4HGLA

Crystal structure of ck1g3 with compound 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
302
structure length
302
Chain Sequence
GSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Casein kinase I isoform gamma-3
publication title Structure-Based Design of Potent and Selective CK1 gamma Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 302
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hglA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hglA01
4KS8A 2HY81 1YDTE 3RPYA 3OVVA 5EQPA 3G5DA 3P78A 1YXUA 4TNBA 2VO0A 4F0FA 5LQFA 2PVJA 3NWWA 3O96A 2JBPA 3G0FA 3AG9A 3FDNA 3C4XA 4NW5A 2VO7A 4M67A 3MVJA 3HLLA 4ITJA 4PDPA 3L8VA 3RPOA 4GFGA 4ASEA 5HTBA 3QWKA 4PV0A 5L8KA 2QODA 4PPBA 1B6CB 1U46A 3DT1A 4IQ6A 4KIPA 5BVDA 3D5WA 3HX4A 1AQ1A 4D5HA 3QHWA 4RPVA 5B0XA 1MQBA 4C59A 4ZY4A 1DAYA 2OIBA 3UOKA 4I0TA 2HWPA 4OTWA 2PVKA 2W9ZB 5BMMA 3ZBXA 5IH4A 3W18A 5CT0A 2C6OA 5J87A 3TNQB 3UTOA 3OT8A 5EM7A 2WO6A 2ZB0A 2ITZA 5CSHA 4TWCA 4K8AA 2WNTA 1OL7A 2PZ5A 3ZC6A 4DH7A 2I40A 4F9AA 2VNWA 3IDCA 3KK9A 4LL0A 4BGGA 4F4PA 5CXZA 3OCGA 5AV2A 4ZTHA 4EK6A 5KMJA 3ZFYA 3MPMA 5CU4A 4GT5A 1QPJA 2CSNA 2C3KA 2HK5A 3FWQA 4U3YA 5FTGA 1SMHA 2KULA 2OW3A 4BGHA 2DWBA 4F6SA 2ERKA 3BLHA 2PVHA 4D2RA 4RJ4A 1Q24A 2R3RA 4NZWB 3ANRA 4EONA 2P55A 5FGKA 5M08A 4E5AX 1Q8UA 5AMNA 3LXKA 1Z57A 2ZM1A 4QYGA 3VWAA 3DXPA 4FT0A 3RM7A 4FGBA 3C9WA 1XKKA 3VQUA 1ZWSA 3BLQA 3W2QA 4MTAA 3ZHPC 5AR4A 1G3NA 3CXWA 3FXZA 4P4CA 4G3DA 3ZFMA 1CTPE 1PF8A 2FSTX 3E3BX 3UDBA 3QZGA 3OEFX 3PXZA 3WF6A 1RW8A 3CE3A 3QLGA 4DFZE 5J7HA 5J9LA 2W1FA 5AX3A 5B2KA 1O6YA 4LOOA 2R7BA 2YDKA 3EJ1A 5C27A 3NYXA 2B52A 1H24A 1PW2A 2B9IA 4D0XA 3N4TA 1H27A 1U5RA 3TL8A 1U59A 2W1GA 1OPLA 5DEWA 4R8QA 5LWNA 4D9TA 2UZTA 4NEUA 5TOZA 1IA8A 3I79A 3BHYA 1XBBA 2R3NA 4W4WA 5J8IA 4G9CA 1V1KA 3LFCA 4PPCA 2XH5A 4HYHA 3Q4ZA 5EYMA 2J2IB 3TUDA 3FEGA 3F5UA 4JBVA 5GZ8A 4CCUA 4BTFA 3G9LX 2AUHA 4OAUC 3FZRA 4AZEA 3QX2A 1ZYLA 4RRVA 3D14A 3VUGA 4MF1A 1M2PA 2GHMA 4LGGA 3IONA 1YXTA 4PDOA 2UW9A 5F1ZA 5KMIA 3RAWA 3EFWA 4BYJA 4KSPA 4W8EA 2WTDA 3W8LA 5A54A 2BFYA 2B4SB 4JNWA 3F5GA 4LL5A 4ZIMA 5H3QA 5HZNA 4ZSGA 1G8AA 1WVXA 2VAGA 2GNFA 3A7IA 4J71A 3HAVA 2XM9A 1LP4A 2B9FA 2FYSA 2RG5A 3QD2B 3I5ZA 3QYWA 4G17A 4IEBA 2VV9A 3TV4A 3U8WA 3VIDA 4CFWA 4MXZA 4EHVA 3UBDA 2B0QA 4C4HA 3OXZA 2CDZA 5AWMA 5DE2A 4U7ZA 2C5VA 2YFXA 1CKIA 1OIYA 3IW6A 3Q32A 4ZAUA 4F9CA 2PPQA 1DI9A 4J7BA 2EVAA 2OWBA 3EN5A 4RFMA 3RCDA 4J52A 4MK0A 3R9RA 3KXXA 4TYHA 3VUKA 2QU6A 4C38A 2HZIA 3D7ZA 4RX8A 4RZVA 2RSVA 2VZ6A 5AP4A 4EH2A 4BZNA 5IU2A 2Y4IB 1YHSA 2OO8X 2W1HA 2VTLA 3DFAA 2HW7A 4FBXA 5AV4A 3C1XA 2OIQA 3RINA 3QTXA 5IEVA 4M15A 2R3FA 5CZIA 4O0YA 3C50A 1TQMA 1BI7A 3BWJA 4H3PA 4I6QA 3R8PA 1U54A 1NVQA 2FVDA 3VUMA 4AA5A 5EKNA 3OW4A 3PJ8A 5AP5A 4XOZA 3A8XA 4XV1A 1T45A 2PK9A 4QP8A 4EHEA 3DOGA 1Y8GA 2A27A 4J96A 3U55A 4R7HA 1NA7A 4QP4A 2XA4A 3FZTA 5CYIA 4FKSA 4OTGA 5EKOA 2A2AA 3TDWA 2PMIA 2QOKA 2BZIB 4KIQA 3QRIA 2UW3A 3VS1A 4HGTA 4D9UA 4QTBA 2BRBA 3AD6A 5IPJA 3PFQA 1KE8A 4ID7A 4IM3A 2B9HA 4GFOA 5AV3A 2OBJA 1BYGA 3KK8A 5DA3A 1PXKA 4YLKA 1PRYA 3UZPA 4MH7A 3GI3A 4C3PA 3LFNA 2W1EA 3IGGA 4PY1A 4ANQA 4E20A 1Q97A 3MH3A 5AP2A 4BC6A 2EU9A 2XNMA 1Y91A 4AOIA 3ZH8A 4YTHA 4Y83A 2WMXA 1SVGA 3VS2A 2DQ7X 3LJ0A 2VX1A 2JKMA 4XBUA 4E1ZA 4EH8A 4DT9A 4FKWA 1ZOGA 2R9SA 3O17A 4DEDA 2EXCX 3FC1X 3ELJA 3GC0A 3LM5A 3R7UA 2WMVA 5JK3A 4Z3VA 5DBXA 3MSSA 3TZ8A 2UVXA 3HGKA 4GYGA 1WBNA 4ITHA 4NKSA 4IM2A 3Q5IA 3QZIA 2I0VA 1ZYJA 3EQDA 3CEKA 4IFCA 4YP8A 4PMSA 4YC8A 4HCTA 3RI1A 5CALA 1ZMWA 2ESMA 5EFQA 3EYHA 4ANSA 4YTCA 4I94A 4BTJA 4IX5A 3MPAA 5AP7A 3O8TA 3KRWA 4FKLA 1XH6A 4Z7HA 2BKKA 3DGKA 3BEGA 3QCYA 4FT3A 3RK7A 4B99A 1OGUA 1GNGA 3QXPA 5LMKC 4H3QA 4FF8A 3SRVB 3NIEA 4ACHA 3HV3A 4AT5A 3PIYA 4BKYA 4OR5A 3TNWA 3UPZA 1BLXA 4LYNA 5ICPA 3R73A 2OICA 1H07A 3ETAA 3ORIA 4QMVA 4BBFA 1TQIA 1G8SA 2H96A 3LOKA 3RMFA 4FR4A 5EDQA 3DKCA 1R0EA 4L45A 5M4FA 2G1TA 5FBOA 4BTKA 4K18A 4GSBA 3TKIA 3K3IA 2C68A 3O50A 2OIDA 4G34A 1WMKA 2WQOA 4DINA 2NRUA 1QPCA 1CKPA 4FKGA 4HGEA 3I6UA 3ZONA 3E8DA 4EEVA 4UMPA 4XLVA 2UW6A 1FVRA 1CSNA 5JFSA 5E90A 5ACKA 2HOGA 4MX9A 5BPYA 4OGRA 1J91A 4G3GA 2J6MA 5GJDA 5EI2A 2Y6OA 1ND4A 3QZFA 2CGXA 4BKJA 4BZDA 1PXJA 4LFIA 4O0VA 4JG7A 3ZBFA 3KRRA 5AUYA 4DLJA 4E5WA 4KS7A 1E1VA 2WELA 4FZDB 4LV5A 4DEIA 4MWIA 4PL5A 3OBJA 4CQEA 1FBNA 4ORKA 2Z60A 3T3VA 1UVRA 3TUCA 3WARA 3QQFA 4ZTQA 4YPSA 2YEXA 2WZJA 1BUHA 3RPSA 4N70A 3KB7A 1FMKA 2HWOA 3EIDA 5FM2A 4ERKA 4QP9A 4TYHB 4IAYA 3P7CA 4FTQA 4BZOA 4FA2A 3ACKA 5HVJA 4GEOA 3I7BA 4X2FA 4DG2E 3FYJX 2OFUA 4ZSJA 3KXMA 3PSBA 3PVBA 3NEWA 4UV0A 5E8ZA 4PNKA 3R2YA 4FTLA 4F9WA 4K77A 4UXQA 5JQ5A 4G9RA 4JAJA 4XRLA 3QA8A 4HPUE 4DITA 3CBLA 4XCUA 4Y8DA 4C35A 4RFZA 3MDYA 3FMMA 4WA9A 3JY0A 4DG3E 4U3ZA 3JPVA 5DIAA 2WB8A 3MTLA 3FQSA 4AGUA 1ERKA 2CLXA 1OIUA 1YI4A 3MV5A 4GK4A 4O6LA 2XKFA 2F2UA 2A1AB 4J95A 4IZYA 5DOSA 1KV2A 5AP0A 4C3RA 3MY0A 3BHHA 4JX3A 3COHA 3QD0A 1TKIA 1XBAA 4Q9SA 4QMPA 4A9UA 3Q04A 5GZAA 2F4JA 1UNHA 2RFSA 5E8VA 5HESA 2B54A 4PUZA 3RAKA 4NYEA 2WU6A 3DS6A 2JBOA 3NUSA 3VHKA 2FH9A 4GL9A 3E8CA 3ALOA 