN6A 4QO9A 4DH8A 4AW0A 4WNMA 2ETMA 5D10A 2G2HA 3OBGA 1ZLTA 3BWFA 4AW5A 3OOMA 4FZDB 4RBLA 1KV2A 4ZJIA 4QYFA 3RZFA 3FLQA 4DTKA 5GZAA 2ONLA 1UA2A 3CEKA 4FKRA 4EH7A 5KHXA 1SVGA 4JS8A 3SQQA 4RLKA 3CXWA 4PTEA 1KOAA 4BDJA 4IXPA 1O6YA 2IO6A 3SOAA 5K9IA 3BU5A 5DT3A 2PMNX 5DG5A 5E8UA 4FEXA 5E90A 2BZHB 4MXZA 1OMWA 5FTQA 2GNGA 3ORKA 2R4BA 3FZPA 2ZV9A 3W8QA 2C6KA 1NY3A 4GT3A 4J52A 3DOGA 5C27A 3OT3A 3ZLYA 4AT5A 2BALA 4UV0A 3NEWA 1CKIA 3DDQA 3ZBXA 4ANOA 4GEOA 4R5SA 5EK7A 4AN3A 3OY3A 2F7EE 4KKGA 5T3QA 2ITTA 1KE6A 2WMAA 3ENHA 3NS9A 5CYIA 3DXPA 3OFMA 2VO7A 2ZB1A 4OLIA 1H26A 3HEGA 4FOCA 2VTPA 3SV0A 2PMIA 3QD3A 4YJPA 3E5AA 4IWQA 1KOBA 5ETIA 1ATPE 5J1WA 1PXIA 4DTBA 4RC2A 2E9UA 3K5VA 1H0WA 3MDYA 4D4SA 5I0BA 5IQCA 1BI8A 4DCEA 4L67A 4IEBA 3ZU7A 3QD2B 4U6RA 4BCNA 4GS6A 4ZSGA 2YABA 4F1TA 5KHWA 5HCYA 1GIHA 3EQIA 5I9ZA 1FGIA 4A9RA 2XM8A 3R7IA 4BDHA 4DEIA 3VJNA 4F6WA 3D5VA 3EKNA 3ELJA 4HYUA 2F4JA 4RIXB 5E1EA 5C01A 3NUYA 1OPKA 4H3QA 3HV7A 5L2QA 2VWIA 3NNVA 4CQEA 2WNTA 2UW7A 2Y6MA 3CPCA 4FNXA 4F9YA 4CYIA 3O0GA 3NIZA 3V04A 3AMBA 2V0DA 4FC0A 4K18A 3R9OA 3U87A 4JDHA 3WF7A 4IAIA 1OBGA 5KX8A 4EKLA 4R7HA 3QD4A 5GJGA 2C4GA 4FG8A 3NDMA 2ITVA 5CXHA 3TCPA 3GU7A 4DBNA 4GL9A 4FEQA 4KKHA 5DRBA 1Q8WA 3FL5A 1K3AA 1Q3DA 2W1DA 4TWOA 4HW7A 4TNDA 4D4YA 3BLRA 4DH3A 4L52A 3TV4A 4IFGA 1WFCA 4JNWA 5B2MA 2R3FA 4EONA 3QZFA 4C35A 1K2PA 2JDRA 3W8LA 1TQMA 4BHZA 2WIPA 3HRCA 3UG1A 4FMQA 4KD1A 5KO1A 4YJTA 3M2WA 4FV9A 2WTIA 5EI8A 2RFSA 4UALA 2QG5A 5LMKC 4E26A 2HYYA 2XK8A 4WUNA 3ZXZA 2WB8A 4N70A 1OGUA 4QP7A 4IZ5A 3OW4A 3HA6A 3ZFXA 4ALWA 4FVPA 3H9OA 3FV8A 3REPA 3UNZA 5AFVA 3BQCA 4JX7A 5J8IA 2IG7A 2QR7A 3G6HA 4J95A 5DWRA 5T6KA 2XBJA 4DEDA 1K9AA 5HG5A 4BIEA 4DEAA 3OCTA 5BVOA 5I5ZA 2PHKA 3L9LA 5AP3A 2B4SB 3FLWA 4OTFA 4RFMA 3GCQA 1RW8A 5CNNA 3TN8A 5F4NA 3UG2A 4QTAA 1VYZA 1FOTA 4A9SA 3IG7A 4F6UA 4Z7HA 5K4JA 3LXNA 3UIBA 4PNKA 5AV4A 5AEPA 2OICA 4BCJA 2GTNA 4U42A 2OXDA 3LFNA 3IK3A 4TNBA 4JDJA 2W1FA 4CRSA 1PXOA 2XNOA 4J1RA 5M57A 3JY9A 2Z2WA 3QALE 3L8PA 2RIOA 3R9HA 3LXPA 1YXUA 3O7LD 4LFIA 5FD2A 4E3CA 5IMEA 4YBKA 1OUKA 4ZSLA 3FMEA 3EZVA 4YZDA 4D2VA 5CU4A 5CS6A 1YHVA 5CF6A 4MD9E 3R7EA 4R5YA 5DH3A 3C5IA 2EB3A 3DBCA 5F94A 4DFBA 3QRJA 4KRCA 4RGJA 5JQ5A 4GT4A 2ITXA 4J71A 4M3QA 3EN7A 5GZ8A 2Y8OA 1XHAA 3QZIA 5A46A 4USEA 5JFVA 4W9XA 5A6OA 2W9FB 2EUFB 4LRJA 4O2PA 3U54A 1GIIA 2WMQA 4FV7A 3UO6A 3MJ2A 4HNIA 4YPDA 3NUPA 4IX3A 4F7NA 1R78A 3OY1A 4XV9A 1XH9A 4TL0A 2JDVA 3HMIA 4ERKA 1W83A 4FODA 4O96A 3ZO2A 4F4PA 4FSTA 4DGMA 2YFXA 3DDPA 3A8WA 2F9GA 2HY81 4NM7A 2WU6A 3I4BA 3DTCA 1XQZA 3MWUA 2GNIA 2XA4A 2AUHA 3PSBA 5GINE 4EZ5A 2YDKA 2PE2A 3NCGA 3LPBA 3Q2JA 5E92A 4EH6A 4GG7A 3KU2A 4R1YA 