4HGLA

Crystal structure of ck1g3 with compound 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
302
structure length
302
Chain Sequence
b'GSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase I isoform gamma-3
publication title Structure-Based Design of Potent and Selective CK1 gamma Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 302
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hglA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hglA01
3Q4CA 4GK3A 4IEBA 4IJPA 3H4JA 4O1OA 5IA2A 3WYYA 5E8ZA 5IA1A 3ZEPA 5DN3A 5HI2A 4I5HA 5L2TA 3FMHA 4YJOA 4ZIMA 4QQTA 3PA4A 4GH2A 3SHEA 2BDFA 3ZDIA 3U9CA 4ALUA 4QPAA 3E7OA 5AUXA 2CGUA 4RWKA 1YWVA 3F82A 4PPBA 3SW4A 2QR7A 2EUFB 3NW5A 5LVOA 4ZMEA 1BMKA 3HRCA 3IW4A 4S34A 5DA3A 4YMJA 2GNGA 3H0ZA 5LJJA 4IX5A 4KSQA 4M12A 4YBKA 3EN9A 3R1NA 2AUHA 4OTDA 1YDTE 4O83A 1Q8UA 3QCSA 2JBOA 5A3XA 4EQCA 3A4OX 5FXSA 3R21A 4S32A 5AR7A 4D0WA 2XKFA 3HV3A 3QCQA 2XK4A 3F2NA 1XH7A 1P4OA 2IWIA 4UMUA 4FV1A 1W83A 3E8CA 1BLXA 4QOXA 3P79A 2VWUA 4YPSA 1R78A 3RAIA 5BVDA 4D4SA 5CF5A 3UPZA 4C3FA 3GFWA 1PXOA 2WTVA 3MH3A 3PJ3A 4YZBA 2YACA 2YIWA 3MH2A 3VQUA 4D2TA 4ERKA 4QMWA 4QMXA 3ZLYA 1Q8TA 3GI3A 5LVLA 3FXZA 4MH7A 5AX3A 4ZXTA 2VRXA 4RC2A 5BVWA 3RPVA 2I7QA 5CVFA 3OW4A 4R7IA 3FJQE 3FY2A 4RQVA 2OXXA 3FZRA 3DFAA 3NCZA 3ZCLA 5CY3A 4Z16A 5FXRA 1F5QA 4HYUA 4EQMA 1ERKA 4QYHA 5JN2A 3RAWA 4FKOA 4YZDA 3AGMA 3D9VA 1Q8ZA 2QI8A 2W5HA 4JR3A 2XK9A 5CU3A 3UMWA 2WQEA 3E3PA 3RHXA 1KV2A 2HCKA 3B8RA 2QOQA 4GSBA 3BV2A 3G9NA 3H10A 3GU5A 4IQ6A 4ZAUA 4ZJIA 4ZP5A 3PTGA 3KK8A 3SQQA 3RK9A 4F7SA 4JDKA 3VF9A 4BTFA 4IB3A 3QZFA 4JDHA 4L7SA 5B7VA 1WBPA 4I24A 3F88A 4O0XA 1FMKA 5A54A 4RX8A 1PY5A 4D2RA 3PPKA 2XBJA 3FAAA 4KRDA 3U87A 5L2QA 3RINA 4BDJA 4BRXA 3SGCA 5CSHA 2XNMA 3IECA 4ANMA 2RFNA 3QUPA 4NTSA 2IVUA 2OW3A 4EEVA 1KE6A 2UW7A 4RIXB 4CKJA 5K9IA 5I3RA 1O6KA 4QMZA 3P5KA 2ITNA 1QCFA 5D7AA 2F4JA 3TUDA 4ALVA 5I0BA 4FTQA 3R7VA 2Q0BA 5KKRB 4FVPA 1MUOA 2R7BA 3BYVA 4WD5A 3QD3A 3ELJA 3VW8A 4NFMA 4I6FA 1Q62A 4XCUA 2O65A 1W0XC 3WZKA 2VGPA 4IAFA 5HG5A 2UZWE 5C27A 4EH6A 2PHKA 3ERKA 2Q0NA 3DQWA 2YM5A 2Y4PA 2FSTX 3QRJA 4MBJA 3UVQA 3PJCA 4DGLC 5EK7A 3A8WA 4N4SA 5A46A 4EHZA 5HVKA 5K4IA 4EOKA 4JG8A 4DEIA 3HV7A 5HE0A 2XNPA 3CY2A 4PMTA 4E4NA 3A61A 3MTLA 3H3CA 5AUWA 3IO7A 4ERWA 2XEYA 2EXEA 3KXXA 1H25A 4II5A 4EZ3A 1H27A 3CLYA 3QQKA 5AV1A 2OLCA 3TT0A 3E88A 1WBTA 4QYGA 5ITAA 5J5SA 2CGVA 4QP2A 4OR5A 4TKSA 3PXQA 1Q97A 4GEOA 2UUEA 3FBVA 3GBZA 3LAUA 5I9XA 4C0TA 4FKQA 3UC3A 3VS5A 4NSTA 4FSQA 4I5PA 2XNOA 4PL4A 1BX6A 2QODA 2X1NA 4GK4A 4J98A 5DIAA 5FLFA 3TZMA 3EYGA 4CRSA 4E5AX 2GS6A 2VO0A 3VHEA 5I4NA 4UYAA 2QR8A 5IUHA 5CZIA 1HCKA 2PE1A 2R3QA 4BDFA 4WT6A 3SA0A 4UZDA 4K77A 3U6IA 2EXCX 3DAEA 2RG5A 4GU9A 5AP5A 3V6RA 2B1PA 4BDCA 4PP7A 1CM8A 3KMUA 3DJ7A 4XP3A 3WZUA 1KV1A 1J7UA 2R0UA 2QOHA 2X2KA 4NIFB 4U6RA 4UEUA 5KMLA 2J0IA 3QZGA 3GQLA 3L8XA 3NRMA 