3MV5A

Crystal structure of akt-1-inhibitor complexes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
334
structure length
315
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMIRPHFPQFDYSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords v-akt murine thymoma viral oncogene homolog 1 (AKT1)
publication title Design of selective, ATP-competitive inhibitors of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 315
sequence length 334
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mv5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mv5A01
4YLKA 3S2PA 4YZBA 1O6KA 3PWDA 4EHZA 3A60A 3DBEA 5DGZA 4NL0A 5A3XA 3UOLA 4BCKA 3VS1A 4XP2A 1OL2A 4E93A 2PVLA 5DI1A 3ZMMA 4NM0A 3DDQA 2EU9A 2JAVA 3ZYAA 5A4LA 1H1RA 2C3JA 3HKOA 4FTTA 4AOJA 1ERKA 1OKWA 3SXFA 2XZSA 2AYPA 4EBWA 3TV7A 4DLIA 3R63A 1PKDA 2JFMA 3KMUA 4KKHA 3UYSA 3AXWA 3BE9A 3VWAA 2GNGA 4QP9A 4DFYA 4L3LA 1YXSA 5DA3A 4EOIA 4F7LA 2R7BA 1AD5A 1QPJA 4KIKB 2QVSE 2BZHB 2XKFA 3F5GA 4ZS4A 4D5KA 4F65A 5HESA 2I0HA 4RSSA 1OECA 1YHWA 2V55A 1OBDA 2CNVA 3PDTA 5FDPA 3QRTA 5A14A 3RZBA 4PPAA 5AM7A 3O7LB 3ZDIA 5BVNA 3DK3A 5AUXA 2P2IA 4AXAA 1CSNA 2QO2A 4DC2A 3UZTA 3GOPA 4CKIA 1KWPA 3LQ5A 4HGTA 1V0BA 2NPQA 1YHSA 5H2UA 5HO6A 4CNHA 4DH8A 4E73A 2LAVA 1YWVA 3MJ2A 3ORPA 3QD2B 4FTIA 4H58A 4IHPA 5C9CA 3UQGA 2UVXA 5IQFA 2WMVA 3M1SA 2ZV7A 2Z02A 5CU3A 3VHKA 2PYWA 1KE9A 4BDIA 3OOMA 5HTBA 2EUFB 2G9XA 4XG9A 2XIKA 4PUZA 3G51A 3BLHA 1IA8A 3LHJA 4JX3A 4OTRA 5GZ9A 4DCEA 5IUGA 3NW6A 4GT4A 5L8KA 3SXRA 1WZYA 1QL6A 3UE4A 4FZAB 5CWZA 1CKJA 4LRJA 3DNDA 2XK8A 2O64A 4M69A 4ERWA 2W1ZA 4BHZA 4K11A 4DGOA 4DLJA 3CS9A 4BTJA 3LJ2A 3CY3A 2XYNA 4X2NA 4DYMA 2YITA 2XK3A 2WMBA 5EQEA 5AIKA 4WG4A 3AMYA 4PP9A 4FKPA 5KMOA 3UVPA 3ID6C 4PL5A 2BFXA 2X8IA 3UQFA 1FVRA 3OHTA 4D1ZA 3SHEA 3PJ1A 4J1RA 3POOA 3Q4TA 5EQPA 4KNBA 5B0XA 4FIHA 4CFWA 3IW7A 3SW4A 1ZARA 4TTHB 4O86A 3MIAA 4LUDA 3FWQA 3PSCA 4I5MA 4TYJA 1H08A 2R3FA 4I4FA 4BDKA 2FSMX 4ASEA 4M0ZA 2GQGA 3OS3A 3K54A 3P4KA 4IWDA 4UB7A 4AF3A 4E20A 5M4FA 2YACA 4FICA 4O0YA 3KC3A 3LFFA 3QCYA 2HZ0A 2PZ5A 4AQCA 3P86A 3LFNA 3F2NA 3SD0A 2C4GA 4D2VA 4X2FA 5E8XA 1URWA 3DOGA 2C6LA 2XKDA 3G9LX 3KKVA 3OWJA 4NM7A 4L67A 3DZOA 1Y8GA 2C0IA 4FX3A 3MY1A 4MWHA 2VTAA 4Y73A 3VBYA 3TJDA 3GFWA 3R83A 4OW8A 3OZ6A 1OKVA 3V5QA 4BBMA 3CPBA 5E1SA 3QZIA 2F7XE 3ZO3A 2A2AA 4OTDA 5HE2A 3QX4A 4O1PA 2XIZA 2IPXA 2W5AA 2XS0A 5KMIA 1OPLA 3OD6X 3OFMA 4FUYA 4FZ7A 4UYNA 4ANOA 3NRMA 3NUXA 4PRJA 4ZZOA 4E5BA 3E8EA 4BCMA 3VIDA 3FQEA 2C5NA 4X6RA 2J7TA 2XEYA 5IZFA 3GU8A 4XG2A 4EJ7A 2PVYA 3PYYA 3NMUF 4X3JA 2RF9A 4KINA 4I0TA 4ZSEA 3ZRMA 4BI2A 3W33A 3R8ZA 4YU2A 2BIYA 3EQCA 2WU6A 4LOOA 5AJQA 4NU1A 2VWUA 4DTAA 3PY1A 4KIQA 4EYMA 3OW4A 1Y6BA 4AW2A 4CRSA 2VO0A 4TY1A 3ACKA 3P7BA 3V01A 1OBGA 5LCKA 4DH1A 4EOMA 4M3QA 4APCA 3CP9A 5IQGA 3EIDA 4O6LA 1FPUA 5CEKA 1YOMA 2BRBA 3HMOA 4QMMA 2ITPA 5AP4A 3KFAA 3LZBA 5CF4A 1IRKA 3EL7A 3IS5A 4QD6A 3F2RA 3OY1A 4BZDA 1GZNA 3UC3A 2PWLA 2BILB 3PVUA 3JR1A 3HVCA 2HAKA 2WTVA 2BR1A 4CYIA 3HLLA 4ACMA 4FV2A 4EOPA 2R3OA 3F69A 1WBSA 3QRKA 5T6KA 4DFZE 2QG7A 3PJ8A 1BYGA 4NSTA 3HGKA 2W1EA 3W2CA 4DGMA 4EOJA 3CQEA 4YSJA 3DAKA 5FM3A 2I7QA 1NY3A 1YQJA 2VGPA 3A62A 2UW3A 4FSMA 4U0IA 4YTHA 2WQEA 3TIZA 4JG6A 3DCVA 2OICA 4NZWB 5IH5A 3GQLA 3ZLYA 3ZOSA 4EHGA 3PPKA 3FZOA 4OAVB 1WAKA 2PVKA 4X3FB 3A99A 4XS2A 2C6MA 4BZOA 1OVEA 5DT0A 3AT2A 3VRYA 4UWBA 3GCUA 3LXKA 5C27A 4AN9A 4W4VA 4FKIA 4BCNA 2BRMA 2YIQA 1GZ8A 3G2FA 1OIYA 2RG5A 4L01A 2QOFA 2PZPA 4MVFA 3MVHA 3BWJA 2WMSA 5M4CA 4MXXA 2PMLX 5L6OA 3BPRA 4CGAA 4D2SA 4HCVA 1GNGA 5AM6A 4ZLYA 3ZLWA 2XIRA 2R0UA 1Q99A 5T3QA 3IW4A 2WMQA 3EKKA 4LG4A 3R8PA 3ORNA 4AT3A 5M4UA 3F9NA 1PXLA 3T8OA 5LMAA 1M52A 2W4KA 4NW5A 5J87A 3C0IA 2GNIA 4FNXA 4OBPA 4TYIA 3ULIA 4FSUA 4FNZA 3LE6A 4TPTA 1R0PA 2IVTA 3HA6A 4FSRA 4L3JA 1GIJA 3PXKA 5IQAA 4IANA 3A7FA 1BL7A 4XHKB 3GCPA 2EXMA 3A2CA 5ANOA 4ZTRA 2X2KA 4ZTQA 1YWNA 5LWNA 4YZCA 3SXSA 4JIKA 3R9RA 2HELA 4IC8A 1T46A 3MVJA 5AP2A 4L42A 4FK6A 5IU2A 2R3GA 2C0TA 3HAMA 5LARA 3FLSA 2BAKA 4M97A 2X8EA 4V0GB 4X21A 5JEBA 3FMMA 4YJOA 3NVKI 2RFDA 3ZBFA 1U54A 3MPMA 2YHVA 4X3FC 4E5AX 4E6DA 5EHLA 3QWJA 4X0MA 4DEEA 4IDTA 2WZJA 3DBFA 4OGRA 4ASZA 2CN8A 4Y83A 2C6OA 4BB4A 4CTCA 4F6UA 3LKMA 4FL3A 4BL1A 3EMGA 2PVHA 5HLWA 5JRQA 2UW5A 2XMYA 3ODZX 1BI8A 3HDMA 1L3RE 2DQ7X 3Q3BA 5LVLA 4E3CA 4CFFA 1U46A 3RPOA 3G6HA 4O7TA 3EL8A 4IXPA 5CU0A 2J0IA 5LVNA 4CYJA 5HCXA 5A9UA 3GNIB 3WF6A 4O0RA 4FKGA 4TNBA 3U87A 4ENXA 4DT8A 5IQCA 3W1FA 1OL6A 2YM7A 3OVVA 4FG8A 4RZWA 4EOOA 3TDVA 3MIYA 5KZ0A 2VWWA 4JBOA 3TL8A 3PY3A 4I4EA 3QFVA 3RK5A 3NEWA 3HYHA 4GG7A 4G3FA 3I0QA 3E62A 4DFUA 2C6DA 4DEDA 3EN6A 5K0KA 4YC3A 4JBQA 2UZLA 3Q32A 2YM5A 2GHGA 2XJ1A 4ZJIA 1Q5KA 4AP7A 2HY81 2VX0A 4QPAA 3P5KA 3LMGA 1ZZLA 2PUUA 4O21A 3PZHA 1MUOA 2IVSA 3JXWA 1H4LA 4G6NA 2OJGA 5KKRB 1VYWA 2J5EA 3NUYA 3BHTA 3R8LA 4R3CA 1HCLA 2FUMA 5AX9A 3U6JA 3R9NA 3V5PA 4FIIA 2WAJA 4S32A 1UKHA 4KIOA 4YBKA 4YJTA 4PMTA 4YJPA 5LCJA 4RIWB 3N4UA 3NS9A 4X7QA 4DF3A 4Q2AA 4FKOA 3PLAE 4IAAA 3D5VA 4PX6A 2ITOA 2QOBA 3D5XA 3GB2A 4Z7HA 4M7IA 4MYGA 2Y7JA 4CCUA 4KRDA 2X1NA 