1Y8GA 5M4IA 2VWWA 4ACHA 1PMVA 1MUOA 4YJVA 4MXCA 3ULIA 4BWPA 4EOLA 3BQRA 4PL3A 2OLCA 4JQ8A 4LOQA 5IEVA 3CBLA 2YCSA 2JBOA 1OITA 2H96A 4FSRA 3SC1A 5DYJA 4QNYA 1H07A 4ENYA 4JQEA 4F0IA 3DKGA 2X2LA 4FKVA 5ETCA 1YWVA 4MBIA 5EOBA 3LCDA 4NJ3A 3PLAE 3TT0A 1SVEA 3CR0A 4F7LA 3G51A 2J9MA 3PIXA 5K5NA 4AS0A 3AT3A 5HBEA 3DV3A 4QMSA 3FE3A 4D55A 5M44A 3KCKA 4C3PA 4CFXA 3H3CA 1YRPA 1YDRE 4G31A 3KN5A 3PIYA 3POOA 4XG4A 3R9RA 3F3TA 3EN9A 4ZZNA 3F2NA 2BROA 1V0OA 4L7FA 1NVSA 4QMXA 3DXQA 2BIKB 2CHLA 4UXLA 3AC5A 3FQHA 5HU9A 5CXZA 5J5TA 4CT2A 3DZQA 1WBTA 3FXWA 4ID7A 2R5TA 3ORLA 4JR7A 4EHVA 4OBPA 3GU8A 3PA3A 4U0IA 4U41A 3DAKA 4U97A 2VTTA 4X3JA 3RI1A 1JPAA 2WMWA 5TF9A 5E8TA 3ZC6A 3EWHA 2XM9A 3BYVA 3OD6X 1YI6A 5CF8A 3AD4A 3QCSA 3CKXA 3LE6A 4X6QC 2LAVA 2YZAA 1JKTA 2VTIA 3SAYA 4CQGA 3LFAA 4C38A 2DYLA 3EYHA 5L6WL 4O83A 3KVWA 3OZ6A 3P86A 5AUVA 2J5EA 2OJJA 4S34A 4BY9E 3KK9A 2W4JA 3PVBA 4FYOA 4L01A 5BPYA 2VZ6A 3NX8A 4AT4A 4HCVA 1MRVA 4EOKA 3PJ8A 1YQJA 2UZWE 3DB8A 4NZWB 2I6LA 5HG9A 3E3PA 3R21A 4FV1A 4XJ0A 4G6OA 5FG8A 3RINA 2C69A 3WZEA 4M15A 2PVRA 3VS3A 1BMKA 1UU8A 3AC1A 5AV2A 4X3FC 4EH8A 2HELA 3TKUA 3DAEA 4PF4A 4FT0A 1AGWA 3JPVA 4QYYA 2QHNA 2CN8A 2WHBA 1QPDA 4CFNA 4YTCA 4O7WA 4QQCA 2QKRA 2BRBA 4DLIA 3D4QA 5AMNA 2REIA 1P14A 2F2UA 3QKKA 4O0VA 3EFWA 4JX3A 4UWCA 1VJYA 4EBVA 1FBNA 1FPUA 3QTSA 5ANEA 1PW2A 4LQMA 4TWNA 2R3GA 3SXRA 4L42A 3FL4A 3BHYA 1RE8A 4KS8A 3KRWA 1UVRA 2XVDA 3V51A 4YJRA 4J96A 4U9AA 4XP3A 3UO4A 2O2UA 4L3PA 4F1MA 1ZOHA 1CKPA 1J91A 2QOKA 4OTHA 3UZPA 4LMUA 4FGRA 2CNVA 3HKOA 2CKPA 3NWWA 3C0IA 3C4XA 3F2AA 4L45A 3QU0A 3V8WA 4AF3A 5FTGA 4JDKA 3AMYA 3DFAA 3RP9A 3W1FA 1HCLA 3JUHA 4E8AA 4FTKA 4NYEA 4EUUA 5C8KA 4O7VA 2VNYA 4QYHA 3O8TA 3PXZA 3BV2A 4S30A 4WG3A 4DFYA 2WTDA 3NVKI 4NSTA 3W2CA 4YSJA 4Q5EA 3VRYA 3GQLA 4GMYA 4O0UA 3WE4A 3ZSGA 3V6SA 3C4CA 4D2RA 2WPAA 1Q8YA 2C0OA 2ITWA 2VWZA 3RCDA 1UV5A 1SYKA 4FTUA 1PXNA 1OL2A 2CPKE 2BRNA 3BIZA 1ZARA 5M4CA 1XH5A 3LW0A 1M2RA 4GIHA 1X8BA 3LQ3A 2BKKA 4UZHA 5IA4A 4IB5A 1OM1A 2OF4A 4K77A 4YLKA 3E3BX 3SXFA 5DFPA 4ONAA 2X9FA 3OWLA 3RPRA 3LLAA 3VUTA 3D9VA 2WD1A 4PQNA 3MS9A 1YHSA 1MQ4A 3D5UA 5DHJA 4ZZMA 4C4HA 4FE2A 5CQWA 1MRYA 5AP0A 2ZB0A 3SHEA 2F7ZE 3ETAA 5E9EA 3FMJA 3GFWA 1Q41A 4DEEA 4F08A 1Q61A 2R3RA 4O0XA 5A4TA 3CGOA 5ETAA 3WIKA 4JBQA 1OUYA 5IPJA 2XK4A 5JZJA 5ANGA 3KXZA 4FSUA 3WZUA 2NPQA 4ZTHA 4UWYA 4BTMA 5AAEA 2XCHA 2VO0A 4LL5A 5FP6A 4GV1A 2GFCA 4XLIA 3U51A 5FXQA 4BDBA 4G16A 3I60A 5T68A 2BAKA 1PHKA 4TW9A 3LXLA 5F20A 4MF0A 1WBWA 2XCKA 1OPLA 2W06A 5L8JA 5LJJA 2JKOA 1MQBA 4MK0A 5A6NA 2WMTA 3OWJA 4OTDA 2GNLA 4M97A 5JKGA 1ZZ2A 4EH2A 3BHHA 2P4IA 4U43A 4C8BA 5FLFA 4ACDA 4D2WA 3F3ZA 4ZMEA 3C7QA 