3MV5A

Crystal structure of akt-1-inhibitor complexes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
334
structure length
315
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMIRPHFPQFDYSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords v-akt murine thymoma viral oncogene homolog 1 (AKT1)
publication title Design of selective, ATP-competitive inhibitors of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 315
sequence length 334
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mv5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mv5A01
5TO8A 3VHEA 5AUTA 3QKKA 2OKRA 5CF5A 4EOIA 4H39A 2QO7A 3BHHA 5C8KA 4FZAB 3ZBXA 3PXFA 3R7VA 1OECA 2BZJA 2O2UA 5L2QA 4BBFA 3NIZA 3H30A 3I81A 2ZJWA 3EN5A 3UNJA 4U8ZA 4DF3A 3FI8A 4BDCA 2UW8A 4FZFB 3IECA 4FSTA 4L52A 4XG2A 4F1TA 4QQTA 3FZPA 5IQAA 4RLKA 5JQ8A 3HNGA 1OL2A 5JQ5A 2XCHA 4IBMA 4MD8E 3WF5A 4U44A 4NIFB 2YM3A 4B4LA 4QYHA 4TYHB 3FPQA 4JVGA 4YJUA 3C5IA 4XEYA 4EBWA 2EXEA 3Q32A 5K0XA 2XNNA 4OAVB 4HNFA 1YHVA 4XG3A 4XG9A 3VBWA 2UW3A 4BI2A 5AM6A 4II5A 3GP0A 4CFWA 5HESA 5B2KA 2BHHA 4O7WA 2ETKA 3SG8A 3TV6A 3KKVA 4IZ7A 4ASXA 4GK4A 4CKIA 3RTPA 4HNIA 4G9RA 4BDGA 5BVFA 1Y57A 4K33A 4QOXA 2PHKA 2XIZA 2YIXA 4G16A 3E62A 3DLSA 4FTJA 4ITJA 4J8NA 4PTEA 4AA0A 3NNXA 5M09A 4B99A 3EQBA 3EQDA 4QYEA 5CTPA 1M14A 4NK9A 1H24A 2VTJA 4O82A 3UIUA 5ETIA 3LCDA 4ANOA 2X2MA 4C59A 4DEEA 5CF8A 4DITA 5EI2A 2PL0A 4O0VA 3VS2A 2B0QA 1NVQA 3PA5A 2X7GA 4IDTA 4KRCA 5E1SA 4EK3A 4UZHA 3UYTA 2C3LA 5GJFA 3E3BX 3DT1A 2WIPA 5AR4A 1YXSA 4C36A 3UPZA 1LP4A 2RL5A 1M7QA 4GIIA 2BTSA 5HTIA 1IEPA 5HHWA 3RVGA 3UTOA 3C4WA 3V5PA 4DGOA 3QTWA 3M42A 4DH3A 5HG7A 5FG8A 5TE0A 4F9BA 5LVMA 3KMUA 4XMOA 1GIJA 5IH4A 1URCA 4HGLA 4DT8A 3LCOA 2OICA 1P2AA 1OIYA 5FBNC 2YN8A 2HK5A 4FUYA 4O1OA 3RWQA 3HEGA 2CNQA 5CSPA 4K11A 2B9HA 2QU5A 5KNJA 3ZU7A 2ITZA 4QPAA 5EHYA 1OKVA 3ALOA 4MNFA 4I4EA 3RBWA 3A60A 3MGYA 3TIZA 4M68A 3E7OA 3V51A 3GC9A 3MY1A 3H10A 4DFYA 2XF0A 3TEIA 4APPA 5I3RA 3GU7A 3R9DA 4G3FA 5AV4A 4PF4A 4RIWA 2B9IA 3F6XA 4NCTC 4OGRA 4GKIA 4HGTA 2J51A 4D5KA 3W33A 4S32A 3EQPA 3KB7A 4L6QA 4NM5A 2A2AA 2X8DA 4JQEA 3MPTA 4ZP5A 1R78A 4LOPA 5E8VA 4AW0A 3CP9A 3R8MA 4EHGA 3CPCA 4A4LA 3PJ1A 3CTHA 4LOOA 3VUIA 3L8VA 1ZMUA 2F2UA 4FZDB 5GJDA 5DT0A 2HZIA 4QP4A 4D2PA 4D28A 4CG8A 3F2AA 3CSVA 3HUCA 3ZUVA 4U97A 4QMSA 3L8XA 5CS6A 2X9EA 4FT9A 5HE1A 3EN7A 3GXLA 4ERKA 2C5VA 3U9NA 3C0GA 3BX5A 3HA6A 5HTBA 1KV1A 2BRBA 4KNBA 4IMYA 5JRSA 3U8WA 4F1MA 4TY1A 2ZYBA 5IA0A 2PMNX 3LQ5A 1OZ1A 4BWKA 3SX9A 4CTBA 3WF6A 3ZBFA 2Q0NA 3R00A 2CHLA 2OIQA 2V7OA 4IEBA 4GFOA 3DA6A 2OO8X 4ASDA 1YOJA 3MB7A 4OT6A 3IW6A 4WBBB 1MRVA 4E4XA 4KIKA 4U43A 4P5QA 5GZAA 2NRUA 3Q9WA 2V0DA 4OTPA 1XKKA 3FAAA 5G1XA 4BY9E 3DK6A 2IVSA 3VJOA 3LLTA 2OFUA 4QP7A 4QTDA 3FC1X 1Z57A 2WXVA 3KMWA 4RZWA 1QPCA 3NIEA 5IISA 2IZUA 2XYUA 3R71A 4JX7A 2C47A 4B9DA 1OI9A 3O2MA 3ET7A 4PUZA 4YTIA 4AW2A 4D0XA 1U5QA 4KS7A 3IQ7A 4U5JA 2CKQA 1WMKA 4KABA 1MP8A 1ZLTA 3LJ0A 3S95A 4JR3A 5CSXA 3ZLSA 2IVTA 5M57A 4R77A 4E7WA 2VTQA 4WNMA 3G33A 4JIAA 1PMNA 2O65A 2C6EA 2G1TA 1REJA 2BALA 4GL9A 3Q6WA 4FF8A 5CU6A 4C61A 1V0BA 3MFUA 3TKHA 4GKHA 5EM5A 5I9VA 4HCTA 3AGMA 4M7IA 4E6CA 4AACA 4X2NA 5DBXA 1M2QA 1QMZA 3MPMA 4HCVA 4IWOA 4M14A 5BVNA 4EEVA 1YXTA 4IC7A 4LUEA 4UEUA 4WUNA 1U54A 3QBNA 4FOCA 3TCPA 3NUYA 3L1SA 3HZTA 4X2GA 4OLIA 4JDIA 2J7TA 4A4OA 4XRJA 1GJOA 1T46A 4ZOGA 3QU0A 2YWPA 5JK3A 2XRWA 3NDMA 4FIJA 4APCA 5CEQA 2JC6A 4FYNA 4PNIA 3GU6A 5L2WA 4FT7A 4K6ZA 2HCKA 3BHYA 1B6CB 3LFEA 4O86A 2QI8A 5CU4A 4PP9A 4P2KA 5CVHA 1Y6AA 4BIEA 4B6LA 3O23A 4JDHA 3UOLA 4KWPA 3GEQA 4G9CA 2BZHB 4GG7A 2H96A 4CD0A 2BMCA 1P5EA 3BLRA 4FEVA 4X2KA 5AJQA 3DKCA 1OUYA 5C8MA 2BIYA 3TZMA 4HVGA 1YXUA 2QOFA 2WO6A 3Q2MA 5F94A 1KV2A 2VTHA 3EH9A 3IOPA 5DH3A 3RI1A 2QOIA 3T3VA 1Q99A 1OIUA 2ZB0A 5CEIA 3R8UA 2WD1A 4QMMA 4RC4A 4AW1A 3DS6A 3M2WA 2QKWB 2BFXA 2C0TA 4KRDA 4CQGA 1Y91A 3UDBA 4CT2A 2W4KA 3C0HA 3OXIA 4U0IA 5DNRA 5DWRA 5AR3A 1OL7A 3FZTA 3SG9A 5EW9A 2P55A 4XG7A 5A14A 5C4LA 4RIXA 1PMEA 3QTRA 4F9YA 2XIKA 3RZBA 3VULA 2YFXA 5HX8A 5BYLA 4MQ2A 3QF9A 1BMKA 4RRVA 4PY1A 4C2VA 4XG6A 2VTNA 3GCQA 3HRCA 2BDFA 3EZRA 2OJIA 5JEBA 4M3QA 5EKOA 5FTQA 1K3AA 4BGHA 2GHMA 3JY0A 4DG0E 4WSYA 4ZEGA 1WBOA 3HX4A 2PVHA 3TT0A 3QCYA 5EYMA 3COIA 4D4VA 4M13A 3PSBA 3TM0A 3A8WA 4RJ5A 3UZTA 5HIEA 2NO3A 1H1SA 1FGIA 2W5AA 4UYAA 3EFWA 4H1MA 3LCTA 4FZ6A 5CAPA 3A99A 3M1SA 4NH1A 3DJ5A 2WU6A 5FDXA 1KUTA 5FBOA 4DEAA 1XBCA 1JWHA 1R39A 2QURA 5AX9A 3F5PA 4ACDA 3UODA 3ENHA 2W1IA 3PP0A 4EH3A 5DA3A 3ZZWA 3DDQA 2WTVA 4F0GA 3P08A 3SLSA 2XKEA 2VTOA 4N4SA 3OOMA 5J1WA 5M51A 4NIFA 3QUPA 1GZNA 4RFZA 4GK2A 3BZ3A 4TYHA 3VIDA 2PU8A 5I9WA 2QONA 3LMIA 4NEUA 3DK7A 2W1ZA 4I5PA 5LMAA 4OTDA 1ZMVA 4KKEA 4XBUA 3DXNA 3OT3A 5LWMA 2X4FA 3ZH8A 4XJ0A 4BCHA 2XM8A 3PFQA 4C62A 4I24A 5HE2A 2G2IA 3FHIA 3EL8A 4EKLA 2GQRA 5IA4A 5LMKC 3ZRLA 2UW0A 3NNUA 3SXFA 4C4JA 2C6IA 2Y8OA 2V62A 3LFCA 4LGDA 4KSQA 4YO6A 3D83A 2YDJA 1G3NA 3P1AA 3TUDA 3D0EA 4FA2A 4J98A 4H1JA 5E7RA 4MXYA 4EHVA 4ZTHA 2XS0A 4I41A 3NRMA 2Q0BA 1RQQA 3RGFA 2NP8A 4MF1A 5ETFA 3NVKI 4BN1A 4C0TA 1XH7A 3F9NA 