3NUYA 3QX4A 3BKBA 5JSMA 2ZAZA 3TTJA 4MNFA 4IDTA 4ORKA 5C03A 1NW1A 2GNIA 3KVXA 4L3LA 3H9OA 2PUPA 2PL0A 3D0EA 2YCRA 3ANRA 2OJ9A 3ORPA 4CD0A 5L4QA 3G90X 5J1WA 5EYDA 3AC3A 3MIAA 4FSMA 1H1PA 2ZM4A 2ZV9A 3AT4A 4LOQA 4NJ3A 4TXCA 4PMSA 4CFWA 5I5ZA 2JBPA 5KHWA 1H1RA 4C4EA 3DDQA 2R3OA 3NAYA 1Y6AA 3POZA 3NSZA 4YJNA 4IAAA 3GENA 3GCQA 5G1XA 5HX6A 4FKIA 3LJ0A 2ZDUA 5LWNA 4FGBA 4W4WA 5FWKK 1G5SA 3QC9A 4FC0A 3QYZA 3VNTA 3CKXA 4R7BA 4L44A 4RPVA 2RSVA 4KKEA 5D11A 3IS5A 3W2QA 1UNHA 5ACBC 2WMUA 4GU6A 4X2NA 4AZSA 1DI9A 3Q52A 3SD0A 3D15A 3OOGA 3A7HA 2R5TA 4DG3E 2YDIA 5CYIA 2ITWA 5CU6A 2X8EA 3QLFA 2C1AA 2R3PA 2YIQA 2UVYA 3ULIA 3UOHA 3UIUA 1L3RE 3PE2A 4E6CA 4QTBA 1OKYA 5E90A 2XMYA 3FQHA 2P0CA 3Q53A 2UW9A 3ZYAA 4Q2AA 2CNQA 2OF4A 2BZIB 3JXWA 3LFEA 1YDRE 2VTHA 4G3GA 4O7RA 2YN8A 3JPVA 3TEIA 5IEYA 4R77A 3DB6A 4HCTA 3F3TA 4RWLA 3PXYA 4L3JA 4Q5HA 4O91A 4RVLA 5DBXA 3BIZA 4JG7A 4X2FA 3BQRA 3ORMA 1CTPE 2PVLA 3ACKA 3TACA 3TV4A 3MYGA 3L1SA 3FHRA 4JQEA 3HRBA 3AC4A 1PXNA 3BU5A 3R02A 3R7OA 2Y4IC 3I6UA 4D5KA 4MTAA 4UMPA 3NUAA 2XK6A 4H39A 4FOCA 4QYEA 5M55A 2WELA 4U8ZA 4OTWA 2QHNA 3FLYA 2REIA 4FG9A 4HNFA 4QT1A 4H1JA 4XV9A 3HDMA 3SXFA 4TNBA 1M7QA 1YOJA 1Q99A 2PMNX 4DN5A 4IFCA 2QURA 4QD6A 4QP9A 5K5XA 5CXZA 4AZTA 2F7EE 2PMIA 4X2JA 2R3KA 3FXXA 3OFMA 2W1EA 4GG7A 4DFBA 3LVPA 5IA0A 5HTIA 3RHKA 2DWBA 2YIRA 2WMVA 2PYWA 3CCNA 3I5ZA 4AGUA 2C6MA 2A0CX 3EN4A 3Q3BA 4G5JA 1Q24A 4IBMA 4O1PA 5JH6A 2WMWA 2X7GA 5IQAA 4G9RA 2C30A 3O23A 5CU2A 2YLEA 4NM5A 4HGTA 2YM4A 4DFUA 3COIA 3DKCA 4M8TA 4Z3VA 1Q8YA 2QOLA 1ZMUA 4XV2A 5T6KA 3QGWA 5L2IA 5TKDA 3OCBA 3MW1A 2IG7A 1Q3DA 1R0PA 2JDVA 2XKEA 1YXTA 2QKWB 4U42A 4YSMA 2JDSA 4EHGA 2C5XA 4QTAA 4IANA 3IGGA 2WHBA 4J7BA 3V5LA 1XBBA 5HU3A 1W8CA 1K2PA 2PTKA 2EU9A 4WA9A 4CRLA 1PYEA 2O2UA 4MBLA 4RJ7A 3S2PA 3ORNA 3UQFA 5FDPA 4OAVB 2WAJA 5AWMA 4TTHB 4FV5A 1U46A 3QD4A 4H3PA 4KIPA 3VN9A 3VUKA 3WBLA 5A4QA 4BDKA 3U6JA 2OSCA 4WSYA 2YCQA 3A8XA 3C1XA 3NR9A 5IQDA 1JPAA 2BILB 4BI2A 2VGOA 5EM7A 5IU2A 4FEWA 3DNEA 4EOLA 3CGFA 3C4XA 3CD3A 2EB2A 1K9AA 4FTIA 4I1ZA 4KBKA 5AR5A 2CMWA 3OBGA 4YZNA 4YZMA 3BZ3A 3FL4A 3LM0A 4GS6A 2PK9A 3QLGA 2HY81 4PMMA 4WUNA 4UV0A 2LAVA 4HCUA 3W33A 3ZM4A 4LRMA 3EFJA 4DGMA 1YKRA 4WNMA 2E9PA 3GEQA 3NW6A 3QKMA 4LUEA 3IW6A 4PPAA 4CNHA 3ZO3A 4PDYA 5AR4A 4KBAA 4M15A 4BGHA 2FSMX 3FQSA 4JJRA 4DH3A 4JBVA 4IWPA 4X21A 3G6GA 3VVHA 3E63A 3CC6A 2CNUA 3ZH8A 3ID6C 1VYWA 4EQUA 5F20A 4QMQA 4S31A 5A6OA 3EQPA 4X7QA 5AP6A 3HMOA 4F70A 1OZ1A 2VWBA 4W8EA 4E5BA 1PKDA 4GT3A 2NRUA 2CJMA 4IADA 5TR6A 1GZKA 3RPYA 4I5MA 5H9BA 2BALA 4ZSAA 5JFVA 1OKZA 2EB3A 5EOBA 5K3YA 3T8OA 5EH0A 4OTGA 4IXPA 4BI1A 2XJ1A 2OH0E 1WFCA 1ZWSA 5L6WL 5E7RA 2VWIA 3MV5A 5AJQA 3MJ2A 2WMBA 5J9LA 2UZOA 4RLLA 3M2WA 1ZXEA 3JYAA 4K33A 3LXKA 4AW2A 4I94A 4ENYA 2JIVA 4IM2A 3FUPA 2BHHA 2OJFE 3HECA 4XG9A 4LRKA 1Q41A 3G33A 4J52A 4FL1A 3W2CA 5HNIX 5IEVA 3NLBA 3L9MA 3AMBA 4P4CA 3LQ8A 3I60A 