4IADA 4QMWA 3C50A 5AUZA 2PMLX 3QUDA 1H1WA 3WZJA 5IH5A 1WVXA 4J8MA 4Y46A 3E8EA 5CT7A 3ZUTA 2P2IA 1TQIA 2GQGA 3A7FA 2J6MA 3HL7A 4EC8A 5IU2A 4LGHA 3W16A 2B54A 2IW6A 1GZKA 4FOBA 5GJFA 3G0FA 3GBZA 4USDA 3HGKA 3O8UA 1APME 3DTWA 4XRLA 1BKXA 1PYXA 1S9IA 4UEUA 3IOKA 3IW5A 5JGBA 4NCTC 1YOLA 3D2IA 3HECA 3CQWA 4ZTNA 4IVAA 4KBKA 3OWKA 3R02A 3GU6A 4MEDA 4W4VA 4EOMA 3ORIA 2J0JA 4BCKA 4ERWA 5AUUA 2XRWA 3UQCA 4YO4A 4W8EA 2X81A 3FHRA 4GK3A 5KBQA 2PVNA 5HLPA 5L2IA 4FIHA 4LYNA 4X2JA 1IEPA 3Q9ZA 4IBMA 1URWA 3DFCB 3D2KA 3HZTA 2PU8A 3AT4A 3LLTA 2QU6A 3UMXA 4C0TA 5I9YA 2H8HA 2QR8A 2WOTA 4WHZA 2YIWA 3LCOA 4O7LA 2JDOA 5AR8A 3C0HA 3OEFX 3DQWA 1XBCA 3NUAA 4V0GB 1DI8A 2W05A 3I0OA 3KVXA 5EQEA 4G6LA 2W7XA 4ZAUA 3TNQB 3R00A 2R2PA 2XIXA 5JGAA 3UMWA 5KMMA 5CU2A 2VX0A 3QTUA 4I20A 3QQLA 5CWZA 2F57A 3UNJA 3W2OA 4BZOA 4DFXE 5CAUA 2X6DA 4ANBA 5AV1A 4ZTMA 2BIYA 4FTCA 4PPAA 3KULA 4A9TA 4K11A 4U7ZA 3KK8A 1ZYJA 2BKZA 2YISA 1P5EA 3IKAA 5IH6A 5AAFA 3RPYA 4KIKA 3IECA 4KIKB 4I4EA 2Z02A 3L9NA 1Y6AA 4DT8A 5HO8A 1QMZA 4TZRA 5DBXA 3UOJA 4IX6A 4R77A 4PDPA 3ATSA 4BFMA 4YJSA 2BMCA 4TXCA 3ZO3A 3RK5A 2O63A 4FV4A 3I1AA 2WTKB 4QMYA 2IZTA 3R8LA 3TUBA 4LOOA 4PRJA 1H0VA 3FMDA 4FA2A 3Q4CA 5LOHA 4R7IA 2A27A 4RRVA 1NT2A 2C6DA 5CSVA 4YMJA 4BIDA 2X7GA 2EXCX 3W32A 5CASA 1ZYLA 3V8SA 2YM6A 1P2AA 2R3MA 2HW6A 2WZJA 4FVQA 4AOTA 4BTKA 3ZONA 2IWIA 3QZGA 2GSFA 4AW2A 2CKEA 4TYIA 1GY3A 3ZS5A 3GC0A 5DI1A 3KFAA 4R3CA 3WARA 4P90A 3A8XA 3WF8A 4GFOA 4IAFA 5E91A 4PPCA 4CNHA 5GNKA 4RIWB 4ASZA 3DJ7A 4ANMA 5E8XA 4CV9A 4EHGA 4AXAA 2WMRA 3ZMMA 4HVDA 3LMIA 4NM3A 4G2FA 1YOMA 3AQVA 3ZHPC 2GNJA 2GTMA 5HX6A 2X4FA 3THBA 4AQCA 2WQNA 3F66A 2OIDA 3MFRA 3NUSA 2UZEA 3G9NA 4HGEA 5K0XA 4TWCA 5AAGA 1J1CA 4AOJA 2YAKA 3FZTA 5BUEA 4EHEA 1AD5A 1UU7A 4FKLA 4IM3A 4AG8A 1M2PA 4E1ZA 5GIOE 2X2KA 4UYNA 3BEGA 3V5LA 4FYNA 2ITYA 2R3LA 5IA3A 3FAAA 3KMUA 5CNOA 3RNYA 2VGPA 4FK6A 3RK7A 3GC9A 1GZOA 3QHWA 5LMBA 5A4EA 3EFLA 2AYPA 2GNHA 4BDKA 4O81A 2R3JA 1DAWA 4RX8A 4DAWA 3MVMA 2HWPA 3QRIA 3FLYA 4I23A 4MXXA 5CZHA 4EH9A 2J4ZA 3B2TA 3BHUA 5HE0A 4E6DA 5KKRC 5LVNA 1P4FA 1O6LA 1OECA 4WO5A 3KL8A 3Q9YA 3DBFA 4YLJA 2GS7A 5HE3A 4EOSA 5HBHA 5HIDA 4L46A 4JDIA 4AWIA 3MV5A 4K6ZA 1NXKA 4LUDA 4NIFB 4PX6A 2BDFA 5DRDA 2UW6A 4P2KA 1OI9A 2VAGA 2Y7JA 4IIRA 3DKFA 3CE3A 5CY3A 4O2ZA 1XH6A 4YZNA 4W4YA 1TKIA 2HZIA 3R2BA
chains in the Genus database with same CATH superfamily