1Z9XA 3TKHA 3U4WA 2P33A 1KUTA 3SW7A 5EHYA 4KSQA 3D83A 1MQBA 2HWOA 2VWIA 5EG3A 3R7IA 4F7JA 4O7YA 2XCKA 5G6VA 3SOCA 5M09A 3P0MA 5G1XA 4IM3A 5EDQA 5KNJA 2W1HA 1IG1A 4XMOA 4N57A 4S33A 3OOGA 4MQ2A 5M08A 1JKSA 1ZLTA 5AP7A 2XVDA 3AGLA 4PTGA 1H1WA 4WBBB 4HYIA 1SVGA 4FF8A 4U3ZA 4A9SA 2OXXA 3UP2A 2YIRA 3C7QA 3KRXA 4ZOGA 3BWFA 4D9TA 4NKSA 5EW9A 5I9YA 4MCVA 4GK3A 2WTWA 2UZOA 5C8NA 3AT3A 3GU4A 3QX2A 3NYVA 4ZJJA 3MTFA 4DG3E 1PF8A 3UODA 2P4IA 4KS7A 4XG4A 3R7YA 1TKIA 3OP5A 4QT1A 2JKMA 4O7WA 4CLIA 4APPA 2WQNA 2GHMA 3DKCA 2I0EA 3L9PA 1UWHA 1XH6A 4JOAA 3LM5A 2PU8A 3ORMA 2OJ9A 2OIBA 2X2MA 5J1WA 3QTWA 3W2RA 4H3BA 4CV9A 4AAAA 3QTQA 3HDNA 2W1FA 4DFNA 4EZ3A 3DKGA 5JFWA 5KMJA 4FODA 1WVXA 3MH3A 4FT7A 4QTAA 4IB0A 4W9XA 3NPCA 4M14A 5AP0A 3WE4A 5IPJA 3RI1A 4FGBA 3PA3A 1YXXA 3WBLA 4ALWA 1TQIA 5KBRA 3RAKA 3O8PA 5FRIA 5KHWA 3UNJA 4W4XA 5AEPA 2PVJA 3EQRA 5LJJA 3RNIA 2QOIA 2F57A 3CY2A 3NAYA 1SMHA 2XKEA 4ID7A 3VUKA 3ZC6A 2Z7SA 3FYJX 4EC9A 5TE0A 3QQKA 3KXXA 3QQGA 2DS1A 2B55A 2WMTA 4O0VA 5AFVA 4FE2A 3WZEA 4GFMA 3LM0A 4ALVA 1URCA 4BDGA 5IF1A 2OK1A 3DZQA 3TZ9A 4WSYA 3CTHA 4IADA 3FQHA 3LJ1A 4J53A 1YI4A 4EH8A 4U80A 3ZLXA 5J8IA 4QQJA 3FZ1A 4GMYA 4IQ6A 1JQHA 3WARA 4AE6A 4D0XA 2VTIA 4Z7GA 4LMUA 2P3GX 2P55A 5EOBA 1KV2A 1K2PA 3CD8A 4UMTA 3R71A 5JZNA 1FMKA 2JKQA 4IVAA 2QOHA 4QMUA 4I0SA 3S4QA 1H28A 2YAAA 5FQDC 3Q96A 4GJ3A 2PZIA 4G2FA 2XM8A 4LGHA 2YLFA 4YO4A 4Y5QA 5C03A 4HPTE 3NYOA 4L53A 1PYEA 2YIYA 2GQSA 4ZY4A 2G15A 4ZJVA 5CNOA 4FTOA 4NCTA 2WMXA 3FKNA 4LL5A 3WZJA 1NXKA 4EOLA 3HECA 2IZUA 5J9ZA 3HV7A 5HE3A 4B8MA 4DTBA 1KSWA 3ZLSA 3FKOA 1XWSA 1FVTA 1ZYJA 3GC9A 3ORLA 3HA8A 3Q53A 2QO7A 4F0FA 3DXQA 3LLTA 2EB2A 1AQ1A 3A8XA 4FVPA 3FXXA 4YJSA 4ACCA 2R9SA 4MKCA 5I3RA 2PK9A 4U6RA 4I6BA 1M7QA 4E6CA 3G15A 2XKCA 1PXOA 4NUSA 4DFLA 3C5IA 3K5VA 3PSBA 3ZSIA 2WEIA 4JJRA 1H27A 4U8ZA 3R9DA 2WO6A 3RAHA 3U8WA 3IDPA 5B2LA 2VTNA 5A4QA 1PXKA 5KMLA 1S9JA 2BZKB 4O7VA 3ITZA 1W84A 1BUHA 4O22A 5JGDA 3ZDUA 2IO6A 4GJ2A 4RWLA 3NUPA 3II5A 5AV2A 3OCBA 1OGUA 1XH4A 1YVJA 4QYFA 2AC5A 4MNEA 3VJOA 4ASDA 5AMNA 1STCE 2E9VA 3F5UA 1H1QA 3KY2A 2C5OA 2CPKE 1ZYDA 4EKKA 2Z60A 4C02A 4CKRA 3FL5A 3GU5A 3D7ZA 4YURA 4YC6A 4ZY5A 1L8TA 2QKWB 4QMNA 2IZTA 3AC5A 3H30A 4YTIA 2O0UA 2O63A 3TXOA 5EDRA 3FYKX 2PVMA 4CSVA 3QHWA 3ACJA 5AUTA 3F3TA 4QMTA 2PUPA 1Q24A 5DT4A 2BKKA 4NWMA 3AQVA 4H1JA 3BV3A 3EN9A 1YHVA 5TO8A 4C2VA 2C6KA 4FKJA 2YM4A 4XLVA 5HU3A 2GSFA 5JK3A 4JRVA 1ZYSA 3DGKA 4DN5A 1DI9A 1YOLA 3QKMA 3DK7A 4CRLA 4K77A 4HCTA 4EKLA 4GIHA 4FZFB 5K9IA 2GFSA 3FLZA 4EK8A 4QPMA 4CQGA 4R3PA 4R5YA 4AWIA 1R39A 5E1EA 4F63A 2W99B 5FTOA 3H0ZA 2I0VA 2B53A 2B52A 3JS2A 4A4LA 4IH8A 3BGPA 3ALNA 3ZM4A 3ENHA 1IASA 4JG8A 5HTIA 1B39A 2ZB1A 4FOBA 4MXYA 1Q8TA 3A4OX 3IECA 4K0YA 5DLSA 5GJFA 1YI3A 1V0PA 3DBDA 3E88A 3IONA 4HPUE 5E90A 2OFVA 2ZVAA 3SAYA 4C4EA 4MEDA 3TWJA 2BPMA 3KREA 5LWMA 2A4LA 3DPKA 5CNNA 5IA3A 4JDKA 4BDJA 4YNOA 4UX9A 3FZRA 4O81A 2Z2WA 2JLDA 4PDOA 5D9HA 3JYAA 5CVGA 4GCJA 5HZNA 3C4FA 4YJRA 3L9LA 2QOLA 3CXWA 3EZVA 3BEAA 1PXIA 3CJFA 3HL7A 3R1NA 4TWOA 2YLEA 2FO0A 3H4JA 1JKLA 4LGDA 2ZOQA 4DH3A 3LFDA 3RINA 3DK6A 4FYOA 1DAWA 4UYAA 3VS3A 3ZHPC 5F9EA 5E8YA 5H8GA 4F1TA 1UNLA 5CF6A 4QQTA 4O7RA 5TT7A 4EC8A 1B38A 1FGKA 4NKAA 4XOZA 4P5ZA 4YGAA 4ARKA 1K3AA 2OJIA 1UU9A 3EFKA 3QD0A 2VX1A 3W8LA 4CFUA 1OIQA 2UZNA 4FI1A 1M2RA 4PMSA 3M42A 5CT0A 2ITVA 4UXQA 4IC7A 4C7TA 5JZJA 5T68A 3VF8A 2ZV2A 3BYSA 3D4QA 1OPKA 2OH4A 4XNEA 4G6OA 5BVWA 2YCQA 3VQUA 4BWPA 1O6YA 3ATSA 3VS4A 3GU6A 2GCDA 2VTHA 3FMHA 3Q9XA 3C0HA 2WEVA 3GCQA 3KQ7A 3VUTA 1I44A 3KF4A 3NZ0A 4XG6A 4RWKA 4M13A 2I1MA 3D5UA 4HNIA 4O84A 4CQEA 5CEPA 3F3VA 4Y95A 1KV1A 3KEXA 4HGEA 2BAJA 3BU6A 4K33A 3I79A 4BFMA 3Q52A 4ACDA 2YCSA 4PF4A 1WBOA 2PZRA 4AN2A 4AW1A 4PDYA 4QMSA 4B6LA 4QTEA 4NM3A 2R3NA 2ZYBA 3OUKA 4JS8A 4ZY6A 1PMVA 4FVQA 4QYEA 4U44A 5KHXA 3QD4A 3AGMA 1R3CA 4FTAA 5B2KA 3OXTA 5HO8A 2ZV9A 3F3UA 3TNIA 2PUIA 2AC3A 1WBPA 5BVKA 3CBLA 2QU6A 3OEZA 3I81A 3Q9ZA 5LMBA 3FY0A 5CSWA 5KX8A 5CYIA 1XH7A 5AA9A 4M68A 1BL6A 2OF4A 3F88A 4QQCA 4C3FA 3KXGA 5C4KA 3OTVA 5KE0A 4L9IA 4LMNA 4QP1A 1JWHA 3D7TA 2GNJA 4IJPA 4CXAA 3MTLA 4BN1A 2R5TA 3UDBA 4AZWA 4NFNA 3LCOA 3E8DA 4E7WA 3R8UA 4ZLOA 3QUPA 4BDHA 3IDBA 3Q2JA 4YSMA 1WVWA 2VO3A 5FTQA 1O9UA 2VN9A 2W05A 3O17A 5EM8A 3ZO4A 3ZEPA 5DRDA 5CSPA 4BYIA 1AGWA 3R01A 3PG3A 4PV0A 1EH4A 5EM6A 4BC6A 3LFQA 1ZOGA 2B7AA 4FG7A 3HMNA 5HE0A 4A9YA 2XYUA 4WRSA 4C2WA 4UZDA 5JSMA 3R7VA 4Z3VA 3E87A 2QU5A 5DT3A 1TVOA 2UW9A 4LUEA 3R7EA 4TL0A 3ORKA 5C4LA 3PFQA 3QQFA 3HV3A 2GNFA 3ELJA 4RIXA 5DOSA 4W4YA 5IA5A 3LXPA 4H3PA 4GKHA 4M8TA 4DE4A 3BCEA 3L8PA 4I93A 4HVSA 5BNJA 1Q62A 4OTQA 5CU2A 2WXVA 4J98A 2HCKA 1YDTE 2CDZA 4WO5A 4D4RA 4ERKA 2WHBA 4W8DA 3C4WA 1KE5A 3FE3A 2YAKA 4G9CA 4Q9ZA 3FXZA 3CPCA 4BY9E 2E2BA 2JKOA 2NRUA 3Q6UA 3DQXA 4R7HA 3IW6A 5AP1A 1OPJA 3LLAA 4AGUA 3VUMA 3MH1A 1FOTA 4GG5A 4I24A 2O3PA 3O50A 4LOQA 3TCPA 3VUDA 2Y6OA 3ZO1A 4B7TA 3RCJA 2F9GA 4JG7A 4L43A 2GS2A 3LXNA 4BTMA 3DLSA 1U59A 4OBOA 3EFWA 3UC4A 5LMKC 3TUDA 4NIFB 1U4DA 2GMXA 3BYVA 1BKXA 4H1MA 2BIKB 3VUIA 4NEUA 3ZSGA 5CANA 4Q5HA 4AZTA 3W2OA 5K5NA 5FXRA 3FY2A 