3OBJA 3BV3A 5ANEA 1OB3A 5B2KA 3OWPA 4XRLA 4B6LA 4EH8A 2GNHA 2XIZA 4MYGA 5HBHA 4QP1A 5HTBA 3SVVA 3UQGA 2HELA 4HYHA 4E4MA 4DITA 1JWHA 4PL5A 5D9HA 2CLQA 4JLCA 4EWHA 1YHVA 4MNEA 2XIXA 4MK0A 5EYKA 4ZTHA 3VC4A 1DAWA 2UZLA 4ID7A 5ANDA 5D41A 5L2WA 2WGJA 4LOPA 4RBLA 5HHWA 5F95A 4EOJA 3FL5A 5HE1A 5CAOA 5JFWA 4QMVA 3ZTXA 3PLAE 2J2IB 2WTCA 5EW9A 4FE2A 3ORTA 2XCKA 2I0HA 2UZDA 3FXWA 4XBRA 1IR3A 4B9DA 2C5VA 2YEXA 4O96A 4ITIA 3SDJA 1H28A 2ZB0A 1S9JA 5CNOA 4DCAA 5B2MA 3ZXZA 4XHKB 5GJFA 5ACKA 3SV0A 2J0LA 4EK8A 5CF8A 2J5FA 2QVSE 1FQ1B 4WIHA 1J3HA 3WF9A 1YXSA 2GS7A 4HJOA 3SRVB 1PKGA 1R0EA 3FV8A 2JD5A 3DB8A 4ITHA 4FNXA 2OK1A 5FEQA 4PUZA 3OG7A 2ZV8A 5AM7A 5LWMA 3FI8A 2FYSA 3FMMA 3KGAA 2W1CA 5CTPA 5FTOA 3EH9A 4QMYA 5M51A 4DAWA 3OWJA 2ZV7A 5KNJA 2BDWA 2W5AA 3FZOA 5DE2A 4CZUA 3ITZA 4CFUA 4EHVA 3A99A 2FVDA 3MFUA 1L8TA 3NDMA 3E5AA 4LM5A 4O0WA 2CKPA 3O8PA 3UIMA 3UNJA 3C4WA 3UVRA 4ZTMA 2BRHA 3BEGA 4P90A 5EQPA 1BKXA 1M2QA 3CP9A 4MX9A 3O8UA 4D58A 2UZNA 4XMOA 5CU0A 4O7NA 5BQ0A 1YWNA 3Q9YA 5HOAA 4F08A 2C6EA 1KSWA 4CFNA 3MFRA 4HYSA 2IPXA 1SMHA 2OZOA 3FE3A 4KWPA 5DT4A 5HCZA 4DGOA 5C1QB 4JDIA 4DA5A 3VBQA 1Y91A 2WQMA 3GC0A 3FLSA 4C57A 5I9VA 2BRNA 4CG9A 4F65A 4DEHA 3RPSA 4C58A 2OJJA 3FWQA 3R1YA 2BAJA 4LMUA 3C4ZA 3V8WA 4IMYA 4UXLA 2E2BA 3O17A 2B55A 4YC8A 3R83A 1E1VA 1T45A 3D2IA 3D5WA 4DTBA 4D9TA 3S0OA 4HPUE 5AA8A 2IVSA 4WBOA 3T9TA 4MWIA 2B54A 2Y4IB 4AOTA 3F5XA 3LFQA 4PTCA 4FNWA 4J8NA 3TDWA 3EQHA 4UB7A 3KRLA 4RMZA 4NW6A 2NO3A 3JY9A 1YW2A 5HIDA 5CI6A 3QBNA 1OL2A 3MS9A 3NYXA 4RZWA 4FI1A 4S30A 3LW0A 4X6RA 3KXZA 1GZNA 4N6ZA 4RIWA 4TPTA 4ANOA 3CQWA 3NCGA 2Z7SA 5EDQA 4OAUC 3KREA 3RZBA 3N51A 1ZYLA 2I6LA 4BB4A 2WNTA 3MH1A 5ICPA 3TNWA 2OIQA 3OMVA 2XM8A 3ZRMA 4E6QA 4F9AA 2GHMA 2XM9A 5HU9A 2VU3A 1LP4A 4LOOA 3MY5A 3U8WA 2I0VA 3CE3A 4FNYA 4RFMA 2ZMCA 4OTFA 5LARA 5LCJA 2QG7A 3N4UA 2XYNA 2XJ2A 1FPUA 1YDSE 3UMXA 3DTWA 4CMTA 2BAQA 3MN3A 1STCE 4UYNA 4YBJA 5EQYA 4YO4A 1YQJA 2PWLA 2BCJA 5LMKC 4FMQA 4JDJA 4D2PA 3GXLA 1FVVA 3F9NA 3RVGA 4NL0A 3EQGA 2ETMA 4G9CA 3AXWA 3PVWA 2QCSA 2ZVAA 3QZIA 4Y8DA 4BYIA 2YIYA 3ZLXA 4PV0A 4F63A 3IOKA 4AN2A 3VRYA 2ITXA 3NUNA 3ZO2A 3RKBA 3PXFA 2X7FA 3QTZA 4O7SA 3LFSA 1XWSA 2NPQA 4ZTQA 2R3MA 3TNPC 3ZFXA 4QQ5A 4D4YA 4FKTA 4JI9A 4NWMA 4KS7A 1SZMA 4ENXA 2VTQA 5E8WA 1FMOE 3MVMA 2FB8A 3ZLSA 1UNLA 3II5A 5LMAA 4FG7A 5TO8A 3D14A 2Z2WA 3DJ6A 5J7BA 4LFIA 3ZZEA 1PJKA 3KK9A 1O9UA 1P4FA 3KRRA 4FKVA 5HE3A 2O8YA 5TOZA 2W06A 4G5PA 3F66A 4ZZNA 4FT9A 4RIOA 5LQFA 3PRFA 4G3CA 4I4EA 4YGAA 4OBQA 4AA0A 4A07A 3RCJA 5HO8A 1IAJA 4DINA 3VS4A 1M7NA 4L3PA 2PVJA 3RK7A 5HE2A 3QTSA 3GU4A 4GW8A 5HBEA 3BHVA 5BVNA 2PPQA 2WPAA 5H2UA 4Y85A 1Z5MA 4QQCA 1OKWA 4P5ZA 5KMOA 2ITYA 1BYGA 3PXKA 1J7IA 3UQCA 4FSNA 1H8FA 2G1TA 4KA3A 4BBEA 4ZJVA 4OT5A 2XF0A 3R2BA 3Q60A 2HZIA 3TZ8A 1KOBA 1FGIA 4AACA 4AGWA 5BVFA 4O7WA 4B0GA 4U7ZA 4O2ZA 5IQHA 2OO8X 1JSUA 4A4LA 1FGKA 4FIIA 5BUJA 3V6SA 