2XRUA 3PXRA 3AKKA 4JT3A 2CCHA 2JAVA 2WELA 4J8NA 5HLNA 4IVCA 2ZVAA 3R7GA 4S33A 4HGLA 5HD4A 4PNIA 3U6HA 2OH4A 3LCKA 3ROCA 2VGOA 2H6DA 1QCFA 4XBRA 3CC6A 5IQHA 1PF8A 2W9ZB 4MXYA 3LQ5A 4A4OA 4BDCA 4RIYA 4RIYB 3VUHA 3Q60A 2C1AA 1DS5A 1YDSE 1J3HA 3QTWA 5CEQA 2W96B 1EH4A 3CTHA 5CT0A 4RVKA 3PXQA 4IANA 4U3ZA 4Q9ZA 3UNKA 4A9UA 4Y5QA 3PPKA 4IACA 5BUJA 2QQ7A 4QMNA 5TO8A 3TG1A 5L2TA 5IEXA 4DINA 3IONA 1IA8A 2E9VA 2ITQA 2E2BA 3E92A 4XUFA 2C47A 4ZTQA 4C36A 4UMRA 1CM8A 3Q4UA 3SGCA 2VWYA 4XG9A 4FG9A 2J50A 4W4WA 2QOIA 4E93A 1L8TA 1CKJA 4YTFA 2UVZA 5J79A 1OL5A 3FC1X 3PP0A 4GIIA 4D1XA 4ENXA 3PDTA 3MY5A 4DT9A 1U54A 2GS2A 3ZDUA 3A62A 1R0EA 4DEHA 4UX9A 1U59A 4OBOA 4IB3A 4N6ZA 3PG1A 1B39A 4IZAA 2PVFA 4XH6A 3LAUA 4YJQA 4USFA 3OCSA 5CSHA 1M52A 4BR3A 1O9UA 3QRUA 4TKSA 3ZSIA 3NAXA 4O7NA 2Z7SA 3KY2A 3MPAA 3RWPA 3SLSA 5L6OA 2BDJA 3LZBA 4JRNA 4I5MA 2UZLA 4FR4A 5HGIA 1KUTA 4IVDA 1W0XC 2YWPA 3AOXA 2C6OA 2O5KA 3P0MA 1ZMVA 3NW6A 1JOWB 4AOIA 4TPTA 4MXAA 5AA9A 4RA4A 3P79A 1XO2B 5JRSA 2Z7QA 3TV7A 3DBEA 2XMYA 3BLHA 4ZTRA 2P2HA 5CU3A 3R8PA 1BYGA 2YJRA 3PSDA 3P7AA 4K1BA 5HKMA 3T9TA 3QA8A 5ACBC 2C3JA 3MB7A 3AC4A 4ALVA 2WQMA 3QRKA 5FEQA 2NO3A 4HYIA 5HVJA 2JIUA 5ANDA 1W84A 1H00A 2WTVA 4FV2A 3BGZA 3TZMA 4ZK5A 3ZSHA 2X2MA 2A98A 4F78A 3R1SA 4HYSA 2J0IA 2UW8A 2OIBA 2XB7A 3MPMA 3R0TA 4JAJA 1NVQA 2WAJA 4IAZA 5BVDA 5BNJA 5L4QA 2PPQA 4FZ7A 2WIHA 1SZMA 2QCSA 2HAKA 3NW7A 5CAQA 4CD0A 3FZRA 2OFUA 3IW8A 4QQ5A 5EDRA 3N4TA 4R3RA 3VS5A 2XKDA 4BL1A 4FKQA 3SOCA 3HMNA 3ZM9A 4Y95A 4EOPA 1U5RA 3DNEA 1RJBA 3OS3A 4BI0A 5CEKA 5IQIA 4I41A 3COMA 3IOPA 3R30A 4KABA 1QPCA 3GP0A 1U5QA 4GG5A 4BJJB 4DF3A 4WA9A 3F5UA 1RDQE 3QLFA 4RA5A 4BDGA 2QG7A 3NYVA 3UVQA 2WEIA 4MBJA 3EQFA 5EKNA 4JIKA 3VBQA 5EHLA 3MIYA 4QMMA 5BQ0A 3DBQA 1W2CA 4GSBA 4WOVA 1ZOGA 2YA9A 1ZY4A 4YO6A 5ETFA 4F1OA 3M11A 2R9SA 1OL1A 1H24A 3D83A 4G3DA 3WZKA 1REKA 5IUGA 1G8SA 3RGFA 3T9IA 2P3GX 3K3IA 2W5BA 1W82A 3R73A 2HXLA 3R01A 3QCXA 4IJ9A 4L00A 4XV3A 3R2YA 4KRDA 4C59A 4EUTA 5M51A 4FV5A 5DT4A 3VBWA 3WIGA 4F7JA 3AKLA 4YZMA 3PA4A 3ANRA 5BMMA 3KKVA 3VUKA 1KSWA 4H58A 4JAIA 2W4KA 4U80A 3RPSA 4M14A 3V5PA 4Z55A 5E8YA 4L68A 5JFXA 4DITA 5D1JA 2RF9A 3G6GA 5CALA 2UVYA 2ZV7A 1ZYCA 4DYMA 2YIXA 3BU3A 4FTAA 3EMGA 3PPZA 4P4CA 4C3FA 4FTNA 5IQGA 2JAMA 2WMXA 4C4EA 4M67A 4QP1A 5CVHA 4TTHB 3GU4A 3N9XA 2QURA 1HCKA 3QRTA 3IS5A 4IAYA 3RAHA 4B8MA 5B7VA 2OSCA 2B9JA 3F9NA 3DK7A 3JVSA 2FA2A 4ZSJA 3TKIA 4F64A 4ACMA 5JEBA 4J97A 2QOQA 4FTTA 4IHPA 1STCE 4UN0C 3AKJA 4MCVA 2BVAA 2WTJA 5DA3A 3AC2A 3TTIA 1M7NA 5DVRA 3Q53A 3ZRMA 3I0QA 3FYKX 3IGOA 4IM0A 4LRMA 2QO2A 3NGAA 4RC3A 4IC7A 5HG7A 3MVLA 4IDVA 3ORTA 3MSSA 1LUFA 2CGUA 3VULA 3R7OA 5M06A 3D94A 3F7ZA 4L8MA 4PDYA 5ANOA 1G3NA 1GZNA 4NJDA 3HMMA 4V04A 4O38A 5D7VA 3S1HA 5HIEA 3JR1A 3GEQA 2FSOX 1ZMWA 2B52A 3UYSA 3CSVA 1WBNA 2YLFA 4RPVA 4MUQA 5DOSA 2IN6A 3I7CA 5DEYA 3IDBA 3NW5A 5AV3A 5J1VA 3HP5A 1JVPP 3OWPA 3RZBA 3NNUA 2CCIA 2XK9A 3VAPA 1URCA 4DFLA 4FKUA 4GJ2A 