2HXQA 5JFSA 3FHRA 1YWRA 3CCNA 3GENA 2J0LA 3PUPA 3PVGA 2G01A 3RALA 3OMVA 1BX6A 2PE2A 2XNGA 1PHKA 1PXPA 4H39A 4JLCA 3OCSA 3DU8A 3UIXA 5IEYA 2BDJA 4F7SA 2QHMA 1NA7A 2VUWA 3L9MA 3FEGA 4HVDA 2QCSA 4BTFA 3MH0A 2ONLC 4ONAA 3CGOA 3TNQB 3MS9A 5CALA 4GKIA 3UMWA 4DFBA 4YO6A 3GXLA 4RIYA 4P5QA 4RFZA 2KTYA 4JIAA 4TW9A 4I0RA 2YM3A 3UQCA 4BICA 2ITWA 4B8LA 2I0YA 3COMA 2W06A 3C4CA 2A0CX 1PXMA 1Y91A 3K2LA 4JT3A 2C1AA 4O7NA 3DQWA 3OBGA 5CU6A 3WILA 3VF9A 2XF0A 4P4CA 2X4FA 3ORZA 2GS7A 2XIXA 2GTNA 3OF0A 1HOWA 3HMIA 2ETMA 3QQLA 3AD6A 4RWJA 1W82A 2JDVA 5F4NA 3PE2A 4G3EA 3ZUUA 3MVMA 4J8MA 3RM6A 4C4IA 4IB3A 4YZMA 4F08A 4QP2A 2IZRA 4EONA 4GVAA 3K3JA 3TDWA 5IG1A 4RLKA 3ZUVA 5DEWA 2PVNA 2RSVA 2YABA 2CMWA 3PXRA 4HVGA 5JKGA 3HRCA 1RE8A 4RVKA 4EK6A 5FDXA 2YJRA 3GC8A 2CJMA 4BYJA 1FBNA 3LMIA 3UVRA 3DNEA 3I6UA 4GK4A 5IMEA 3KB7A 4GU9A 3QU0A 5EYMA 5IDNA 2NRYA 3FUPA 4HJOA 5GJDA 3E8CA 4FMQA 3EQBA 3IW5A 2KULA 4RVLA 2J0MB 2ETKA 3QTRA 4D55A 4C4GA 3VBXA 2J0JA 1PKGA 4FA2A 3WOWA 1XO2B 3E92A 2QURA 3DXPA 3QZHA 4D4SA 2XRUA 5J5SA 3UIBA 3NCGA 2E9NA 2Y4IB 3C13A 4IZ5A 3VNTA 1QPEA 3I6WA 4BBEA 4GS6A 3W2SA 4CG8A 2UZVA 3SLSA 4U9AA 2HW6A 5DWRA 5CXZA 3QTIA 1PY5A 2OO8X 5CZIA 3PIXA 2CGWA 3FI4A 3GFEA 5EI6A 5CENA 4DEIA 5E4HA 3IQ7A 3MGYA 4DCAA 3EHAA 3ZS5A 5M53A 4XV9A 3UG1A 3CD3A 2YZLA 2RL5A 5AUWA 3AMAA 3U55A 1FMOE 2QOQA 3D14A 3TG1A 4CT1A 3KVWA 3RAWA 1XBAA 4TYHA 5CTPA 1SNXA 2BRNA 1XR1A 3DS6A 3MI9A 4D2PA 3RPSA 4U40A 4WG3A 5BYZA 4CZUA 3LOKA 5A4CA 5HHWA 5M4IA 1IAHA 5H8EA 4Y5HA 1DI8A 3FQSA 3VUHA 4UMPA 4DEAA 3ZFXA 3TV4A 1J91A 4IB1A 4BIEA 4DBXA 3ZZWA 5CVHA 1WCCA 4IBMA 2RFNA 5ANGA 3T9TA 5L2SA 4QP3A 2ITYA 3I0OA 4JAJA 4L8MA 5C26A 2XNEA 1JKTA 4JBVA 2IVVA 4RJ4A 3PXZA 5D7AA 3SOAA 3W2PA 4UWYA 3BBWA 3FI2A 3FC2A 5HNGA 3EQGA 4E4LA 4EOSA 4GU6A 4DH5A 4BRXA 4AFJA 4B4LA 3B8QA 5HVKA 3NYXA 2RKUA 3C0GA 4OR5A 4BIBA 5GNKA 4U41A 3VQHA 2UV2A 5J7BA 2Y4IC 2QKRA 4A06A 1WBWA 4BF2A 4C37A 4KBAA 4YPDA 4D28A 5AAFA 3ZONA 4WA9A 4HW7A 2F49A 2R3PA 2G2IA 3TI1A 1ZXEA 3Q6WA 1VZOA 3UJGA 4RPVA 1WFCA 4FTNA 3NSZA 3RHXA 5EQYA 5CQUA 4FTMA 3B8RA 2JDRA 1UU7A 2UW0A 1CTPE 4C0TA 4YNEA 4L7SA 2QOCA 3DJ6A 4GW8A 4L68A 5IKWA 4G3DA 3QRJA 4F9BA 3R21A 4FKUA 2G1TA 3LCSA 3N4VA 4HGLA 5AIRA 3GQIA 3ZRKA 1Q61A 2PMIA 3KVXA 3SQQA 4DG0E 4DITA 4YTFA 2A27A 2EVAA 2OSCA 5EFQA 2C5VA 3QKKA 4BHNA 3LFAA 4FC0A 4J71A 1W98A 3KCKA 4NCTC 3F2AA 3PG1A 4RJ8A 2YFXA 4A9RA 4ITJA 5K0XA 3FPMA 2F2CB 2WPAA 3FZSA 3ZFMA 2R2PA 4HNFA 4DGLC 1NW1A 4UMRA 4DTKA 1MQ4A 2OZAB 3BI6A 3RVGA 4E6AA 4JQ7A 3DAJA 4ITIA 2Y0AA 3FHIA 2VO7A 5BPYA 3QF9A 4EQMA 5CXHA 2R3HA 5AP5A 4ZTLA 2OJFE 3SC1A 3V5JA 3ZZEA 5LVPA 3GEQA 4FTRA 5HU9A 4UBAA 3UIUA 1UV5A 2I40A 3ETAA 3CQUA 1OL7A 4NJDA 3BEGA 3P7CA 2HZIA 2JBOA 3KMMA 4C4FA 4CFMA 5FGKA 3RTPA 4CVAA 2O5KA 3UP7A 2YWVA 2Z7QA 4AS0A 1OI9A 3NWWA 3AC4A 3ANQA 5DIAA 4EBVA 3IPHA 2V62A 4WOVA 5JGBA 4ZXTA 2ERZE 4RC4A 2UW6A 3OT8A 1ATPE 4IM0A 5JRSA 4D9UA 3VW6A 5ETIA 1Y57A 3ANRA 5CF8A 4PL3A 4BCPA 4PNIA 3UGCA 3R02A 4USFA 4J96A 2YCFA 2C6TA 4UALA 5B2MA 3LXLA 4KIKA 2CNUA 1OIUA 3DJ5A 3OCGA 3RPYA 3DV3A 2BVAA 2VWBA 3GBZA 3LCTA 4G6LA 5E92A 4CZYB 2BZIB 1Z57A 3G9NA 2HZNA 3A8WA 2ERKA 3QTZA 2AUHA 3KK8A 4FYNA 4MX9A 5FXSA 5CEQA 1MRYA 2SRCA 3FSFA 4FTQA 3V8TA 1UA2A 4NJ3A 2DYLA 4FIEA 2P0CA 5HLNA 5E8WA 5ACBC 4TKSA 2R3QA 3EWHA 4PWNA 1J1CA 4DAWA 5DNRA 1JOWB 3D2KA 3MVLA 4JQ8A 4AOTA 3S0OA 3U51A 3CLYA 4FL2A 3FBVA 4GL9A 4JDIA 1W7HA 3I60A 3HMMA 3IGGA 3LIJA 3MY0A 3V5WA 4BI0A 3P9JA 4KWPA 2CGVA 2PHKA 2X6EA 5A54A 3P1AA 4J52A 4FV8A 5M55A 2ESMA 1P2AA 2B1PA 5IISA 5EYDA 4CMTA 5AP3A 3BBTB 2WMAA 3VS0A 4D0WA 1Q8WA 3QC9A 3SA0A 1JVPP 4JBPA 1JNKA 2CN5A 2VTPA 3DFAA 3HP5A 3R1YA 2PL0A 3MA3A 4ENYA 4F6WA 2CHLA 3EFLA 3R0TA 4HOKA 5EYKA 3T3UA 4BZNA 1UWJA 4G3CA 3SRVA 4DFXE 5BVFA 2XJ2A 2VV9A 3W8QA 5EI8A 3VS7A 2VNYA 3G0FA 4XRLA 4A07A 4ZMEA 3DLZA 4M67A 3KN6A 2H8HA 5KKRC 4DEHA 3E8NA 3V8SA 4MNFA 4C57A 4EH2A 4USEA 3AD5A 4F0GA 3V8WA 4R3RA 3MW1A 1UU3A 4KIPA 2WTJA 3PWYA 4NYEA 2PVRA 3DKFA 4HVIA 5L2WA 5CSVA 1RJBA 2YN8A 3MB7A 2BAQA 3V5TA 4FT0A 4AGCA 5HBJA 4ZIMA 4EQCA 4YJQA 4E4NA 3VRZA 2CCHA 2QD9A 3KRRA 3QHRA 3ZUTA 5CSXA 3UNKA 2X8DA 3EH9A 1PRYA 5L6PA 2XK6A 3AC3A 4ASXA 4F0IA 1MP8A 4P90A 2PZYA 2OF2A 3WIGA 5BYYA 1WMKA 5GINE 4NK9A 4ZK5A 4MD7E 4GFGA 5M56A 3O2MA 1BMKA 4I21A 1JSVA 1XBCA 4TT7A 4BWKA 5D10A 2BALA 2IJMA 4DG2E 4RX8A 4I92A 3RPVA 2CGXA 2GFCA 4G31A 3A7IA 3UBDA 5GZ8A 4IEBA 1T45A 1LPUA 5E9EA 5I9XA 3BHUA 5IH4A 3QLGA 5HQ0A 1F3MC 3GOKA 5D11A 4F99A 2NP8A 3UOKA 3LMHA 4ORKA 3NW5A 4IIRA 2FVDA 1M2PA 4AGDA 3TN8A 4DBNA 4R77A 3L8VA 1Q41A 3O8UA 3MYGA 3D7TB 2VRXA 5I9VA 5GJGA 1ZMWA 2W1IA 3PIZA 2VWZA 4FL1A 2WQMA 3C4ZA 4D2TA 5AP6A 1WBTA 2EXEA 2FB8A 4DH7A 2UZUE 3E3BX 4EL9A 4EQUA 3OCTA 5M51A 3G90X 5J1VA 3FV8A 3LFEA 2J0KA 5FBNC 3KRLA 4QTDA 3SV0A 4F1MA 4RVMA 4ZP5A 4G17A 1R0EA 3TZ7A 3H3CA 4RG0A 5TR6A 3N4TA 2Q0BA 3G0EA 2XK9A 4CFXA 4BTKA 3AT4A 4CKJA 4Y46A 4OBQA 2V22A 4C35A 3WYYA 3WE8A 3QGWA 2JBPA 4I1ZA 1H8FA 3CQWA 2C5XA 1QMZA 3MSSA 1GJOA 2BDFA 5E8VA 5AR2A 3PRIA 3DA6A 3EZRA 4AZEA 4K9YA 2ZMDA 1KOBA 2X39A 3ZC5A 2Y9QA 3KK9A 1Q4LA 3QD3A 4XLIA 3EQPA 2J2IB 1ZRZA 4CMOA 