4AA5A 4E7WA 3NMUF 1U4DA 1YI3A 3TN8A 4EOMA 1OM1A 3SKCA 1UU8A 4LGDA 4F0GA 3ACJA 4GFGA 4YJQA 2JEDA 4Y95A 4BHZA 4C4GA 2X9FA 2VZ6A 1ZMVA 1E1XA 3MDYA 3NNXA 2QO2A 4L9IA 3AOXA 4JXFA 4IJ9A 4D5HA 4AZVA 3E64A 4CFXA 2JDRA 4LGGA 3BYMA 3CJFA 5EFQA 3A4PA 5EKNA 1VJYA 2VTRA 5BPYA 2AYPA 3Q4UA 4W4XA 1V1KA 4TYIA 2ONLA 4RIXA 4RRVA 3I5NA 4FSWA 3EFKA 3VS2A 2R3RA 3WF6A 5HIBA 4IB5A 4AOJA 2NP8A 3FMEA 2IN6A 1DM2A 4C3PA 5CF6A 1APME 3C50A 4R3RA 4K6ZA 5FM3A 1J1CA 3PE1A 4YSJA 2VUWA 3VW6A 5JGAA 4ALWA 3L8VA 4QMTA 1M52A 2GNLA 2WQBA 4AWIA 3LFCA 4KB8A 2ACXA 3RNYA 1XQZA 4I0RA 4DT9A 2XK3A 4AG8A 3UNZA 4IZ5A 4IACA 4F6UA 5AP1A 4P7EA 4E20A 4ANSA 1NVSA 5J5TA 4CMOA 3S1HA 3DT1A 4IVAA 3GC7A 3VS6A 4I21A 3PZEA 3Q9WA 2YIXA 3ZSIA 5C8NA 4J96A 3S00A 1BI8A 3UZRA 2UW8A 3OCSA 3QQLA 2W4KA 4RA5A 3FSFA 2PMOX 2XUUA 4NJDA 5EYCA 3TNIA 3DU8A 3OW3A 4K8AA 4L6QA 4EK5A 1VEBA 3FI3A 3UNKA 2VV9A 2Y8OA 4KABA 4YLLA 3R9HA 2EWAA 2BIYA 2X6EA 3ORZA 1CSNA 5IQGA 4F9CA 3TL8A 1H1QA 3F61A 4XYFA 1OL5A 4HNIA 3LCTA 4IWDA 3CQUA 4Z9LA 2HZ0A 4RVKA 2B7AA 4O7ZA 1SNXA 3FPQA 2ZMDA 1CKJA 4H1MA 4NFNA 2CSNA 5CLPA 2C6TA 5E8UA 3MIYA 4RJ8A 2GFSA 1PYXA 4L43A 4AX8A 3ZUVA 2C6DA 3OEZA 1XH5A 3RK5A 1S9IA 2BZKB 4GCJA 4G3DA 4D1ZA 4EZ5A 2UZTA 2X4ZA 3R7UA 3KL8A 5CEOA 3G9LX 3GP0A 3O50A 4QP3A 2C6IA 3EOCA 4FNZA 4U80A 4ARKA 4BWKA 4JX7A 4TZRA 4NIFA 4CQEA 4YURA 3OD6X 4FA2A 3F7WA 3R7IA 5KBQA 3DAJA 4BCHA 3BHTA 3F2RA 4H05A 2BKZA 2V7AA 4QO9A 3HYHA 2QLUA 3BBWA 4BL1A 5CALA 1J91A 2QD9A 4FVQA 3HUBA 3SG9A 2BMCA 2W1ZA 4MXOA 3Q2MA 3MI9A 5J79A 4G2FA 2OBJA 3PY1A 2OFUA 5AUVA 1OIUA 2GQSA 5DGZA 4MF0A 1H24A 3JS2A 2VTIA 2UW3A 2VN9A 2XBAA 3IDBA 4JIKA 4OW8A 5HG8A 3VIDA 3QF9A 2WO6A 2JIIA 1F0QA 1OGUA 3C4EA 3PVGA 4UZHA 2G01A 3BU3A 5JFSA 4QMOA 4D4VA 3OY3A 3VBTA 4FV6A 4EH5A 3RM7A 3V51A 3HVCA 1WVXA 1CKIA 3FZTA 3R1QA 5FDXA 4O6EA 2RF9A 4CLJA 3MWUA 3DK7A 3UDBA 3HZTA 2B52A 2W4JA 4MXYA 4C02A 5IDNA 3SG8A 4BIDA 5E8VA 4JL9A 4U43A 4CTCA 3DBEA 3ZLWA 2HENA 3LFNA 2YM8A 4TWOA 4G6LA 3DY7A 4QMLA 4ANBA 5EDRA 4I92A 2PUUA 3CPCA 2KULA 4BCMA 4I6BA 4EH9A 3QALE 3FHIA 2R3JA 2XVDA 2B9FA 4K11A 2X2MA 4BF2A 1M17A 2JAVA 2Y7JA 3R7EA 4AW5A 3VBWA 1B38A 2R0IA 4RG0A 5EHOA 2GMXA 4RJ3A 5D12A 1G3NA 4C35A 3IDCA 5IMEA 4KUJA 3QUDA 4E3CA 2OG8A 4FZDB 2Z02A 1P2AA 3PSDA 4U45A 2WTKB 5E8TA 3SOAA 3DBCA 5IMXA 3OOMA 3QTQA 4O38A 2HWOA 4B7TA 1LR4A 3EB0A 3D5VA 4N6YA 2YZLA 5IA3A 1PMUA 2Z60A 3R6XA 4DE4A 1WBVA 4WNKA 4M68A 1GZ8A 4KIOA 2C6LA 5L8KA 1PMVA 2ZOQA 4CFMA 3DKFA 4ONAA 5EM6A 4I23A 4NYEA 2R7IA 2AC3A 3TNQB 1UKIA 1V0PA 3L9PA 2BTSA 4AS0A 2C0OA 1OPLA 2BRBA 2XNEA 3PXZA 4QMMA 3H30A 1SVHA 1EH4A 4F9BA 3QTUA 5I9WA 3BYUA 3GOPA 1GIHA 3TV7A 4U97A 2QNJA 4FTUA 4AT3A 4D28A 3BLRA 2GS2A 3W1FA 5DEYA 4KRCA 4BBMA 1XBAA 5IPJA 3MESA 3COMA 5CF4A 4XNEA 3BRBA 4XP0A 3QRKA 1PHKA 4CCBA 4V05A 3WYXA 2X2LA 2UVXA 4MCVA 3TIYA 2HXQA 3U4WA 5IQEA 2OWBA 3U51A 4TT7A 4TL0A 5HKMA 1WBNA 2JGZA 5CEIA 2UW6A 5HVYA 4MEDA 4RC4A 