3T8OA 2IW9A 3F2RA 3DJ7A 4IHPA 4WG3A 4QMQA 4PMPA 4NCTA 4JQ8A 1H8FA 3TZ7A 2BRHA 3BGPA 3R21A 5CTPA 4UYNA 2Z7RA 1Q41A 5BQ0A 4YC6A 5FXRA 4QMMA 3R1QA 2O8YA 3IW5A 5CS6A 3SDJA 3B2TA 4FTJA 4C4GA 4G5JA 4M12A 4F09A 4MQ1A 1NY3A 4ZXTA 3E87A 4IVCA 4JAIA 1OI9A 5KZ0A 5DMZA 5KMLA 3DA6A 3KA0A 4OT6A 4JJRA 2YM6A 3LLTA 4EC9A 3UC4A 4WNPA 2GS7A 2YJRA 4L43A 2WTKB 3FKLA 2R7IA 2WMWA 3I0QA 4LMNA 3VAPA 3VUDA 3POOA 3MS9A 2BHHA 2YCRA 1ZYCA 2J51A 4G2FA 5DVRA 5JSMA 3ZFXA 4D2TA 5AP6A 4P5QA 3UP7A 3VBVA 4RX5A 3I7CA 4F1TA 4KBKA 3Q9XA 5ETCA 3D5XA 4UEUA 5LMAA 4RIWB 1PHKA 4FOBA 4MVFA 5DT3A 4BDDA 4E26A 4DGNA 2HXQA 4J98A 1FVTA 4BCQA 2BDWA 3MI9A 4PTGA 3CKXA 5L8LA 5DNRA 3A7JA 3E64A 1JLUE 5I3RA 2CKPA 1M7NA 3D9VA 5BVFA 4M66A 1MUOA 4RT7A 4OTFA 3SW7A 3B2WA 4XP3A 3ORTA 1ZYDA 3G6GA 2ZJWA 3V8SA 5AP1A 4H36A 3FUPA 4DCAA 4ITIA 1H0VA 4H05A 1GZ8A 4NU1A 3RWQA 2XK7A 4EYMA 5JGAA 5A4EA 3LFQA 2OU7A 4R7IA 3RK5A 3EQPA 1B39A 4BI1A 4IJPA 2GCDA 3GU5A 3DNDA 5BYZA 3FQHA 3R2BA 4CCBA 5BX0A 5IH5A 3NNUA 5G1XA 2LGCA 2UZBA 4ZY6A 4FTKA 3AC4A 1M52A 3OW3A 4RLKA 2QURA 1FMOE 2GHGA 2V7AA 2VTIA 3ROYA 3VC4A 4FTTA 2R64A 2NNWB 2IZRA 5IUGA 2HAKA 1S9IA 3LFEA 2ZMCA 3RALA 3CS9A 4NM5A 5JGDA 5ANIA 1H28A 5CVHA 4X2JA 2ZV2A 2J50A 1VZOA 3HMNA 2X8IA 4O86A 1Z5MA 3U9CA 3AC3A 4J1RA 4O1PA 4WRSA 4WIHA 4O0UA 4IXPA 2H34A 5M56A 2XS0A 4QYEA 5BVEA 4BN1A 1H1PA 4FG7A 4FNWA 3ERKA 2C6KA 4IX4A 3FZSA 2PZIA 4ANOA 4PMMA 4JRNA 4U5JA 4BDBA 4DN5A 5KMNA 3UOJA 3VBXA 4BIEA 3V5JA 1M7QA 4EC8A 1H1QA 3DCVA 3PVUA 3NW6A 4FNXA 5FLFA 4O2ZA 2WKMA 3BBWA 4G6OA 4P2KA 3PE1A 4QMYA 1Q8TA 1XR1A 2UW7A 2QVSE 3LCSA 2R0UA 2QOIA 2YAAA 5CVFA 3CTQA 4DYMA 2PY3A 3GVUA 4E4XA 4HZSA 4JVGA 4RX9A 4X7QA 2ZAZA 5GNKA 4BCOA 3D94A 3BLRA 3P4KA 5TO8A 4JT3A 1WBWA 4DC2A 5I3OA 5KX8A 3MB6A 3KN5A 5K4IA 5E4HA 2UV2A 3TUBA 4K1BA 2X81A 4W9WA 3R83A 5E7RA 4YHJA 3EYGA 1OM1A 1Q61A 2YIXA 4FKIA 4FODA 2XJ0A 1ZRZA 5BUIA 3OROA 4M0YA 5HG9A 1P4FA 4H3BA 5CLPA 4C4IA 4D2VA 4FEXA 3V8WA 5ITAA 5JFVA 4DHFA 3KMUA 4RGJA 2ONLA 3QRTA 4MBJA 3SW4A 4FUXA 1PMVA 3QX4A 3MFUA 4AZTA 4CFMA 4EWHA 4EZ7A 3KXGA 4F1MA 2HXLA 5AUVA 5A6OA 5F4NA 5D41A 3GU4A 5FTQA 5KE0A 2QO9A 3RZFA 5CEIA 3BKBA 4PP7A 4IB0A 2WU7A 4V01A 3WZEA 3V5LA 4G1WA 4LG4A 4RLLA 4CYIA 3GC8A 5AV0A 4BF2A 5CEKA 1JOWB 1XH5A 3H9OA 4FV5A 4IVAA 3FXWA 3GQLA 3LPBA 4QYHA 3TI1A 4EZ3A 5KKRC 3BGZA 2B55A 3G9NA 4R77A 4IANA 5FEDA 3ZUVA 5DH3A 4NW6A 3GFWA 3FMLA 2VWYA 3DK7A 3ZLYA 4GG5A 4O96A 5FD2A 3KN6A 1OUYA 4BKZA 5CEQA 3FHRA 2BZHB 3LFFA 1GIHA 1U5QA 2C1AA 4BDJA 2JDSA 4LGDA 1WBSA 3II5A 4NFNA 3RPVA 2XK9A 3CQEA 4L68A 3V51A 3D2KA 2WTCA 4FIHA 2WIPA 4BCPA 3V8TA 3IECA 4AW1A 2WEIA 5FWKK 3HDMA 4N4SA 4F6WA 4S32A 4FTUA 4RIOA 2WHBA 3WE4A 1OVEA 4Q2AA 1DAWA 1CMKE 2XP2A 4L52A 3NUXA 2C6TA 2QLUA 3DZQA 4BWPA 2WXVA 1J7UA 1REJA 3DDQA 4FTIA 3BU5A 3AMBA 3FLZA 1AD5A 2VRXA 2WQNA 3D2IA 4JQ7A 1E9HA 2J0IA 3TNPC 5BNJA 1M2QA 3PXQA 3LFAA 3OT3A 3COKA 3KRJA 2F7ZE 5IQAA 3IK3A 1YXSA 4EK5A 1KUTA 1QPDA 3EQBA 3FAAA 3IPHA 5BMSA 5LCKA 3SOCA 3QYZA 4FIEA 4C4EA 3D5VA 4FSYA 1OKZA 1IR3A 2CKEA 2O3PA 3OWJA 3FL4A 1YKRA 4RSSA 4RVMA 3KXHA 4G5PA 3UVQA 3ENHA 5IISA 4MWHA 1FINA 3TG1A 1H01A 4PNIA 5B2MA 2VWZA 1KE6A 4FV1A 3WZDA 4E7WA 3D5UA 3OY3A 1UWHA 1IA9A 5DPVA 3FSKA 2W5BA 4E4NA 2VWUA 4ARKA 3M11A 3CJFA 4O7ZA 3PLSA 5ANJA 3Q6WA 4UBAA 2ETMA 1BKXA 2Y6MA 5HX6A 5KMKA 2WAJA 3CLYA 2SRCA 3GCPA 3QLFA 3WBLA 4BCJA 1Y6BA 4FUYA 4O7YA 4RFYA 1TVOA 2C6EA 4EUUA 3PXRA 4FK6A 4RWJA 4AGDA 4EOJA 3NUPA 1GZKA 2ZYBA 1PXIA 2Z7QA 4O38A 1FOTA 3LFBA 5E1EA 4BFMA 3OS3A 2OJFE 4F9BA 1JWHA 1OKYA 3O7LD 4I5MA 4N6ZA 3IDBA 5TF9A 1J7IA 2XUUA 1FPUA 3WE8A 2IWIA 4NSTA 2W7XA 4PTEA 4BDHA 3PP0A 2OF4A 4CFUA 1ZY4A 4IX3A 4L46A 4YJNA 4CNHA 2GDOA 2XF0A 3CIKA 4IZAA 4QP3A 1Q8WA 5EYDA 4AGWA 4OTQA 4OBQA 1UU8A 5EI6A 1OKWA 4YO6A 1CM8A 5CAUA 3C5IA 2VWBA 2WTJA 3VUIA 3I6WA 2BAQA 2IVUA 3MWUA 4IX6A 2PMOX 4WG5A 4FV3A 3SD0A 5CF5A 3DXNA 5EYKA 3EOCA 4CG8A 4DEAA 4RJ5A 1SZMA 2ZB1A 4OTPA 3TV7A 3H0ZA 4TWPA 5FP5A 2W1IA 2YA9A 4IJ9A 2CNQA 4HNIA 2GNGA 3MW1A 4OTIA 4IAKA 4ZOGA 4B9DA 3C51A 3BCEA 2GSFA 3E62A 1F0QA 5CI7A 1H1RA 2XM8A 4GFMA 4OLIA 4ZZMA 3HRFA 4K11A 5JZJA 3EL8A 1H26A 4EH4A 4YLJA 3EB0A 3UQFA 4ZSAA 4BICA 5J5TA 3MFSA 2RGPA 3R7GA 3TCPA 3L8PA 4RJ7A 1JQHA 3DZOA 2VD5A 3PG1A 3PWDA 2Y0AA 4QOXA 4R5YA 4G3EA 1PXPA 4EZ5A 4B4LA 3O8PA 5CEOA 5TKDA 5A14A 4AE6A 4CRLA 2CNVA 4QNYA 4O91A 4FK3A 3EMGA 2XYNA 3ZC5A 2JKOA 3R8MA 2WEVA 2W1DA 2E9VA 4U80A 3OOGA 1W8CA 3UQGA 3DPKA 2YAKA 4LQMA 2F49A 3O8UA 3OBGA 3LAUA 4QP7A 2I0YA 2VTQA 4RC3A 1S9JA 4GU9A 4EOPA 2UZOA 3A8WA 3MH0A 4X3FC 3THBA 4A9TA 5CT7A 1XHAA 4EOMA 3BQCA 4I1ZA 3PTGA 4EH6A 4HPTE 2YM3A 3ZRKA 4TXCA 2X7OA 3E8EA 3PSCA 4I3ZA 1HCKA 4YBJA 2EUFB 4R3PA 3EWHA 2X2LA 2FO0A 2W4JA 3DBCA 3T9IA 3VUHA 2ITNA 4YTIA 3W2RA 4GVJA 5IDPA 5L2SA 3D0EA 3MVLA 4IIRA 4Y72A 3ZO4A 2QG7A 3UE4A 4CLJA 3HRBA 3PJ3A 2KTYA 1O9UA 2XNNA 3UVRA 4Y85A 4ZY5A 3TDVA 3I0OA 3V3VA 2A4LA 3MB7A 4O0RA 5LVMA 2QU5A 4KRCA 4RIXB 5L2WA 1Z9XA 3HUCA 3KC3A 4HVDA 4FKQA 4GRBA 4IWDA 4NM3A 1OITA 3FI3A 3PIXA 2OZAA 4X6QC 3RM6A 4GCJA 2R3JA 4FIIA 4KAOA 2QHNA 4I5PA 3F3UA 1KWPA 3E93A 3QCSA 2OI4X 4C7TA 1UNLA 3HA8A 4J99A 4U81A 