3FPQA 3TZ8A 2YCRA 4MHAA 3RCJA 3O5AA 4D4RA 3VS6A 3W0SA 3VF9A 2QOFA 2JITA 4W9WA 2F49A 4GVAA 1Z57A 3PFQA 3TNHA 4E4LA 4YR8A 5HQ0A 3VW8A 3JY0A 5CTPA 3OCGA 2IW9A 4FEWA 2VUWA 3ORXA 3OHTA 3MB6A 3EQPA 3SXSA 4FV8A 1Q24A 3QGYA 1GIJA 4NU1A 1TZDA 2OJGA 2Q0NA 5H3QA 3ZYAA 4L3LA 3C5UA 4Y5HA 2JFLA 2B9HA 3LIJA 2RFNA 4N57A 4DBXA 3QC4A 1XKKA 4XHKB 5HNGA 2I40A 2E9PA 4IX4A 3RTPA 1L3RE 4CG9A 5G1XA 4JBPA 4O4EA 4HZSA 1S9JA 3MA6A 5L2SA 3EHAA 2XYNA 4FIEA 5M09A 4G17A 3GUBA 4CKRA 4NW5A 4GW8A 1WBVA 3PWYA 4TYHA 2UZTA 3U6JA 3QBNA 2XKFA 4MNEA 5LARA 2OXYA 3WZDA 3TTJA 4E6CA 3Q04A 4ZJVA 3QA0A 5HBJA 4YGAA 3Q2MA 4M13A 4AN2A 2EB2A 2IZRA 3AC8A 4I94A 4LM5A 3CQEA 3VN9A 3BE2A 5AUTA 3WI6A 4BDDA 4FTQA 4RT7A 4YURA 3PVWA 3KMMA 3L9PA 1RQQA 5EYDA 5DR2A 5ANIA 4AZVA 2IEWA 3TXOA 2JGZA 4BZNA 2PE0A 3COKA 2OWBA 2X7FA 3QTZA 4E4NA 3F7WA 2GMXA 3O23A 5A3XA 5AP1A 1U4DA 4FSYA 5AX3A 4RMZA 4LG4A 4QOXA 3W0OA 5FTOA 1H1RA 3ZO4A 2WMUA 4RVLA 3RBWA 5J9ZA 3QQJA 3ZZEA 4RZWA 4XX9A 3H9FA 4FUXA 3TNPC 1Q62A 3VUMA 5EW3A 3SVVA 2PYWA 2XK6A 2DUVA 5EI6A 2XALA 3CCNA 4Q9SA 3T8OA 5J5SA 3OTUA 5FM3A 3ATTA 2RKUA 3GENA 4E4MA 5JSMA 2UW3A 1YXVA 4K33A 3QAME 5DN3A 4H3BA 5I9WA 2HXQA 5EG3A 4BDAA 4F09A 3EJ1A 5BVKA 4H1JA 2G1TA 4M8TA 4B7TA 5EDPA 3WBLA 3CY2A 5DPVA 1DM2A 3E93A 1YOJA 4N0SA 4C2WA 2Z7RA 4C61A 3LXKA 5ICPA 4CV8A 2IVTA 3DK6A 3LFEA 4KKEA 3EQBA 4QP2A 5BVEA 3UC4A 1TQPA 2YWVA 2PK9A 4O21A 4MYGA 3RM7A 3BL7A 3BLAA 3GFEA 5KUPA 1OKWA 1CTPE 3GT8A 2OGVA 1PXJA 4KNBA 1IR3A 3FI4A 3GB2A 4NKAA 1LPUA 3QX2A 3FI3A 2PZYA 2UW4A 3BU6A 4RJ6A 4NFNA 5J9LA 3G15A 2ETRA 2E9NA 2QLQA 3LM0A 1V0BA 5L2WA 3SRVA 4EOIA 1T46A 3UGCA 2VN9A 2Y4IC 2UW5A 2PVYA 3ODZX 2J0LA 4HGSA 3TACA 3SG8A 2YHVA 5AM6A 4ZEGA 5AV0A 2XNNA 4ITIA 5DLSA 1YHWA 3EYGA 3AMAA 5H9BA 4Z3VA 2KTYA 4Q5HA 3N51A 1FINA 2WMVA 4X7QA 4QTDA 3N4UA 4AN9A 5DR6A 3WF9A 2G15A 1GZ8A 3OTVA 1ZOEA 2VTSA 3DK3A 2Z7LA 3F6XA 3HRBA 5EQPA 4NL0A 4FKJA 2R3IA 2XJ2A 3F5XA 3PTGA 4IWDA 5EW9A 3T3VA 4FIJA 4OAVB 1YXTA 4PTGA 2R3HA 3BWJA 3QTQA 3VQUA 3ULZA 4A06A 1PRYA 4O0YA 3C13A 4ANSA 1V0PA 2UUEA 2YM5A 4WSQA 2ITNA 3PJCA 5EKOA 3EKKA 3LFSA 1XBAA 3BYMA 2G2IA 2IZSA 4AZSA 4QMOA 4GVJA 1UKHA 1UNHA 3F88A 4QP3A 3D7ZA 3PPJA 4BBFA 4C57A 5IA1A 2JDSA 3GNIB 3MH1A 3TUDA 1M17A 5L6PA 3GCVA 3TNIA 2ETKA 4GFMA 2VTRA 4RWKA 4E73A 3QC9A 3S00A 3DU8A 4EWHA 5AP7A 1FVVA 3Q9XA 3H9RA 4KS7A 1LR4A 2QLUA 3R1NA 4BTFA 4ZLYA 3HAVA 4HVGA 2X1NA 4GYGA 5HESA 4H1MA 2CLXA 1IASA 4RJ3A 3W2RA 1JKKA 1JBPE 2W1HA 2XUUA 4E6AA 2OJFE 4E7WA 4ALUA 3B8RA 2BZJA 5K5XA 4EKKA 4DH7A 2BILB 3LMGA 3K2LA 3Q3BA 3PYYA 4NEUA 4AT3A 3PP1A 4FSNA 5K0KA 3PVUA 5D9HA 1T45A 3FBVA 5CU0A 3NNXA 5E7RA 4B4LA 3Q52A 1GNGA 4JRVA 4PMPA 2QONA 4BZDA 2C0TA 2YM4A 