3P7CA 2ZM1A 4MQ2A 2GFCA 4M66A 3TCPA 5GJDA 4C34A 4L01A 2R3HA 4AZFA 2J0JA 4HGEA 5AV3A 2I1MA 1PXJA 3PY0A 4A4OA 5HBJA 2QU6A 2BAKA 4FYOA 2O0UA 4WKQA 3MB7A 4AT4A 5ETAA 1YWRA 1JKKA 4IDVA 2V62A 4FTJA 3EWHA 3SC1A 5CSVA 3DBQA 2OF2A 5T68A 3QQFA 3P7AA 3MA3A 3Q5IA 4GFMA 4NTTA 4O22A 4U3YA 4Y46A 5FD2A 5KMMA 2OH4A 3DZOA 3DXQA 4EUTA 5HGIA 4BFMA 4ZSGA 1FVRA 3KMMA 3OXIA 4L8MA 4XEYA 1IA9A 3U6HA 4FTLA 4QMPA 2QONA 5FBNC 4BKJA 5GHVA 2JKKA 4UMQA 4LYNA 5EI2A 4DF3A 4FVRA 5HEZA 2HZ4A 4HVHA 5HG7A 3M1SA 2ERZE 1JBPE 4K1BA 3R7GA 4ZMFA 2GU8A 3HMPA 2C6KA 2XIYA 3TKHA 4HVDA 5IDPA 2JITA 4BDEA 3E7VA 4FTRA 3RJCA 2VNYA 4AN3A 5DT3A 1PMEA 2DUVA 3FZSA 4QQJA 2RIOA 3MBLA 4GIHA 2P2IA 2H8HA 3OVVA 5HO7A 4BCQA 1ZOEA 4ZSLA 5EDPA 5BVEA 1DI8A 2A19B 2CN8A 4WG5A 3LXLA 4F9YA 3TJCA 2GPHA 3REPA 3OP5A 1JNKA 2ITTA 4MD9E 4B8MA 2XNNA 2YERA 4BCGA 2J0KA 2J51A 3AMAA 1ZY4A 2IZTA 2VX3A 4HOKA 4WNOA 3S95A 5IQCA 2PSQA 2Y0AA 4GJ2A 4YPDA 2C5NA 2YAKA 4IHPA 3SX9A 4O21A 3ZONA 1TKIA 2HK5A 3UO5A 4O7LA 5DWRA 4KBCA 5HD4A 2FA2A 1IEPA 4JR7A 3V01A 3Q2JA 2PULA 3BGZA 3KXHA 5FP6A 4JVGA 4I6HA 4I6QA 1H0VA 4YTHA 3S3IA 4ZTRA 4A9TA 4FG8A 4D2SA 5FG8A 3P9JA 3LE6A 1GZOA 2XIRA 4PDSA 4DBNA 2ETKA 3BCEA 5LVMA 5DLSA 4DH8A 4FEQA 3A62A 3OCTA 4ZSEA 5T3QA 4IAZA 4J99A 1KE8A 4K9YA 3ZEWA 3CGOA 1R39A 5KE0A 3ODZX 3NZ0A 5HG9A 3ZC6A 4FBXA 3BE2A 4BHNA 4M3QA 4RIYB 4ANQA 5E8XA 4EK6A 3N4VA 4PTGA 4HZSA 3GC9A 4IB1A 5FXQA 2CCHA 1JOWB 3VUGA 5KUPA 3TDVA 4FKSA 1YI4A 4ZOGA 5K5NA 5A4TA 3PPJA 2Q83A 3AGLA 4AW0A 4W9XA 5LVPA 5JK3A 2W7XA 3VBVA 5AV4A 5DEWA 2WMTA 3LMIA 4RWIA 2VWVA 4Y5QA 3ZUTA 2GCDA 1YOLA 5AR8A 3UG1A 4USEA 5GIOE 1RJBA 4MBIA 3R2YA 4NKSA 3HUCA 3HA8A 4C37A 3Q9ZA 4EH3A 2X7OA 4R1YA 3V5QA 4RX5A 5JEBA 5L6OA 4UWCA 4IC7A 3Q5ZA 1ATPE 4FICA 3SRVA 4X2GA 3ALNA 3QC4A 5J87A 4CSVA 2XYUA 3PVBA 3TIZA 4ASEA 3AQVA 4QMSA 4NZWB 1PF8A 3IG7A 2YITA 1ZOGA 4MKCA 3P0MA 3ZC5A 1G8SA 4GG5A 5JFXA 4JOAA 4FEVA 3PWYA 3OUNB 5BMSA 5L8LA 3IW7A 4USDA 4DEDA 3IQ7A 5H8EA 3QYWA 4O0YA 3UIXA 1YI6A 2ZYBA 4AFEA 1A9UA 4DYMA 4AOIA 3AT3A 2G9XA 1XKKA 1JLUE 4WUAA 3OF0A 4MQ1A 4JG6A 5AP4A 4FTNA 5FEDA 5IG1A 3QXOA 1JAMA 4X3FC 3KXNA 4HVSA 3GB2A 4RGJA 3CD8A 2E9UA 4K0YA 4Q9ZA 4W4VA 4E4LA 4XG2A 1PW2A 2WTIA 4PDOA 4ACGA 5M09A 1OMWA 2WMQA 2FSOX 3W2OA 3W2PA 3DBFA 3HV6A 3NUUA 1OPKA 4L42A 4P2KA 1HCLA 4GJ3A 4G31A 4D2WA 3KRJA 5F1ZA 4JS8A 4DTKA 4L00A 5CAPA 4DEGA 2BTRA 2GQRA 5HX8A 4MAOA 4AZWA 4FTMA 3QQUA 3VUIA 3QWKA 3BEAA 5DRDA 3I4BA 4R5YA 4O84A 3L9NA 4IIRA 4AE9A 2CNVA 3TUBA 2OZAB 4M84A 2W96B 4UBAA 1MQ4A 4DLIA 2OI4X 3GNIB 4FT5A 4APPA 4EHEA 1MP8A 3RPOA 3R71A 3UO4A 3HV5A 2X81A 3DFCB 4ZY5A 2YHVA 4XG3A 3HL7A 2XRWA 2F7XE 4O0UA 1URWA 3CKWA 2FO0A 5E92A 3RMFA 3BGPA 4FR4A 3ZMMA 3R22A 4YJUA 3DNDA 2LGCA 4YZCA 5BYZA 4FF8A 3ZRLA 2XNGA 4W4YA 3W32A 3Q9XA 2CPKE 3MPMA 5CXHA 1AGWA 4IB0A 1UKHA 3AMYA 3BWFA 4KAOA 4FV4A 4BC6A 2PY3A 3BX5A 3F69A 4C61A 5M4CA 3OZ6A 1BUHA 5GZ9A 3BLHA 4IZAA 1JSTA 2UZEA 