4IWOA 3ZEPA 4NJDA 4DGOA 1WBVA 4FYNA 4H58A 3U6IA 1XO2B 4FYOA 2XMYA 2CN8A 4ZMEA 4FIGA 4B7TA 1UKIA 2X9FA 3O51A 4ZSEA 4HCVA 4F0GA 4BHZA 4ZTMA 3O2MA 4LM5A 4KD1A 1JKTA 1KOBA 3QTIA 1IG1A 4FKPA 5L8JA 4C61A 4CEGA 3Q2MA 3DAJA 3SRVA 2JIVA 4EHGA 5KCVA 1R39A 2QOCA 4IMYA 4YJVA 3QXOA 2VWVA 3TWJA 3FMDA 5HVYA 3VVHA 3ZSHA 3PJ2A 3NCZA 5I9YA 5G6VA 1Q8ZA 1UA2A 5BVWA 5IQBA 2QC6A 3PXYA 3UO6A 3GGFA 1GZOA 4NH1A 4KNBA 5DYJA 5J1VA 3C4EA 3QUEA 3VRZA 2GTMA 3VO3A 4X2NA 5E91A 4EH7A 3MFRA 5EM8A 5T6KA 2R5TA 3GCUA 4U41A 3NMUF 3DDPA 5CQUA 4MEDA 3UIMA 5DGZA 3GU7A 2BUJA 2XKDA 5EOLA 3ORPA 4CD0A 1WVYA 2DYLA 1W7HA 1QCFA 2EWAA 5AR7A 3NYVA 3FBVA 3QQJA 1BI8A 3RAHA 4OT5A 4A06A 3QTQA 5AAEA 5HVKA 4TNDA 3L8SA 5DI1A 5FDXA 1FQ1B 2I0HA 2XK8A 5IH6A 3VS3A 4DCEA 3R8VA 5CF4A 1WBTA 2QOBA 2V7OA 5FEEA 3FPQA 1LR4A 3ORXA 5IQDA 5HIDA 3NSZA 2WQEA 3QRUA 4YJPA 1M14A 5BYLA 4BDFA 3VS4A 3WZKA 2OH0E 3FI2A 3IQ7A 4WKQA 3CQWA 5CSWA 2VU3A 3P0MA 4R1VA 4F65A 3DTCA 2ITQA 2X4ZA 4XJ0A 3OMVA 3VF8A 4UX9A 3AC2A 4ZS4A 4BWKA 4AOJA 4PL4A 2IZTA 5CY3A 3R0TA 4EOIA 4BYIA 3JXWA 3LCDA 4MCVA 1BX6A 3SA0A 2H9VA 2BDFA 5HU3A 1H08A 1H4LA 4X2GA 3LW0A 4A9SA 2XEZA 3TNHA 1NW1A 4F7LA 4UALA 1GZNA 1MRUA 4M0ZA 3ZTXA 4CFFA 5FUTA 5HO8A 4BR3A 4I0RA 5IA0A 2OGVA 2P2IA 4MXCA 4QQJA 1OIRA 4CVAA 2QOOA 4JBPA 5JRSA 2IJMA 2WOTA 5GZ9A 5D7VA 5JKGA 5CF8A 5CSVA 4FVPA 1JAMA 3D15A 3OZ6A 4RJ6A 4FZ7A 4DEEA 1NT2A 5L2IA 5AEPA 4U79A 4JXFA 3KRXA 3RHXA 5IQCA 4FT9A 3IS5A 4KBAA 4HGSA 5EYCA 1OUKA 3GU8A 2QD9A 1OBGA 2Z7SA 3F3ZA 2VTTA 3FXXA 4FV6A 4YZNA 5CSXA 5DEYA 2R3OA 3VBTA 3WF9A 3WIKA 4CT2A 3CQUA 5HE3A 3L9LA 5IQHA 2HCKA 4RWIA 4P5ZA 1V0BA 2W1CA 3PRFA 4Y46A 5DR2A 2PU8A 2C47A 3CP9A 2PYWA 3LLAA 4PWNA 2BTSA 3HA6A 1KE9A 1JKLA 1U4DA 3AC1A 4JOAA 2HW6A 4X3FB 1SVEA 4ASDA 4M7IA 4JS8A 4QTCA 3PZHA 4DH3A 1WBOA 3QRJA 3HMPA 5CZHA 4IDVA 3HUBA 1KV1A 3OY1A 4MD8E 3R9NA 3QL8A 3FZPA 5CVGA 2RFNA 4AFEA 4BVUA 4L67A 1IEPA 2ITOA 2ERZE 4AZWA 3A2CA 5CASA 4QMXA 3NUNA 3MVMA 4D2WA 2YISA 4F08A 3RZBA 3NVKI 2BALA 1OL6A 4YZMA 4O2PA 3GU6A 3K5UA 3RVGA 4E4LA 3ODYX 4Q9ZA 4FSMA 5C26A 2GU8A 1XBCA 5AUTA 5AUXA 5HG7A 5ETAA 3MFTA 4TT7A 5ANEA 3NZ0A 5CXHA 4L53A 3C0IA 4GUBA 1KE5A 2GQRA 3DQWA 4J8NA 3UVPA 3NNWA 3P9JA 4FTCA 2QG5A 3QUPA 1MQ4A 1ZZ2A 4EORA 1J3HA 4TWNA 2OZAB 4TRLA 3BU6A 2W17A 2PVYA 3B8QA 3QTWA 4RIWA 2FA2A 4AS0A 3BRBA 3HAMA 4O83A 3KXZA 3ORMA 1WZYA 2UZUE 5E9EA 1X8BA 3UP2A 3JVSA 4FMQA 4W4YA 2W1ZA 2QKWB 5LMKA 3F3VA 4FG8A 2NRYA 2WTVA 2V0DA 3UIXA 1ZMVA 2QQ7A 2VTRA 4IBMA 2JIIA 4EOOA 4HVHA 5LVPA 3GC9A 3T9TA 1P4OA 2VN9A 4I6BA 2OJGA 5CNNA 3C4WA 3G33A 2GFCA 4PMTA 4ZJIA 3UO4A 3NR9A 2YM5A 3O7LB 2XEYA 4QP6A 1ZOHA 2JAVA 3HP5A 2PTKA 5C9CA 2QOHA 3TKHA 5DR9A 1H00A 2ITYA 2OJJA 3AQVA 2DUVA 4B8LA 3A60A 2X6DA 3B8RA 3VULA 3BWFA 5E1SA 5CENA 4K6ZA 4L44A 3EZRA 5L6PA 3IOPA 2J5EA 5FG8A 4CFXA 4F63A 4ZZOA 5CEMA 1OZ1A 5L4QA 2BAKA 4QMWA 2WIHA 4UYAA 4L8MA 3MIYA 3QTSA 4FL3A 2X2MA 4JDJA 1KOAA 5CNOA 2XNBA 3C7QA 3QTUA 4QMNA 1FGKA 3QKMA 3AGMA 5CAVA 3BI6A 2WMRA 5AV1A 4BCFA 3QUDA 5CSPA 2VTHA 4FL2A 3R00A 2CKOA 4CZTA 3WYYA 5CWZA 4YZCA 3DV3A 4V0GA 4C33A 3EQHA 5IMXA 2R4BA 2EB3A 3ATTA 3ACJA 3MN3A 3BBTB 5L2QA 4F64A 5FM3A 5HORA 2I7QA 1R1WA 4GIHA 4W4VA 4R3CA 4R1YA 2NP8A 3QC4A 2E9UA 1RDQE 5IEXA 4M69A 2CLQA 4E6QA 2CKQA 2H6DA 4UMTA 5FBNC 3JVRA 4ACDA 2UUEA 3K2LA 4IZ7A 5HO6A 2J7TA 5HOAA 4M8TA 5FDPA 4HW7A 2W5AA 2JFLA 4TYIA 2XB7A 2BKZA 4JG6A 2R3GA 4UMRA 3UNZA 5HCYA 2JLDA 3O71A 3Q9ZA 1ZLTA 5K0KA 3KULA 2PMLX 5C01A 2ZV8A 5HD7A 3AMAA 3NW7A 3PRIA 4UY9A 4XX9A 2REIA 4EOSA 4GJ3A 4KUJA 2JD5A 1L3RE 2GHLA 2PZYA 2GTNA 4HGLA 3FI8A 3SXRA 4QMOA 5I9WA 3AOXA 3BEAA 4GG7A 4QYYA 4W8DA 2Z8CA 3RWPA 3VBYA 1WFCA 2HENA 5E92A 3A7HA 3OC1A 4JG8A 1LEZA 3SX9A 2AC5A 4QPMA 3E3PA 4BRXA 4XOYA 4ZTLA 2ETRA 3ZO2A 3ZM9A 4GH2A 5FEQA 3U4UA 2YITA 3JS2A 4QMTA 4GKHA 4P7EA 1KSWA 2JKQA 3FLYA 3HYHA 5E8TA 3R28A 2PUNA 4FV7A 3WILA 3OUKA 3BYUA 3R04A 3ZZEA 3CY3A 5K4JA 4O7VA 4NTTA 3QQGA 4K2RA 2FUMA 1UU7A 3LXPA 3NAXA 3G90X 1UU9A 4ZTSA 4TWOA 4CMOA 4C58A 4EBWA 2ZM3A 2JEDA 3ZUTA 5A6NA 1Q62A 1SNXA 2QNJA 1V0PA 3GBZA 2R3KA 4YBKA 3JYAA 4WBOA 5K9IA 1PKGA 2BR1A 4ANMA 4ALUA 4F0IA 3U87A 5J9YA 2UVZA 2WMQA 4XG6A 2IPXA 2GQGA 4NWMA 4GW8A 3WYXA 5FXSA 2EXMA 3DY7A 3FZ1A 3EH9A 4KINA 4XG3A 5HTCA 3OEZA 1WVWA 4G3CA 2PVLA 4QQCA 2GNHA 3QHRA 5HBEA 4JDIA 4OBOA 5A4LA 4QP1A 1XH4A 4DFLA 2W5HA 4M97A 5GJGA 4TZRA 5DG5A 4DTKA 3AC5A 1ZAOA 2UZWE 4IM0A 3NUYA 4QO9A 2JDTA 4FZFB 4AW2A 4LRMA 2AC3A 3MA3A 1BL7A 1R0PA 4O0SA 2XK4A 1XH7A 1GIIA 2ZMDA 2WFYA 3C13A 4D4RA 4XS2A 4CGAA 4D5KA 4AZFA 2BILB 3ODZX 5TR6A 2XNPA 4ZLZA 5KHXA 3AD5A 3VNTA 3LMIA 2C3IB 5T68A 1KE7A 4Y73A 2UZDA 4A9RA 4DGGA 5I0BA 4RVKA 2VX0A 2CMWA 3ZUUA 2IG7A 4PDYA 4FTAA 5DWRA 4FSZA 5HG5A 4USEA 5CQWA 1Y6AA 1WCCA 2HELA 1SM2A 3L8XA 4BIDA 2BMCA 2WOUA 1PMEA 1Q99A 1JKKA 3LMGA 4FKRA 4RJ3A 3F69A 5E8UA 3Q4CA 4BDAA 3PXKA 5JRQA 4AF3A 4BI2A 1H1SA 2IVVA 3DK3A 5EH0A 4DEGA 2BRMA 3SKCA 2C0IA 4I20A 5M4IA 4L3LA 4ONAA 5A4CA 4IB1A 3V5QA 4L00A 3HL7A 3U6JA 3WF8A 1APME 5AR3A 2X0GA 3MH1A 1FGIA 3SXSA 2WMSA 4EYJA 4CV9A 4FKJA 3H9FA 4JDHA 3TIYA 5M55A 4NKAA 4EQCA 5HBJA 5KUPA 3ZMMA 4RVLA 3CD3A 3QALE 