2JKQA 3O7LD 3G90X 4FK3A 2VV9A 4FIFA 4PRJA 3SRVB 4ANBA 4F7NA 2V7AA 3LOKA 2FYSA 4N0SA 4F1OA 1UVRA 2ZMDA 3HMIA 3LW0A 4FTLA 3PE1A 4RC3A 5C03A 4F7SA 1PMVA 5C27A 5EFQA 2BAJA 4FZ7A 4DEBA 3A4PA 4W4YA 2W4JA 4D5HA 2ZDTA 3G9NA 4QMLA 4OBOA 2ITXA 5DT3A 5M44A 3PXZA 1KE8A 3UOHA 5KKRC 4K0YA 4CNHA 3ZRKA 4DINA 4E3CA 1VR2A 1EH4A 1BKXA 4IJ9A 1V0PA 2R0UA 4YNOA 1W0XC 3W2QA 2IPXA 5AUVA 3RAWA 3WYXA 4S33A 4R7BA 4IX3A 3PWDA 5J5SA 2R3HA 3DNDA 2VTTA 4FEQA 5BVDA 2R3QA 3L9MA 4ZLOA 2W1FA 1UNHA 2VTLA 3A62A 3QD0A 3QD4A 4D0WA 5CQUA 2O5KA 4Z9LA 5CSHA 3KRXA 1ZY4A 2HZ0A 4U42A 3AC2A 3GU5A 4F64A 3F69A 5C01A 5IUHA 4JAIA 1PXMA 2EB2A 3PUPA 4QTAA 2J6MA 4B0GA 4EC9A 5KMLA 3DZQA 5F9EA 5GINE 3EWHA 4IAIA 2HENA 4JS8A 4BWPA 4M69B 3EMGA 4D9UA 2R0IA 4EONA 4BZNA 4EORA 4F99A 3KN5A 2J0MB 4NUSA 4BCPA 4NJDA 4X2FA 5IPJA 1QPJA 3W2PA 2C5YA 2PUPA 3MFTA 5HKMA 5LJJA 3QRKA 4NW5A 4HYUA 2PMIA 3IS5A 2QC6A 3KK8A 2OZAA 4W4WA 3BI6A 4DG2E 3CJGA 2X6DA 3R7GA 2WMBA 1YQJA 3COKA 3HA8A 4FSZA 3FQEA 1U5RA 1GOLA 1M52A 1UU8A 3CS9A 5L8LA 1RW8A 3OY1A 4CCBA 5ITAA 3BE9A 1OITA 2W0JA 4RX5A 5BVKA 3D5XA 5HD4A 5JMSA 3H0ZA 3FLZA 2I6LA 4O6EA 3W2RA 4QMPA 4D4YA 5K0KA 5H8EA 2BKKA 1UA2A 4C37A 2HWOA 4F09A 4O0YA 4JDJA 3A4OX 3LLAA 1H07A 3VBYA 3F5XA 4USEA 3EQHA 4TXCA 2WZJA 3SHEA 3FXXA 2J4ZA 4IAFA 4JAJA 4IJPA 4O1PA 2A0CX 2Y0AA 5I3OA 4EC8A 4ZMEA 4BCFA 4DG3E 4YJQA 5IZFA 2F7ZE 4PX6A 3ZC5A 4UWCA 3DGKA 4QP3A 2OLCA 1SNXA 4L53A 4AOJA 4H3PA 2Z8CA 3MH1A 1T45A 3QZIA 2QOCA 4R7IA 4E1ZA 1ZARA 2UV2A 5M4FA 5IQIA 4ARKA 3H0YA 4YZ9A 4FIHA 1OVEA 2QCSA 5HBHA 3I1AA 4C34A 5K4IA 1OL5A 4H3QA 3SA0A 4EH8A 4JBVA 3PJ8A 5BUJA 3R9RA 3G0EA 4O0SA 3FL4A 4E6DA 5I9YA 3GT8A 3Q04A 5ETCA 2J2IB 4NJ3A 2X8EA 4A9UA 4YTHA 2OXYA 1I09A 1LUFA 3Q4CA 2PWLA 3BE2A 3ENMA 4A9RA 2HWPA 2ZV9A 1CKJA 1KE9A 3VJNA 3F7WA 4UY9A 3F3WA 3BU3A 4E5BA 4QMXA 4ZZNA 4XUFA 2IW9A 1V0OA 2OGVA 3DAEA 2F2CB 3RKBA 4F7JA 3KXNA 3FY2A 2PMLX 5TOZA 2HOGA 2GNLA 4HYIA 4CFXA 2PVFA 2WQBA 3GCSA 3MBLA 3PPJA 4XLVA 2QVSE 3NWWA 3MJ2A 4LV5A 3GGFA 3PIYA 2Y9QA 4AFEA 1ZYDA 3LAUA 3WZEA 3K2LA 3DY7A 4FKTA 3G9LX 5HO8A 3RK7A 4WO5A 3KRJA 4U9AA 5EK7A 4J97A 5CI7A 1UU3A 3KCFA 3LVPA 2P0CA 4FKPA 2P4IA 1YRPA 3AG9A 3MY0A 5FP6A 1YDTE 4KKHA 4TW9A 1TQPA 3QRUA 4I6BA 2PUIA 4ZIMA 2YIQA 3PJ2A 3QTSA 5KMJA 2LGCA 5AR5A 3CD3A 2A4LA 4XP0A 3HMMA 5ACBC 3RM6A 3QA0A 3LHJA 3L8SA 4U6RA 5T6KA 3QALE 3CD8A 3QQKA 5HD7A 3R7UA 2X39A 4BCJA 3E8CA 4AWIA 2PUNA 2CKOA 2BHEA 2UVZA 4MNEA 3U54A 5AP2A 4Q9ZA 1HCKA 4MWIA 4IFCA 4YZCA 2UZLA 2YDIA 3KXMA 4DEIA 4EOSA 5AR7A 3DFCB 2EXMA 2WMVA 3PPZA 4WRGA 3MH0A 2BZKB 3DV3A 3V6SA 3ZDIA 1RE8A 4B8MA 5CAQA 4P90A 4DHFA 4KKGA 3GC8A 3NW7A 4KIKB 4EYJA 3S2PA 4PMMA 4JOAA 4Q2AA 3F88A 1WBWA 4RX7A 4RPVA 1YXVA 4S34A 4QMWA 4ZMFA 4Y95A 4AE6A 1Q8WA 1Q3WA 3QCSA 3OT8A 1JKTA 2J9MA 1FPUA 4XOYA 4OTWA 4FSNA 4G3DA 5AWMA 3UP7A 3EJ1A 5TF9A 3TTJA 2W1EA 4R7HA 5HO7A 5M4CA 4G1WA 2DS1A 4FNYA 4CQEA 4L3LA 3E88A 1LEZA 4GU9A 2XIYA 5EM7A 2CNUA 3GCUA 4GT5A 3LFDA 1OPLA 5GHVA 5HICA 3CQEA 2O64A 2XEYA 3DQXA 3UVQA 4WG3A 2UZTA 2CCHA 4E73A 5C1QB 2XNMA 4DAWA 4W9XA 4XP2A 2BUJA 4KIPA 2DUVA 3R21A 3QA8A 2QNJA 5HLWA 2AUHA 5HIBA 2BCJA 1U54B 3P9JA 3LJ2A 2PY3A 3R7EA 2PZRA 5CAOA 4CG9A 3LZBA 3DXQA 2BRNA 1Q61A 4YZNA 5AV3A 4KA3A 4J8MA 5GJGA 3UO5A 5H8BA 3ZONA 3OS3A 3RINA 4BRXA 2KULA 3LMHA 4IAKA 3P7BA 3DKFA 4EZ7A 3DKGA 3IW8A 4ANMA 2CNVA 1PXNA 3NYVA 3QLFA 4LL0A 3OVVA 1H4LA 4L3JA 3TNIA 4FTRA 3VUTA 3ORZA 4UX9A 3I6WA 3Q9YA 3IOKA 1WBNA 3PA3A 4GMYA 3U55A 3UO6A 3CC6A 1VJYA 2W06A 4M0YA 4UBAA 3LFNA 3SQQA 3C13A 3R7YA 2GS7A 3SRVA 2R3LA 3A7HA 3MB6A 2Y6OA 3O50A 3PSDA 3SW4A 5AM7A 2QO2A 4NM3A 3PSCA 3KQ7A 5IQEA 3O51A 3II5A 3ZUUA 2YCSA 5DR2A 4RWJA 3D9VA 4X3JA 3F5GA 3HECA 4RG0A 1ZOEA 5DT4A 3SVVA 2EUFB 2WHBA 3A8XA 4RX9A 3PRIA 3F66A 4XLIA 2PSQA 4RC2A 1PXLA 5I0BA 4D2TA 4OTIA 4EL9A 1TQMA 3HGKA 4I92A 3F3TA 4RIXB 2CJMA 2VTPA 2YA9A 3DJ6A 4EQCA 2XKCA 3JPVA 3ZXTA 1OKWA 4D58A 1O6LA 4CFMA 5EQPA 3PVBA 4TYGA 5J9ZA 4XBRA 4LQMA 4BDHA 1PXJA 3GC0A 5M4UA 4I5CA 4U3ZA 2SRCA 2W7XA 3ZXZA 1XO2B 1UWHA 4ZTLA 4LGGA 3CBLA 4L46A 2UZNA 1PRYA 4BR3A 4BGGA 3NMUF 5EM8A 3Q6UA 2JDSA 3C9WA 2VX0A 1R1WA 3BCEA 1MRUA 4EH2A 1PXKA 4EOOA 3DBCA 3NUSA 3T9TA 3TZ9A 4DTBA 2WMUA 3OWJA 5J9LA 2JGZA 4M69A 5L2IA 4UMPA 1CM8A 2R7IA 3JVRA 5LOHA 1FVVA 2I7QA 4USDA 4OTHA 3NW5A 4F9WA 4ZTQA 3RHXA 4D2VA 5B7VA 4Y5HA 1H1RA 3E87A 2YCFA 5L4QA 3UGCA 2WQMA 5HCYA 1Z9XA 3HUBA 5IA1A 3CKXA 5GZ8A 4CEGA 3EFLA 3UC3A 3ZC6A 3ZEWA 4NYEA 2BRGA 2VO0A 3ORTA 5EYKA 2PZPA 3R30A 2ITYA 3MFSA 2I0HA 4QP6A 3QGWA 1UNGA 1SYKA 4C33A 5CEOA 2UW9A 4BB4A 5L6OA 2ZMCA 3GQIA 5CSVA 4BTFA 5E8SA 2EU9A 3OUKA 2XBAA 4Z7GA 3WF9A 5E90A 1E9HA 1TQIA 4X6QC 2YDKA 4P7EA 5H8GA 2JFLA 3MY5A 4AZTA 4A06A 2I0EA 2XNPA 4ZZOA 3CY3A 3UPXA 4MXCA 1V1KA 3C7QA 3P5KA 3IW5A 2OF2A 5EI6A 3ERKA 4WHZA 3V01A 5DI1A 2XUUA 3N4UA 4DFUA 1YWVA 3EYHA 3R0TA 2C6KA 5CEMA 5M56A 1ND4A 1IR3A 1ZZ2A 2R2PA 2WB8A 3AT3A 3KK9A 3NCZA 4DBXA 3QXOA 4FKIA 1NA7A 4YJTA 4IZYA 1FOTA 4CXAA 3VN9A 4FV2A 2Y4PA 3GCVA 4FV6A 4OTRA 3R7OA 3BHTA 2WQNA 3QL8A 4WNKA 2RSVA 1IA8A 3Q96A 4PP7A 4FTTA 3HP2A 3HLLA 2CKPA 4FT5A 3BYMA 3WZJA 4QMOA 1PXIA 3WYYA 1UV5A 3VS7A 5IDPA 4AFJA 