4ITJA 1A06A 4MXXA 2XA4A 1TQIA 1W98A 2H96A 4CZTA 4WRSA 1H26A 2XRUA 3T9IA 2IW9A 4YNEA 2VX1A 4IZYA 3SXRA 4FUXA 4GMYA 4DEAA 2ITPA 2R64A 4FTKA 4BBFA 4E4XA 1E9HA 2WU7A 3ZRKA 3PG3A 5BUIA 3FSKA 3W8QA 4QMNA 3HP2A 4GUEA 4GK2A 4UX9A 3VS0A 2XB7A 3UC4A 5CAQA 3QX2A 4MF1A 3IONA 4ZLYA 2IVVA 3O96A 1KE7A 3M42A 2GQGA 4N0SA 4ZZMA 5J8IA 3O7LB 3BLQA 4ZEGA 2GSFA 4I93A 2OIBA 4WSQA 4AQCA 4EBVA 3RTPA 4U40A 3CS9A 3ZOSA 4L7FA 1GNGA 5E8SA 2XIKA 4RJ6A 2ERKA 3QQHA 3PY3A 1U54A 2PVNA 3LFBA 4BYJA 4S2ZA 3QHRA 2B0QA 4QP8A 4IH8A 4A06A 3VQHA 4FZ6A 5K4JA 4BTMA 2A27A 5DYJA 3NUSA 2ZDTA 3CPBA 1GIIA 4NKAA 4BDBA 5CSPA 5KCVA 4W8DA 3ORXA 4DGNA 5DNRA 3VRZA 4FEUA 2VTPA 5J9ZA 4G3EA 2GTNA 1LUFA 3MPAA 4C38A 5EM8A 5M06A 4FKPA 3LXNA 3L9LA 1B39A 2W0JA 3PVUA 5IQFA 4EUUA 4EKLA 2OKRA 2WTDA 2CGWA 5J95A 2X8IA 5L8JA 5C26A 3AC8A 5EM5A 3AG9A 2HY0A 3EFLA 4R3CA 1MRVA 5ETFA 3OEFX 4Z7GA 2P55A 4HYIA 1TQMA 4PDPA 5CNNA 4EL9A 3ALOA 3NNUA 1RW8A 2C3JA 2R3GA 1QL6A 3OT3A 4KKHA 5IQIA 4CKIA 4GT4A 2DQ7X 5E1EA 4HZRA 5DMZA 4Q9SA 1OL6A 3ZDUA 5LMBA 1UU7A 1RQQA 3LIJA 3IW8A 4Y5HA 5DPVA 5EW3A 4U81A 2R9SA 3NS9A 4G17A 4YJSA 4G3FA 2HW7A 4YP8A 1T46A 3NPCA 4FZAB 4W9WA 5E4HA 1UNGA 4XP2A 2QOIA 2BUJA 2HYYA 4GKHA 3F3VA 3TZ7A 2WTJA 4APCA 3ZSHA 4OTPA 3AT2A 5H8GA 4BCFA 1XHAA 2GNJA 2C3IB 4KKGA 4OLIA 1BI7A 2XEZA 4YJRA 4I22A 5A14A 3K2LA 3KN6A 2BZJA 3MH0A 3R0TA 1UWHA 4C2WA 3PYYA 4XV1A 1ZZLA 4LQMA 3MA6A 2VWWA 2J50A 4RX7A 4IVBA 5AP7A 4HW7A 4Z55A 2ITZA 4BCNA 4RQKA 4UMTA 3R9NA 3THBA 4F64A 2A2AA 3DV3A 3I1AA 4PX6A 4GFOA 4FSTA 3WZJA 4PMPA 4M97A 4XLVA 3ROCA 4BIEA 4FGRA 4TYJA 2GTMA 3GGFA 1KWPA 4CG8A 4YR8A 3A7GA 3D2KA 2PVFA 3QA8A 4O0TA 1VR2A 4YC6A 4O7TA 4E5WA 5JMSA 1H1SA 2PE0A 4EI4A 1YOMA 3HMNA 1PXIA 3HA6A 4GVJA 2YLFA 4G6NA 5AEPA 4YTFA 4I0SA 3DKGA 3FC1X 5I9ZA 3HDNA 1SVGA 4IM0A 2WOTA 4F6WA 2WMAA 4FEXA 3MPTA 2C5YA 2J6MA 4FV7A 4XG8A 2Y6MA 3KMWA 3EKKA 3G0EA 2QOCA 1GJOA 5CANA 4V0GB 4MVFA 3LPBA 5EQEA 2RFSA 4OTHA 3UOKA 3TKUA 4FIHA 4Y72A 4EONA 2QOOA 3O51A 3KY2A 4YLJA 3KF7A 1XR1A 3UG2A 3W2RA 4DFXE 4AFJA 4G1WA 4N57A 3DS6A 4FKRA 2CLXA 4IE9A 2H9VA 5CVGA 4BWPA 5CQWA 3LFAA 2BROA 4ZS4A 2QOKA 4GYGA 3G2FA 4MD8E 1OBDA 1QPJA 2Z7RA 5CVHA 1Y8GA 1FOTA 2CKEA 2I40A 2R3FA 3RZFA 3T3VA 4A7CA 3MGYA 2J7TA 3LCSA 1K3AA 2W4OA 3QTRA 4X3FB 4ASZA 5J7HA 5KKRC 2VAGA 4XX9A 4D2VA 3GCSA 3F2AA 2VTLA 3QRTA 3RI1A 3E8NA 5EHLA 4RC3A 4EORA 5A4CA 5AR2A 3SOCA 3PIYA 5IH5A 5DOSA 4FUYA 1OKVA 2X0GA 4XG7A 4ZJJA 1U54B 5KMKA 2WEIA 2XK7A 4BZOA 3V5JA 4FV8A 4UWBA 3LKMA 2PZIA 4IVCA 1I09A 3FZ1A 4TYHB 2F49A 1MRUA 3MB6A 4JQ7A 1QPEA 3ZO1A 3WILA 3PIXA 3BPRA 1HOWA 2G2FA 3PJ1A 3R9OA 4C2VA 3FZPA 3K5UA 3NIEA 4O0VA 4F7NA 5L6PA 4U0IA 4XS2A 2WEVA 4EYMA 1ZYCA 2W9FB 3OY1A 5J9YA 2RFEA 5DRBA 3RBWA 4D9UA 4EOQA 5IF1A 5IUIA 3Q6WA 3W10A 1Z9XA 3WF7A 4EC8A 2A1AB 5AAFA 3DA6A 3W8LA 4CXAA 1UU9A 3G6HA 4KIKB 4ZS0A 3DTCA 2QO9A 5D10A 4TW9A 4JNWA 3NYNA 3F5PA 3V8TA 3FI2A 3MY0A 3Q96A 2W9ZB 1M14A 