3WF5A 4EI4A 3JR1A 4C37A 4XV3A 5CU3A 3DJ5A 5FXQA 3CTHA 4FSWA 4F7JA 2B1PA 3TTIA 4XLIA 1YQJA 4HJOA 1JVPP 2OLCA 5M06A 3V01A 4V0GB 1JBPE 3UOLA 3LKMA 4U45A 5LWMA 3Q4UA 3BV3A 5CAPA 5BVOA 4ASZA 4ALVA 5CI6A 3R8ZA 4R7BA 3C4ZA 5DLSA 3ZZWA 4TPTA 3EZVA 3LIJA 4XV2A 1O6KA 5AM6A 5EDPA 5F9EA 4AW5A 4HVGA 1STCE 5B2LA 1OPKA 4M69B 3VJOA 1OIQA 3GCVA 4BDIA 5IA2A 3BQRA 3UQCA 4RJ8A 2JAMA 3TJDA 4A4OA 4LOPA 4FT5A 4MNEB 4R3RA 2IW6A 3RP9A 3TIZA 4APCA 4G3FA 3K54A 4C3FA 4PQNA 4D1ZA 4Y5HA 3ORNA 2WMBA 1DM2A 3JY9A 4QQ5A 3VUTA 3N4UA 4MXYA 5JEBA 2G15A 2PZPA 1M17A 3KCFA 3KULB 3MY1A 3UOHA 4DBNA 3AC8A 3FYKX 3R1YA 4TN6A 3AGLA 3FLSA 3R7YA 4I5CA 4FKVA 3Q96A 3QRKA 4GV1A 1CDKA 3RCJA 3V6SA 4C57A 5LCJA 4DGLC 3EKKA 3R7OA 1SYKA 2VWWA 3GC7A 3R63A 4AZVA 4TYEA 4BTMA 3LHJA 4AGCA 4EQMA 4RA5A 4YJQA 4DTBA 3HV6A 2XRWA 2OF2A 2VGOA 4N0SA 2YM4A 4J97A 4GUEA 4MHAA 4O1OA 4KA3A 4A07A 3C4FA 1I44A 4RIYB 3LM0A 4EJ7A 4Y5QA 4YZBA 3KMWA 2F7XE 4O7WA 5EHLA 1DS5A 3L9NA 4AA0A 5M53A 2R2PA 4OTHA 5LVNA 4D2PA 4F9YA 3HNGA 2W96B 2Y9QA 3KF4A 3OFMA 5HCXA 4I4FA 3ULZA 4YSJA 1PJKA 1BL6A 4C36A 4ZZNA 3DBEA 4UWBA 3FY2A 4ALWA 4BCMA 1H25A 3OHTA 3EKNA 4FEVA 3P7AA 4DGMA 2RKUA 3GNIB 1BMKA 5D9HA 4CQGA 3KXNA 2C1BA 3CKWA 3HP2A 4RC2A 4W4XA 3CJGA 3D83A 3VQHA 4ACCA 4DH5A 3PDTA 1VJYA 4MAOA 4EBVA 3BYSA 1ZXEA 2JFMA 3KU2A 4RC4A 4YPDA 3QF9A 2QCSA 5BVKA 4AN9A 1MRYA 1Q3DA 2IO6A 4I41A 5C8KA 1F5QA 3ANQA 2YACA 4V05A 1V0OA 1PY5A 5JQ8A 5JT2A 2P2HA 3F2NA 1OB3A 2E9NA 4MNFA 4YHFA 3EN9A 4B8MA 4A7CA 1YVJA 4RIXA 2OJ9A 5H9BA 4QRCA 2W4KA 2BTRA 3QA0A 4C02A 4W9XA 3ZSIA 3ZYAA 5BVNA 2QOFA 4O6EA 4TYGA 5IA4A 3LCTA 3CR0A 4M3QA 3UIUA 3C5UA 4E8AA 2NPQA 3BYOA 3WI6A 4CG9A 3UIBA 3GQIA 3KRLA 3U54A 4WUNA 4BWXA 4Z16A 4DFXE 3AD4A 5I9XA 1XWSA 4GVAA 1URWA 2VTMA 4FV4A 4FG9A 4JBQA 4CLIA 5KHWA 5HTIA 3ATSA 2H8HA 3TACA 3WZJA 4D4YA 3SXFA 4I5HA 1Q5KA 3POZA 3HMOA 4QT1A 2W0JA 1CKJA 4D4SA 4XH6A 2ITWA 5C03A 3RPRA 4QMZA 2X7GA 2A19B 3HV4A 2E9PA 5EDRA 5FQDC 1K2PA 3U4WA 3EQIA 4D28A 2R3QA 1JKSA 1J7LA 2QHMA 5IDNA 5L6OA 3F3TA 3W32A 4F70A 3ITZA 4E6DA 3UPXA 4FV9A 4BY9E 4Z9LA 3VS5A 4CSVA 4JR7A 3H10A 4BCGA 4YZ9A 4O7LA 4IC8A 2YM7A 3FLWA 3OCSA 4U97A 4JRVA 3O0GA 3CPBA 2PZRA 3DKOA 2VTSA 4FC0A 3H3CA 4IWQA 2VX3A 3OCBA 2CGVA 5C8NA 2YIQA 2CPKE 2VTOA 3R1NA 4XBRA 5L3AA 2X2KA 5DFPA 3W8QA 5AAGA 3MBLA 2UZLA 3M42A 3BYMA 5HCZA 4M84A 2JC6A 2F9GA 2Q83A 1R3CA 2E2BA 4DAWA 1A48A 1PYXA 3MA6A 5DT0A 5HD4A 4D2SA 2XBJA 3QKKA 5CF6A 4FTNA 2J4ZA 3SHEA 4XP2A 4RWLA 2HZNA 3VBWA 3GOKA 3U6HA 4OBPA 2OXXA 4J8MA 4XNEA 2R3IA 2YDJA 3Q3BA 4FNYA 1W84A 4R6VA 3MIAA 2BPMA 4FT7A 4HYSA 5AUUA 3CGOA 1VYWA 4YJTA 1Y57A 4GKIA 4HYUA 3CC6A 2BFXA 3A61A 2C30A 3CPCA 4ZP5A 5F94A 3ZXTA 3MESA 3H30A 4EH9A 4OTRA 5IMEA 4XG8A 4EQUA 4GS6A 3KY2A 3PXFA 2B7AA 4L3PA 1MRVA 5CANA 2R3HA 1XQZA 3TZMA 4TKSA 4X3JA 5EK7A 4RVTA 2V62A 4WHZA 5EQEA 3FZOA 4OW8A 3WZUA 4ASXA 4L3JA 2YIRA 2PMNX 3BYVA 4GJ2A 3F5XA 3SAYA 4N57A 3NS9A 3NIZA 2C5XA 4CT1A 2YCQA 3MYGA 3TKUA 3I5NA 3LMHA 5M57A 3IKAA 4WSQA 3UG1A 2WTIA 2V5QA 3EFKA 5GINE 3BU3A 4CFVA 4FX3A 4IB5A 4WT6A 4X3FA 4CKJA 5KKRB 2ACXA 3ZU7A 4O7SA 3I4BA 2Y4IC 3LVPA 4BB4A 3DTWA 1W0XC 4XYFA 4LI5A 3SG8A 3EFJA 1YHWA 1ATPE 4G6LA 1ZYSA 2WMTA 4DA5A 4YR8A 3FMHA 3ORKA 4JI9A 3V04A 5JZNA 3HVCA 3SGCA 3RAIA 2BVAA 2Z02A 2R3MA 4AWIA 3DAEA 1JSUA 4BDEA 3ZLWA 3KVXA 3QCXA 4XG2A 4XUFA 3O23A 2Q0BA 5HEZA 1NXKA 2XNEA 3AXWA 1YWVA 3C4CA 4CZUA 3NVMB 4EH5A 4YNEA 3KF7A 3IW4A 3QWJA 4QTDA 4FI1A 2FGIA 3PJCA 5IF1A 2HIWA 3MVHA 4X2KA 3DBDA 4QMLA 3NGAA 4RZWA 5I4NA 3E88A 2C5NA 1H1WA 3OWKA 5F20A 3TT0A 4C34A 3PPKA 3A7GA 4WD5A 4TW9A 3Q9WA 2V55A 5I9UA 5M4CA 4QNAA 3E5AA 2ITVA 3OD6X 5AIKA 3FMEA 3W10A 2YCFA 4JIAA 3U9NA 4DFNA 4AQCA 4F1OA 2I1MA 3FMKA 3NX8A 2Y4PA 1OL5A 4BCHA 2DS1A 4FIFA 5M44A 4G6NA 3MGYA 3V5TA 1J1CA 5TT7A 2EB2A 3DBQA 4IZ5A 3DLZA 2J0MB 3GCQA 3R1SA 5FTOA 3ZS5A 4NUSA 2YIWA 4XEYA 4AOTA 3NCGA 4O81A 4K33A 4FZ6A 4JR3A 3W2SA 4ANBA 3FQEA 2WD1A 2XIXA 4GT3A 2WQMA 4X0MA 3V6RA 4AAAA 3BE2A 5AUZA 5FRIA 4NJ3A 3CCNA 3PPJA 2XYUA 2JKKA 2BRNA 2RFEA 2X6EA 4P90A 4D4VA 1J1BA 4YLLA 3A7FA 4ANNA 3P86A 5HGIA 3VS7A 4AFJA 4CTCA 5HIEA 3SQQA 3NNXA 4D0WA 1E1XA 1GAGA 4O7TA 5H8GA 3UGCA 1YDSE 3RNIA 3OTVA 4U0IA 2RL5A 2YZLA 2GNJA 4JBOA 4M13A 2OXYA 5KBQA 4GYIA 5IA5A 3WOWA 5ETFA 4ZLOA 4BIBA 3NRMA 3QQKA 3OG7A 4ZMFA 2HZ4A 2XIZA 2J90A 2HZ0A 4EK8A 2RG6A 3F5PA 2P4IA 2GQSA 3BIZA 4WNMA 2ZDUA 5ANKA 4ZS0A 5FP6A 1A06A 3KREA 4USFA 1ZZLA 4KSQA 3PA3A 3OCTA 3FHIA 4QPSA 3IW7A 2X7FA 3W16A 3UO5A 1VYZA 2IZUA 3HZTA 3VN9A 4ZK5A 3HMMA 4O0XA 5E8SA 4QMSA 5HBHA 3L1SA 4HZRA 4AU8A 5GIPE 3LXLA 4PP9A 4XG9A 3DB6A 2C5YA 1Y8YA 5C8MA 4BCNA 5AP3A 3OWPA 3QAME 4C4FA 4FSNA 3W2OA 3PY3A 3PA5A 4BI0A 3LJ2A 5KZIA 4QPAA 4OAVB 3E8NA 2ITTA 3DXQA 2XKEA 3ET7A 3FL5A 3A99A 2GPHA 3UC3A 3OOMA 4L9IA 4NFMA 4IC7A 3DKFA 5EM5A 1VEBA 4IVDA 4QMUA 3P23A 5GJFA 4EH3A 4EHZA 5B7VA 2FSMX 3GOPA 4NT4A 4U40A 3F61A 4EK3A 3M2WA 4RMZA 5CEPA 5KNJA 2OH4A 2J0JA 3FKOA 4U44A 1ZOEA 4MKCA 5AR5A 4JQEA 2OXDA 5JFXA 3LE6A 4FIJA 2UZVA 2C3JA 5I5ZA 1YXXA 3T3UA 1H0WA 4FNZA 3ZO1A 5AA8A 2X39A 1WBPA 3TJCA 2PE1A 5CU2A 5L6WL 5EHYA 4HCUA 2VO3A 3FE3A 4EJNA 5IUHA 3QTRA 