4JRNA 4IZ7A 4PMPA 5BMMA 2JAMA 4S2ZA 4R7BA 4IVCA 1YDSE 4R1VA 3PE1A 5HD4A 3BELA 4B9DA 4EHVA 1M14A 3QRIA 3ATTA 5AX3A 1SZMA 4LM5A 4YUQA 4DEBA 4Q5EA 2H9VA 3BZ3A 3MBLA 5ETFA 5HIDA 3V6SA 3Q60A 3H10A 5IEXA 1ZYCA 2XK4A 4X3FA 5C1QB 5HD7A 4EWHA 1JLUE 2BHEA 4FV4A 4C58A 3DB8A 4E4XA 3F82A 3THBA 3VBWA 4BCFA 3RNYA 2QQ7A 3R2BA 4K8AA 3WZKA 2YIXA 4ALUA 4F9WA 3A7JA 3EQIA 3V6RA 4AX8A 3QZFA 4EZ7A 4QRCA 2HXLA 3TKUA 3UIMA 2PMNX 4S34A 4IVDA 4BCGA 5DR2A 3NW7A 4M69B 4C59A 4V01A 2V5QA 2WQBA 4WD5A 3VULA 5CAUA 2UZEA 3M11A 5D41A 1IA9A 4IWPA 3U6IA 4Z16A 4A7CA 3FI8A 3F5PA 4TWCA 4GEOA 4KD1A 5EW8A 2BCJA 4WNMA 4FSQA 1QCFA 4QP6A 3W16A 4XG7A 3MY5A 4YLJA 4C61A 2IW6A 4NTTA 3TKIA 4ZZNA 5BYLA 4U7ZA 1R78A 2RIOA 3VHEA 5DN3A 4AT5A 4EK4A 3NAXA 2WTDA 1H0VA 1LEZA 2W5BA 5ANDA 4RIYB 4QP4A 3HV6A 5CAPA 2PUNA 4G9RA 2IW9A 2HYYA 2B9JA 4ANBA 3UNZA 5LVMA 3R00A 3AG9A 3TTJA 3NUSA 1H25A 2W5HA 3C1XA 3MJ1A 2HK5A 4QPSA 5ANJA 5L2QA 4QP8A 3RCDA 5AA8A 2OJJA 4GUEA 5KMKA 1WVYA 4V0GA 3W55A 4OTGA 3GGFA 4ZEGA 1CKPA 5EOLA 2OU7A 2ZMCA 4QP7A 3WF8A 4YHFA 3ZO2A 3ZFYA 3BV2A 3UZRA 4DEGA 3VS2A 3QKLA 3I1AA 5EH0A 4ZZMA 2RFSA 3NNWA 4PL4A 4RX5A 3LCDA 5D12A 3Q4ZA 4RGJA 4ZSGA 3S1HA 3QZGA 3RPRA 2CCIA 2EB3A 5GZAA 5E91A 4RX7A 3R8MA 4I20A 4KS8A 3PPZA 5H9BA 1IR3A 3VC4A 5HIEA 2X0GA 2YISA 4EH5A 4U81A 4YR8A 4FIFA 1ND4A 1LUFA 1B6CB 1U5RA 4MBLA 4MWIA 4EOKA 2JGZA 4GV1A 2YCRA 3AMBA 4BWXA 4FSWA 1OKZA 5IUIA 4USDA 2HENA 2R0IA 3A7HA 4RA5A 5EYCA 1DS5A 3PIYA 4KABA 4TZRA 3OT3A 2RGPA 4OTWA 4FKWA 1YXUA 2WMWA 4GT3A 2VD5A 3V3VA 4M0YA 2RFEA 3E5AA 4W9WA 4WT6A 3SX9A 2JFLA 4NFMA 4UMQA 2X4ZA 5AR4A 4C36A 3HMPA 1I09A 3O7LD 5HG9A 3QYWA 3WF5A 2W1DA 3NYNA 4O91A 5J9LA 2XCHA 4AACA 5A46A 4QMZA 5IEVA 3I7BA 4KKGA 3O96A 4R5SA 2ITUA 4RLLA 3R1QA 4P2KA 3QYZA 4RIWA 4EYJA 3DKOA 1BLXA 3WZDA 3TM0A 3C5UA 1ZYLA 3EOCA 3H9FA 3QAME 3TZ8A 4A4OA 3D0EA 3EKNA 1P5EA 4NT4A 4QNYA 5FXQA 3BX5A 1OZ1A 3DT1A 4U43A 4IZAA 5CEIA 3R6XA 2FH9A 3PXQA 4FBXA 2WELA 3F7WA 3DY7A 5IH6A 3KCFA 5KZIA 4Z55A 3R1SA 3PP0A 3KL8A 3LFBA 1RW8A 3RGFA 2VTJA 3FAAA 5BUIA 3NIZA 4F70A 1OB3A 3VS5A 4IFGA 4IAZA 1G8SA 4TXCA 1ZMVA 3FPQA 5H3QA 4F4PA 2ACXA 4WRGA 5BVDA 5CF5A 4M15A 2WNTA 5BUEA 1ZY5A 4FEVA 2W7XA 2IWIA 4G5JA 4GH2A 2WIPA 4PQNA 2VWYA 3KA0A 1ZY4A 2QLUA 2CKPA 1YW2A 3NGAA 4ITHA 2WGJA 3D5WA 3FLYA 4RIOA 3RM7A 5E8ZA 5IUHA 4IX4A 3B2WA 5FM2A 4FTJA 4LRMA 4F9YA 4AW0A 4BCOA 4BDAA 3GCSA 3DB6A 4X2KA 4E5WA 4F64A 3MESA 1YKRA 2J51A 2ZJWA 3KF7A 2OW3A 2ZV8A 4L46A 4L00A 4QQ5A 5HIBA 3JVRA 2YM6A 3GCVA 2C30A 3NNUA 3R2YA 1UNGA 3EJ1A 5FEEA 5CQWA 5C8MA 4C4HA 5CY3A 5FEDA 4QTBA 3COKA 4FIJA 2ZDUA 4FEQA 3PJ2A 5M06A 4TN6A 1KOAA 1JKKA 2JDTA 4I41A 4FNYA 3CTJA 4TWNA 3RHKA 3W10A 4PDPA 2X81A 4MXOA 3EQHA 4AW5A 2J5FA 3CE3A 4YMJA 5EKNA 3RKBA 3ZXZA 2V7OA 5J9YA 1V0OA 4ANLA 4BCHA 4NM5A 3MV5A 4WKQA 4YJVA 2X7FA 4WBOA 4ANQA 3GC0A 3QCQA 4J97A 5EI2A 3TJCA 4YJUA 4IW0A 1IAJA 3MDYA 1JBPE 3FMNA 4QMLA 5JH6A 2VTOA 3UMXA 3F7ZA 3ORXA 3TEIA 4AGWA 3KULA 4N6YA 2XH5A 2CSNA 2V0DA 1XQZA 5JT2A 3JY0A 2I6LA 1U54B 2BTSA 2C1BA 2QO9A 4I6HA 3R28A 4ZTHA 2ITTA 5AUYA 5CEOA 5M44A 4O0UA 4N6ZA 5JMSA 1OM1A 3MFTA 2JITA 4C3PA 1J7UA 2BRGA 2X7GA 3IW8A 3LPBA 3BYUA 5DPVA 4RFMA 5AV3A 2VGOA 5AUVA 1H1PA 5GHVA 3POZA 2OIQA 3IOPA 4IMYA 3TUBA 3H0YA 2GNLA 2VNWA 2VO6A 4IX3A 4EUUA 2H6DA 3IO7A 2O8YA 1A9UA 1F5QA 2QG5A 4AZFA 5BVOA 3LQ3A 4NW6A 4WUAA 4C3RA 1VEBA 2QHNA 5HO7A 3DAEA 4RRVA 2REIA 4BDEA 3BLRA 3ERKA 4PTEA 3IKAA 5IQBA 4YLLA 5K5XA 2OIDA 4I6QA 3ZXTA 2CKQA 4OTHA 1PYXA 4RC2A 4I5PA 3SG8A 5CAOA 3GI3A 4BGHA 4BVUA 2ZB0A 2A1AB 2VTQA 3QBNA 4W8EA 4GK2A 4GRBA 3K5UA 3QA8A 3QTXA 4XBRA 5CAQA 2UW8A 3C9WA 5HOAA 2EXCX 3BLQA 4G5PA 2BFYA 3F5XA 4ZTSA 4O38A 4EH9A 2Y6MA 2J4ZA 2V7AA 3BQRA 4IACA 2GDOA 4UY9A 1OL1A 4QMXA 4L6QA 3EYHA 2LGCA 4U42A 4FGRA 1E9HA 1RQQA 5DH3A 5DEYA 4DINA 5AV4A 4RZVA 2PULA 4LL0A 4YHTA 3VBTA 2H96A 3SGCA 5DYJA 2JIUA 3ZTXA 3N9XA 4MK0A 3CJGA 4OUCA 1XH8A 2VTRA 4LGGA 5DHJA 3PLSA 4CV8A 4XCUA 2WFYA 4AT4A 2QI8A 2WTCA 4FIGA 3EFJA 3KXZA 4D5HA 3RZFA 3QA0A 3JY9A 2PY3A 3FKLA 4FTLA 3EQDA 3QTSA 4CT2A 2VZ6A 4Q9SA 2X6DA 4O96A 4XRJA 4RBLA 3QL8A 4LFIA 5J7HA 3ULZA 3GUBA 4XP0A 2CNQA 1DM2A 3E63A 3R04A 3ZU7A 2OZOA 1NVRA 4L44A 4QNAA 4XOYA 3OC1A 1PMEA 2YDIA 4O1OA 5CX9A 5CZHA 3PZEA 3RBWA 5IQEA 4PY1A 4CTBA 4XEYA 3MFRA 3SRVB 2B54A 3BHVA 3JUHA 5D7VA 3KXMA 1CDKA 3QCXA 3BHHA 5EDPA 4AZVA 5JFVA 5CLPA 1FVVA 5L3AA 3R8VA 4UXLA 1UU8A 1W83A 4FK3A 4RT7A 5L4QA 4OAUC 3PA5A 1A48A 3FSKA 1PXNA 4MXZA 1GY3A 1MRUA 4DGNA 2BHHA 2XB7A 4E1ZA 4G34A 4GUBA 4LQMA 2HIWA 5DFPA 3R7UA 3CKXA 3WF9A 4LRKA 4FR4A 5F20A 4QYYA 2WOUA 3BU3A 2ZM1A 4AE9A 3VUGA 3L1SA 2VTMA 2VTSA 3TTIA 2XM9A 3O71A 4YP8A 3ZBXA 5IA0A 5FP6A 3FMKA 5EHOA 3NIEA 2OI4X 1Q8ZA 2YZAA 3EQFA 3R9OA 2UW7A 3L9NA 4ACGA 3NLBA 2F2UA 1CMKE 3DJ7A 4MXAA 3V51A 4GT5A 4RX9A 4FSNA 3RWPA 4IZYA 3DBQA 4BKZA 3RAIA 1BI7A 1OKYA 1ZAOA 4DT9A 5H8BA 5HNBA 5AR8A 4M66A 3DTWA 3JPVA 5L6WL 4ZTNA 1FQ1B 4JL9A 2ITZA 4GIIA 3HP2A 4BGQA 1XKKA 4OTIA 3HUBA 1ZOHA 4LOPA 5HG8A 5LQFA 4UMUA 1VYZA 1Q97A 3E64A 5BUJA 1SVEA 3QWKA 3MN3A 2UUEA 1MRVA 4G1WA 4V05A 3LFSA 2F4JA 5E7RA 2RG6A 5HKMA 2VX3A 2Z8CA 1KE6A 2YERA 4XX9A 4C34A 4E6QA 