2CCIA 2HIWA 3E93A 1AD5A 3HGKA 4C8BA 4BGQA 5C8MA 5AIKA 1BL6A 5BNJA 3G0FA 3DLSA 2J90A 3SW7A 3BBTB 2FH9A 4FKUA 4NCTA 4UY9A 5EI6A 3LQ3A 3ATTA 2YZAA 2OIDA 1JKLA 5CSWA 3QKLA 4I0TA 4U9AA 3VUHA 4EK3A 1WMKA 3NAXA 3QTXA 4OTRA 4HVIA 4EH4A 3UZTA 3BYSA 5M57A 1ZYDA 4D1SA 4RT7A 3KFAA 4DH7A 3ETAA 4ZSJA 4C7TA 5LMKA 3H9FA 2J0MB 3COKA 3HP5A 3I7CA 4EOSA 4Y83A 4LG4A 4UALA 2G2HA 3FMJA 3QCYA 1IG1A 4BN1A 2W5BA 2UW0A 4D1XA 1XBCA 4WNPA 4BGGA 4IX3A 1GIJA 3ORKA 5BX0A 4AF3A 3UPXA 1FINA 1NY3A 5M53A 2BPMA 3I81A 4BVUA 3FLNC 5GZAA 4KD1A 1URCA 4NU1A 3KC3A 2HW6A 5CSXA 2C0TA 2JIUA 2VNWA 3NWWA 4JIAA 3KB7A 4R8QA 3A7FA 4NT4A 2GHLA 2WZJA 2VTSA 3NIZA 4V01A 3UZPA 3GUBA 3QTWA 5EI8A 4A9UA 4DFNA 3P1AA 4FKGA 4M13A 5F94A 3JY0A 3VBYA 3VJOA 2YCSA 3PA3A 4CYIA 5DG5A 4NM7A 3PWDA 3VUDA 3U9NA 2X8DA 2RL5A 5C8KA 1WAKA 3QRUA 2XKDA 4JBPA 4RJ4A 4TYEA 3TNHA 1OVEA 3E87A 3R8VA 4CCUA 4TYGA 2BRMA 4G6OA 2HOGA 5AM6A 5HCYA 3D5UA 3PZHA 2QU5A 1OIRA 4ACCA 2GNFA 4J71A 3GOKA 4AN9A 3E8EA 4PP9A 4QYYA 2W1GA 5AR3A 5ETIA 4FTOA 3ZBFA 2R3NA 3TV6A 3BQCA 2R2PA 3B2WA 5CENA 3RM6A 4BCOA 3R1SA 3O7LD 1NXKA 2YDKA 4I5CA 3VWAA 1OITA 3V3VA 3VS3A 4QP4A 5JRQA 4ACDA 4DFLA 1ZY5A 4B99A 3KA0A 5CT0A 4QTDA 1BL7A 2F2UA 4GRBA 5CZHA 3ZO4A 4C36A 3ZS5A 4E6AA 4GT5A 3R04A 1PXLA 1NVRA 2H6DA 2X6DA 3ZFYA 5HICA 4ASDA 2YM6A 4CEGA 5B2LA 4WRGA 5M4UA 3Q4ZA 1Y8YA 3LFDA 4FSUA 2BDJA 5D7VA 3ZFMA 5JGDA 2VO6A 2XK8A 3NNVA 4XUFA 3QGYA 3IK3A 2VO7A 3OXZA 5DVRA 4C4IA 4JBQA 5BMMA 2IW8A 4EJNA 4I20A 2VTMA 4BDHA 4LMNA 2E9NA 3F3WA 5ANOA 3UTOA 4CLIA 3LJ1A 2R3LA 5FM2A 4AUAA 4O0SA 4BCPA 3ZM9A 3VO3A 2IZUA 4BTKA 2BVAA 4TNDA 4FODA 4LRJA 5FTGA 4M69B 1WBOA 3EQIA 4GYIA 4XH6A 5AX9A 4QTCA 5IH6A 1U5RA 5CU4A 5CX9A 5BVKA 4Z7HA 2WKMA 4DGGA 4JAIA 3SAYA 4IAKA 3SXSA 4HPTE 4NH1A 2Z7QA 1WVWA 1Q3WA 2YCFA 3IOPA 4HGSA 4KS8A 4LL0A 2QC6A 1QPCA 5F4NA 4CFFA 4CQGA 2GDOA 2YDJA 3EZVA 4YTIA 5EG3A 3CTHA 3D7TB 3GCVA 2JDTA 3KCKA 4FV9A 4FL3A 2OU7A 4FV2A 4EOOA 4S33A 2YFXA 5HNBA 2BHEA 4CTBA 4L52A 4RLKA 1V0BA 4KIQA 3DK3A 5DH3A 3RNIA 1U5QA 3FI4A 4TN6A 5TT7A 3O71A 4MXCA 5FTQA 2YWVA 3ZSGA 3NYOA 2RFDA 4RVTA 4YJTA 2V5QA 2QG5A 3FMLA 2WQOA 3PXRA 2VWYA 1SYKA 5GNKA 3LQ5A 1H4LA 5IQBA 2YM3A 4UXQA 4U5JA 2UW5A 1CDKA 3B8QA 2W1HA 3EZRA 3T3UA 4F99A 1CMKE 3GU6A 4EZ7A 5A6NA 4BR3A 2VTTA 4FSZA 2JAMA 3KEXA 5HESA 3DXPA 1OPJA 2X39A 2B9JA 1ZARA 4USFA 3PRIA 4MD7E 3I79A 3LCDA 5EYMA 1XH9A 5CEQA 2PZYA 2CGXA 2YISA 4PNIA 2AC5A 3R8LA 1UV5A 4FT0A 4AA4A 4AXAA 1Q61A 2OICA 1PRYA 2CKOA 4RA4A 2WIPA 3MFTA 3QZHA 3ZU7A 2OJIA 4O2PA 4RIYA 5DR9A 3OTVA 2PZRA 3HAMA 3ORLA 4O81A 3OUKA 3KXGA 4H58A 4YHTA 3WZDA 3JUHA 3HEGA 4PF4A 5GINE 3U4UA 4AGCA 3I0OA 3VUTA 3AD6A 2C68A 2YJRA 4RSSA 3LJ2A 3W16A 4UMRA 4OTQA 2BFYA 4FIJA 3Q4TA 2ZM3A 1CKPA 5CQUA 4FIFA 4BKYA 2SRCA 1UU3A 3QFVA 4EH2A 2UVZA 5IEXA 2FUMA 3QA0A 4PTEA 3KF4A 5DR6A 3TM0A 3C7QA 3R01A 4YO6A 5DI1A 5FBOA 4I41A 5AMNA 3DCVA 4GKIA 4LUDA 4X6QC 2P2HA 4BCKA 5IISA 3BYOA 