4C4JA 4ERWA 1UNGA 4H39A 3ID6C 4PF4A 4YNOA 2PUIA 5HLWA 2BAJA 1UU3A 3REPA 5C4KA 4MXOA 2CCHA 3GEQA 5HI2A 3VJNA 4IB3A 3OUNB 4XV9A 4WRGA 5DN3A 3MJ2A 1PKDA 4L7FA 2P0CA 2UVYA 2XZSA 5CU0A 3IDPA 1I09A 3G51A 3N9XA 4IACA 3QQUA 4MBLA 4O0TA 3HV7A 3ORLA 5H8BA 1P2AA 2JDVA 2BDJA 4DEBA 4TYJA 3K5VA 2PUUA 4LUEA 4YJOA 5ANDA 2XNGA 4UMQA 5IQGA 1AGWA 2OJIA 3ALNA 5IQEA 3R01A 3BELA 1JSTA 3W1FA 5HO7A 3PLAE 3PZEA 4NL0A 2F7EE 4HVSA 3K3JA 1HCLA 2F2CB 3F3WA 3E92A 4WNOA 1JSVA 3W2CA 2BROA 3JUHA 5AM7A 2BHEA 2C0OA 3DJ6A 4WSYA 5TE0A 3W55A 1Q3WA 2YN8A 4N6YA 4E4MA 1RE8A 3QCQA 4FV8A 4IWPA 2FSOX 2J5FA 4ENXA 2C4GA 2X1NA 2BCJA 4ZJJA 3E7OA 3GP0A 1YOJA 2IVTA 4LUDA 2C6LA 3VS0A 1GY3A 2P3GX 2YDIA 4RA4A 4R78A 1URCA 4Z55A 4I0SA 4WG4A 1YOMA 4AT4A 4L6QA 2GNLA 2WTKC 4L7SA 3UG2A 3PUPA 4G31A 3LZBA 4IH8A 5A3XA 5JH6A 3QKLA 3HDNA 3Q4TA 1F3MC 5LARA 3KVWA 5AFVA 2WQBA 2QONA 1NVSA 2X9EA 4NK9A 4AACA 4APPA 2R3LA 1UKHA 4I24A 4R5SA 3R9OA 1YI3A 3UMXA 2PVRA 2QR7A 1GOLA 1NVRA 3N51A 4LGHA 2ZV7A 4O21A 4UXLA 5LJJA 4NIFA 2V22A 3HKOA 5J79A 1L8TA 4E73A 5EW8A 2ITXA 4I6HA 3AT2A 4MBIA 5A4TA 5L2TA 3FJQE 3OXIA 5CX9A 1IAHA 2E9OA 2WGJA 4F6UA 4KB8A 1GJOA 5JGBA 4BCKA 3NYOA 3MY5A 3D7TA 1JPAA 2GNIA 2O5KA 3G0EA 4H1JA 4ZTRA 3VW8A 2R3PA 2PVNA 1YI6A 4JL9A 2A0CX 2YLEA 3NNVA 3R02A 4I22A 5D10A 4U6RA 2C69A 4FICA 3IW8A 4E6AA 4X6RA 3SG9A 4LV8A 5HNGA 3FPMA 2FB8A 3PY0A 4WUAA 3SLSA 4UZHA 3R8LA 4PX6A 3BPRA 5AAFA 3V5WA 1UV5A 3TN8A 4YHTA 3DB8A 3QFVA 5D1JA 4BHNA 1K9AA 3LJ1A 1PXMA 2BZKB 3QQHA 2GS2A 3DBFA 3H9RA 3LQ5A 4MNEA 3TTJA 2PWLA 3I60A 4DT8A 1OKVA 2G01A 5ANOA 2XBAA 1LEWA 4M68A 5AA9A 1PMNA 4PPAA 2PE2A 2VTJA 3FSFA 3GXLA 1PXLA 4AE9A 4E93A 3Q9YA 4FSUA 5IQIA 2JDOA 4PDSA 3R71A 5EW9A 5IUIA 2R0IA 4CKRA 5D7AA 3DLSA 4KKGA 4AW0A 4K9YA 5HICA 2OZOA 1OECA 4HNFA 2C6DA 5IG1A 4DF3A 3BE9A 5AX9A 4IVBA 4WOVA 4ZJVA 4JX7A 2PSQA 3ZSGA 1XH9A 4D58A 1W82A 3G15A 2GS6A 4FVQA 2ZOQA 4HOKA 4ZSLA 2YERA 3EQFA 4GIIA 4KRDA 3UYSA 4YURA 2YABA 4RIYA 2QR8A 3FKNA 3FC2A 4YJUA 1YXVA 2PVFA 1Q8YA 4BDCA 5JN2A 2XKCA 1YWNA 4DH1A 4FTMA 3RHKA 5LOHA 4QYFA 3S0OA 3V5PA 4ANLA 4XP0A 3M1SA 4Q5EA 4I92A 4FZAB 4RWKA 3QD3A 3R7EA 2ZDTA 2G9XA 1T46A 3PE2A 2JDRA 4YO4A 3DFCB 2QLQA 3ZRMA 3COMA 4NM0A 3IO7A 4DH8A 5DRBA 2PVMA 4F99A 1PXOA 1VR2A 4KKEA 2G2FA 3VHEA 4BDGA 4FSTA 2JGZA 1U54B 3LCOA 4IAIA 3VF9A 2XCHA 2YJSA 4A9YA 5A46A 3S95A 4PTCA 4YZDA 2HY0A 3LQ3A 4XRJA 2XK3A 3DQXA 3I1AA 5EHOA 4RQKA 3FI4A 4S30A 2XIYA 3PWYA 4DE4A 3BHUA 4EK4A 2Y7JA 4M14A 4KWPA 3R7VA 2XJ2A 4G16A 4I93A 3QU0A 5IQFA 3S4QA 2X4FA 2UW8A 5HLPA 3RNYA 5CAOA 3QZHA 4BCIA 5ACBC 3R30A 3P79A 4LMUA 3ZLSA 5JMSA 1OPJA 4L01A 5E8YA 3BZ3A 3L9PA 3GT8A 1R78A 3KCKA 4GU6A 4UN0C 3NUAA 4PL3A 4O82A 3SC1A 2I0EA 3QGYA 3ULIA 4BGQA 4ENYA 4BBMA 4NCTC 5E8WA 2UW5A 3N4VA 4MQ2A 5CU6A 2XK6A 4OUCA 3LFSA 3AT4A 4FEWA 2CGUA 5J9ZA 5LVOA 4LRJA 4EWQA 4BBEA 5M09A 3QD4A 2JIUA 4L42A 3HRCA 3LQ8A 5BUEA 2YLFA 3CD8A 4MD9E 3HV5A 4UMUA 4KABA 4IAZA 3R22A 2VNYA 4Q5HA 2O63A 3ROCA 1OBDA 3KEXA 4FV0A 4S34A 3KL8A 3ZDIA 4NM7A 4BL1A 1RJBA 4MD7E 4U43A 5KMOA 4H1MA 4YUQA 4KIOA 4KBCA 2C3LA 4F7SA 4ZLYA 3OWLA 3EL7A 2W4OA 3FV8A 4GK3A 5GIOE 3PJ1A 5A4QA 3PY1A 3MTFA 4QTEA 4XG7A 1YDRE 2WPAA 4KIKA 4LOQA 2RIOA 4IE9A 2W99B 4I21A 1K3AA 4J53A 4E6CA 3SVVA 2XNOA 3GUBA 3BV2A 4RQVA 3SV0A 5HU9A 2QO7A 3UZRA 4AG8A 2LAVA 2UZEA 4C62A 2G2IA 4EOLA 2WTWA 4CZYB 4OTDA 3ZM4A 3S00A 1A9UA 4NIFB 4CMUA 4O7NA 4A4LA 4O22A 2VTPA 4MXAA 4UB7A 2WMAA 5H8EA 3TZ9A 5M51A 1XJDA 2XCKA 1FVVA 2CN5A 2ZV9A 4S31A 2CGWA 3HEGA 3ZO3A 3ORZA 3P7BA 3R6XA 3Q2JA 3EN7A 3D7TB 5I9VA 2YZAA 3C0HA 4AT3A 5HLNA 3CY2A 2YCSA 2JITA 4YJRA 3LFDA 4AP7A 3ENMA 4AXAA 3S1HA 4GK2A 3WF7A 1EH4A 3EQRA 4JDKA 4RX7A 3ZRLA 1W98A 4AX8A 3F66A 3RGFA 3U51A 4FVRA 1PMUA 4YGAA 5DHJA 3QQLA 3LXNA 3Q6UA 5HHWA 4USDA 1OL2A 4U9AA 5J7BA 3FY0A 4I23A 1SVHA 5D12A 3WIGA 2O65A 5H2UA 4EUTA 5J95A 4YJSA 3EN6A 5I9ZA 4GT4A 1HOWA 2FSLX 1ZMUA 3P1AA 1IRKA 3UYTA 1YHVA 2B53A 3IOKA 4QQTA 4DLIA 2YWVA 5ETIA 1TQPA 1GIJA 1OL1A 4DG0E 3F9NA 3TM0A 4EL9A 3EN4A 5KBRA 5AIRA 4QTAA 3MPTA 2PUPA 3PP1A 4YMJA 4U42A 4U8ZA 2Z2WA 4I4EA 3CTJA 2ITUA 4CKIA 3QGWA 4HYIA 3P5KA 3UMWA 4UZDA 4CFNA 2Z7LA 5EM6A 4S33A 5IEYA 1B38A 4IADA 4HVIA 1QL6A 3BGQA 4FV2A 2XIKA 4XG4A 5E8XA 3UNJA 1REKA 3HECA 3UZTA 2CJMA 3FMJA 4C0TA 1LUFA 2VUWA 4QP2A 4CTBA 4PRJA 2IVSA 3W2PA 3BHVA 5CAQA 1QMZA 4FTRA 3NUUA 4O27B 4WBBB 3IG7A 5T3QA 5AJQA 4AA4A 4DTAA 4TTHB 2CHLA 2YIYA 5C4LA 3KKVA 3VBQA 4CV8A 4EKLA 3R7IA 3KQ7A 2OKRA 1QPEA 3S3IA 2BIKB 2QO2A 2HYYA 4BDKA 1YRPA 5GHVA 3ZLXA 5KMMA 5IZFA 3PPZA 3NLBA 5K0XA 2C6IA 4O84A 3VRYA 4YTFA 3EQGA 2W06A 2C0TA 3EHAA 3EQCA 4FKTA 4DFUA 2XJ1A 4FSQA 3RKBA 4MYGA 3R9DA 1P5EA 5HNIX 1IAJA 4D1XA 5AR2A 1G5SA 2Q0NA 3D4QA 5A9UA 3HMIA 4D55A 2BRGA 3H0YA 3OF0A 4IAFA 2XVDA 3F88A 4O0WA 3A4OX 3NPCA 4IDTA 4MF0A 3QC9A 2C6MA 2RFDA 2ONLC 1YW2A 1Q4LA 2O64A 5EG3A 3I81A 3KGAA 3NDMA 4YSMA 2AYPA 3DK6A 5HE1A 3ZOSA 5HQ0A 3UJGA 3KFAA 3F7ZA 4FKOA 2W9FB 2OG8A 3Q60A 3ZEWA 3L9MA 2ETKA 5AADA 1IASA 2OK1A 4WO5A 3ZXZA 4C2VA 5J1WA 4UWYA 4RBLA 2IN6A 3F7WA 2EXEA 1UWJA 2BIYA 2QI8A 2O2UA 4AN3A 4TL0A 2OFVA 2QOQA 4E3CA 2UW0A 3W33A 4UWCA 3RTPA 4FKUA 