4A4LA 4CT1A 3H4JA 3GI3A 4R3PA 4FNZA 4JXFA 1GJOA 4QP4A 4S32A 5EI2A 1J7IA 1FGKA 2Y4PA 3FC2A 4DFUA 3ZXTA 3FWQA 4C58A 4MWIA 3DGKA 3P78A 2YM8A 4BYIA 4O4DA 2OF2A 2X0PA 3HUBA 4I6LA 3TM0A 3MI9A 4PL4A 2CKQA 3UP2A 5FP5A 4JI9A 4PY1A 2JIIA 2A2AA 3RPVA 4O0WA 5CZIA 2QOLA 3OXIA 2I0EA 4DEBA 5LCKA 2ONLC 2C5XA 3P23A 5TOZA 1V1KA 3BV3A 4HVIA 3MPTA 4JG8A 4PWNA 4FNWA 2ITOA 2ZV2A 3R63A 1E1XA 4WBBB 3FZ1A 2G9XA 3IPHA 3UOHA 4NM5A 5A4LA 3DBDA 5J7BA 4CYJA 2C3IB 4QQJA 5TT7A 4DHJA 5LVOA 2JC6A 4XP2A 5TR6A 5LCJA 1BLXA 2GHGA 4FIIA 3WF5A 5TKDA 5FBOA 3ZOSA 4BYJA 2CKOA 4D5KA 2B9FA 3EIDA 4IMYA 2VV9A 2R3NA 4C33A 4DC2A 2OW3A 4AXDA 4FSQA 2J0KA 2XEYA 3PJ3A 4FIFA 4CXAA 4CKJA 4D0WA 5IDPA 4IZYA 3H0YA 3W33A 1M7QA 1BL6A 2QOCA 2A1AB 2XARA 3NVMB 2B0QA 5DNRA 2W5AA 3HMOA 4YJNA 5FM2A 5BYZA 4FKPA 4LDTA 5E4HA 4FTRA 4AP7A 3VW6A 4UBAA 3W0NA 3FSFA 4OTPA 3WILA 3FUPA 4S2ZA 3CP9A 4NH1A 4Z7GA 3TUCA 3MFTA 2ERZE 4BI2A 1JWHA 2Y0AA 2ITPA 4AACA 5KCVA 1GAGA 5ACKA 2PZ5A 4FSWA 3GCUA 2J51A 3PXYA 1Q99A 2BUJA 2R0UA 3O71A 4RFZA 3Q6WA 3ZEWA 3QQHA 4QRCA 2XP2A 2VTMA 3PUPA 5CF5A 3Q9WA 5DEWA 4IC8A 4JL9A 4R8QA 3MY0A 1Y91A 2BHHA 3LFCA 4P5QA 4G3EA 1Q8TA 4M66A 2ZYBA 1G8KA 3IDCA 5BV3A 5FEDA 4OT6A 4DG3E 3NZ0A 4P5ZA 5IUHA 3D5XA 5A14A 4BRXA 4B0GA 2YZLA 3ITZA 4GK2A 3A2CA 3FI8A 4XV1A 2OZOA 4BDEA 1BI7A 2IZUA 4RJ8A 5AIKA 3NFGB 4DH1A 3OUNB 1LEZA 2EWAA 2RG5A 3LKMA 4GJ3A 4QQTA 4MD7E 4EEVA 3FEGA 5JFWA 3A7HA 2WU7A 3CD3A 3FY0A 3MIAA 3HX4A 4I6HA 3WE8A 2VWBA 3PZEA 3RKBA 3ZLSA 5LMKA 5M08A 4WSYA 2OO8X 3UQGA 3VS4A 4FEUA 4RJ4A 2JDTA 2WGJA 4GU9A 4FZ6A 3QX4A 2IPXA 4DE4A 4CMUA 1PXPA 3FJQE 2XKEA 3O7LB 4IB1A 3CLYA 3FZOA 3MBLA 2XIKA 3DKOA 4KA3A 4FUYA 4O6LA 5DIAA 2QOBA 4FVRA 4IAKA 2X0QA 4GT5A 4I0SA 1LEWA 4LUEA 4NKSA 3RJCA 4B8LA 4F9AA 5BVNA 1R0PA 4WRSA 4BIBA 5A9UA 5IH4A 3UDTA 4M12A 1B6CB 3A4PA 4D1ZA 3MVHA 4CRLA 3EQDA 1J1BA 3UVRA 3KULB 5HZNA 3NUUA 4H36A 4YHFA 3F82A 3EN5A 5AX9A 3V5WA 2VU3A 5AUXA 3MESA 4YNEA 4IWPA 3PY1A 5FEEA 5IISA 5CQUA 4OGRA 3IW6A 3R1QA 4IM2A 3QD0A 2C6IA 3E87A 3RVGA 4LGGA 3BX5A 3V5JA 5AWMA 5EHOA 3OC1A 3L8VA 4FL1A 5DT0A 2BDWA 2EXEA 3A61A 3DXNA 3L8SA 2XF0A 1IA9A 4AGWA 4NFMA 5IQAA 3O2MA 2WO6A 3DPKA 4FJVA 3ZTXA 3BHTA 1I44A 2CJMA 2SRCA 3MH3A 3DB6A 4U79A 3NUNA 4IX5A 4I92A 4ANLA 4QDEA 4DCAA 3FLZA 2H9VA 3ERKA 4PV0A 4XYFA 4EC9A 3O51A 3BBTB 2BFYA 4RG0A 4XV2A 3C4ZA 4EL9A 4WKQA 5HVYA 1Q8UA 3F3VA 3Q4ZA 4DGLC 4APPA 4B99A 2C3LA 3KQ7A 3PRFA 3NAYA 3OVVA 4BKZA 2HOGA 5JN2A 5DE2A 4KIOA 4O82A 3QUPA 2XK7A 4CFFA 4KUJA 1VR2A 2VWUA 3E63A 3RNIA 1BL7A 1YI3A 3BGQA 4UB7A 4F0GA 2FYSA 2HK5A 3O50A 3SKCA 1ERKA 5CU6A 3MH2A 3AGLA 4FG7A 4YC3A 5ANJA 2OIQA 3KXMA 1J7UA 1PYEA 4BCOA 4HJOA 3VHEA 1DAYA 4NTSA 3U4WA 4OAUC 3A7JA 