2YZLA 4TL0A 4M0ZA 3LCSA 4RLLA 4IADA 4XH6A 1Q3DA 4BHZA 5DLSA 5M07A 2W17A 3AT2A 3R1SA 1FMKA 2PYWA 2EVAA 2I0VA 3PYYA 5AV1A 4A4XA 2C3JA 2BR1A 2V5QA 5A4LA 5CYIA 3LXNA 4BCKA 4NCTA 2WMTA 3GC7A 2YIWA 2VN9A 3MH3A 4LI5A 4FIIA 4BIBA 2R3GA 2B53A 4FG7A 3MSSA 4G6OA 4EK4A 5IQDA 3CCNA 4JR7A 2FB8A 3FXWA 3QUDA 4FKQA 3C1XA 4XV1A 5AIKA 3GOKA 3R8PA 3B2TA 4FTAA 3QZHA 4CRSA 1L8TA 3OWLA 4M66A 2BFYA 1ZOHA 4OTGA 1SMHA 4E93A 4DCAA 3PVGA 2UW6A 4CT1A 3EOCA 3KY2A 3FDNA 4PDOA 3RAIA 5CSWA 5FTGA 5KZ0A 4NTTA 2XBJA 1K2PA 4LRKA 5E8XA 4F7LA 3HAVA 4KBAA 4IM2A 3RPYA 1KWPA 5HE0A 2WMRA 3I0QA 2X0GA 4MXAA 1GZOA 3PY3A 3E8EA 2C5XA 2W05A 1XBBA 4FNZA 5A4TA 3CQUA 3S1HA 2OZAB 4E4LA 5FXSA 5IEVA 2W1DA 4HZSA 2GTNA 4TKSA 3VRZA 4C7TA 2BDWA 1M2PA 2GMXA 4FI1A 4W8EA 2OH0E 4FTCA 4YLKA 5J5TA 5CAUA 3G5DA 4D2SA 5CEPA 2IWIA 3PG3A 2ETRA 1MUOA 1CTPE 2F4JA 3COMA 3E8DA 5ANIA 4C2WA 1OBDA 4P4CA 2HIWA 4H3BA 4IM3A 2XYNA 4TNBA 1YHWA 4JBPA 1DI8A 4M12A 2RFEA 3EFKA 2B54A 3NEWA 2KTYA 4L01A 4RZVA 1BLXA 3MIAA 1HCLA 4BCGA 4ZY5A 3PPKA 4N70A 3ZLYA 5E4HA 5BMMA 5IA5A 3KL8A 3JXWA 4BC6A 4GH2A 4IAZA 3UNZA 2CSNA 4OBPA 4QD6A 4X3FC 4EHEA 4MBJA 1Y6BA 3JR1A 4JXFA 2UVXA 1FGKA 3PRFA 1XH8A 3B8QA 5A46A 2JAVA 1R0PA 4J95A 4FK6A 4UN0C 1MQ4A 2FSLX 3PZEA 4M97A 2PVJA 2R3MA 3TACA 2O3PA 5AUZA 2QD9A 3WBLA 2B55A 4E8AA 2GCDA 3EB0A 3R9HA 5JFSA 3ANQA 4YC6A 2WTJA 3OROA 5EDPA 4XS2A 1U59A 3IKAA 1M7NA 1H1WA 4F63A 2ZM1A 4EUUA 1E1XA 2AC3A 4UXQA 2HY0A 4FKGA 4FGBA 3IO7A 3DBFA 4PTGA 5I4NA 3UC4A 4MXOA 3R8VA 5B2MA 5IF1A 5JRQA 3DXPA 5JGBA 1QPDA 3D15A 4GK3A 3ZDUA 3I7CA 3EQFA 4S2ZA 5DEYA 5E8UA 4G3CA 3SOCA 4RMZA 4Q5EA 3TWJA 2C1BA 1I44A 2P2IA 3PY1A 5AP4A 1IA9A 3DTCA 1GNGA 3ZSIA 4BTKA 3LIJA 4W4XA 3RNIA 3HAMA 1LPUA 4TYIA 4GUBA 4Y73A 4HOKA 2REIA 3JVSA 4QP1A 4D4SA 4E5AX 3OXZA 3IK3A 5G6VA 4UALA 3WARA 3PLAE 4RIYA 4M84A 2ITTA 2FGIA 2BAQA 4XHKB 3ROYA 4HW7A 3Q9ZA 3EKNA 2ZM3A 3CE3A 5LMBA 3W8QA 1Q62A 3BV3A 4DTAA 3RAHA 4JQ8A 2PULA 3OCBA 1YVJA 3MN3A 3TJDA 1OUKA 3O0GA 4PDPA 3V5QA 5TT7A 4QMYA 5ANJA 4FL3A 4BDFA 2VX3A 3U9CA 3MVLA 4AZEA 3F3UA 4CZUA 3R83A 4YPSA 5LCJA 3B8RA 2PE0A 3T8OA 2XNGA 4AE9A 2GNHA 4YJOA 4RFYA 1ZYCA 3FI3A 3OG7A 4ASEA 4X0MA 3QLGA 4XP3A 1WAKA 4OUCA 4YC3A 4Z3VA 4DA5A 3QQLA 1BYGA 4HZRA 2C6TA 2GFSA 4XV2A 3BV2A 1Q8ZA 3E64A 3QRIA 1YOLA 4QPSA 4QMNA 4YTCA 4QNYA 2YAKA 4J71A 3AT4A 4OT5A 3FLQA 5K3YA 3UZPA 4L44A 2OIBA 3QQFA 4NWMA 4DLJA 4CFVA 2RFDA 3NAYA 1P4OA 5J7BA 2YAAA 1HOWA 4LM5A 2GTMA 3FMLA 4FL1A 1GZKA 4MNEB 3UJGA 1H00A 1NW1A 4UMQA 4XYFA 5M08A 3MS9A 1CDKA 4CYIA 2QLUA 4UWYA 3A7FA 3DB6A 1UKIA 4TYJA 1OPKA 2G15A 2RFNA 3C4XA 4IW0A 5C26A 4YR8A 3QYZA 4EK6A 1NVSA 3EFJA 4JBOA 2VZ6A 4JLCA 4RJ3A 5EDRA 3OHTA 4LRMA 3KULA 3R04A 3BIZA 1SZMA 2X7FA 4QMVA 4D1XA 4F0IA 2H34A 3TXOA 2BKZA 4H58A 4L7FA 3COHA 5B0XA 2YHVA 4UMTA 5ANDA 4I0SA 5EDQA 4FV9A 3PJ3A 4DC2A 3AC3A 3ALNA 1IG1A 1OM1A 3OCGA 4ZTRA 3Q9XA 4KD1A 4GFGA 3BRBA 3ELJA 4JL9A 5AP3A 4CLJA 4DFLA 4LYNA 3SAYA 3AMBA 4QTCA 4DGNA 3KF7A 3O71A 3HRBA 5AV2A 4FTNA 5HE3A 1A06A 2VWWA 4WOVA 2HYYA 4TWNA 4X2JA 3EQCA 4DFBA 4AN9A 1J7LA 2YM6A 4XNEA 3H4JA 1JAMA 4RJ6A 5AP5A 1OIQA 4HVIA 4QPMA 2HELA 1YI3A 1R0EA 3AC5A 1JSUA 2Y4IB 3DFAA 4R1VA 4FV4A 4FTUA 3MYGA 4DEDA 3VUDA 4FSQA 5AMNA 3LQ3A 4MK0A 2OXXA 3VUMA 5LMKA 3C0IA 3DBQA 3G6GA 1Q41A 4Z7HA 2E9OA 2XP2A 3DQWA 4AS0A 4ALVA 4EOJA 2J0LA 4OTFA 5AA9A 2OBJA 4O22A 2F7XE 5ANKA 4AT4A 4IAAA 1JNKA 4JJRA 2E9NA 4NT4A 4YJSA 3ORIA 3EIDA 3LJ1A 3T3UA 2GU8A 3I60A 3ZO4A 3DBEA 4FR4A 1G5SA 4O0XA 4PMSA 3TKUA 3BPRA 2W4OA 3QQUA 1CKIA 3VF9A 3H3CA 1M17A 1W7HA 2WTKB 3UIXA 3WE8A 2HAKA 2WNTA 3W18A 5HQ0A 1PYXA 4MBLA 5IDNA 5AP7A 2JLDA 4ZY4A 5LXMA 4LRJA 3UQFA 3K54A 3F3VA 4GJ3A 2VO3A 4I3ZA 4ACHA 2VWUA 4YTFA 4PL5A 4GRBA 3D2KA 4Q5HA 2F9GA 4WA9A 3TDVA 2P3GX 5HGIA 3BYUA 2PPQA 1Y8GA 2OZOA 2H8HA 5IKWA 1H1QA 4ID7A 5IU2A 4BDIA 2QODA 3WF8A 3NAXA 2HZNA 2OH4A 4KSPA 4L68A 4L3PA 1J3HA 3DDPA 1ZZLA 4NSTA 3UIBA 1DAWA 4DE4A 4FEUA 4FE2A 2ZB1A 4IX6A 2GFCA 2UVYA 2X7OA 4WSQA 1PXPA 3UG1A 4ZJIA 5JSMA 4U45A 3ANRA 4N57A 4V05A 2BILB 4TTHB 3R8ZA 2ERKA 3AGLA 3HYHA 5BVOA 2E9VA 2JBOA 2WFYA 2XB7A 4AXAA 4QMQA 3AOXA 4KS8A 1GIHA 2C30A 3V8WA 1AGWA 3IGOA 3Q53A 5HCZA 5HBJA 4FL2A 4BWXA 3BU5A 4P5ZA 4ONAA 4DH1A 4O7RA 1ZYSA 2OIDA 3Q5ZA 5CU2A 5GZ9A 4YO4A 1PJKA 1XBAA 4EH5A 3PG1A 4IXPA 4C3FA 3EN4A 3P86A 4ANLA 4CMUA 4WBOA 3ORMA 4C4EA 3G51A 4NM7A 4FKOA 4FVRA 1OPJA 4GU6A 1MRYA 3ACJA 4O7NA 2R9SA 2UZVA 3OEFX 2RFSA 3UP2A 2WPAA 3WZDA 4BDBA 3N9XA 4YP8A 2GPHA 1P4FA 3MI9A 3ODYX 1Q8UA 3BYSA 1MQBA 1W82A 3FQHA 4KAOA 3WOWA 2JDOA 1NXKA 4YSJA 1CMKE 2PTKA 3CTQA 3LE6A 5ANGA 4ASZA 3NYNA 4F6WA 4G6LA 2OI4X 4I6HA 4YNEA 5AV0A 3OY3A 3RMFA 3GUBA 4AGWA 4CCUA 4YURA 4IFGA 4AGCA 1J1CA 2QOQA 1ZRZA 4O0TA 5TKDA 4D4RA 3R2YA 2OXDA 3OBGA 4KBKA 2X81A 4O7VA 4W4VA 4Z16A 1L3RE 3MA6A 2V22A 4FKUA 4HYHA 2GNGA 5LWNA 2CPKE 2BPMA 5I9ZA 2CN5A 5KO1A 3SW7A 4BHNA 4FUXA 4E20A 3PY0A 5FEDA 4I22A 4AA4A 3N51A 2XK4A 1APME 1F3MC 4I21A 5EH0A 1CKPA 2A19B 4IH8A 5J87A 2WQOA 4CRLA 5H9BA 4AZWA 3CPBA 1JKKA 4QTBA 2C5NA 2C0IA 1PY5A 4FG9A 4R6VA 3FLYA 4QYFA 4N6ZA 3GBZA 1O6KA 2EB3A 5D9HA 5CZIA 3KXXA 5E91A 4ZAUA 5AUYA 1F0QA 4LG4A 5M4IA 