3BHTA 2I6LA 3DU8A 3F6XA 3QBNA 2WMUA 3TV6A 3E63A 2ZM4A 4CYJA 4XMOA 4FL1A 4JIKA 2CNUA 2P33A 5BUJA 4O7RA 3DKGA 5LMBA 5D11A 2W05A 2YWPA 4XHKB 3COIA 3NW5A 3PVGA 3PSDA 5AUWA 1W83A 5EQYA 4AUAA 3NYNA 5IKWA 3F2AA 4YC3A 4ACMA 1M2RA 4FE2A 2VTAA 1PXNA 5EI8A 3C0GA 2CCIA 3OP5A 2PHKA 3G6HA 3MJ1A 4QD6A 4C2WA 1OMWA 2UZNA 4KIKB 5F95A 5K3YA 3RJCA 2ITPA 5M4UA 1SNUA 4FGRA 3RBWA 5HNBA 4DFYA 4GMYA 2G2HA 2F57A 4MXXA 3G2FA 3GFEA 5HE2A 4CRSA 4EKKA 3PIZA 4TY1A 4CXAA 5J5SA 5LXMA 3DNEA 3R9HA 5ANGA 3OTUA 4FTOA 4ZEGA 1XH8A 2QOLA 4FEQA 4JLCA 5M07A 4K0YA 3H4JA 5HE0A 1JNKA 2PE0A 3KMMA 1PYEA 4X21A 2QKRA 4I6FA 3ZDUA 3LCKA 2VWIA 4DEHA 5LVLA 2VGPA 2NO3A 4IFGA 5K5XA 1P14A 3EFLA 4NTSA 3TXOA 4EOQA 4ZTNA 1ZY5A 4EOKA 2VWXA 3IGOA 5HIBA 4DBXA 1RQQA 1YWRA 3P08A 3NAYA 5K5NA 2RF9A 2PULA 3MH2A 3TEIA 4IAAA 4LRKA 4Y95A 2XRUA 3S2PA 3PYYA 2YM8A 5C1QB 2GFSA 2Y8OA 4CMTA 3BX5A 2O0UA 3E7VA 5DR6A 4IW0A 5DRDA 3TNIA 1YOLA 1LPUA 4FSRA 2VO6A 5IA3A 3CSVA 5AR8A 3A4PA 3ZCLA 2B9JA 3Q53A 5DT4A 3SOAA 4II5A 4Z7GA 4A4XA 4AN2A 4E5BA 2J9MA 3Q52A 3UNKA 2VTNA 1O6LA 2J0KA 3RK9A 5IA1A 2IZSA 4V04A 4RG0A 5HX8A 5JFWA 4AZSA 3CGFA 3F82A 1ZARA 5BYYA 3QTZA 2ZVAA 2UW4A 2YHVA 4D1SA 2X8DA 3PVWA 5EOBA 3PA4A 4B0GA 1DI8A 1WAKA 3OXTA 3R8UA 2X8EA 2OSCA 2XIRA 2C5OA 3GB2A 3FMNA 3VS6A 3Q5ZA 4WNKA 5KO1A 4DFBA 1MP8A 4S2ZA 4C8BA 2J0LA 3PG3A 4F7NA 3FLNC 4YU2A 4FOCA 3GCSA 3AMYA 4ACGA 4KKHA 5EW3A 2IW8A 3A62A 5HG8A 3AT3A 3GENA 4B6LA 4FEUA 2GMXA 3UODA 3VW6A 3DAKA 2BZJA 3FLQA 2PL0A 5HKMA
chains in the Genus database with same CATH superfamily
4KS8A 2HY81 1YDTE 3RPYA 3OVVA 5EQPA 3G5DA 3P78A 1YXUA 4TNBA 2VO0A 4F0FA 5LQFA 2PVJA 3NWWA 3O96A 2JBPA 3G0FA 3AG9A 3FDNA 3C4XA 4NW5A 4O4FA 2VO7A 4M67A 3MVJA 3HLLA 4ITJA 4PDPA 3L8VA 3RPOA 4GFGA 4ASEA 5HTBA 3QWKA 4PV0A 5L8KA 2QODA 4PPBA 1B6CB 1U46A 3DT1A 4IQ6A 4KIPA 5BVDA 3D5WA 3HX4A 1AQ1A 4D5HA 3QHWA 4RPVA 5B0XA 1MQBA 4C59A 4ZY4A 1DAYA 2OIBA 3UOKA 4I0TA 2HWPA 4OTWA 2PVKA 2W9ZB 5BMMA 3ZBXA 5IH4A 3W18A 5CT0A 2C6OA 5J87A 3TNQB 3UTOA 3OT8A 5EM7A 2WO6A 4JMQA 2ZB0A 2ITZA 5CSHA 4TWCA 4K8AA 2WNTA 1OL7A 2PZ5A 3ZC6A 4DH7A 2I40A 4F9AA 2VNWA 3IDCA 3KK9A 4LL0A 4BGGA 4F4PA 5CXZA 3OCGA 5AV2A 4ZTHA 4EK6A 5KMJA 4LV7A 3ZFYA 3MPMA 5CU4A 4GT5A 1QPJA 2CSNA 2C3KA 2HK5A 3FWQA 4U3YA 5FTGA 1SMHA 2KULA 2OW3A 4BGHA 2DWBA 4F6SA 2ERKA 3BLHA 2PVHA 4D2RA 4RJ4A 1Q24A 2R3RA 4NZWB 3ANRA 4EONA 2P55A 5FGKA 5M08A 4E5AX 1Q8UA 5AMNA 3LXKA 1Z57A 2ZM1A 4QYGA 3VWAA 3DXPA 4FT0A 3RM7A 4FGBA 3C9WA 1XKKA 3VQUA 1ZWSA 3BLQA 3W2QA 4MTAA 3ZHPC 5AR4A 1G3NA 3CXWA 3FXZA 4P4CA 4G3DA 3ZFMA 1CTPE 1PF8A 2FSTX 3E3BX 3UDBA 3QZGA 3W0PA 3OEFX 3PXZA 3WF6A 1RW8A 3CE3A 3QLGA 4DFZE 5J7HA 5J9LA 2W1FA 5AX3A 5B2KA 1O6YA 4LOOA 2R7BA 2YDKA 3EJ1A 5C27A 3NYXA 2B52A 1H24A 1PW2A 2B9IA 4D0XA 3N4TA 1H27A 1U5RA 3TL8A 1U59A 2W1GA 1OPLA 5DEWA 4R8QA 5LWNA 4D9TA 2UZTA 2AEGA 4NEUA 5TOZA 1IA8A 3I79A 3BHYA 1XBBA 2R3NA 4W4WA 5J8IA 4G9CA 1V1KA 3LFCA 4PPCA 2XH5A 4HYHA 3Q4ZA 5EYMA 2J2IB 3TUDA 3FEGA 3F5UA 4JBVA 5GZ8A 3W0RA 4CCUA 4BTFA 3G9LX 2AUHA 4OAUC 3FZRA 4AZEA 3QX2A 1ZYLA 4RRVA 3D14A 3VUGA 4MF1A 1M2PA 2GHMA 4LGGA 3IONA 1YXTA 4PDOA 2UW9A 5F1ZA 5KMIA 3RAWA 3EFWA 4BYJA 4KSPA 4W8EA 2WTDA 3W8LA 5A54A 2BFYA 2B4SB 4JNWA 3F5GA 4LL5A 4ZIMA 5H3QA 5HZNA 4ZSGA 1G8AA 1WVXA 2VAGA 2GNFA 3A7IA 4J71A 3HAVA 2XM9A 1LP4A 2B9FA 2FYSA 2RG5A 3QD2B 3I5ZA 3QYWA 4G17A 4IEBA 2VV9A 3TV4A 3U8WA 3VIDA 4CFWA 4MXZA 4EHVA 3UBDA 2B0QA 4C4HA 3OXZA 2CDZA 5AWMA 5DE2A 4U7ZA 2C5VA 2YFXA 1CKIA 1OIYA 3IW6A 3Q32A 4ZAUA 4F9CA 2PPQA 1DI9A 4J7BA 2EVAA 2OWBA 3EN5A 4RFMA 3RCDA 4J52A 4MK0A 3R9RA 3KXXA 4TYHA 3VUKA 2QU6A 3PFYA 4C38A 2HZIA 3D7ZA 4RX8A 4RZVA 2RSVA 2VZ6A 5AP4A 4EH2A 1TZDA 4BZNA 5IU2A 2Y4IB 1YHSA 2OO8X 2W1HA 2VTLA 3DFAA 2HW7A 4FBXA 5AV4A 3C1XA 2OIQA 3RINA 3QTXA 5IEVA 4M15A 2R3FA 5CZIA 3P5JC 4O0YA 3C50A 1TQMA 1BI7A 3BWJA 4H3PA 4I6QA 3R8PA 1U54A 1NVQA 2FVDA 3VUMA 4AA5A 5EKNA 3OW4A 3PJ8A 5AP5A 4XOZA 3A8XA 4XV1A 1T45A 2PK9A 4QP8A 4EHEA 3DOGA 1Y8GA 2A27A 4J96A 3U55A 4R7HA 1NA7A 4QP4A 2XA4A 3FZTA 5CYIA 4FKSA 4OTGA 5EKOA 2A2AA 3TDWA 2PMIA 2QOKA 2BZIB 4KIQA 3QRIA 2UW3A 3VS1A 4HGTA 4D9UA 4QTBA 2BRBA 3AD6A 5IPJA 3PFQA 1KE8A 4ID7A 4IM3A 2B9HA 4GFOA 5AV3A 2OBJA 1BYGA 3KK8A 5DA3A 1PXKA 4YLKA 1PRYA 3UZPA 4MH7A 3GI3A 4C3PA 3LFNA 2W1EA 3IGGA 4PY1A 4ANQA 4E20A 1Q97A 3MH3A 5AP2A 4BC6A 2EU9A 2XNMA 1Y91A 4AOIA 3ZH8A 4YTHA 4Y83A 2WMXA 1SVGA 3VS2A 2DQ7X 3LJ0A 2VX1A 2JKMA 4XBUA 4E1ZA 4EH8A 4DT9A 4FKWA 1ZOGA 2R9SA 3O17A 4DEDA 2EXCX 3FC1X 3ELJA 3GC0A 3LM5A 3R7UA 2WMVA 5JK3A 4Z3VA 5DBXA 3MSSA 3TZ8A 2UVXA 3HGKA 4GYGA 1WBNA 4ITHA 4NKSA 4IM2A 3Q5IA 3QZIA 2I0VA 1ZYJA 3EQDA 3CEKA 4IFCA 4YP8A 4PMSA 4YC8A 4HCTA 3RI1A 5CALA 1ZMWA 2ESMA 5EFQA 3EYHA 4ANSA 4YTCA 4I94A 4BTJA 4IX5A 3MPAA 5AP7A 3O8TA 3KRWA 4FKLA 1XH6A 4Z7HA 2BKKA 3DGKA 3BEGA 3QCYA 4FT3A 3RK7A 4B99A 1OGUA 1GNGA 3QXPA 5LMKC 4H3QA 4FF8A 3SRVB 3NIEA 4ACHA 3HV3A 4AT5A 3PIYA 4BKYA 4OR5A 3TNWA 3UPZA 4O4DA 1BLXA 4LYNA 5ICPA 3R73A 2OICA 1H07A 3ETAA 3ORIA 4QMVA 4BBFA 1TQIA 1G8SA 2H96A 3LOKA 3RMFA 4FR4A 5EDQA 3DKCA 1R0EA 4L45A 5M4FA 2G1TA 5FBOA 4BTKA 4K18A 4GSBA 3TKIA 3K3IA 2C68A 3O50A 