5FRIA 4ACCA 3O96A 5C26A 3AGMA 1QPJA 4OW8A 2VRXA 4AUAA 5EQYA 5AUWA 4DGGA 2PWLA 3HV4A 4EJ7A 3FDNA 2R3OA 4J53A 4CG8A 3S0OA 3UDBA 2NRUA 5H8GA 2OZAA 2OZAB 2OBJA 3GU5A 3KA0A 2R7IA 3LVPA 4BGQA 3P1AA 3KXGA 3DKCA 4UMPA 5HU3A 2YIYA 1UKIA 2HY0A 3NUXA 3QF9A 5I3OA 2WMBA 3TWJA 3MVJA 3W0QA 4S31A 4MVFA 2GHMA 4Z9LA 3WYYA 3V5TA 5LVMA 3UBDA 4DLJA 3E8CA 4RX5A 3VS7A 2P0CA 5JRQA 3ZCLA 5IA2A 5JK3A 4MNFA 3E62A 3R28A 4QD6A 3S3IA 1XH8A 3SW7A 5D11A 3DZOA 3RPOA 4JG7A 2GCDA 5CEPA 4FKGA 1SMHA 3JXWA 3MW1A 4XS2A 5HD7A 3TJCA 3VWAA 5IEYA 1ND4A 3ID6C 4DA5A 3FMKA 3F2RA 2RL5A 2HIWA 5C8MA 3D0EA 4PMMA 3TZ7A 5F95A 1UWHA 3R8MA 4DN5A 4YC8A 1OGYA 2O0UA 3EH9A 4CTBA 2GPHA 3FZSA 5KNJA 3FYJX 2BZKB 2J0MB 4APCA 2GQRA 4M0ZA 1IRKA 5IDNA 3N4VA 4CMOA 3DAJA 4MQ1A 2CNQA 4BTJA 1Q8ZA 2FSMX 2QOHA 3PWDA 4FX3A 4YJOA 3KRRA 3I5NA 4LMNA 1H1QA 5CLPA 4BCFA 2RGPA 2Y9QA 4FI1A 4MTAA 3DLZA 5DMZA 4RZVA 3R83A 3UPXA 4YTIA 4BDFA 4UMTA 3ORNA 2HENA 4BCIA 4F9CA 4KIQA 4L53A 4RQVA 4TYGA 4IW0A 3VO3A 2Q83A 1KE5A 2FB8A 3VBVA 3UYTA 3SG9A 2R3KA 4PP9A 3MYGA 4Y85A 5HOAA 3ANQA 5B0XA 3PE1A 4X3FA 4X3FB 2VTLA 3LFQA 5EFQA 3OEZA 3Q4TA 4FF8A 3VF8A 4C37A 5IQFA 4MBLA 4XEYA 1OB3A 3I6WA 1IAHA 1JSVA 5HEZA 4PDSA 4TRLA 3KC3A 5CANA 4O86A 3VONA 4F63A 1OVEA 2AC5A 3VUIA 2G01A 1Q4LA 4KIPA 4JJRA 5TE0A 3RK9A 4D1SA 4I3ZA 5IA0A 1ZYSA 3CY3A 3R8UA 4CFVA 4F70A 4A7CA 1KV1A 4C3RA 2R7BA 3PY3A 4YJUA 5EM6A 1U54B 2KULA 2YM3A 4CTCA 4EH5A 5C03A 2A0CX 3HDMA 1A06A 1OKVA 4M68A 2QD9A 2CN5A 3F3WA 2PVKA 4H3PA 2WTCA 3KCFA 4I4FA 1NVRA 3I5ZA 2UVXA 2VTAA 3K54A 5F9EA 1ZWSA 1CSNA 2HZ4A 2O3PA 1CMKE 1I09A 4TYEA 2UZDA 2PSQA 5LVLA 3EN6A 1BX6A 3D7TA 4BWKA 4DHIB 2YEXA 4OT5A 3QTIA 3Q96A 5EOLA 4ZTLA 3VBXA 2W5HA 3C4WA 4YLLA 3VBYA 4EZ3A 3HAMA 3ML1A 5HORA 5HCXA 3BLQA 4N6YA 4UZDA 5IG1A 1YW2A 4J99A 5D41A 3KRLA 3KRXA 4CGAA 2OFVA 4ANQA 2YN8A 4FZAB 3W2PA 2NYAA 4I5HA 3W0PA 1H1SA 4EWQA 2H34A 4BICA 3TJDA 4QNAA 2GQSA 3IQ7A 3TIYA 5CSPA 5DR9A 3VBTA 1ZMUA 1WMKA 2FH9A 4JQ7A 1Q97A 3CGFA 2DWBA 4WG5A 3BI6A 3CPBA 1VYWA 4EHZA 2ITUA 1YXXA 2DS1A 4G5JA 4A07A 5LMAA 3HRFA 3R8ZA 3ZRKA 3GGFA 2QO9A 2YLEA 2IW8A 2ZMCA 4YP8A 2WFYA 2DQ7X 3P5KA 3QTXA 4AA0A 2C6LA 3SD0A 4CZTA 2IVSA 2YACA 4ARKA 3UIMA 4AQKA 3F5PA 2PUNA 4YBJA 1MP8A 1ZXEA 3LJ2A 3MJ1A 1QPEA 5JH6A 3ZRLA 5ANKA 1XBBA 4D28A 4DH5A 5CSWA 4ZLOA 4MX9A 3LHJA 4PMSA 4RFYA 1PY5A 2V62A 4EOOA 2C0IA 3QYZA 4FKOA 2P55A 4CFWA 5AR3A 3C0GA 1IG1A 2BAJA 3GOPA 3HV5A 4OTWA 5HG8A 3TIZA 5HO6A 3WOWA 2X6EA 1P4OA 4O1PA 4AA4A 4EOQA 4Q2AA 4PP7A 3LFFA 3ZUUA 2JD5A 5CAOA 5EM8A 5BYLA 3MN3A 2QI8A 3PA5A 2CMWA 2PMOX 1ZAOA 2R3PA 4HGTA 3CTQA 3LCTA 3BL9A 3CQUA 3U4UA 3EN4A 3H0ZA 3KB7A 3A7GA 2YITA 4CMTA 4QP8A 5HTIA 5ITAA 4AGDA 3E7VA 3E7OA 