4O2ZA 3BE2A 4YTCA 2F7EE 1Q8UA 2BDWA 3OWKA 4IM2A 5I9WA 4IWQA 4C4JA 2DUVA 5L8LA 2ZM3A 1PW2A 2QOOA 5GIPE 2WMRA 4H05A 5JQ8A 3CKWA 1OUKA 2W1CA 4FTUA 2C6EA 4R1YA 2ITNA 2ITXA 3WF7A 2Z7LA 4BDFA 4C62A 3UO5A 5HCZA 2WD1A 1Z5MA 1SVHA 3MFUA 4AA4A 5CT7A 4BCJA 5DG5A 4OTFA 4QMQA 2Y8OA 1JAMA 4BDCA 2Q83A 4FVRA 3COHA 4FTCA 3VAPA 4MXCA 1UVRA 1ZMUA 4EH7A 4EOQA 2EWAA 5M57A 1TQPA 3EN5A 5IMXA 1XH9A 2UZWE 3D15A 3NUUA 3NX8A 4AG8A 3JVSA 3EN4A 5DRBA 5IDPA 4FNWA 4IVBA 5F1ZA 1Y6AA 4D1XA 4EHEA 3N51A 3VBVA 4EH4A 3U6HA 1U5QA 2BRHA 3F66A 4FV9A 2PTKA 5CEMA 4JNWA 3PSDA 5E8UA 4C38A 5L2TA 4J7BA 1P4FA 4FEWA 5IA2A 4Y85A 5IQIA 4FV5A 4PDSA 4FEXA 3PVBA 4FKLA 4WG5A 2CLXA 3CTQA 4ANMA 3UYTA 1APME 1XH5A 2J9MA 4FSTA 4IX6A 4LYNA 2WOTA 1YI6A 3QUDA 4WSQA 3ZRLA 5FTGA 3NNVA 4RFYA 3ENMA 5TOZA 4WNOA 4LV5A 2OGVA 3UZPA 4MNEB 2QODA 4IE9A 5HG5A 4AUAA 4EORA 2HW7A 2C68A 4G16A 2BKZA 4O2PA 2XBJA 3CEKA 5EM5A 5K4IA 2VU3A 1H00A 2GTMA 2B0QA 1LEWA 2WB8A 3LJ0A 2OWBA 1W8CA 3FMDA 3TACA 1YXTA 2XA4A 2CGUA 3HRFA 3LQ8A 5A4TA 4EJNA 3G33A 2UZTA 4RA4A 3L8SA 2OBJA 4BI1A 2QONA 4I23A 3NR9A 4FSYA 5FEQA 3HX4A 2IW8A 2JDSA 2W4OA 3MB6A 4TYGA 5A6NA 2GNHA 2CKOA 3NUNA 4BDBA 4JXFA 5HORA 1FINA 3U9NA 1GZOA 2PMOX 4O82A 1NT2A 2YM8A 1YXVA 5HEZA 4UV0A 2YDKA 2PE0A 4FZDB 5AUZA 5JGAA 4KBCA 5DR9A 2JD5A 3BGZA 3FMEA 2QR8A 1VJYA 3KU2A 4F1OA 4W4WA 4I94A 5LMKA 2R3RA 2GS6A 4BKYA 3OWPA 2HWPA 3FDNA 5HLPA 2C3KA 3T9IA 3UPZA 4IB5A 3QUEA 3BRBA 4XJ0A 1PMNA 2W9ZB 3FMJA 2G2FA 3F6XA 4J99A 4MHAA 5LOHA 2B9HA 3KRWA 4HZSA 1YOJA 5J95A 2PE1A 5HICA 3F3WA 5A4EA 2YIWA 3UO6A 2XNNA 2XNBA 4FOCA 5HBHA 1OUYA 2XNPA 2J90A 2YJSA 3ZM9A 1OMWA 4S30A 4FKRA 4FV0A 5CI6A 3ORIA 3CSVA 4O0SA 3SVVA 4F09A 3A4PA 4RJ3A 4ZS0A 1Q3WA 3QRUA 3IOKA 4UZHA 1J7LA 1H24A 5FWKK 2IG7A 2ONLA 5HGIA 4HVHA 3D2IA 3DXNA 1E1VA 1W0XC 4FG9A 2VWVA 4EZ5A 3IK3A 4J8NA 4JVGA 5HX8A 2C69A 1NVQA 3MWUA 2P2HA 3P08A 3Q5ZA 5BMSA 2GHLA 3KXNA 2VAGA 3O0GA 3F3ZA 3OW3A 2YEXA 3FXWA 3QALE 1GZKA 5I4NA 3NUAA 2QC6A 3HUCA 2J6MA 4ANNA 4K1BA 3MA6A 5I9ZA 2JC6A 4QMOA 3RP9A 3Q4UA 3V04A 4XYFA 3EN7A 3NNXA 3UOJA 4O7SA 1M17A 2W96B 4QMYA 1G3NA 4D58A 4MF0A 3R7OA 5DVRA 3REPA 5AUUA 2UZDA 4LI5A 3UOHA 2C0OA 5I0BA 2WTKB 1M7NA 1R1WA 4NIFA 5LXMA 1ZWSA 3MPTA 4NH1A 2UZBA 5ACKA 1DAYA 3Q5IA 3D9VA 4U3YA 5E8SA 4A4XA 1J3HA 3P23A 3TNWA 4K18A 3Q4CA 3E3PA 4FV7A 2BTRA 3HV4A 4FT9A 3PRFA 1XJDA 3FMLA 4N4SA 5AWMA 3TUCA 2XEZA 3C50A 4OT6A 1H0WA 4JDHA 2WMUA 4XG3A 4BDDA 4PPBA 5DBXA 4KKEA 2OXYA 2O2UA 4MF1A 4O27B 1REJA 3KXHA 2OH0E 2NO3A 4FV6A 3PPJA 3R9HA 1GOLA 3OXIA 4R78A 3PP1A 4BBFA 3KN5A 3LCKA 3LW0A 3I4BA 3VJNA 4FKQA 3BU5A 3MFSA 4KA3A 2X2LA 2GPHA 4D1SA 4LV8A 5AV1A 5DMZA 5BVEA 2ZAZA 5ITAA 3R30A 2E9OA 5HX6A 3HAVA 1OIRA 4O7ZA 1S9IA 3WYXA 2QNJA 2R3MA 2WIHA 5HVYA 2FSOX 5HI2A 2ZM4A 4OT5A 5B7VA 4IAFA 1Q8YA 4J95A 4FT3A 5DR6A 5JFXA 4OLIA 4N0SA 1TQMA 4RQKA 4Y72A 5HNIX 4BCIA 1G5SA 4G3GA 3PXYA 3I5NA 2DWBA 2B9FA 4O0TA 3LFCA 2WTKC 4FSZA 3VN9A 4AA0A 4MBIA 3ORTA 3DDPA 3OBJA 4YHJA 5AR5A 4E26A 4Z9LA 3E93A 3NDMA 3NVMB 3G5DA 4DHFA 4XH6A 4EWQA 3HNGA 4F7NA 2XBAA 4XG8A 4GVJA 4Y8DA 4AN3A 2IZSA 4I6FA 4PP7A 4FKTA 4XV1A 2OXDA 2UW4A 3P79A 4JR3A 5KCVA 2OFUA 3HEGA 2ZDTA 4JX7A 3TZMA 2PSQA 3W2QA 3BYOA 3OWLA 3ROYA 3UTOA 4A9TA 1QPCA 3BGQA 3FLNC 3OY3A 1G8AA 2B9IA 4JAIA 4QYGA 4PPCA 1K9AA 3KULB 3OG7A 3I5ZA 3NCZA 4TWPA 2W17A 1Q3DA 4H3QA 3VO3A 3AC1A 3G6GA 3MPAA 3BYMA 2J50A 1OITA 4JI9A 5KUPA 3QQHA 5J79A 5HE1A 3FZPA 2JIIA 3M2WA 1LR4A 1M2QA 3U9CA 3W18A 4MTAA 3OUNB 5M07A 4FKSA 2B4SB 4U45A 3DBCA 5ETAA 1P14A 2C6IA 3Q9WA 3B2TA 1GIHA 4RIXB 4RWIA 4FEUA 3QXOA 5LVOA 2OLCA 3U54A 4EH3A 4JDJA 3L8XA 4CZTA 5IA4A 4AZSA 5EM7A 4R8QA 4JR7A 4IX5A 4K6ZA 4D4VA 5I9UA 3KRJA 2R3LA 1NVSA 2GU8A 3VW8A 1SNUA 3S95A 2WKMA 2XIYA 3OXZA 4XP3A 2HZ4A 4O0XA 5AAGA 4WHZA 5KMNA 2NNWB 3SG9A 1V1KA 2OG8A 5HTCA 1LP4A 4TYEA 5K3YA 3RK9A 3ALOA 1GAGA 3R22A 3VVHA 4HYSA 5BQ0A 1O6LA 2JEDA 3GVUA 4I3ZA 2WU7A 5KMMA 5IA1A 3VBQA 1KE8A 2PVFA 2W1GA 4F9AA 1H26A 3E7VA 4FZ6A 4KBKA 4BR3A 3P7AA 2XNOA 3PY0A 4QYHA 3OEFX 2Z7RA 4P7EA 4EEVA 3O8TA 4KSPA 4EH6A 4EUTA 3PJCA 5ETCA 1J1BA 4O0WA 3C4XA 1Y8YA 4MBJA 4DA5A 4ANSA 3K3IA 4C33A 1SYKA 4F6SA 4HYUA 4II5A 4JQEA 3QQJA 4X2JA 4YBJA 4YC8A 2R3JA 2WQOA 2XRWA 4GSBA 5AV0A 4D2WA 2XP2A 4ZAUA 2ETRA 3H9RA 3RJCA 4QMPA 3SDJA 4FKVA 4GFOA 4I22A 4V04A 4HYHA 3A61A 5FUTA 4B0GA 4RJ7A 4D4YA 5J5TA 4CMUA 2X9FA 2FYSA 1CM8A 4HCUA 4KUJA 4O6EA 3E7OA 3AC8A 1X8BA 2R3IA 2JIVA 4YJNA 4AFEA 3O23A 4CFNA 5HBEA 1F0QA 1XBBA 3QTUA 4L7FA 2VTLA 2ITQA 5FBOA 1YDRE 3AOXA 4CCBA 5AAEA 4CG9A 5JN2A 2YA9A 3AC2A 4RJ5A 2XUUA 5CSHA 2PPQA 4RVTA 5E8TA 5HVJA 3CR0A 4ZSAA 5IQDA 2IVUA 4IWOA 5ICPA 3IG7A 4IFCA 5AADA 2BUJA 3CC6A 2XJ0A 2Q0NA 3UPXA 4CLJA 3C4EA 3CIKA 4F9CA 4RJ6A 5EK7A 4MD9E 5I5ZA 1A06A 2OZAA 3S3IA 1JSUA 5EW3A 4BIDA 2O65A 2W4JA 4AOIA 3FLWA 1XHAA 2UVZA 4IJ9A 5JQ5A 5CU4A 3TT0A 1VR2A 2FGIA 1RDQE 2GQRA 5ANIA 3ZEWA 3O51A 4CFVA 4XUFA 1ZOEA 3D94A 5ANKA 2VTTA 4RC3A 3GP0A 3OTUA 4XBUA 4ZSJA 1H07A 4ACHA 5HCYA 4X2GA 4YZDA 1KE7A 4ZTMA 4XV2A 3QC4A 4AU8A 4FTKA 2R3KA 1PXJA 4QMVA 4RMZA 4CEGA 3ROCA 3P78A 5CVFA 3ODYX 3HV5A 4GYIA 1P4OA 1J7IA 4UWCA 3RMFA 3Q2MA 2IN6A 2QR7A 2F7ZE 