3HDNA 5DGZA 5CENA 4MKCA 2C1AA 2G9XA 2E9UA 3QRJA 4DEGA 2UZWE 1F5QA 4HPUE 3HMNA 3VO3A 1U4DA 2IN6A 2CMWA 2GSFA 4RA5A 4CZYB 5JFXA 3WF7A 5C8NA 3SDJA 2Q83A 4AOTA 1H26A 4ZJVA 4IB5A 3SKCA 3FL5A 2VTMA 1S9JA 1Z5MA 3FMDA 5DOSA 3D5VA 4AA5A 4UMUA 5JFWA 3UNKA 5DVRA 4FIGA 3WILA 3KRWA 2XZSA 2J90A 4E6AA 4EWQA 5FRIA 3K3JA 4FVQA 3IW7A 4BZOA 1X8BA 3POZA 3UVRA 5E1EA 3ETAA 3P4KA 3SV0A 3ULZA 4I6QA 1VEBA 4FV0A 4DH8A 2NRYA 3I79A 5BUEA 3FMKA 4YLLA 4FTIA 3AQVA 3A7IA 3OTUA 4WG4A 5D11A 1YXXA 2ZOQA 3AXWA 4U81A 1O9UA 2BAKA 2OSCA 4RVMA 4O2ZA 2C6DA 3MDYA 3S4QA 1PMUA 5L6PA 3AMYA 2ITQA 2PVMA 4JRNA 4PMPA 3ZO2A 3VS5A 3FZSA 4JG7A 4BDEA 5CNOA 5CXHA 4USFA 2QG7A 2PZYA 3WZUA 4FV7A 3WI6A 1TVOA 5HZNA 1XH6A 4FX3A 4EYMA 1ZYJA 5IA2A 3ZFYA 1IAJA 3G6HA 2W5BA 3DJ7A 4WKQA 5ANEA 4J96A 3FYJX 2XK6A 3LXLA 1K9AA 1XH4A 5EW8A 5A4EA 1XH9A 3A7JA 4ZLYA 4YPDA 4RVTA 5FXQA 2XK9A 3EN6A 4GT4A 4D9TA 5K5NA 4I94A 3KXGA 2PUUA 4RIOA 4HGSA 2VAGA 1CSNA 2JIVA 5K9IA 1Y8YA 2JKMA 3QD2B 3K3IA 5H3QA 2GHLA 3D7TA 1PF8A 5IQCA 3ZZEA 4F08A 4NZWB 4K2RA 4UMRA 5DRBA 3RHKA 4MCVA 2YIRA 5ETAA 2B7AA 2Z60A 2LAVA 4OAUC 3LFBA 2OJFE 2BRMA 4Z55A 5JGDA 2IZSA 4I23A 1GY3A 4IVCA 4HVSA 3AC8A 5LARA 3LM5A 2GDOA 4BL1A 2R3IA 4G6NA 3ID6C 1Q4LA 2WIHA 2R4BA 2XKFA 3BLQA 3BGQA 3CGOA 3NUXA 3OCTA 3PZHA 3GFWA 3Q60A 4A07A 3NLBA 3RWPA 1OL6A 2UZBA 4FSMA 4GG5A 3IPHA 1UWJA 2PE1A 3ORLA 3LFFA 4FKWA 3Q4ZA 1VYZA 2X2LA 1IASA 3FUPA 4FTQA 4TPTA 5JGAA 3FY0A 2YJRA 2NPQA 3GENA 3TV7A 3E3PA 4QQ5A 2R7BA 2OW3A 3NVMB 3S00A 4FSUA 3TZ7A 3U6JA 3GB2A 1ZOGA 2UUEA 2ZDUA 3AD5A 3BGPA 5BVWA 4BIDA 4CTCA 2UZDA 1FINA 1SM2A 3HMPA 3REPA 5KMNA 3SC1A 2J0IA 5CALA 3ZFXA 2YLFA 2VGOA 3TG1A 2RF9A 4JT3A 3VW8A 5JKGA 3NUUA 1A48A 2HXQA 3FYKX 3LFQA 2YABA 3I5ZA 3RALA 1H28A 3TI1A 3RM7A 2QU6A 2VWZA 3CLYA 1E1VA 3DBDA 4ZZMA 4GYGA 5AUWA 2CKEA 5HI2A 5HG8A 4RIYB 4EOQA 5FQDC 4L45A 4X7QA 3LXKA 3ORNA 4GSBA 2BZIB 4WIHA 1H08A 2DQ7X 1SNUA 3JY9A 3KFAA 3R9NA 5L8JA 4A9SA 4BCIA 4QT1A 2EXCX 2VWIA 2WOTA 3F7ZA 5IMEA 2CGUA 4QNAA 3NW6A 3GU8A 4JDKA 4XX9A 4YZDA 4ZTSA 3ZEPA 1IRKA 4ITIA 4DT9A 2P33A 1YI4A 5HLPA 3RCDA 4F70A 4C4GA 1YI6A 2G01A 1VZOA 1UU9A 4TRLA 3KRLA 4O7ZA 2QOKA 4ZSEA 4ZXTA 3W8LA 4Y46A 2Z7LA 4R1YA 3IDPA 4EOKA 4YGAA 5CT0A 4YBJA 3H9OA 1J7IA 3L9LA 3P7CA 2R3RA 5CF4A 5J8IA 2JFMA 2XJ0A 3CEKA 3FBVA 4MXXA 1QCFA 3PE2A 4S30A 3ZOSA 1P14A 4A9YA 4FTOA 5IH5A 2ESMA 3JUHA 1OBGA 3MW1A 3O96A 3UYSA 4FKVA 5JH6A 3PLSA 4F6SA 5LVNA 3RP9A 4G3GA 4ALUA 3QTXA 3VS1A 2ETMA 5C9CA 2W9ZB 4IB3A 5BUIA 3P7AA 3UMXA 3ZFMA 2CCIA 3R22A 3E8NA 3KULB 5AX3A 4BCOA 4EJ7A 2VWXA 2XK7A 5CLPA 2OF4A 2PVNA 5BNJA 4R5YA 3R01A 4TWOA 3VW6A 3CIKA 1KOBA 3P79A 5E8TA 5IEYA 3O8UA 3TUCA 3W10A 2FO0A 3VWAA 2ITPA 2WQEA 4B8LA 4LMUA 4BI1A 2HW7A 2CDZA 1S9IA 3OWPA 4I5MA 4DLIA 4PPBA 3GVUA 5FLFA 2HY81 4BDKA 4BKJA 4GV1A 2FSOX 4BCMA 5E9EA 3KEXA 3OF0A 4AGUA 3QWKA 1W98A 1WVYA 4O0RA 2FSTX 3UQGA 1ZMWA 2I1MA 1FVTA 2ITOA 3I0OA 4ANSA 1A9UA 4HVDA 4R8QA 5FM2A 4HCUA 3OEZA 5L2SA 2YLEA 3DLZA 2R3KA 3U87A 2QHNA 4FSRA 4EH4A 3NCGA 4IDVA 3V5LA 4WUAA 4GS6A 4QO9A 2C6MA 3NUNA 4PPCA 5E92A 3S0OA 3MESA 2ONLC 4FIEA 2YM4A 3TN8A 4TZRA 3RPSA 3W2OA 4O7TA 3JS2A 5E8YA 4EH6A 4GCJA 2J0JA 4O84A 3KGAA 2VNYA 3POOA 4O96A 4WRSA 4ANQA 1KSWA 1WBSA 3MVJA 3V8TA 5D12A 3U4WA 4ZLZA 3Q2JA 5KMIA 3RK5A 1OB3A 1W8CA 2PMOX 2GQGA 3PIZA 3AD4A 4EUTA 4IM0A 2VTRA 2EWAA 3NPCA 5T68A 2CLXA 4I93A 5DMZA 5A54A 4YHTA 5JZNA 1JSTA 4C3PA 5EOLA 2CGWA 3P78A 3R1QA 3R9OA 2X6EA 1JOWB 4GVAA 4ZSLA 2VD5A 2WMQA 5KKRB 3BLHA 3SOAA 1GAGA 4UZDA 4AZSA 4D1ZA 4WT6A 2WOUA 5FD2A 4CKJA 5IA3A 4BKZA 2GNFA 3CJFA 5C4KA 3VF8A 5KZIA 5H2UA 2R3JA 3HV5A 1OGUA 4GEOA 4MVFA 4BGQA 2WMWA 3OD6X 3O7LB 4JBQA 5AP6A 1XQZA 2XCKA 5FP5A 4RJ7A 2W1GA 5GNKA 3DNEA 5LVLA 4CFNA 2YISA 3QTIA 2ZV2A 4QMZA 3FKLA 4BYJA 4L67A 3UMWA 5AUUA 5CAVA 2JIUA 3QHWA 4C4FA 1R3CA 2H9VA 4L8MA 2Y7JA 3CXWA 3FE3A 3I5NA 4EI4A 2QO9A 4XV3A 5I9UA 3NUAA 4BCQA 2OU7A 4XV9A 3ZO3A 5BMSA 3ROCA 3DTWA 5JN2A 4BYIA 4CV9A 4FNWA 1DAYA 3RK9A 2JITA 3HRFA 4G34A 2C5OA 4W9WA 4DGMA 5ACKA 3CY2A 5JFVA 3FC2A 1ZYLA 4R3CA 2IZRA 2W9FB 2JAMA 1WFCA 2UZEA 3HV3A 4YC8A 5FWKK 4PMTA 3BQRA 1QL6A 5CVGA 5FXRA 4DH5A 4E5WA 2QKRA 1GZ8A 4AOIA 3UIMA 4G3EA 2WGJA 3F5UA 4M15A 3ORPA 5A9UA 2ITVA 4BFMA 4QYYA 4DEHA 1BL6A 5AAGA 5CX9A 3CQWA 3W55A 4J99A 4AX8A 3KF4A 4BVUA 5IG1A 4CYJA 4ZSGA 5I5ZA 3C50A 3LQ8A 1OKZA 2C6OA 3EQGA 4BZDA 4IVAA 1JKLA 2XM9A 1WZYA 4QP8A 1H01A 4IVBA 3ORXA 2QHMA 3T9IA 1RDQE 1WBVA 3WE4A 3RPVA 4ZTMA 2R3NA 4UYNA 3Q52A 2W96B 4ACGA 1ZAOA 5D1JA 5T3QA 4LUDA 4OW8A 4X3FA 3H9RA 3FZ1A 4O21A 4M67A 4GFMA 2ITNA 1WBTA 3LFAA 3OOGA 1OL1A 4IZ5A 4J1RA 4O91A 5CI6A 3UBDA 2BROA 3ZHPC 2JDRA 1FQ1B 4NKAA 5GIPE 4EOLA 1W84A 3AC4A 4QMTA 2CN8A 3O8TA 3SD0A 3SXRA 2IZTA 3NX8A 1FVRA 2O8YA 5HVKA 5ANOA 3VS4A 4RQVA 3V5TA 4FMQA 3PIXA 5HEZA 2R3PA 4FKLA 2O0UA 3I7BA 4AQCA 3QFVA 4D2RA 4R3PA 5DRDA 1BI7A 3M11A 4MH7A 4O27B 3HV6A 4AZVA 4C3RA 4EZ5A 3QQJA 5B2LA 5CASA 2RG6A 5IQHA 4FV8A 4YSMA 3UVPA 3TNHA 2UW4A 5EM6A 3KREA 2ITUA 2VUWA 4FTKA 3TDWA 4WNOA 3DKOA 4ZTNA 4YMJA 3ITZA 2B4SB 4JG8A 5BQ0A 2QLQA 2HZ4A 1URWA 2YERA 4FNXA 3OW3A 3ZUTA 2C3KA 4PTCA 4E26A 3FV8A 1PYEA 3VBVA 3PXRA 4AG8A 