2OIDA 4G34A 1WMKA 2WQOA 4DINA 2NRUA 1QPCA 1CKPA 4FKGA 4HGEA 3I6UA 3ZONA 3E8DA 4EEVA 4UMPA 4XLVA 2UW6A 1FVRA 1CSNA 5JFSA 5E90A 5ACKA 2HOGA 4MX9A 5BPYA 4OGRA 1J91A 4G3GA 2J6MA 5GJDA 5EI2A 2Y6OA 1ND4A 3QZFA 2CGXA 4BKJA 4BZDA 1PXJA 4LFIA 4O0VA 4JG7A 3ZBFA 3KRRA 5AUYA 4DLJA 4E5WA 4KS7A 1E1VA 2WELA 4FZDB 4LV5A 4DEIA 4MWIA 4PL5A 3OBJA 4CQEA 1FBNA 4ORKA 2Z60A 3T3VA 1UVRA 3TUCA 3WARA 3QQFA 4BJJA 4ZTQA 4YPSA 2YEXA 2WZJA 1BUHA 3RPSA 2NYAA 4N70A 3KB7A 3KIOC 1FMKA 2HWOA 3EIDA 5FM2A 4ERKA 4QP9A 4TYHB 4IAYA 3P7CA 4FTQA 4BZOA 4FA2A 3ACKA 5HVJA 4GEOA 3I7BA 4X2FA 4DG2E 3FYJX 2OFUA 4ZSJA 3KXMA 3PSBA 3PVBA 3NEWA 4UV0A 5E8ZA 4PNKA 3R2YA 4FTLA 4F9WA 4K77A 4UXQA 5JQ5A 4G9RA 4JAJA 4XRLA 3QA8A 4HPUE 4DITA 3CBLA 4XCUA 4Y8DA 4C35A 4RFZA 3MDYA 3FMMA 4WA9A 3JY0A 4DG3E 4U3ZA 3JPVA 5DIAA 2WB8A 3MTLA 3FQSA 4AGUA 1ERKA 2CLXA 1OIUA 1YI4A 3MV5A 4GK4A 4O6LA 2XKFA 2F2UA 2A1AB 4J95A 4IZYA 5DOSA 1KV2A 5AP0A 4C3RA 3MY0A 3BHHA 4JX3A 3COHA 3QD0A 1TKIA 1XBAA 4Q9SA 4QMPA 4A9UA 3Q04A 5GZAA 2F4JA 1UNHA 2RFSA 5E8VA 5HESA 2B54A 4PUZA 3RAKA 4NYEA 2WU6A 3DS6A 2JBOA 3NUSA 3VHKA 2FH9A 4GL9A 3E8CA 3ALOA 3T8OA 2IW9A 3F2RA 3DJ7A 4IHPA 4WG3A 4QMQA 4PMPA 3UDTA 4NCTA 4JQ8A 1H8FA 3TZ7A 2BRHA 3BGPA 3R21A 5CTPA 4UYNA 2Z7RA 1Q41A 5BQ0A 4YC6A 5FXRA 4QMMA 3R1QA 2O8YA 3IW5A 5CS6A 3SDJA 3B2TA 4FTJA 4C4GA 4G5JA 4M12A 4F09A 4MQ1A 1NY3A 4ZXTA 3E87A 4IVCA 4JAIA 1OI9A 5KZ0A 5DMZA 5KMLA 3DA6A 3KA0A 4OT6A 4JJRA 2YM6A 3LLTA 4EC9A 3UC4A 4WNPA 2GS7A 2YJRA 4L43A 2WTKB 3FKLA 2R7IA 2WMWA 3I0QA 4LMNA 3VAPA 3VUDA 3POOA 3MS9A 2BHHA 2YCRA 1ZYCA 2J51A 4G2FA 5DVRA 5JSMA 3ZFXA 4D2TA 5AP6A 4P5QA 3UP7A 3VBVA 4RX5A 3I7CA 4F1TA 4KBKA 3Q9XA 5ETCA 3D5XA 4UEUA 5LMAA 4RIWB 1PHKA 4FOBA 4MVFA 5DT3A 4BDDA 4E26A 4DGNA 2HXQA 4J98A 1FVTA 4BCQA 2BDWA 3MI9A 4PTGA 3CKXA 5L8LA 5DNRA 3A7JA 3E64A 1JLUE 5I3RA 2CKPA 1M7NA 3D9VA 5BVFA 4M66A 1MUOA 4RT7A 4OTFA 3SW7A 3B2WA 4XP3A 3ORTA 1ZYDA 3G6GA 2ZJWA 3V8SA 5AP1A 4H36A 3FUPA 4DCAA 4ITIA 1H0VA 4H05A 1GZ8A 4NU1A 3RWQA 2XK7A 4EYMA 5JGAA 3NFGB 5A4EA 3LFQA 2OU7A 4R7IA 3RK5A 3EQPA 1B39A 4BI1A 4IJPA 2GCDA 3GU5A 3DNDA 5BYZA 3FQHA 3R2BA 4CCBA 5BX0A 5IH5A 3NNUA 5G1XA 2LGCA 2UZBA 4ZY6A 4FTKA 3AC4A 1M52A 3OW3A 4RLKA 2QURA 1FMOE 2GHGA 2V7AA 2VTIA 3ROYA 3VC4A 4FTTA 2R64A 2NNWB 2IZRA 5IUGA 2HAKA 1S9IA 3LFEA 2ZMCA 3RALA 3CS9A 4NM5A 5JGDA 5ANIA 1H28A 3W0NA 5CVHA 4X2JA 2ZV2A 2J50A 1VZOA 3HMNA 2X8IA 4O86A 1Z5MA 3U9CA 3AC3A 4J1RA 4O1PA 4WRSA 4WIHA 4O0UA 4IXPA 2H34A 1XMMA 5M56A 2XS0A 4QYEA 5BVEA 4BN1A 1H1PA 4FG7A 4FNWA 3ERKA 2C6KA 4IX4A 3FZSA 2PZIA 4ANOA 4PMMA 4JRNA 4U5JA 4BDBA 4DN5A 5KMNA 3UOJA 1W2FA 3VBXA 4BIEA 3V5JA 1M7QA 4EC8A 1H1QA 3DCVA 3PVUA 3NW6A 4FNXA 5FLFA 4O2ZA 2WKMA 3BBWA 4G6OA 4P2KA 3PE1A 4QMYA 1Q8TA 1XR1A 2UW7A 2QVSE 3LCSA 2R0UA 2QOIA 2YAAA 5CVFA 3CTQA 4DYMA 2PY3A 3GVUA 4E4XA 4HZSA 4JVGA 4RX9A 4X7QA 2ZAZA 5GNKA 4BCOA 3D94A 3BLRA 3P4KA 5TO8A 4JT3A 1WBWA 4DC2A 5I3OA 5KX8A 3MB6A 3KN5A 5K4IA 1XMLA 5E4HA 2UV2A 3TUBA 4K1BA 2X81A 4W9WA 3R83A 5E7RA 4YHJA 3EYGA 1OM1A 1Q61A 2YIXA 4FKIA 4FODA 2XJ0A 1ZRZA 5BUIA 3OROA 4M0YA 5HG9A 1P4FA 4H3BA 5CLPA 4C4IA 4D2VA 4FEXA 3V8WA 5ITAA 5JFVA 4DHFA 3KMUA 4RGJA 2ONLA 3QRTA 4MBJA 3SW4A 4FUXA 1PMVA 3QX4A 2AQXA 3MFUA 4AZTA 4CFMA 4EWHA 3KXGA 4EZ7A 4F1MA 2HXLA 5AUVA 5A6OA 5F4NA 5D41A 3GU4A 5FTQA 5KE0A 2QO9A 3RZFA 5CEIA 3BKBA 4PP7A 4IB0A 2WU7A 4V01A 3WZEA 3V5LA 4G1WA 4LG4A 4RLLA 4CYIA 3GC8A 5AV0A 4BF2A 5CEKA 1JOWB 1XH5A 3H9OA 4FV5A 4IVAA 3FXWA 3GQLA 3LPBA 4QYHA 3TI1A 4EZ3A 5KKRC 3BGZA 2B55A 3G9NA 4R77A 4IANA 5FEDA 3ZUVA 5DH3A 4NW6A 3GFWA 3FMLA 2VWYA 3DK7A 3ZLYA 4GG5A 4O96A 5FD2A 3KN6A 1OUYA 4BKZA 5CEQA 3FHRA 2BZHB 3LFFA 1GIHA 1U5QA 2C1AA 4BDJA 2JDSA 4LGDA 1WBSA 3II5A 4NFNA 3RPVA 2XK9A 3CQEA 4L68A 3V51A 3D2KA 2WTCA 4FIHA 2WIPA 4BCPA 3V8TA 3IECA 4AW1A 2WEIA 5FWKK 3HDMA 4N4SA 4F6WA 4S32A 4FTUA 4RIOA 2WHBA 3WE4A 1OVEA 4Q2AA 1DAWA 1CMKE 2XP2A 4L52A 3NUXA 2C6TA 2QLUA 3DZQA 4BWPA 2WXVA 1J7UA 1REJA 3DDQA 4FTIA 1VLRA 3BU5A 3AMBA 3FLZA 1AD5A 2VRXA 2WQNA 3D2IA 4JQ7A 1E9HA 2J0IA 3TNPC 5BNJA 1M2QA 3PXQA 3LFAA 3OT3A 3COKA 3KRJA 2F7ZE 5IQAA 3IK3A 1YXSA 4EK5A 1KUTA 1QPDA 3EQBA 3FAAA 3IPHA 5BMSA 5LCKA 3SOCA 3QYZA 4FIEA 4C4EA 3D5VA 4FSYA 1OKZA 1IR3A 2CKEA 2O3PA 3OWJA 3FL4A 1YKRA 4RSSA 4RVMA 3KXHA 4G5PA 3UVQA 3ENHA 5IISA 4MWHA 1FINA 3TG1A 1H01A 4PNIA 5B2MA 2VWZA 1KE6A 4FV1A 3WZDA 4E7WA 3D5UA 3OY3A 1UWHA 1IA9A 5DPVA 3FSKA 3BL9A 2W5BA 4E4NA 2VWUA 4ARKA 3M11A 3CJFA 4O7ZA 3PLSA 5ANJA 3Q6WA 4UBAA 2ETMA 1BKXA 2Y6MA 5HX6A 5KMKA 2WAJA 3CLYA 2SRCA 3GCPA 3QLFA 3WBLA 4BCJA 1Y6BA 4FUYA 4O7YA 4RFYA 1TVOA 2C6EA 4EUUA 3PXRA 4FK6A 4RWJA 4AGDA 4EOJA 3NUPA 1GZKA 2ZYBA 1PXIA 2Z7QA 4O38A 1FOTA 3LFBA 5E1EA 4BFMA 3OS3A 2OJFE 4F9BA 1JWHA 1OKYA 3O7LD 4I5MA 4N6ZA 4FJVA 3IDBA 5TF9A 1J7IA 2XUUA 1FPUA 3WE8A 2IWIA 4NSTA 2W7XA 4PTEA 4BDHA 3PP0A 2OF4A 4CFUA 1ZY4A 4IX3A 4L46A 4YJNA 4CNHA 2GDOA 2XF0A 3CIKA 4IZAA 4QP3A 1Q8WA 5EYDA 4AGWA 4OTQA 4OBQA 1UU8A 5EI6A 1OKWA 4YO6A 1CM8A 5CAUA 3C5IA 2VWBA 2WTJA 3VUIA 3I6WA 2BAQA 2IVUA 3MWUA 4IX6A 2PMOX 4WG5A 4FV3A 3SD0A 5CF5A 3DXNA 5EYKA 3EOCA 4CG8A 4DEAA 4RJ5A 1SZMA 2ZB1A 4OTPA 