4XV3A 5CI7A 2BMCA 4QTCA 4YZNA 2CKEA 2FA2A 4K2RA 5KO1A 2BROA 3U4UA 2FSTX 4D2RA 4TNDA 2YDJA 3FI3A 2HY0A 3GC7A 2C47A 3PXFA 3HRBA 5I3OA 3TV6A 4E8AA 2X7OA 3C51A 3PTGA 4HGSA 5CAVA 1WBNA 3LAUA 4IAKA 4FV3A 2UVYA 3QCSA 3QGYA 4AA5A 2OKRA 3R7GA 4L52A 5L8JA 3FLQA 4H36A 4L3PA 2VWXA 4ZMFA 3WZUA 2HOGA 1FGIA 4FV1A 1E1XA 2XK7A 3AD4A 2R64A 4NTSA 4S31A 4TYHB 4U79A 5F94A 3SKCA 3TNHA 3CGFA 4UEUA 4WNPA 4GYGA 1H1SA 3IGOA 3PA4A 1YRPA 5EKOA 2R4BA 2CLQA 3ET7A 4MQ1A 4U97A 3RWQA 3WIKA 2FSLX 5AR7A 3MH2A 2C3IB 1CKIA 4ZLZA 2QLQA 3ZH8A 3EYGA 4OTPA 3VS6A 3V5LA 5BX0A 3GT8A 1ZZ2A 2G2HA 3FJQE 5CASA 4WIHA 2BZJA 5FG8A 5C01A 4C8BA 5A6OA 4WNKA 5L2IA 4PTCA 4QMWA 5F95A 3UVQA 3ZSHA 4O7LA 2YWPA 3FL4A 4E4MA 3FZTA 3BKBA 1PJKA 2H34A 1JPAA 4MD8E 4X6QC 1WBVA 3F61A 5FD2A 4BGGA 4EK3A 4MH7A 4YPSA 4QO9A 2E9UA 4B99A 4FT5A 3EB0A 3COIA 2WTIA 4M12A 4RQVA 5ANEA 3TIYA 3R73A 2QOKA 1H01A 5C8KA 5GIOE 4A9UA 4PMMA 3W32A 2W9FB 3QXPA 2C3LA 5CS6A 4EK5A 3KGAA 3T3VA 4O83A 4R7IA 5FLFA 3I7CA 3IDCA 1REKA 3KMWA 4N70A 4R6VA 3FC1X 4BCQA 1UKIA 5TKDA 2XNMA 3OROA 4EI4A 1JSTA 2W0JA 4L45A 4IDVA 1OL5A 5K4JA 5TF9A 3Q04A 3TNPC 2A19B 1UNHA 1QPDA 2C5YA 4U5JA 5D1JA 1GIIA 1IEPA 2JKKA 3QQUA 5KBQA 5IQHA 4MAOA 2Y4PA 4KB8A 3DTCA 3RK7A 3PVWA 4UN0C 3H9OA 1PMUA 4FUXA 4HZRA 5FP5A 1SM2A 3BQCA 3LVPA 5HG7A 2JDOA 4KAOA 3ZCLA 4DGGA 3S00A 4WUNA 1HCKA 5AR3A 4M84A 2X9EA 4IAYA 3BHYA 4IAIA 3Q9YA 4BKJA 4ZSLA 2R7IA 3UG2A 4KRCA 3PJ3A 3QLFA 4PNKA 3A7GA 4I5HA 5DE2A 4CD0A 3UO4A 4YZ9A 2E9PA 3HZTA 4I5CA 4QOXA 3GU7A 3DFCB 4TRLA 3BIZA 3WI6A
chains in the Genus database with same CATH superfamily
4YLKA 3S2PA 4YZBA 1O6KA 3PWDA 4EHZA 3A60A 3DBEA 5DGZA 4NL0A 5A3XA 3UOLA 4BCKA 3VS1A 4XP2A 1OL2A 4E93A 2PVLA 5DI1A 3ZMMA 4NM0A 3DDQA 2EU9A 2JAVA 3ZYAA 5A4LA 1H1RA 2C3JA 3HKOA 4FTTA 4AOJA 1ERKA 1OKWA 3SXFA 2XZSA 2AYPA 4EBWA 4O4EA 3TV7A 4DLIA 3R63A 1PKDA 2JFMA 3KMUA 4KKHA 3UYSA 3AXWA 3BE9A 3VWAA 2GNGA 4QP9A 4DFYA 4L3LA 1YXSA 5DA3A 4EOIA 4F7LA 2R7BA 1AD5A 1QPJA 4KIKB 2QVSE 2BZHB 2XKFA 3F5GA 4ZS4A 4D5KA 4F65A 5HESA 2I0HA 4RSSA 1OECA 1YHWA 2V55A 1OBDA 4AAYA 2CNVA 3PDTA 5FDPA 3QRTA 5A14A 3RZBA 4PPAA 5AM7A 3O7LB 3ZDIA 5BVNA 3DK3A 5AUXA 2P2IA 4AXAA 1CSNA 2QO2A 4DC2A 3UZTA 3GOPA 4CKIA 1KWPA 3LQ5A 4HGTA 1V0BA 2NPQA 1YHSA 5H2UA 5HO6A 4CNHA 4DH8A 4E73A 2LAVA 1YWVA 3MJ2A 3ORPA 3QD2B 4FTIA 4H58A 4IHPA 5C9CA 3UQGA 2UVXA 5IQFA 2WMVA 3M1SA 2ZV7A 2Z02A 5CU3A 3VHKA 2PYWA 1KE9A 4BDIA 3OOMA 5HTBA 2EUFB 2G9XA 4XG9A 2XIKA 4PUZA 3G51A 3BLHA 1IA8A 3LHJA 4JX3A 4OTRA 5GZ9A 4DCEA 5IUGA 3NW6A 4GT4A 5L8KA 3SXRA 1WZYA 1QL6A 3UE4A 4FZAB 5CWZA 1CKJA 4LRJA 3DNDA 2XK8A 2O64A 4M69A 4ERWA 2W1ZA 4BHZA 4K11A 4DGOA 4DLJA 3CS9A 4BTJA 3LJ2A 3CY3A 2XYNA 4X2NA 4DYMA 2YITA 2XK3A 2WMBA 5EQEA 5AIKA 4WG4A 3AMYA 4PP9A 4FKPA 5KMOA 3UVPA 3ID6C 4PL5A 2BFXA 2X8IA 3UQFA 1FVRA 3OHTA 4D1ZA 3SHEA 3PJ1A 4J1RA 3POOA 3Q4TA 4O4CA 5EQPA 4KNBA 4AQKA 4F78A 5B0XA 4FIHA 4CFWA 3IW7A 3SW4A 1ZARA 4TTHB 4O86A 3MIAA 4LUDA 3FWQA 3PSCA 4I5MA 4TYJA 2XALA 1H08A 2R3FA 4I4FA 4BDKA 2FSMX 4ASEA 4M0ZA 2GQGA 3OS3A 3K54A 3P4KA 4IWDA 4UB7A 4AF3A 4E20A 5M4FA 2YACA 4FICA 4O0YA 3KC3A 3LFFA 3QCYA 2HZ0A 2PZ5A 4AQCA 3P86A 3LFNA 3F2NA 3SD0A 2C4GA 4D2VA 4X2FA 5E8XA 1URWA 3DOGA 2C6LA 2XKDA 3G9LX 3KKVA 3OWJA 4NM7A 4L67A 3DZOA 1Y8GA 2C0IA 4FX3A 3MY1A 4MWHA 2VTAA 4Y73A 3VBYA 3TJDA 3GFWA 3R83A 4OW8A 3OZ6A 1OKVA 3V5QA 4BBMA 3CPBA 4BJJB 5E1SA 3QZIA 2F7XE 3ZO3A 2A2AA 4OTDA 5HE2A 3QX4A 4O1PA 2XIZA 2IPXA 2W5AA 2XS0A 5KMIA 1OPLA 3OD6X 3OFMA 4FUYA 4FZ7A 4UYNA 4ANOA 3NRMA 3NUXA 4PRJA 4ZZOA 4E5BA 3E8EA 4BCMA 3VIDA 3FQEA 2C5NA 4X6RA 2J7TA 2XEYA 5IZFA 3GU8A 4XG2A 4EJ7A 2PVYA 3PYYA 3NMUF 4X3JA 2RF9A 4KINA 4I0TA 4ZSEA 3ZRMA 4BI2A 3W33A 3R8ZA 4YU2A 2BIYA 3EQCA 2WU6A 4LOOA 5AJQA 4NU1A 2VWUA 4DTAA 3PY1A 4KIQA 4EYMA 3OW4A 1Y6BA 4AW2A 4CRSA 2VO0A 4TY1A 3ACKA 3P7BA 3V01A 1OBGA 5LCKA 4DH1A 4EOMA 4M3QA 4APCA 3CP9A 5IQGA 3EIDA 4O6LA 1FPUA 5CEKA 1YOMA 2BRBA 3HMOA 4QMMA 2ITPA 5AP4A 3KFAA 3LZBA 5CF4A 1IRKA 3EL7A 3IS5A 4QD6A 3F2RA 3OY1A 4BZDA 1GZNA 3UC3A 2PWLA 2BILB 3PVUA 3JR1A 3HVCA 2HAKA 2WTVA 2BR1A 4CYIA 3HLLA 4ACMA 4FV2A 4EOPA 2R3OA 3F69A 1WBSA 3QRKA 5T6KA 4DFZE 2QG7A 3PJ8A 1BYGA 4NSTA 3HGKA 2W1EA 3W2CA 4DGMA 4EOJA 3CQEA 1ST0A 4YSJA 3DAKA 5FM3A 2I7QA 1NY3A 1YQJA 2VGPA 3A62A 2UW3A 4FSMA 4U0IA 4YTHA 2WQEA 3TIZA 4JG6A 3DCVA 2OICA 4NZWB 5IH5A 3GQLA 3ZLYA 3ZOSA 4EHGA 3PPKA 3FZOA 4OAVB 1WAKA 2PVKA 4X3FB 3A99A 4XS2A 2C6MA 4BZOA 1OVEA 5DT0A 3AT2A 3VRYA 4UWBA 3GCUA 3LXKA 5C27A 4AN9A 4W4VA 4FKIA 4BCNA 2BRMA 2YIQA 1GZ8A 3G2FA 1OIYA 2RG5A 4L01A 2QOFA 2PZPA 4MVFA 3MVHA 3BWJA 2WMSA 5M4CA 4MXXA 2PMLX 5L6OA 3BPRA 4CGAA 4D2SA 4HCVA 1GNGA 5AM6A 4ZLYA 3ZLWA 2XIRA 2R0UA 1Q99A 5T3QA 3IW4A 2WMQA 3EKKA 4LG4A 3R8PA 3ORNA 4AT3A 5M4UA 3F9NA 1PXLA 3T8OA 5LMAA 1M52A 2W4KA 4NW5A 5J87A 3C0IA 2GNIA 4FNXA 4OBPA 4TYIA 3ULIA 4FSUA 4FNZA 3LE6A 4TPTA 1R0PA 2IVTA 3HA6A 4FSRA 4L3JA 1GIJA 3PXKA 5IQAA 4IANA 3A7FA 1BL7A 4XHKB 3GCPA 2EXMA 3A2CA 5ANOA 4ZTRA 2X2KA 4ZTQA 1YWNA 5LWNA 4YZCA 3SXSA 4JIKA 3R9RA 2HELA 4IC8A 1T46A 3MVJA 5AP2A 4L42A 4FK6A 5IU2A 3TYKA 2R3GA 2C0TA 3HAMA 4DHIB 5LARA 3FLSA 2BAKA 4M97A 2X8EA 