1H25A 3KVWA 3MV5A 3DU8A 3QZGA 4L7SA 2YJSA 3KU2A 2PZ5A 3VAPA 4V0GB 3ZS5A 3R6XA 2OJGA 4L43A 3PJCA 3SGCA 3U4UA 2OG8A 3D7ZA 2ZM4A 5FTOA 2GHGA 4ACMA 2X8IA 4AN3A 3F61A 3EKKA 4IE9A 2QOHA 3IGGA 2R64A 2VX1A 3FSFA 4I5HA 5L8KA 2G2FA 2X4ZA 2H6DA 4DFZE 5AAEA 3PP1A 5HIDA 5DYJA 2R3FA 2X9FA 3ZTXA 4ERWA 3IW4A 4V04A 1STCE 5HOAA 3GOPA 3QC4A 4O7LA 5EYCA 4R78A 2B9JA 3QQGA 2J5FA 2YIYA 1KE5A 2HW6A 2Z2WA 3KCKA 4XG4A 2O63A 3BQCA 3S3IA 3MTFA 4C38A 4U79A 4RWKA 4YBKA 2CGXA 5M53A 1BI8A 1KE7A 2J0KA 2Z7RA 3UO4A 3C4CA 1H0VA 4FSWA 4BDDA 3RAKA 2RG5A 4J7BA 3C5UA 4EOMA 5CF6A 4AF3A 3O17A 3OW4A 4O0UA 2X1NA 3RPRA 3UZRA 3D14A 4TWPA 4NL0A 2XVDA 3TNWA 5AAFA 3MWUA 4JRVA 2G2HA 3BYVA 3MVMA 1DI9A 3MH2A 4BTJA 4PV0A 2OJJA 3D7TB 3VS3A 1G8SA 2XNOA 3FZRA 4DFNA 4IAYA 4OR5A 2RGPA 4O83A 4BKYA 3VS6A 1YWRA 3ZSHA 3GFEA 4AP7A 4ENYA 4PL4A 2B52A 1OKYA 4F4PA 3NYOA 4A9TA 4ANNA 1BX6A 4IACA 3WZKA 4DH7A 3F2RA 4O81A 2XIRA 4MHAA 5BYZA 4C4HA 1JBPE 4QQJA 5ICPA 4D1SA 1H1PA 3L9NA 3NYXA 4FEXA 2W99B 3QRTA 4Y72A 2WMXA 5EI8A 1UNLA 3E63A 3EN9A 3NS9A 4RFMA 4S31A 3N4TA 3TL8A 1JVPP 3O8PA 5I9XA 3KN6A 3FMEA 4U3YA 3TUBA 2NNWB 4IC8A 4R5SA 3ULIA 3W2SA 2R3OA 4MD7E 4YZMA 5FGKA 3VBTA 2A27A 3FMNA 5F20A 2B9FA 4FODA 3JYAA 4JX3A 5AP0A 1NT2A 3H9FA 2P2HA 4XCUA 2WMSA 1YOMA 2CLQA 2JDVA 3EQIA 4FVPA 4UV0A 3R7IA 5BX0A 3D5UA 3U6HA 5HNBA 4FTMA 3ACKA 4RWIA 2YM7A 3OC1A 4C58A 1VYWA 4QYGA 2WU7A 2W1HA 4MF0A 2FSMX 5EYDA 2ZV8A 4HPTE 4EOPA 3E93A 3FMJA 5HTCA 4MXZA 3EL7A 3OMVA 5AUXA 3QTUA 5JT2A 4EK8A 1SVEA 4FOBA 3TIYA 3FMMA 4YHFA 4NFMA 4EWHA 4C02A 1KOAA 5HBEA 2GQSA 3PTGA 2XJ1A 3CTJA 4X6RA 1U46A 4AN2A 4HVHA 1PW2A 3BKBA 3BBTB 3G2FA 2WTIA 4GYIA 3C4FA 3SXSA 3ATSA 4J52A 3F3ZA 3NR9A 3P0MA 3VBXA 2XIXA 4WG5A 5HU3A 5AR8A 2VTAA 2BIKB 2FH9A 5KBQA 4IVDA 2ITWA 1G8AA 1YHSA 4L9IA 1QPEA 3VUHA 4ALWA 3AMAA 1ZY5A 5DR6A 3FKOA 4AW5A 2Y6MA 2XNEA 2WTDA 5GIOE 4D55A 3Q3BA 1XJDA 3Q4TA 4QTEA 2RIOA 4PWNA 4ACCA 2VWVA 3LKMA 5D7VA 3VVHA 2IO6A 3MIYA 3OXTA 2IJMA 2Z7SA 4ZK5A 5AA8A 2QR7A 3QZFA 4G17A 1JLUE 2C3IB 3KMMA 3V6RA 5DHJA 2PE2A 4C8BA 4QP9A 3OFMA 3ZMMA 3B2WA 1DM2A 2XA4A 4AU8A 4CMOA 2GNJA 3BEAA 2ACXA 5KBRA 4O7YA 2J50A 2XRUA 4PQNA 4EBVA 2WKMA 2OK1A 2BVAA 4FT0A 4IB1A 4U40A 4XRLA 1AD5A 5J79A 3NSZA 5KMOA 1H27A 1GIIA 4ZY6A 4CLIA 4RX8A 5FEEA 5HG5A 2ZVAA 4A7CA 4AZFA 4KIOA 2JEDA 3HDMA 3ZLXA 3VQHA 2IG7A 3BHUA 3GNIB 4MWHA 1Q97A 3D2IA 4NFNA 5DPVA 3D94A 3UOKA 4EKKA 4UB7A 4YJNA 2DWBA 5KUPA 5EQYA 4XOZA 2E2BA 3A61A 4FV1A 2XH5A 1WVXA 4EJNA 4IANA 5IUGA 4AAAA 4GVJA 1NVRA 5CT7A 5LVPA 2IVVA 4FKRA 3CKWA 5F95A 2VNWA 4CZTA 1ZXEA 4NM0A 4L00A 2A1AB 2BRHA 4I20A 4CFUA 1YKRA 2WELA 3FSKA 3NZ0A 1OIRA 3TZ8A 4O2PA 1PKDA 3ODZX 2AYPA 4JQ7A 3R8LA 5HORA 4G5PA 3U6IA 3VUKA 4D2WA 2XKDA 3I4BA 4YJPA 1LEWA 4RT7A 4I0TA 4K18A 4ENXA 4E4NA 5EHOA 2HXLA 3OZ6A 4U7ZA 3L8PA 3RCJA 5KX8A 1XWSA 3LCKA 3UE4A 1IAHA 4ZS4A 1XR1A 3HP5A 5KE0A 3FXZA 4DTKA 4IIRA 3AC1A 4MAOA 4EZ3A 4QMUA 4I0RA 4JNWA 1Q5KA 4O0WA 3TTIA 4YU2A 3THBA 1UKHA 4WNPA 2Z02A 2YM8A 5L2TA 3QCQA 5A3XA 5DFPA 3W32A 1BUHA 2FUMA 2W1CA 2VWBA 3IG7A 5D10A 5K4JA 4AT5A 2DYLA 3P23A 3EHAA 3GI3A 2FA2A 2WAJA 2VU3A 5JZJA 3BU6A 1PKGA 2IW6A 4BTMA 2VTSA 3VC4A 3CR0A 2WTCA 1H0WA 5BPYA 3EYGA 2JDTA 3R28A 3CGFA 4H36A 4BICA 4E6QA 3UOJA 1UU7A 3HVCA 3A2CA 5CU0A 3DPKA 4BCNA 3LFSA 4KINA 3TNPC 3U51A 3GU4A 3PVUA 4FV5A 1WBPA 4YHJA 4BI0A 4LV8A 2ZV7A 4L42A 3WIKA 3GCPA 4CV8A 1B39A 1KE6A 3V04A 4JI9A 2W5HA 4J53A 3DB8A 2XK8A 3GQLA 1ATPE 3TNQB 4LGHA 2PVYA 3FWQA 5IMXA 3QC9A 5AEPA 3D4QA 3PXKA 3MA3A 4G31A 4TNDA 3QAME 5FUTA 5FM3A 2VRXA 1JPAA 4EH9A 1J1BA 4KIQA 1W83A 2PVKA 3QHRA 3TJCA 4CFFA 3FI2A 4V0GA 1WVWA 3KVXA 1OMWA 3BGZA 4TN6A 4U41A 4YLJA 5IEXA 5KMMA 4YJVA 2ERZE 2V55A 4LMNA 4WD5A 3N4VA 3C4ZA 2F57A 4EQUA 3V5JA 4FYOA 5D41A 3EQRA 3MPAA 4DYMA 1SVGA 2QOLA 3K5VA 3IDBA 4RQKA 4FC0A 4ZSJA 4Q9SA 1DS5A 5CEKA 2E9PA 2PVLA 4GJ2A 1YW2A 5KHWA 2WEVA 2UW5A 4C4IA 3ZCLA 1FBNA 4BDAA 2C4GA 4M8TA 3VBQA 3VNTA 3W2CA 4DGLC 4GT3A 2R5TA 3BEGA 4N6YA 4HYSA 1Q8YA 2IW8A 5L6WL 2I40A 2OJ9A 4UXLA 4F0FA 3OP5A 5A4QA 5DE2A 2IVUA 5HLNA 2XMYA 2C68A 3BELA 4AUAA 3LPBA 5EW3A 3V8SA 2YCRA 2C69A 3BHVA 2YCQA 2OFVA 4KB8A 5BVEA 3R1NA 5EOBA 2QR8A 3VHKA 3VUGA 4FKSA 2WEIA 2YACA 4DFXE 5BYYA 3UQCA 4AT3A 4HJOA 3HL7A 3FMHA 3FJQE 4RJ8A 3R2BA 3FPMA 2C0OA 2XEZA 3G15A 1AQ1A 4ZSAA 2JKOA 3QX4A 4MYGA 5DR9A 4RIWB 3DK3A 1PHKA 4Y83A 2GNIA 2CGVA 2Z7QA 5EHLA 5AADA 5CXZA 1RJBA 2QQ7A 1SVHA 3Q4UA 2C6LA 2QG5A 3W16A 2VGPA 4CSVA 5LCKA 3MVHA 4RSSA 4FT3A 1REKA 4X3FB 3G0FA 4CKRA 5J1VA 5CNNA 2GS6A 2VO7A 3MJ1A 3FZOA 4F9CA 3QCXA 1BL7A 4G5JA 4PPAA 3ORKA 2UZUE 3FKNA 3OTVA 4Y8DA 5HVYA 3EZVA 2XJ2A 3E5AA 3QXPA 4FICA 4Y5QA 4V01A 4HGEA 4BF2A 4MQ1A 5HCXA 5AFVA 1JKSA 5AP1A 3KC3A 5D7AA 2JBPA 4C35A 3VQUA 4JIKA 4CGAA 4IHPA 2UW7A 3V5WA 3FLNC 3MTLA 5J95A 3BWFA 4BBMA 3PVWA 4JG6A 2YITA 5IH6A 5LVOA 3QWJA 4PDSA 4EK5A 5HX6A 5HNIX 3R02A 3QKLA 3BBWA 3PXYA 4TYEA 4FKJA 3F82A 3LM0A 1ZWSA 2YM5A 1TKIA 4F65A 3FQSA 1M2RA 2GS2A 5DG5A 4FV3A 5CU3A 4R3RA 1B38A 5FDPA 1Q8TA 1H8FA 4NU1A 5EG3A 3QTZA 2XNBA 3W1FA 5DIAA 5KMKA 2F7EE 3HKOA 5J7HA 2QOOA 2VWYA 3ZO1A 5DN3A 4O7SA 4CMTA 2OWBA 5J9YA 4ITHA 2WMAA 3DAJA 1FMOE 