2XS0A 1E1VA 1UNLA 2X39A 5JMSA 2PTKA 3MTFA 3GVUA 5EHYA 5BYYA 4I93A 4PMTA 3UE4A 4F9WA 3UOKA 2PVJA 4ZOGA 3SX9A 3ZO1A 3OG7A 4YPSA 4CKIA 2PULA 2XIYA 4RIXA 4NCTA 3FMMA 4C4FA 4FBXA 4L6QA 5FDXA 3VS0A 2B1PA 3OF0A 4EK6A 2PE1A 2GU8A 4JG6A 3UDZA 2X8DA 4TYJA 2CSNA 4XMOA 4WRGA 2ACXA 1R3CA 3QWKA 5E8SA 2VTQA 2XK3A 4PTCA 4Y72A 2W1IA 3FLSA 4M0YA 1PMNA 5CI7A 4QYEA 4CLIA 3OMVA 4BGGA 3M42A 4J7BA 3W0RA 5CX9A 2WEVA 4MD8E 3B8QA 3BYOA 4FKIA 3QWJA 4X2FA 4DDIA 4ZTSA 2PVHA 3MGYA 4G9RA 4G3GA 4RX9A 4ACGA 5KMJA 4JLCA 2BFXA 1YDTE 4X21A 5FXSA 2HWOA 4QMLA 4X2NA 4D2TA 4WT6A 1AQ1A 4QPAA 3RALA 4HPTE 3E8DA 3EQRA 2UV2A 4FT3A 3NLBA 3BGPA 2YDJA 4H39A 4RVTA 4JBOA 5CEMA 1KE7A 1Z5MA 3L8XA 5IMXA 1OKYA 4DHZA 4O7RA 2BR1A 2YJSA 4ZMFA 3U6IA 3F69A 4AZTA 4AGUA 5JQ8A 3VC4A 2Z8CA 2OG8A 3SDJA 2JFMA 4QTBA 2QO7A 4IQ6A 5LQFA 2VWXA 2RFDA 4BWXA 2B9IA 3F3UA 4RQKA 1G5SA 3HMPA 2VWVA 2WQEA 4L7SA 5KMKA 3A60A 4KSPA 2FO0A 4B9DA 4EK8A 4LGDA 3HP2A 4F99A 2FSLX 4W8DA 1PXKA 3BCEA 5AR5A 3TL8A 2W4OA 4FNYA 4V05A 2BTSA 2UZVA 3O8PA 3RAKA 3OCBA 4O84A 1ZRZA 5CAPA 4PUZA 5AR4A 1BUHA 4X2KA 5BMSA 5HLWA 1FQ1B 3FMLA 3O17A 2LGCA 4O0SA 2ERKA 5KMOA 3E88A 4QMZA 4YNOA 4KSQA 2OKRA 4MH7A 4U40A 4O0RA 1XJDA 1LP4A 3MY1A 5CVFA 2YAAA 3CJGA 4HPUE 5AIRA 3RMFA 1H1PA 4ZY5A 4KINA 4UY9A 1OIYA 3LJ1A 3FPMA 4D9TA 1W98A 4B6LA 3QKMA 5HO7A 4QP6A 3B2WA 3BE9A 1Y8YA 2O64A 3UPZA 3DA6A 5HTCA 4ZY6A 1VEBA 4D4VA 2GDOA 5M55A 3NR9A 5M56A 4MF1A 3UQFA 5FUTA 5J9YA 2FGIA 5E8VA 4TYHB 3R22A 3RAWA 3ENMA 4FK3A 1O6KA 4MNEB 3U8WA 4O7ZA 2QVSE 3PFYA 4ZZOA 5D7AA 5CVGA 3TMOA 2WTKC 4WBOA 2W0JA 3A7IA 2WKMA 3OXZA 4NUSA 3CD8A 3UODA 3P4KA 1PMEA 4D58A 1SNUA 2CLQA 1WCCA 5CI6A 4AZEA 3DY7A 3C1XA 4JIAA 3U55A 4LV8A 3C4EA 3BHVA 4QTCA 2AQXA 4CZUA 3OOGA 1F3MC 4G5PA 1UWJA 4XG8A 4BF2A 1JKLA 4GUBA 5LXMA 3HLLA 1SNXA 4EQUA 2EU9A 1H27A 3EZRA 1FVRA 3DCVA 4AZWA 4HVSA 4ORKA 4XG6A 1Q3WA 3ALNA 4XG3A 4CZYB 3VUGA 3GC7A 5HVKA 2C1BA 5LWMA 2AC3A 3QUEA 2YDIA 4JR3A 4NTTA 3ORZA 4DFNA 4ZIMA 5IQBA 1TVOA 4MQ2A 4BI1A 1W7HA 2FVDA 4FL2A 5KKRB 4U45A 2W1EA 4QTEA 4RIOA 5H8EA 5HICA 3NSZA 2ZM1A 3LFDA 3KXXA 1JAMA 3Q32A 3T3UA 3ZC5A 1YVJA 3II5A 1R1WA 4FTIA 3FKNA 1HOWA 3MFUA 3FHIA 4WNKA 4G9CA 2CDZA 2WQOA 1H08A 3BEAA 4QP9A 4RJ7A 5H2UA 4FKSA 2CGVA 3IW4A 5EM7A 2X0GA 4GH2A 3W2QA 4O7YA 3EB0A 4FEVA 1DI9A 2V7AA 1Y57A 4H05A 1IAJA 4AZFA 3KRJA 3KXNA 3ZZWA 5C1QB 2ZMDA 3G9LX 4O91A 2PUIA 1W8CA 4OTIA 4RWJA 1YWRA 3SRVB 4E20A 2UW0A 2WMSA 2JBPA 2VTOA 3VJOA 3R7YA 1JKSA 4BKJA 2UZNA 2XBAA 4IWOA 3ZBFA 4E6QA 4JBVA 4I22A 2W1CA 4GKIA 3ORMA 1OL7A 3ZFMA 5HTBA 2C30A 1J7LA 5JFSA 3TEIA 5M07A 1Y6BA 4E4XA 1KE9A 3G90X 1M14A 2C5NA 4O4CA 2GNFA 3A99A 1F0QA 3QCQA 4N4SA 5C8NA 4C4IA 2XJ1A 4XOYA 3D15A 5HNBA