4V0GB 4X21A 5JEBA 3FMMA 4YJOA 3NVKI 2RFDA 3ZBFA 1U54A 3MPMA 2YHVA 4O4BB 4X3FC 4E5AX 4E6DA 5EHLA 3QWJA 4X0MA 4DEEA 4IDTA 2WZJA 3DBFA 4OGRA 4ASZA 2CN8A 4Y83A 2C6OA 4BB4A 4CTCA 4F6UA 3LKMA 4FL3A 4BL1A 3EMGA 2PVHA 5HLWA 5JRQA 2UW5A 2XMYA 3ODZX 1BI8A 2X0OA 3HDMA 1L3RE 2DQ7X 3Q3BA 5LVLA 4E3CA 4CFFA 1U46A 3RPOA 3G6HA 4O7TA 3EL8A 4IXPA 5CU0A 2J0IA 5LVNA 4CYJA 5HCXA 5A9UA 3GNIB 3WF6A 4O0RA 4FKGA 4TNBA 3U87A 4ENXA 4DT8A 5IQCA 3W1FA 1OL6A 2YM7A 3OVVA 4FG8A 4RZWA 4EOOA 3TDVA 3MIYA 5KZ0A 2VWWA 4JBOA 3TL8A 3PY3A 4I4EA 3QFVA 3RK5A 3NEWA 3HYHA 4GG7A 4G3FA 3I0QA 3E62A 4DFUA 2C6DA 4DEDA 3EN6A 5K0KA 4YC3A 4JBQA 2UZLA 3Q32A 2YM5A 2GHGA 2XJ1A 4ZJIA 1Q5KA 4AP7A 2HY81 2VX0A 4QPAA 3P5KA 3LMGA 1ZZLA 2PUUA 4O21A 3PZHA 1XMLA 1MUOA 2IVSA 3JXWA 1H4LA 4G6NA 2OJGA 5KKRB 1VYWA 3VONA 2J5EA 3NUYA 3BHTA 3R8LA 4R3CA 1HCLA 2FUMA 5AX9A 2AEGA 3U6JA 3R9NA 3V5PA 4FIIA 2WAJA 4S32A 1UKHA 4KIOA 4YBKA 4YJTA 4PMTA 4YJPA 5LCJA 4RIWB 3N4UA 3NS9A 4X7QA 4DF3A 4Q2AA 4FKOA 3PLAE 4IAAA 3D5VA 4PX6A 2ITOA 1W2CA 2QOBA 3D5XA 3GB2A 4Z7HA 4M7IA 4MYGA 2Y7JA 4CCUA 4KRDA 2X1NA 1Z9XA 3TKHA 3U4WA 2P33A 1KUTA 3SW7A 5EHYA 4KSQA 3D83A 1MQBA 2HWOA 2VWIA 5EG3A 3R7IA 4F7JA 4O7YA 2XCKA 5G6VA 3SOCA 5M09A 3P5JC 3P0MA 5G1XA 4IM3A 5EDQA 5KNJA 2W1HA 1IG1A 4XMOA 4N57A 4S33A 3OOGA 4MQ2A 5M08A 2XARA 1JKSA 1ZLTA 5AP7A 2XVDA 3AGLA 4PTGA 1H1WA 4WBBB 4HYIA 1SVGA 4FF8A 4U3ZA 4A9SA 2OXXA 3UP2A 4FJVA 2YIRA 3C7QA 3KRXA 4ZOGA 3BWFA 4D9TA 4NKSA 5EW9A 5I9YA 4MCVA 4GK3A 2WTWA 2UZOA 5C8NA 3AT3A 3GU4A 3QX2A 3NYVA 4ZJJA 3MTFA 4DG3E 1PF8A 3UODA 2P4IA 4KS7A 4XG4A 3R7YA 1TKIA 3OP5A 4QT1A 2JKMA 4O7WA 4CLIA 4APPA 2WQNA 2GHMA 3DKCA 2I0EA 3L9PA 1UWHA 1XH6A 4JOAA 3LM5A 2PU8A 3ORMA 2OJ9A 2OIBA 2X2MA 5J1WA 3QTWA 3W2RA 4H3BA 4CV9A 4AAAA 3QTQA 4QDVA 3HDNA 2W1FA 4DFNA 4EZ3A 3DKGA 5JFWA 5KMJA 4FODA 1WVXA 3MH3A 4FT7A 4QTAA 4IB0A 4W9XA 3NPCA 4M14A 5AP0A 3WE4A 5IPJA 3RI1A 4FGBA 3PA3A 1YXXA 3WBLA 4ALWA 1TQIA 5KBRA 3RAKA 3O8PA 5FRIA 5KHWA 3UNJA 4W4XA 5AEPA 2PVJA 3EQRA 5LJJA 3RNIA 2QOIA 2F57A 3CY2A 3NAYA 1SMHA 2XKEA 4ID7A 3VUKA 3ZC6A 2Z7SA 3FYJX 4EC9A 5TE0A 3QQKA 3KXXA 3QQGA 2DS1A 2B55A 2WMTA 4O0VA 5AFVA 4FE2A 3WZEA 4GFMA 3LM0A 4ALVA 1URCA 4BDGA 5IF1A 2OK1A 3DZQA 3TZ9A 4WSYA 3CTHA 4IADA 3FQHA 3LJ1A 4J53A 1YI4A 4EH8A 4U80A 3ZLXA 5J8IA 3BL9A 4QQJA 3FZ1A 4GMYA 3AKLA 4IQ6A 1JQHA 3WARA 4AE6A 4D0XA 2VTIA 4Z7GA 4LMUA 2P3GX 2P55A 5EOBA 1KV2A 1K2PA 3CD8A 4UMTA 3R71A 5JZNA 1FMKA 2JKQA 4IVAA 2QOHA 4QMUA 4I0SA 3S4QA 1H28A 2YAAA 5FQDC 3Q96A 4GJ3A 2PZIA 4G2FA 2XM8A 4LGHA 2YLFA 4YO4A 4Y5QA 5C03A 4HPTE 3NYOA 4L53A 3KIOC 1PYEA 2YIYA 2GQSA 4ZY4A 1W2FA 2G15A 4ZJVA 5CNOA 4FTOA 4NCTA 2WMXA 3FKNA 4LL5A 3WZJA 1NXKA 4EOLA 3HECA 2IZUA 5J9ZA 3HV7A 5HE3A 4B8MA 4DTBA 1KSWA 3ZLSA 3FKOA 1XWSA 1FVTA 1ZYJA 3GC9A 3ORLA 3HA8A 3Q53A 2QO7A 4F0FA 3DXQA 3LLTA 2EB2A 1AQ1A 3A8XA 4FVPA 3FXXA 4YJSA 4ACCA 2R9SA 4MKCA 5I3RA 4DDGA 2PK9A 4U6RA 4I6BA 1M7QA 4E6CA 3G15A 2XKCA 1PXOA 4NUSA 4DFLA 3C5IA 3K5VA 3PSBA 3ZSIA 2WEIA 4JJRA 2IF8A 1H27A 4U8ZA 3R9DA 2WO6A 3RAHA 3U8WA 3IDPA 5B2LA 2VTNA 5A4QA 1PXKA 5KMLA 1S9JA 2BZKB 4O7VA 3ITZA 1BUHA 1W84A 4O22A 5JGDA 3ZDUA 2IO6A 4GJ2A 4RWLA 1G8KA 3NUPA 3II5A 5AV2A 3OCBA 1OGUA 1XH4A 1YVJA 4QYFA 2AC5A 4MNEA 3VJOA 4ASDA 5AMNA 1STCE 2E9VA 3F5UA 1H1QA 3KY2A 2C5OA 1TFFA 2CPKE 1ZYDA 4EKKA 2Z60A 4C02A 4CKRA 3FL5A 3GU5A 3D7ZA 4YURA 4YC6A 4ZY5A 1L8TA 3TMOA 2QKWB 4QMNA 2IZTA 3AC5A 3H30A 4YTIA 2O0UA 2O63A 3TXOA 5EDRA 3FYKX 2PVMA 4CSVA 3QHWA 3ACJA 5AUTA 3F3TA 4QMTA 2PUPA 3ML1A 1Q24A 5DT4A 2BKKA 4NWMA 3AQVA 4H1JA 3BV3A 3EN9A 1YHVA 5TO8A 4C2VA 2C6KA 4FKJA 2YM4A 4XLVA 5HU3A 2GSFA 5JK3A 4JRVA 1ZYSA 3DGKA 4DN5A 1DI9A 1YOLA 3QKMA 3DK7A 4CRLA 4K77A 4HCTA 4EKLA 4GIHA 4FZFB 5K9IA 2GFSA 3FLZA 4EK8A 4QPMA 4CQGA 4R3PA 4R5YA 4AWIA 1R39A 5E1EA 4F63A 2W99B 5FTOA 3H0ZA 1XMMA 2I0VA 2B53A 2B52A 3JS2A 3UDTA 4A4LA 4IH8A 3BGPA 3ALNA 3ZM4A 3ENHA 1IASA 4JG8A 5HTIA 1B39A 2ZB1A 4FOBA 4MXYA 1Q8TA 3A4OX 3IECA 4K0YA 5DLSA 5GJFA 1YI3A 1ST4A 1V0PA 3DBDA 3E88A 3IONA 4HPUE 5E90A 2OFVA 2ZVAA 3SAYA 4C4EA 4MEDA 3TWJA 2BPMA 3KREA 3W0NA 5LWMA 2A4LA 3DPKA 5CNNA 5IA3A 4JDKA 4BDJA 4YNOA 4UX9A 3FZRA 4O81A 2Z2WA 2JLDA 4PDOA 5D9HA 3JYAA 5CVGA 4GCJA 5HZNA 3C4FA 4YJRA 3L9LA 2QOLA 3CXWA 3EZVA 3BEAA 1PXIA 4FGRA 4DHZA 3CJFA 3HL7A 3R1NA 4TWOA 2YLEA 2FO0A 3H4JA 1JKLA 4LGDA 2ZOQA 4DH3A 3LFDA 4LV7A 3RINA 3DK6A 4FYOA 1DAWA 4UYAA 3VS3A 3ZHPC 5F9EA 3BLAA 5E8YA 5H8GA 4F1TA 1UNLA 5CF6A 4QQTA 4O7RA 5TT7A 4EC8A 1B38A 1FGKA 4NKAA 4XOZA 4P5ZA 4YGAA 4ARKA 1K3AA 2OJIA 1UU9A 3EFKA 3QD0A 2VX1A 3W8LA 4CFUA 1OIQA 2UZNA 4FI1A 1M2RA 4PMSA 3M42A 5CT0A 2ITVA 4UXQA 4IC7A 4C7TA 5JZJA 5T68A 3VF8A 2ZV2A 3BYSA 3D4QA 1OPKA 2OH4A 4XNEA 4G6OA 5BVWA 2YCQA 3VQUA 4BWPA 1O6YA 3ATSA 3VS4A 3GU6A 2GCDA 2VTHA 3FMHA 3Q9XA 3C0HA 2WEVA 3GCQA 3KQ7A 3VUTA 1I44A 3KF4A 3NZ0A 4XG6A 4RWKA 4M13A 2AQXA 2I1MA 3D5UA 4HNIA 4O84A 4CQEA 5CEPA 3F3VA 4Y95A 1KV1A 3KEXA 4HGEA 2BAJA 3BU6A 4K33A 3I79A 4BFMA 3Q52A 4ACDA 2YCSA 4PF4A 1WBOA 2PZRA 4AN2A 4AW1A 4PDYA 4QMSA 4B6LA 4QTEA 4NM3A 2R3NA 2ZYBA 3OUKA 4JS8A 4ZY6A 1PMVA 4FVQA 4QYEA 4U44A 5KHXA 3QD4A 3AGMA 1R3CA 4FTAA 