3FLSA 2BDJA 3QYWA 4I6FA 4K1BA 4PL3A 5A6OA 4ORKA 4RWLA 1JQHA 4RGJA 3TV4A 3VS0A 4PNKA 1YDSE 3OUNB 5HU9A 1ERKA 4ZS0A 5CANA 3C4EA 4F9AA 4H05A 5KCVA 4FGRA 4EQMA 3D5WA 5HVJA 5FEQA 2XK3A 4MTAA 3ZYAA 1NY3A 4K9YA 2VTIA 3I6UA 3NNWA 3RPOA 3AD6A 4W8DA 3RNYA 1XH5A 2RKUA 2FVDA 3QGYA 4DGGA 4FG8A 3BWJA 5IUIA 3PA4A 3PDTA 2PZIA 4Y85A 4ZJJA 5F4NA 3KXHA 4NTSA 3PXQA 4MX9A 5A4CA 5M06A 4IX5A 3A7GA 4GUEA 3QUEA 4IB0A 3FEGA 2PK9A 1YDRE 3LMGA 4PDYA 2YEXA 2Y4IC 5LQFA 4QRCA 5A6NA 4K8AA 3QX2A 4X21A 2JIIA 4C57A 2I0YA 4LOQA 3HMOA 2F49A 4GW8A 5DEWA 1J7UA 5IQFA 2JKKA 3WIGA 3IDCA 5AR2A 3KA0A 4IX4A 4NKSA 5CQWA 3OCSA 4RVKA 2B1PA 2QOBA 3K5UA 4DCEA 4KUJA 3ZSGA 5CVFA 5HNGA 5HO6A 5IQBA 4RBLA 1J91A 4B7TA 4I1ZA 1O6YA 4GIHA 4OBQA 4YZBA 3QQHA 3ZRMA 3QKMA 4IWDA 2WTWA 5TR6A 2UZOA 4AGDA 4RA4A 2VO6A 5KHXA 4O6LA 5E8ZA 3ATTA 1JSVA 2PVRA 4YUQA 2WTKC 4YJRA 4DBNA 3DCVA 4LL5A 4MBIA 4IWQA 1YWNA 3MFRA 3FI4A 5L3AA 3IONA 2BTRA 4XG8A 3BYOA 5M55A 3HV7A 3KXZA 4I4FA 3DAKA 5HG9A 3ZLWA 4E4MA 3TKIA 4F6UA 5EKNA 4G2FA 4FEWA 1WCCA 1LR4A 3FHRA 3F2NA 4QQCA 4EHZA 3V3VA 5CZHA 4BBEA 2X2KA 4QP2A 4IZAA 2YWVA 3KRRA 3R1YA 4MEDA 1XHAA 3HV4A 4RJ4A 2JD5A 4FBXA 4KBCA 4RVLA 2YZAA 3R73A 4IWPA 4O38A 3OWKA 3L9PA 5K5XA 3ZM9A 4BDJA 4IQ6A 3OBJA 4UWBA 3DZOA 4FSYA 4K77A 4TWCA 3RJCA 3VRYA 4EH7A 4TT7A 3ZM4A 3FLWA 5AIRA 5E8WA 4CVAA 5CWZA 3QD3A 4OTQA 3DOGA 3LXPA 3RZFA 2ONLA 3UG2A 3E7VA 2ZAZA 3NNVA 5IQGA 4NW6A 4U80A 3R63A 5CY3A 2J5EA 3E92A 4LFIA 3C51A 3NGAA 3QTQA 4MD9E 4DN5A 1Q24A 5F1ZA 3Q5IA 5EQEA 1PXOA 3NUPA 2AC5A 3PWYA
chains in the Genus database with same CATH superfamily
5TO8A 3VHEA 5AUTA 3QKKA 2OKRA 5CF5A 4EOIA 4H39A 2QO7A 3BHHA 5C8KA 4FZAB 3ZBXA 3PXFA 3R7VA 1OECA 2BZJA 2O2UA 5L2QA 4BBFA 3NIZA 3H30A 3I81A 4DHJA 2ZJWA 3EN5A 3UNJA 4U8ZA 4DF3A 3FI8A 4BDCA 2UW8A 4FZFB 3IECA 4FSTA 4L52A 4XG2A 4F1TA 4QQTA 3FZPA 5IQAA 4RLKA 5JQ8A 3HNGA 1OL2A 5JQ5A 2XCHA 4IBMA 4MD8E 3WF5A 4U44A 4NIFB 2YM3A 4B4LA 4QYHA 4TYHB 3FPQA 4JVGA 4YJUA 3C5IA 4XEYA 4EBWA 2EXEA 3Q32A 5K0XA 2XNNA 4OAVB 4HNFA 1YHVA 4XG3A 4XG9A 3VBWA 2UW3A 4BI2A 5AM6A 4II5A 3GP0A 4CFWA 5HESA 5B2KA 2BHHA 4O7WA 2ETKA 3SG8A 3TV6A 3KKVA 4IZ7A 4ASXA 4GK4A 4CKIA 3RTPA 4HNIA 4G9RA 4BDGA 4O4DA 5BVFA 1Y57A 4K33A 4QOXA 2PHKA 2XIZA 2YIXA 4G16A 3E62A 3DLSA 4FTJA 4ITJA 4J8NA 4PTEA 4AA0A 3NNXA 5M09A 4B99A 3EQBA 3EQDA 4QYEA 5CTPA 1M14A 4NK9A 1H24A 2VTJA 4O82A 3UIUA 5ETIA 3LCDA 4ANOA 2X2MA 4C59A 4DEEA 5CF8A 4DITA 5EI2A 2PL0A 4O0VA 3VS2A 2B0QA 1NVQA 3PA5A 2X7GA 4IDTA 4KRCA 5E1SA 4EK3A 4UZHA 3UYTA 2C3LA 5GJFA 3E3BX 3DT1A 2WIPA 5AR4A 1YXSA 4C36A 3UPZA 1LP4A 2RL5A 1M7QA 3VONA 4GIIA 2BTSA 5HTIA 1IEPA 5HHWA 3RVGA 3UTOA 3C4WA 3V5PA 4DGOA 3QTWA 3M42A 4DH3A 5HG7A 5FG8A 5TE0A 4F9BA 5LVMA 3KMUA 4XMOA 1GIJA 5IH4A 1URCA 4HGLA 4DT8A 3LCOA 2OICA 1P2AA 1OIYA 5FBNC 2YN8A 2HK5A 4FUYA 4O1OA 3RWQA 3HEGA 2CNQA 5CSPA 4K11A 3TYKA 2B9HA 2QU5A 5KNJA 3ZU7A 2ITZA 4QPAA 5EHYA 1OKVA 3ALOA 4MNFA 4I4EA 3RBWA 3A60A 3MGYA 3TIZA 4M68A 3E7OA 3V51A 3GC9A 3MY1A 3H10A 4DFYA 2XF0A 3TEIA 4APPA 5I3RA 3GU7A 3R9DA 4G3FA 5AV4A 4PF4A 4RIWA 2B9IA 3F6XA 4NCTC 4OGRA 4GKIA 4HGTA 2J51A 4D5KA 3W33A 4S32A 3EQPA 3KB7A 4L6QA 4NM5A 2A2AA 2X8DA 4JQEA 3MPTA 4ZP5A 1R78A 4LOPA 5E8VA 4AW0A 3CP9A 3R8MA 4EHGA 3CPCA 4A4LA 3PJ1A 3CTHA 4LOOA 3VUIA 3L8VA 1ZMUA 2F2UA 4FZDB 5GJDA 5DT0A 2HZIA 4QP4A 4D2PA 4D28A 4CG8A 3F2AA 3CSVA 3HUCA 3ZUVA 4U97A 4QMSA 3L8XA 5CS6A 2X9EA 4FT9A 5HE1A 3EN7A 3GXLA 4ERKA 2C5VA 3U9NA 3C0GA 3BX5A 3HA6A 5HTBA 1KV1A 2BRBA 4KNBA 4IMYA 5JRSA 3U8WA 4F1MA 4TY1A 2ZYBA 5IA0A 2PMNX 3LQ5A 1OZ1A 4BWKA 3SX9A 4CTBA 3WF6A 3ZBFA 2Q0NA 3R00A 2CHLA 2OIQA 2V7OA 4IEBA 4GFOA 3DA6A 2OO8X 4ASDA 1YOJA 3MB7A 4OT6A 3IW6A 4WBBB 3TMOA 1MRVA 4E4XA 4KIKA 4U43A 4P5QA 5GZAA 2NRUA 3Q9WA 2V0DA 4OTPA 1XKKA 3FAAA 5G1XA 4BY9E 3DK6A 2IVSA 3VJOA 3LLTA 2OFUA 4QP7A 4QTDA 3FC1X 1Z57A 2WXVA 3KMWA 4RZWA 1QPCA 3NIEA 5IISA 2IZUA 2XYUA 3R71A 4JX7A 2C47A 4B9DA 1OI9A 3O2MA 3ET7A 4PUZA 4YTIA 4AW2A 4D0XA 1U5QA 4KS7A 3IQ7A 4U5JA 2CKQA 1WMKA 4KABA 1MP8A 1ZLTA 3LJ0A 3S95A 4JR3A 5CSXA 3ZLSA 2IVTA 5M57A 3PFYA 4R77A 4E7WA 2VTQA 4WNMA 3G33A 4JIAA 1PMNA 2O65A 2C6EA 2G1TA 1REJA 2BALA 4GL9A 3Q6WA 4FF8A 5CU6A 4C61A 1V0BA 3MFUA 3TKHA 4GKHA 5EM5A 5I9VA 4HCTA 3AGMA 4M7IA 4E6CA 4AACA 4X2NA 5DBXA 1M2QA 1QMZA 3MPMA 4HCVA 4IWOA 4M14A 5BVNA 4EEVA 1YXTA 4IC7A 4LUEA 4UEUA 4WUNA 1U54A 3QBNA 4FOCA 3TCPA 3NUYA 3L1SA 3HZTA 4X2GA 4OLIA 4JDIA 2J7TA 4A4OA 4XRJA 1GJOA 1T46A 4ZOGA 3QU0A 2YWPA 5JK3A 2XRWA 3NDMA 4FIJA 4APCA 5CEQA 2JC6A 4FYNA 4PNIA 3GU6A 5L2WA 4FT7A 4K6ZA 2HCKA 3BHYA 1B6CB 3LFEA 4O86A 2QI8A 5CU4A 4PP9A 4P2KA 5CVHA 1Y6AA 4BIEA 4B6LA 3O23A 4JDHA 3UOLA 4KWPA 3GEQA 4G9CA 2BZHB 4GG7A 2H96A 4CD0A 3W0QA 2BMCA 1P5EA 3BLRA 4FEVA 4X2KA 5AJQA 3DKCA 1OUYA 5C8MA 1W2FA 2BIYA 3TZMA 4HVGA 1YXUA 2QOFA 2WO6A 3Q2MA 5F94A 1KV2A 2VTHA 3EH9A 3IOPA 5DH3A 3RI1A 2QOIA 3T3VA 1Q99A 1OIUA 2ZB0A 5CEIA 3R8UA 2WD1A 4QMMA 4RC4A 4AW1A 3DS6A 3M2WA 2QKWB 2BFXA 2C0TA 4KRDA 4CQGA 1Y91A 3UDBA 4CT2A 2W4KA 3C0HA 3OXIA 4U0IA 5DNRA 5DWRA 5AR3A 1OL7A 3FZTA 3SG9A 5EW9A 2P55A 4XG7A 5A14A 5C4LA 4RIXA 1PMEA 3QTRA 4F9YA 2XIKA 3RZBA 3VULA 2YFXA 