3TV7A 3H0ZA 4TWPA 5FP5A 2W1IA 2YA9A 4IJ9A 2CNQA 4HNIA 2GNGA 3MW1A 4OTIA 4IAKA 4ZOGA 4B9DA 3C51A 3BCEA 2GSFA 3E62A 1F0QA 5CI7A 1H1RA 2XM8A 4GFMA 4OLIA 4ZZMA 3HRFA 4K11A 5JZJA 3EL8A 1H26A 4EH4A 4YLJA 3EB0A 3UQFA 4ZSAA 4BICA 5J5TA 3MFSA 2RGPA 3R7GA 3TCPA 3L8PA 4RJ7A 1JQHA 3DZOA 2VD5A 3PG1A 3PWDA 2Y0AA 4QOXA 4R5YA 4G3EA 1PXPA 4EZ5A 4B4LA 3O8PA 5CEOA 5TKDA 5A14A 4AE6A 4CRLA 2CNVA 4QNYA 4O91A 4FK3A 3EMGA 2XYNA 3ZC5A 2XANA 2JKOA 3R8MA 2WEVA 2W1DA 2E9VA 4U80A 3OOGA 1W8CA 3UQGA 3DPKA 2YAKA 4LQMA 2F49A 3O8UA 3OBGA 3LAUA 4QP7A 2I0YA 2VTQA 4RC3A 4AXFA 1S9JA 4GU9A 4EOPA 2UZOA 3A8WA 5BV3A 3MH0A 4X3FC 3THBA 4A9TA 5CT7A 1XHAA 4EOMA 3BQCA 4I1ZA 3PTGA 4EH6A 4HPTE 2YM3A 3ZRKA 4TXCA 2X7OA 3E8EA 3PSCA 4I3ZA 1HCKA 4YBJA 2EUFB 4R3PA 3EWHA 2X2LA 2FO0A 2W4JA 3DBCA 3T9IA 3VUHA 2ITNA 4YTIA 3W2RA 4GVJA 5IDPA 5L2SA 3D0EA 3MVLA 4IIRA 4Y72A 3ZO4A 2QG7A 3UE4A 4CLJA 3HRBA 3PJ3A 2KTYA 1O9UA 2XNNA 3UVRA 4Y85A 4ZY5A 3TDVA 3I0OA 3V3VA 2A4LA 3MB7A 4O0RA 2IEWA 5LVMA 2QU5A 4KRCA 4RIXB 5L2WA 1Z9XA 3HUCA 3KC3A 4HVDA 4FKQA 4GRBA 4IWDA 4NM3A 1OITA 3FI3A 3PIXA 2OZAA 4X6QC 3RM6A 4GCJA 2R3JA 4FIIA 4KAOA 2QHNA 4I5PA 3F3UA 1KWPA 3E93A 3QCSA 2OI4X 4C7TA 1UNLA 3HA8A 4J99A 4U81A 4IWOA 3ZEPA 4NJDA 4DGOA 1WBVA 4FYNA 4H58A 3U6IA 1XO2B 4FYOA 2XMYA 2CN8A 4ZMEA 4FIGA 4B7TA 1UKIA 2X9FA 3O51A 4ZSEA 4HCVA 4F0GA 4BHZA 4ZTMA 3O2MA 4LM5A 4KD1A 1JKTA 1KOBA 3QTIA 1IG1A 4FKPA 5L8JA 4C61A 4CEGA 3Q2MA 3DAJA 3SRVA 2JIVA 4EHGA 5KCVA 1R39A 2QOCA 4IMYA 4YJVA 3QXOA 2VWVA 3TWJA 3FMDA 5HVYA 3VVHA 3ZSHA 3PJ2A 3NCZA 5I9YA 5G6VA 1Q8ZA 1UA2A 5BVWA 5IQBA 2QC6A 3PXYA 3UO6A 3GGFA 1GZOA 4NH1A 4KNBA 5DYJA 5J1VA 3C4EA 3QUEA 3VRZA 2GTMA 3VO3A 4X2NA 3AKJA 5E91A 4EH7A 3MFRA 5EM8A 5T6KA 2R5TA 3GCUA 4U41A 3NMUF 3DDPA 5CQUA 4MEDA 3UIMA 5DGZA 3GU7A 2BUJA 2XKDA 5EOLA 3ORPA 4CD0A 1WVYA 2DYLA 1W7HA 1QCFA 2EWAA 5AR7A 3NYVA 3FBVA 3QQJA 1BI8A 3RAHA 4OT5A 4A06A 3QTQA 5AAEA 5HVKA 4TNDA 3L8SA 5DI1A 5FDXA 1FQ1B 2I0HA 2XK8A 5IH6A 3VS3A 4DCEA 3R8VA 5CF4A 1WBTA 2QOBA 2V7OA 5FEEA 3FPQA 1LR4A 3ORXA 5IQDA 5HIDA 3NSZA 2WQEA 3QRUA 4YJPA 1M14A 5BYLA 4BDFA 3VS4A 3WZKA 2OH0E 2XAMA 3FI2A 3IQ7A 4WKQA 3CQWA 5CSWA 2VU3A 3P0MA 4R1VA 4F65A 3DTCA 2ITQA 2X4ZA 4XJ0A 3OMVA 3VF8A 4UX9A 3AC2A 4ZS4A 4BWKA 4AOJA 4PL4A 2IZTA 5CY3A 3R0TA 4EOIA 4AXCA 4BYIA 3JXWA 3LCDA 4MCVA 1BX6A 3SA0A 1W2DA 2H9VA 2BDFA 5HU3A 1H08A 1H4LA 4X2GA 3LW0A 4A9SA 2XEZA 3TNHA 1NW1A 4F7LA 4UALA 1GZNA 1MRUA 4M0ZA 3ZTXA 4CFFA 5FUTA 5HO8A 4BR3A 4I0RA 5IA0A 2OGVA 2P2IA 4MXCA 4QQJA 1OIRA 4CVAA 2QOOA 4JBPA 5JRSA 2IJMA 2WOTA 5GZ9A 5D7VA 5JKGA 5CF8A 5CSVA 4FVPA 1JAMA 3D15A 3OZ6A 4RJ6A 4FZ7A 4DEEA 1NT2A 5L2IA 5AEPA 4U79A 4JXFA 3KRXA 3RHXA 5IQCA 4FT9A 1G8KA 3IS5A 4KBAA 4HGSA 5EYCA 1OUKA 3GU8A 2QD9A 1OBGA 2Z7SA 3F3ZA 2VTTA 3FXXA 4FV6A 4YZNA 5CSXA 5DEYA 2R3OA 3VBTA 3WF9A 3WIKA 4CT2A 3CQUA 5HE3A 3L9LA 5IQHA 2HCKA 4RWIA 4P5ZA 1V0BA 2W1CA 3PRFA 4Y46A 5DR2A 2PU8A 2C47A 3CP9A 2PYWA 3LLAA 4PWNA 2BTSA 3HA6A 1KE9A 1JKLA 1U4DA 3AC1A 4JOAA 2HW6A 4X3FB 1SVEA 4ASDA 4M7IA 4JS8A 4QTCA 3PZHA 4DH3A 1WBOA 3QRJA 3HMPA 5CZHA 4IDVA 3HUBA 1KV1A 3OY1A 4MD8E 3R9NA 3QL8A 3FZPA 5CVGA 2RFNA 4AFEA 4BVUA 4L67A 1IEPA 2ITOA 2ERZE 4AZWA 3A2CA 5CASA 4QMXA 3NUNA 3MVMA 4D2WA 2YISA 4F08A 3RZBA 3NVKI 2BALA 4I6LA 1OL6A 4YZMA 4O2PA 3GU6A 3K5UA 3RVGA 4E4LA 3ODYX 4Q9ZA 2XAOA 4FSMA 5C26A 2GU8A 1XBCA 5AUTA 5AUXA 5HG7A 3TMOA 5ETAA 3MFTA 4TT7A 5ANEA 3NZ0A 5CXHA 4L53A 3C0IA 4GUBA 1KE5A 2GQRA 3DQWA 4J8NA 3UVPA 3NNWA 3P9JA 4FTCA 2QG5A 3QUPA 1MQ4A 1ZZ2A 4EORA 1J3HA 4TWNA 2OZAB 4TRLA 3BU6A 2W17A 2PVYA 3B8QA 3QTWA 4RIWA 2FA2A 4AS0A 3BRBA 3HAMA 4O83A 3KXZA 3ORMA 1WZYA 2UZUE 5E9EA 1X8BA 3UP2A 3JVSA 4FMQA 4W4YA 2W1ZA 2QKWB 5LMKA 3F3VA 4FG8A 2NRYA 2WTVA 2V0DA 3UIXA 1ZMVA 2QQ7A 2VTRA 4IBMA 2JIIA 4EOOA 4HVHA 5LVPA 3GC9A 3T9TA 1P4OA 2VN9A 4I6BA 2OJGA 5CNNA 3C4WA 3G33A 2GFCA 4PMTA 4ZJIA 3UO4A 3NR9A 2YM5A 3O7LB 2XEYA 4QP6A 1ZOHA 2JAVA 3HP5A 2PTKA 5C9CA 2QOHA 4DHIB 3TKHA 5DR9A 1H00A 2ITYA 2OJJA 3AQVA 2DUVA 4B8LA 3A60A 2X6DA 3B8RA 3VULA 3BWFA 5E1SA 5CENA 4K6ZA 4L44A 3EZRA 5L6PA 3IOPA 2J5EA 5FG8A 4CFXA 4F63A 4ZZOA 5CEMA 1OZ1A 5L4QA 2BAKA 4QMWA 2WIHA 4UYAA 4L8MA 3MIYA 3QTSA 4FL3A 3TYKA 2X2MA 4JDJA 1KOAA 5CNOA 2XNBA 3C7QA 3QTUA 4QMNA 3PUFC 1FGKA 3QKMA 3AGMA 5CAVA 3BI6A 2WMRA 5AV1A 4BCFA 3QUDA 5CSPA 2VTHA 4FL2A 3R00A 2CKOA 4CZTA 3WYYA 5CWZA 4YZCA 3DV3A 4V0GA 4C33A 3EQHA 5IMXA 2R4BA 2EB3A 3ATTA 3ACJA 3MN3A 3BBTB 5L2QA 4F64A 5FM3A 5HORA 2I7QA 1R1WA 4GIHA 4W4VA 4R3CA 4R1YA 2NP8A 3QC4A 2E9UA 1RDQE 5IEXA 4QDVA 4M69A 2CLQA 4E6QA 2CKQA 2H6DA 4UMTA 5FBNC 1OGYA 3JVRA 4ACDA 2UUEA 3K2LA 4IZ7A 5HO6A 2J7TA 5HOAA 4M8TA 5FDPA 4HW7A 2W5AA 2JFLA 4TYIA 2XB7A 2BKZA 4JG6A 2R3GA 4UMRA 3UNZA 5HCYA 2JLDA 4DHJA 3O71A 3Q9ZA 1ZLTA 5K0KA 3KULA 2PMLX 5C01A 2ZV8A 5HD7A 3AMAA 3NW7A 3PRIA 4UY9A 4XX9A 2REIA 4EOSA 4GJ3A 4KUJA 2JD5A 1L3RE 2GHLA 2PZYA 2GTNA 4HGLA 3FI8A 3SXRA 4QMOA 5I9WA 3AOXA 3BEAA 4GG7A 4QYYA 4W8DA 2Z8CA 3RWPA 3VBYA 1WFCA 2HENA 5E92A 3A7HA 3OC1A 4JG8A 1LEZA 3SX9A 2AC5A 4QPMA 3E3PA 4BRXA 4XOYA 4ZTLA 2ETRA 3ZO2A 3ZM9A 4GH2A 5FEQA 3U4UA 2YITA 3JS2A 4QMTA 4GKHA 4P7EA