2XAMA 5B2KA 3OXTA 4QEBA 5HO8A 2ZV9A 3F3UA 3TNIA 2PUIA 2AC3A 1WBPA 5BVKA 3CBLA 2QU6A 3OEZA 3I81A 3Q9ZA 5LMBA 3FY0A 5CSWA 5KX8A 5CYIA 1XH7A 5AA9A 4M68A 1BL6A 2OF4A 3F88A 4QQCA 4C3FA 3KXGA 5C4KA 3OTVA 5KE0A 4L9IA 4LMNA 4QP1A 1JWHA 3D7TA 2GNJA 4IJPA 4CXAA 3MTLA 4BN1A 2R5TA 3UDBA 4AZWA 4NFNA 3LCOA 3E8DA 4E7WA 3R8UA 4ZLOA 3QUPA 4BDHA 3IDBA 3Q2JA 4YSMA 1WVWA 2VO3A 5FTQA 1O9UA 2VN9A 2W05A 3O17A 5EM8A 3ZO4A 3ZEPA 5DRDA 5CSPA 4BYIA 1AGWA 3R01A 3PG3A 4PV0A 1EH4A 5EM6A 4BC6A 3LFQA 1ZOGA 2B7AA 4FG7A 3HMNA 5HE0A 4A9YA 2XYUA 4WRSA 4C2WA 4UZDA 5JSMA 3R7VA 4Z3VA 3E87A 2QU5A 5DT3A 1TVOA 2UW9A 4LUEA 3R7EA 4TL0A 3ORKA 5C4LA 3PFQA 3QQFA 3HV3A 2GNFA 3ELJA 4RIXA 5DOSA 4W4YA 5IA5A 3LXPA 4H3PA 2NYAA 4GKHA 4M8TA 4DE4A 3BCEA 3L8PA 4I93A 4HVSA 5BNJA 1Q62A 4OTQA 5CU2A 2WXVA 4J98A 2HCKA 1YDTE 2CDZA 4WO5A 4D4RA 4ERKA 2WHBA 4W8DA 3C4WA 1KE5A 3FE3A 2YAKA 4G9CA 1VLRA 4Q9ZA 3FXZA 3CPCA 4BY9E 2E2BA 2JKOA 2NRUA 3Q6UA 3DQXA 4R7HA 3IW6A 5AP1A 1OPJA 3LLAA 4AGUA 3VUMA 3MH1A 1FOTA 4GG5A 4I24A 2O3PA 3O50A 4LOQA 3TCPA 3VUDA 2Y6OA 3ZO1A 4B7TA 3RCJA 2F9GA 4JG7A 4L43A 2GS2A 3LXNA 4BTMA 3DLSA 1U59A 4OBOA 3EFWA 3UC4A 5LMKC 3TUDA 4NIFB 1U4DA 2GMXA 3BYVA 1BKXA 4H1MA 2BIKB 3VUIA 4NEUA 3ZSGA 5CANA 4Q5HA 4AZTA 3W2OA 5K5NA 5FXRA 3FY2A 2HXQA 5JFSA 3FHRA 1YWRA 3CCNA 3GENA 2J0LA 3PUPA 3PVGA 2G01A 3RALA 3OMVA 1BX6A 2PE2A 2XNGA 1PHKA 1PXPA 4H39A 4JLCA 3OCSA 3DU8A 3UIXA 5IEYA 2BDJA 4F7SA 2QHMA 1NA7A 2VUWA 3L9MA 3FEGA 4HVDA 2QCSA 4BTFA 3MH0A 2ONLC 4ONAA 3CGOA 3TNQB 3MS9A 5CALA 4GKIA 3UMWA 4DFBA 4YO6A 3GXLA 4RIYA 4P5QA 4RFZA 2KTYA 4JIAA 4TW9A 4I0RA 2YM3A 3UQCA 4BICA 2ITWA 4B8LA 2I0YA 3COMA 2W06A 3C4CA 2A0CX 1PXMA 1Y91A 3K2LA 4JT3A 2C1AA 4O7NA 3DQWA 3OBGA 5CU6A 3WILA 3VF9A 4LDTA 2XF0A 4P4CA 2X4FA 3ORZA 2GS7A 2XIXA 2GTNA 3OF0A 1HOWA 3HMIA 2ETMA 3QQLA 3AD6A 4RWJA 1W82A 2JDVA 5F4NA 3PE2A 4G3EA 3ZUUA 3MVMA 4J8MA 3RM6A 4C4IA 4IB3A 4YZMA 4F08A 4QP2A 2IZRA 4EONA 4GVAA 3K3JA 3TDWA 5IG1A 3W0PA 4RLKA 3ZUVA 5DEWA 2PVNA 2RSVA 2YABA 2CMWA 3PXRA 4HVGA 5JKGA 3HRCA 1RE8A 4RVKA 4EK6A 5FDXA 2YJRA 3GC8A 2CJMA 4BYJA 1FBNA 3LMIA 3UVRA 3DNEA 3I6UA 4GK4A 5IMEA 3KB7A 4GU9A 3QU0A 5EYMA 5IDNA 2NRYA 3FUPA 4HJOA 5GJDA 3E8CA 4FMQA 3EQBA 3IW5A 2KULA 4RVLA 2J0MB 2ETKA 3QTRA 4D55A 4C4GA 3VBXA 2J0JA 1PKGA 4FA2A 3WOWA 1XO2B 3E92A 2QURA 3DXPA 3QZHA 4D4SA 2XRUA 5J5SA 3UIBA 3NCGA 2E9NA 2Y4IB 3C13A 4IZ5A 3VNTA 1QPEA 3I6WA 4BBEA 4GS6A 3W2SA 4CG8A 2UZVA 3SLSA 4U9AA 2HW6A 5DWRA 5CXZA 3QTIA 1PY5A 2OO8X 5CZIA 3PIXA 2CGWA 3FI4A 3GFEA 5EI6A 5CENA 4DEIA 5E4HA 3IQ7A 3MGYA 4DCAA 3EHAA 3ZS5A 5M53A 4XV9A 3UG1A 3CD3A 2YZLA 2RL5A 5AUWA 3AMAA 3U55A 1FMOE 2QOQA 3D14A 3TG1A 4CT1A 3W0SA 3KVWA 3RAWA 1XBAA 4TYHA 5CTPA 1SNXA 2BRNA 1XR1A 3DS6A 3MI9A 4D2PA 3RPSA 4U40A 4WG3A 5BYZA 4CZUA 3LOKA 5A4CA 5HHWA 5M4IA 1IAHA 5H8EA 4Y5HA 1DI8A 3FQSA 3VUHA 4UMPA 4DEAA 3ZFXA 3UDZA 3TV4A 1J91A 4IB1A 4BIEA 4DBXA 3ZZWA 5CVHA 1WCCA 4IBMA 2RFNA 5ANGA 3T9TA 5L2SA 4QP3A 2ITYA 3I0OA 4JAJA 4L8MA 5C26A 2XNEA 1JKTA 4JBVA 2IVVA 4RJ4A 3PXZA 5D7AA 3SOAA 3W2PA 4UWYA 3BBWA 3FI2A 3FC2A 5HNGA 3EQGA 4E4LA 4EOSA 4GU6A 4DH5A 4BRXA 4AFJA 4B4LA 3B8QA 5HVKA 3NYXA 2RKUA 3C0GA 4OR5A 4BIBA 5GNKA 4U41A 3VQHA 2UV2A 5J7BA 2Y4IC 2QKRA 4A06A 1WBWA 4BF2A 4C37A 4KBAA 4YPDA 4D28A 5AAFA 3ZONA 4WA9A 4HW7A 2F49A 2R3PA 2G2IA 3TI1A 1ZXEA 3Q6WA 1VZOA 3UJGA 4RPVA 1WFCA 4FTNA 3NSZA 3RHXA 5EQYA 5CQUA 4FTMA 3B8RA 2JDRA 1UU7A 2UW0A 1CTPE 4C0TA 4YNEA 4L7SA 2QOCA 3DJ6A 4GW8A 4L68A 5IKWA 4G3DA 3QRJA 4F9BA 3R21A 4FKUA 2G1TA 3LCSA 3N4VA 4HGLA 5AIRA 3GQIA 3ZRKA 1Q61A 2PMIA 3KVXA 3SQQA 4DG0E 4DITA 4YTFA 2A27A 2EVAA 2OSCA 5EFQA 2C5VA 3QKKA 4BHNA 3LFAA 4FC0A 4J71A 1W98A 3KCKA 4NCTC 3F2AA 3PG1A 4RJ8A 2YFXA 4A9RA 4ITJA 5K0XA 3FPMA 2F2CB 2WPAA 3FZSA 3ZFMA 2R2PA 4HNFA 4DGLC 1NW1A 3BL7A 4UMRA 4DTKA 1MQ4A 2OZAB 3BI6A 3RVGA 4E6AA 4JQ7A 3DAJA 4ITIA 2Y0AA 3FHIA 2VO7A 5BPYA 3QF9A 4EQMA 5CXHA 2R3HA 5AP5A 4ZTLA 2OJFE 3SC1A 3V5JA 3ZZEA 5LVPA 3GEQA 4FTRA 5HU9A 4UBAA 3UIUA 1UV5A 2I40A 3ETAA 3CQUA 1OL7A 4NJDA 3BEGA 3P7CA 2HZIA 2JBOA 3KMMA 4C4FA 4CFMA 5FGKA 3RTPA 4CVAA 2O5KA 3UP7A 1G8JA 2YWVA 2Z7QA 4AS0A 1OI9A 3NWWA 3AC4A 3ANQA 5DIAA 4EBVA 3IPHA 2V62A 4WOVA 5JGBA 4ZXTA 2ERZE 4RC4A 2UW6A 3OT8A 1ATPE 4IM0A 5JRSA 4D9UA 3VW6A 5ETIA 1Y57A 3ANRA 5CF8A 4PL3A 4BCPA 4PNIA 3UGCA 3R02A 4USFA 4J96A 2YCFA 2C6TA 4UALA 5B2MA 3LXLA 4KIKA 2CNUA 1OIUA 3DJ5A 3OCGA 3RPYA 3DV3A 2BVAA 2VWBA 3GBZA 3LCTA 4G6LA 5E92A 4CZYB 2BZIB 1Z57A 3G9NA 2HZNA 3A8WA 2ERKA 3QTZA 2AUHA 3KK8A 4FYNA 4MX9A 5FXSA 5CEQA 1MRYA 2SRCA 3FSFA 4FTQA 3V8TA 1UA2A 4NJ3A 2DYLA 4FIEA 2P0CA 5HLNA 5E8WA 5ACBC 4TKSA 2R3QA 3EWHA 4PWNA 1J1CA 4DAWA 5DNRA 1JOWB 3D2KA 3MVLA 4JQ8A 4AOTA 3S0OA 3U51A 3CLYA 4FL2A 3FBVA 4GL9A 4JDIA 1W7HA 3I60A 3HMMA 3IGGA 3LIJA 3MY0A 3V5WA 4BI0A 3P9JA 4KWPA 2CGVA 2PHKA 2X6EA 5A54A 3P1AA 4J52A 4FV8A 5M55A 2ESMA 1P2AA 2B1PA 5IISA 5EYDA 4CMTA 5AP3A 3BBTB 2WMAA 3VS0A 4D0WA 1Q8WA 3QC9A 3SA0A 1JVPP 4JBPA 1JNKA 2CN5A 2VTPA 3DFAA 3HP5A 3R1YA 2PL0A 3MA3A 4ENYA 4F6WA 2CHLA 3EFLA 3R0TA 4HOKA 5EYKA 3T3UA 4BZNA 1UWJA 4G3CA 3SRVA 4DFXE 5BVFA 2XJ2A 2VV9A 3W8QA 5EI8A 3VS7A 2VNYA 3G0FA 4X