5HX8A 5BYLA 4MQ2A 3QF9A 1BMKA 4RRVA 4PY1A 4C2VA 4XG6A 2VTNA 3GCQA 3HRCA 2BDFA 3EZRA 2OJIA 5JEBA 4M3QA 5EKOA 5FTQA 1K3AA 4BGHA 2GHMA 3JY0A 4DG0E 4WSYA 4ZEGA 1WBOA 3HX4A 2PVHA 3TT0A 3QCYA 5EYMA 3COIA 4D4VA 4M13A 3PSBA 3TM0A 3A8WA 4RJ5A 3UZTA 5HIEA 2NO3A 1H1SA 1FGIA 2W5AA 4UYAA 3EFWA 4H1MA 3LCTA 4FZ6A 5CAPA 3A99A 3M1SA 2AEGA 4NH1A 3DJ5A 2WU6A 5FDXA 1KUTA 5FBOA 4DEAA 1XBCA 1JWHA 1R39A 2QURA 5AX9A 3F5PA 4ACDA 3UODA 3ENHA 2W1IA 3PP0A 4EH3A 5DA3A 3ZZWA 3DDQA 2WTVA 4F0GA 3P08A 3W0OA 3SLSA 2XKEA 2VTOA 4N4SA 3OOMA 5J1WA 5M51A 4NIFA 3QUPA 1GZNA 4RFZA 4GK2A 3BZ3A 4TYHA 3VIDA 2PU8A 5I9WA 2QONA 3LMIA 2IF8A 4NEUA 3DK7A 2W1ZA 4I5PA 5LMAA 4OTDA 1ZMVA 4KKEA 4XBUA 3DXNA 3OT3A 5LWMA 2X4FA 3ZH8A 4XJ0A 4BCHA 2XM8A 3PFQA 4C62A 4AQKA 4I24A 5HE2A 2G2IA 3FHIA 3EL8A 4EKLA 2GQRA 5IA4A 5LMKC 3ZRLA 2UW0A 3NNUA 3SXFA 4C4JA 2C6IA 2Y8OA 2V62A 3LFCA 4LGDA 4KSQA 4YO6A 3D83A 2YDJA 1G3NA 3P1AA 3TUDA 3D0EA 4FA2A 4J98A 4H1JA 5E7RA 4MXYA 4EHVA 4ZTHA 2XS0A 4I41A 3NRMA 2Q0BA 1RQQA 3RGFA 2NP8A 4MF1A 5ETFA 3NVKI 4BN1A 4C0TA 1XH7A 3F9NA 2JKQA 3O7LD 3G90X 4FK3A 2VV9A 4FIFA 4PRJA 3SRVB 4ANBA 4F7NA 2V7AA 3LOKA 2FYSA 4N0SA 4F1OA 1UVRA 2ZMDA 3HMIA 3LW0A 4FTLA 3PE1A 4RC3A 5C03A 4F7SA 1PMVA 3W0MA 5C27A 5EFQA 2BAJA 4FZ7A 4DEBA 3A4PA 4W4YA 2W4JA 4D5HA 2ZDTA 3G9NA 4QMLA 4OBOA 2ITXA 5DT3A 5M44A 3PXZA 1KE8A 3UOHA 5KKRC 1G8JA 4K0YA 4CNHA 3ZRKA 4DINA 4E3CA 1VR2A 1EH4A 1BKXA 4IJ9A 1V0PA 2R0UA 4YNOA 1W0XC 3W2QA 2IPXA 5AUVA 3RAWA 3WYXA 4S33A 4R7BA 4IX3A 3PWDA 5J5SA 2XALA 2R3HA 3DNDA 2VTTA 4FEQA 5BVDA 2R3QA 3L9MA 4ZLOA 2W1FA 1UNHA 2VTLA 3A62A 3QD0A 3QD4A 4D0WA 5CQUA 2O5KA 4Z9LA 5CSHA 3KRXA 1ZY4A 2HZ0A 4U42A 3AC2A 3GU5A 4F64A 3F69A 5C01A 5IUHA 4JAIA 1PXMA 2EB2A 3PUPA 4QTAA 2J6MA 4B0GA 4EC9A 5KMLA 3DZQA 5F9EA 5GINE 3EWHA 4IAIA 2HENA 4JS8A 4BWPA 4M69B 3EMGA 4D9UA 2R0IA 4EONA 4BZNA 4EORA 4F99A 3KN5A 2J0MB 4NUSA 4BCPA 4NJDA 4X2FA 5IPJA 1QPJA 3W2PA 2C5YA 2PUPA 3MFTA 5HKMA 5LJJA 3QRKA 4NW5A 4HYUA 2PMIA 3IS5A 2QC6A 3KK8A 2OZAA 4W4WA 3BI6A 4DG2E 3CJGA 2X6DA 3R7GA 2WMBA 1YQJA 3COKA 3HA8A 4FSZA 3UDSA 3FQEA 1U5RA 1GOLA 1M52A 1UU8A 3CS9A 5L8LA 1RW8A 3OY1A 4CCBA 5ITAA 3BE9A 1OITA 2W0JA 4RX5A 5BVKA 3D5XA 5HD4A 5JMSA 3H0ZA 3FLZA 2I6LA 4O6EA 3W2RA 4QMPA 4D4YA 3BL7A 5K0KA 5H8EA 2BKKA 1UA2A 4C37A 2HWOA 4QDEA 4F09A 4O0YA 4JDJA 3A4OX 3LLAA 1H07A 3VBYA 3F5XA 4USEA 3EQHA 4TXCA 2WZJA 3SHEA 3FXXA 2J4ZA 4IAFA 4JAJA 4IJPA 4O1PA 2A0CX 2Y0AA 5I3OA 4EC8A 4ZMEA 4BCFA 4DG3E 4YJQA 5IZFA 2F7ZE 4PX6A 3ZC5A 4UWCA 3DGKA 4QP3A 2OLCA 1SNXA 4L53A 4AOJA 4H3PA 2Z8CA 3MH1A 1T45A 3QZIA 2QOCA 4R7IA 4E1ZA 1ZARA 2UV2A 5M4FA 5IQIA 4ARKA 3H0YA 4YZ9A 4FIHA 1OVEA 2QCSA 5HBHA 3I1AA 4C34A 5K4IA 1OL5A 4H3QA 3SA0A 4EH8A 4JBVA 3PJ8A 5BUJA 3R9RA 3G0EA 4O0SA 3FL4A 4E6DA 5I9YA 3GT8A 3Q04A 5ETCA 2J2IB 4NJ3A 2X8EA 4A9UA 4YTHA 4BJJB 2OXYA 1I09A 1LUFA 3Q4CA 2PWLA 3BE2A 3ENMA 4A9RA 2HWPA 2ZV9A 1CKJA 1KE9A 3VJNA 3F7WA 4UY9A 3F3WA 3BU3A 3AKLA 4E5BA 4QMXA 4ZZNA 4XUFA 2IW9A 1V0OA 2OGVA 3DAEA 2F2CB 3RKBA 4F7JA 3KXNA 3FY2A 2PMLX 5TOZA 2HOGA 2GNLA 4HYIA 4CFXA 2PVFA 2WQBA 3GCSA 3MBLA 3PPJA 4XLVA 2QVSE 3NWWA 3MJ2A 4LV5A 3GGFA 3PIYA 2Y9QA 4AFEA 1ZYDA 3LAUA 3WZEA 3K2LA 3DY7A 4FKTA 3G9LX 5HO8A 3RK7A 4WO5A 3KRJA 4U9AA 5EK7A 4J97A 5CI7A 1UU3A 3KCFA 3LVPA 2P0CA 4FKPA 2P4IA 1YRPA 3AG9A 3MY0A 5FP6A 1YDTE 4KKHA 4TW9A 1TQPA 3QRUA 4I6BA 2PUIA 4ZIMA 2YIQA 3PJ2A 3QTSA 5KMJA 2LGCA 5AR5A 3CD3A 2A4LA 4XP0A 3HMMA 5ACBC 3RM6A 3QA0A 3LHJA 3L8SA 4U6RA 5T6KA 3QALE 3CD8A 3QQKA 5HD7A 3R7UA 2X39A 4BCJA 3E8CA 4AWIA 2PUNA 2CKOA 2BHEA 2UVZA 4MNEA 3U54A 5AP2A 4Q9ZA 1HCKA 4MWIA 4IFCA 4YZCA 2UZLA 2YDIA 3KXMA 4DEIA 4EOSA 5AR7A 3DFCB 2EXMA 2WMVA 3PPZA 4WRGA 3MH0A 2BZKB 3DV3A 3V6SA 3ZDIA 1RE8A 4B8MA 5CAQA 4P90A 4DHFA 4KKGA 3GC8A 3NW7A 4KIKB 4EYJA 3S2PA 1XMLA 4PMMA 4JOAA 4Q2AA 3F88A 1WBWA 4RX7A 4RPVA 1YXVA 4S34A 4QMWA 4ZMFA 4Y95A 4AE6A 1Q8WA 1Q3WA 3QCSA 3OT8A 4FRFA 1JKTA 2J9MA 1FPUA 4XOYA 4OTWA 4FSNA 4G3DA 5AWMA 3UP7A 3EJ1A 5TF9A 3TTJA 3AKKA 2W1EA 4R7HA 5HO7A 5M4CA 4G1WA 2DS1A 4FNYA 4CQEA 4L3LA 3E88A 1LEZA 4GU9A 2XIYA 5EM7A 2CNUA 3GCUA 4GT5A 4O4EA 3LFDA 1OPLA 5GHVA 5HICA 3CQEA 2O64A 2XEYA 3DQXA 3UVQA 4WG3A 2UZTA 2CCHA 4E73A 5C1QB 2XNMA 4DAWA 4W9XA 4XP2A 2BUJA 4KIPA 2DUVA 3R21A 3QA8A 2QNJA 5HLWA 2AUHA 5HIBA 2BCJA 1U54B 3P9JA 3LJ2A 2PY3A 3R7EA 2PZRA 5CAOA 4CG9A 3LZBA 3DXQA 2BRNA 1Q61A 4YZNA 5AV3A 4KA3A 4J8MA 5GJGA 3UO5A 5H8BA 3ZONA 3OS3A 3RINA 4BRXA 2KULA 3LMHA 4IAKA 3P7BA 3DKFA 4EZ7A 3DKGA 3IW8A 4ANMA 2CNVA 1PXNA 3NYVA 3QLFA 4LL0A 3OVVA 1H4LA 4L3JA 3TNIA 4FTRA 3VUTA 3ORZA 4UX9A 3I6WA 3Q9YA 3IOKA 1WBNA 3PA3A 4GMYA 3U55A 3UO6A 3CC6A 1VJYA 2W06A 4M0YA 4UBAA 3LFNA 3SQQA 3C13A 3R7YA 2GS7A 3SRVA 2R3LA 3A7HA 3MB6A 2Y6OA 3O50A 3PSDA 3SW4A 5AM7A 2QO2A 4NM3A 3PSCA 3KQ7A 5IQEA 3O51A 3II5A 3ZUUA 2YCSA 2XAMA 5DR2A 4RWJA 3D9VA 4X3JA 3F5GA 3HECA 4RG0A 1ZOEA 5DT4A 3SVVA 2EUFB 2WHBA 3A8XA 4RX9A 3PRIA 3F66A 4XLIA 2PSQA 4RC2A 1PXLA 5I0BA 4D2TA 4OTIA 4EL9A 1TQMA 3HGKA 4I92A 3F3TA 4RIXB 2CJMA 2VTPA 2YA9A 3DJ6A 4EQCA 2XKCA 3JPVA 3ZXTA 1OKWA 4D58A 1O6LA 4CFMA 5EQPA 3PVBA 4TYGA 5J9ZA 4XBRA 4LQMA 4BDHA 1PXJA 3GC0A 5M4UA 4I5CA 4U3ZA 2SRCA 2W7XA 3ZXZA 1XO2B 1UWHA 4ZTLA 4LGGA 3CBLA 4L46A 2UZNA 1PRYA 4BR3A 4BGGA 3NMUF 5EM8A 3Q6UA 2JDSA 3C9WA 2VX0A 1R1WA 3BCEA 1MRUA 4EH2A 1PXKA 4EOOA 3DBCA 3NUSA 3T9TA 3TZ9A 4DTBA 2WMUA 3OWJA 5J9LA 2JGZA 4M69A 5L2IA 4UMPA 1CM8A 2R7IA 3JVRA 5LOHA 1FVVA 2I7QA 4USDA 4OTHA 3NW5A 4F9WA 4ZTQA 3RHXA 4D2VA 5B7VA 4Y5HA 1H1RA 3E87A 2YCFA 5L4QA 4DDIA 3UGCA 2WQMA 5HCYA 1Z9XA 3HUBA 5IA1A 3CKXA 5GZ8A 4CEGA 3EFLA 3UC3A 3ZC6A 3ZEWA 4NYEA 2BRGA 2VO0A 3ORTA 5EYKA 2PZPA 3R30A 2ITYA 3MFSA 2I0HA 4QP6A 3QGWA 1UNGA 3NFFB 1SYKA 4C33A 5CEOA 4O81A 2UW9A 4BB4A 5L6OA 2ZMCA 3GQIA 5CSVA 4BTFA 5E8SA 2EU9A 3OUKA 2XBAA 4Z7GA 3WF9A 5E90A 1E9HA 1TQIA 4X6QC 2YDKA 4P7EA 5H8GA 2JFLA 3MY5A 4AZTA 4A06A 2I0EA 2XNPA 4ZZOA 3CY3A 3UPXA 4MXCA 1V1KA 3C7QA 3P5KA 3IW5A 2OF2A 5EI6A 3ERKA 4WHZA 3V01A 5DI1A 2XUUA 3N4UA 4DFUA 1YWVA 3EYHA 3R0TA 2C6KA 5CEMA 5M56A 1ND4A 1IR3A 1ZZ2A 2R2PA 2WB8A 3AT3A 3KK9A 3NCZA 4DBXA 3QXOA 4FKIA 1NA7A 4YJTA 4IZYA 1FOTA 4CXAA 3VN9A 4FV2A 2Y4PA 3GCVA 4FV6A 4OTRA 3R7OA 3BHTA 2WQNA 3QL8A 4WNKA 4AXCA 2RSVA 1IA8A 3Q96A 4PP7A 4FTTA 3HP2A 3HLLA 2CKPA 4FT5A 3BYMA 3WZJA 4QMOA 1PXIA 3WYYA 1UV5A 3VS7A 5IDPA 4AFJA 2YZLA 4TL0A 4M0ZA 3LCSA 4RLLA 4IADA 4XH6A 1Q3DA 4BHZA 5DLSA 4BJJA 5M07A 2W17A 3AT2A 3R1SA 1FMKA 2PYWA 2EVAA 2I0VA 3PYYA 5AV1A 4A4XA 2C3JA 2BR1A 2V5QA 5A4LA 5CYIA 3LXNA 4BCKA 4NCTA 2WMTA 3GC7A 2YIWA 2VN9A 3MH3A 4LI5A 4FIIA 4BIBA 2R3GA 2B53A 4FG7A 3MSSA 4G6OA 4EK4A 5IQDA 3CCNA 3W0SA 4JR7A 2FB8A 3FXWA 3QUDA 4FKQA 3C1XA 4XV1A 5AIKA 3GOKA 3R8PA 3B2TA 4FTAA 3QZHA 4CRSA 1L8TA 3OWLA 4M66A 2BFYA 1ZOHA 4OTGA 1SMHA 4E93A 4DCAA 3PVGA 2UW6A 4CT1A 3EOCA 3KY2A 3FDNA 4PDOA 3RAIA 5CSWA 5FTGA 5KZ0A 4NTTA 2XBJA 1K2PA 4LRKA 5E8XA 4F7LA 3HAVA 4KBAA 4IM2A 3RPYA 1KWPA 5HE0A 2WMRA 3I0QA 2X0GA 4MXAA 1GZOA 3PY3A 3E8EA 2C5XA 2W05A 1XBBA 4FNZA 5A4TA 3CQUA 3S1HA 2OZAB 4E4LA 5FXSA 5IEVA 2W1DA 4HZSA 2GTNA 4TKSA 3VRZA 4C7TA 2BDWA 1M2PA 2GMXA 4FI1A 4W8EA 2OH0E 4FTCA 4YLKA 5J5TA 5CAUA 3G5DA 4D2SA 5CEPA 2IWIA 3PG3A 2ETRA 1MUOA 1CTPE 2F4JA 3COMA 3E8DA 5ANIA 4C2WA 1OBDA 4P4CA 2HIWA 4H3BA 4IM3A 2XYNA 4TNBA 1YHWA 4JBPA 1DI8A 4M12A 2RFEA 3EFKA 2B54A 3NEWA 2KTYA 4L01A 4RZVA 1BLXA 3MIAA 1HCLA 4BCGA 4F78A 4ZY5A 3PPKA 4N70A 3ZLYA 5E4HA 5BMMA 5IA5A 3KL8A 3JXWA 4BC6A 4GH2A 4IAZA 3UNZA 2CSNA 4OBPA 4QD6A 4X3FC 4EHEA 4MBJA 1Y6BA 3JR1A 4JXFA 2UVXA 1FGKA 3PRFA 1XH8A 3B8QA 5A46A 2JAVA 1R0PA 4J95A 4FK6A 4UN0C 1MQ4A 2FSLX 3PZEA 4M97A 2PVJA 2R3MA 3TACA 2O3PA 5AUZA 2QD9A 3WBLA 2B55A 4E8AA 2GCDA 3EB0A 3R9HA 5JFSA 3O5AA 3ANQA 4YC6A 2WTJA 3OROA 5EDPA 4XS2A 1U59A 3IKAA 1M7NA 1H1WA 4F63A 2ZM1A 4EUUA 1E1XA 2AC3A 4UXQA 2HY0A 4FKGA 4FGBA 3IO7A 3DBFA 4PTGA 5I4NA 3UC4A 4MXOA 3R8VA 5B2MA 5IF1A 5JRQA 3DXPA 5JGBA 1QPDA 3D15A 4GK3A 3ZDUA 3I7CA 3EQFA 4S2ZA 5DEYA 5E8UA 4G3CA 3SOCA 4RMZA 4Q5EA 3TWJA 2C1BA 1I44A 2P2IA 3PY1A 5AP4A 1IA9A 3DTCA 1GNGA 3ZSIA 4BTKA 3LIJA 4W4XA 3RNIA 3HAMA 1LPUA 4TYIA 4GUBA 4Y73A 4HOKA 2REIA 3JVSA 4QP1A 4D4SA 4E5AX 3OXZA 3IK3A 5G6VA 4UALA 3WARA 3PLAE 4RIYA 4M84A 2ITTA 2FGIA 2BAQA 4XHKB 3ROYA 4HW7A 3Q9ZA 3EKNA 2ZM3A 3CE3A 5LMBA 3W8QA 3BL9A 1Q62A 3BV3A 4DTAA 3RAHA 4JQ8A 2PULA 3OCBA 1YVJA 3MN3A 3TJDA 1OUKA 3O0GA 4PDPA 3V5QA 5TT7A 4QMYA 5ANJA 4FL3A 4BDFA 2VX3A 3U9CA 3MVLA 4AZEA 3F3UA 4CZUA 3R83A 4YPSA 2AQXA 5LCJA 3B8RA 2PE0A 3T8OA 2XNGA 4AE9A 2GNHA 4YJOA 4RFYA 1ZYCA 3FI3A 3OG7A 4ASEA 4X0MA 3QLGA 4XP3A 1WAKA 2X0QA 4OUCA 4YC3A 4Z3VA 4DA5A 3QQLA 1BYGA 4HZRA 4O4FA 2C6TA 2GFSA 4XV2A 3BV2A 1Q8ZA 3E64A 3QRIA 1YOLA 4QPSA 4QMNA 4YTCA 4QNYA 2YAKA 4J71A 3AT4A 4OT5A 3FLQA 5K3YA 3UZPA 4L44A 2OIBA 3QQFA 4NWMA 4DLJA 4CFVA 2RFDA 3NAYA 1P4OA 5J7BA 2YAAA 1HOWA 4LM5A 2GTMA 3FMLA 4FL1A 1GZKA 4MNEB 3UJGA 1H00A 1NW1A 4UMQA 4XYFA 5M08A 3MS9A 1CDKA 4CYIA 2QLUA 4UWYA 3A7FA 3DB6A 1UKIA 4TYJA 1OPKA 4QDVA 2G15A 2RFNA 3C4XA 4IW0A 5C26A 4YR8A 3QYZA 4EK6A 1NVSA 3EFJA 4JBOA 2VZ6A 4JLCA 4RJ3A 5EDRA 3OHTA 4LRMA 3KULA 3R04A 3BIZA 1SZMA 2X7FA 4QMVA 4D1XA 4F0IA 2H34A 3TXOA 2BKZA 4H58A 4L7FA 3COHA 5B0XA 2YHVA 4UMTA 5ANDA 4I0SA 5EDQA 4FV9A 3PJ3A 4DC2A 3AC3A 3ALNA 1IG1A 1OM1A 3OCGA 4ZTRA 3Q9XA 4KD1A 4GFGA 3BRBA 3ELJA 4JL9A 5AP3A 4CLJA 4DFLA 4LYNA 3SAYA 3AMBA 4QTCA 1W2DA 4DGNA 3KF7A 3O71A 3HRBA 5AV2A 4FTNA 5HE3A 1A06A 2VWWA 4WOVA 2HYYA 4TWNA 4X2JA 3EQCA 4DFBA 4AN9A 1J7LA 2YM6A 4XNEA 3H4JA 1JAMA 4RJ6A 5AP5A 1OIQA 4HVIA 4QPMA 2HELA 1YI3A 1R0EA 3AC5A 1JSUA 2Y4IB 3DFAA 4R1VA 4FV4A 4FTUA 3MYGA 4DEDA 3VUDA 4FSQA 5AMNA 3LQ3A 4MK0A 2OXXA 3VUMA 5LMKA 3C0IA 3DBQA 3G6GA 1Q41A 4Z7HA 2E9OA 2XP2A 3DQWA 4AS0A 4ALVA 4EOJA 2J0LA 4OTFA 5AA9A 2OBJA 4O22A 2F7XE 5ANKA 4AT4A 4IAAA 1JNKA 4JJRA 2E9NA 4NT4A 4YJSA 3ORIA 3EIDA 3LJ1A 3T3UA 2GU8A 3I60A 3ZO4A 4DHIB 3DBEA 4FR4A 1G5SA 4O0XA 4PMSA 3TKUA 3BPRA 2W4OA 3QQUA 1CKIA 3VF9A 3H3CA 1M17A 1W7HA 2WTKB 3UIXA 3WE8A 4AXEA 2HAKA 2WNTA 3W18A 5HQ0A 1PYXA 4MBLA 5IDNA 5AP7A 2JLDA 4ZY4A 5LXMA 4LRJA 3UQFA 3K54A 3F3VA 4GJ3A 2VO3A 4I3ZA 4ACHA 2VWUA 4YTFA 4PL5A 4GRBA 3D2KA 4Q5HA 2F9GA 4WA9A 3TDVA 2P3GX 5HGIA 3BYUA 2PPQA 1Y8GA 2OZOA 2H8HA 5IKWA 1H1QA 4ID7A 5IU2A 4BDIA 2QODA 3WF8A 3W0PA 3NAXA 2HZNA 2OH4A 4KSPA 4L68A 4L