4K18A 1JQHA 2XJ0A 3WOWA 3EQFA 4R3PA 3F5UA 5AA9A 3PA5A 4EWQA 4IAIA 5HZNA 3IGOA 3AC5A 2CHLA 3F5GA 4TWPA 5M07A 3NVMB 3IPHA 1REKA 1WBSA 5TE0A 3QQGA 4XJ0A 3CSVA 3PJ2A 2F9GA 3IKAA 2FSLX 4ZTSA 3VS7A 3UE4A 4B8LA 2ITUA 3KU2A 1V0OA 3NX8A 2PMLX 3EYHA 3TG1A 5AUUA 3LMHA 2PU8A 5K0XA 3NW7A 4QNYA 3EN6A 4IX4A 2V55A 2OJGA 1M2PA 2A4LA 1PMNA 4IWOA 4L68A 4X3JA 5FRIA 4BDDA 1ZOHA 3NNWA 3P78A 4J8MA 4DCEA 3FY0A 1VYZA 4JT3A 5ANJA 4BWXA 1H1WA 4ACHA 4R1VA 2YA9A 3EHAA 3LCOA 3LFFA 4TRLA 5E91A 2QKRA 2X4FA 1W82A 5FP5A 2WB8A 3O2MA 3V04A 3NYVA 4QP6A 3HMIA 3VULA 5A9UA 4OBPA 3Q32A 4EC9A 1OIQA 1ZAOA 2UV2A 3LLAA 3PIZA 5E1SA 4QYFA 3HAVA 2VTAA 5H3QA 3IDPA 3QTIA 3MSSA 3LM5A 4QMUA 1F3MC 3EQDA 2X9EA 5JKGA 3P08A 4NK9A 3VHKA 3FEGA 1B6CB 2XNBA 3FLQA 2WMSA 3UOJA 2DYLA 3R63A 5HD7A 3A2CA 5J1VA 4E73A 2YWPA 2OZAA 1ND4A 1Y6BA 2XH5A 4E6DA 4WG3A 5M44A 1TQPA 1XH4A 2V0DA 1WVYA 3KULA 4LV8A 4U44A 4E93A 4EOIA 4C62A 3OC1A 2JKMA 5IUGA 1KE5A 3EIDA 3EQBA 4YLKA 4EJ7A 3ORIA 1JKTA 3R00A 1OIYA 3CTJA 2HZNA 4R78A 4N70A 3LLTA 2QOFA 3BU6A 1UA2A 2J4ZA 3DOGA 4RFZA 3WI6A 2EXMA 2Y6OA 4QNAA 3UJGA 5HIEA 1OBGA 5CS6A 3ANQA 2BZHB 4IC8A 5IA5A 4CV9A 4CYJA 4FIEA 5HLWA 4CGAA 1GOLA 2JLDA 4ZK5A 3RGFA 3PDTA 4DFYA 1OL7A 3K54A 3BELA 4Q5EA 3ET7A 3FKOA 3GU8A 3QD0A 1YXXA 2I0EA 5TF9A 4X2KA 3RALA 4XLIA 4AT5A 5JZNA 3W18A 4C4FA 3FYJX 3PSCA 2J9MA 4ACMA 3K5VA 2Z7LA 4O86A 1DS5A 3F7ZA 2KTYA 4NW5A 5IZFA 1LEZA 4NUSA 4CFVA 3CTQA 3HLLA 3UODA 2VWZA 4NM3A 3DLZA 5EHYA 2WMRA 3JVSA 4KSPA 4F1OA 1REJA 1R3CA 5KO1A 3H0YA 4P5QA 4TY1A 1AQ1A 5G6VA 3TI1A 2UZVA 3D94A 2HAKA 3GU7A 4OTIA 3KN5A 4GL9A 5DHJA 3QWJA 3WE4A 3D83A 5JZJA 4YUQA 1SVEA 3ZUUA 3UP7A 3LMGA 2E9OA 1IAHA 4YZ9A 4FV3A 5L2SA 3POOA 2PZ5A 3EN5A 3C0HA 5CAUA 2B53A 2C3KA 3EQCA 5ANIA 2GHGA 3GC8A 4WO5A 3DBDA 4MXZA 3GQIA 1Q8WA 2C3LA 3P7BA 2W1IA 1G8AA 4DH5A 1ZYSA 3PUPA 4LGHA 3DQXA 4L67A 3R8ZA 3HKOA 1ZRZA 5BYYA 4BZDA 4J95A 3R8PA 1UWJA 3G5DA 3QRIA 5LCKA 4MWHA 1NVQA 3EL8A 5FGKA 4CMUA 3KKVA 3RAKA 5FUTA 2IZSA 4DTAA 2C5OA 2OFVA 2V7OA 4FTAA 4IM3A 3RWPA 1QMZA 3O0GA 2ITQA 4RJ5A 4LL5A 5A4LA 2BKKA 2NRYA 3D7ZA 3OCGA 3NVKI 4WBBB 2QOBA 3HRFA 5AUYA 3WE8A 4XBUA 4I3ZA 4RFYA 3QKKA 4C33A 2ZV2A 3CEKA 5I3OA 5KMIA 3G15A 3B2TA 3R30A 4BCIA 1RE8A 2BRGA 1XH6A 2P33A 3DJ5A 5E8YA 1GAGA 1FVTA 3MVJA 3HX4A 5AP0A 1ZZ2A 3VJNA 3A7JA 5JGBA 4FK3A 5AAEA 5H8BA 3V5PA 5HCXA 3PG1A 3V8SA 2E9VA 3DAKA 3MVHA 5FEEA 2C47A 1J7LA 4WOVA 2B9IA 1A48A 5GIPE 4IX6A 4LV5A 3R73A 2WU6A 2W99B 3UOLA 3BWJA 2W17A 3R8MA 3ATSA 4BDAA 2PZPA 4F1MA 3TTIA 4V04A 2WXVA 4QRCA 4ASXA 2OGVA 2YM7A 4C3RA 5KMNA 3QQJA 3V5WA 4HGLA 2JFMA 4ZLOA 5AUTA 3GCPA 2XS0A 2Z8CA 4PL3A 1GY3A 4CKRA 3VUMA 5HLPA 3KULB 2IVTA 3SLSA 3FDNA 5M08A 3LHJA 1FBNA 4J97A 4DH1A 1YXVA 4B4LA 2HWPA 3UP2A 1RDQE 3L8SA 2W1DA 4BI0A 4G16A 3CBLA 4IAYA 4DT8A 1WBWA 3LCKA 1QPDA 2F2CB 3OHTA 3MTFA 4FIGA 2JKOA 4MXAA 5ETCA 3V5TA 4F09A 4X0MA 3UYSA 1TVOA 1XH8A 3F3ZA 5HQ0A 1XJDA 3PP0A 2JC6A 3FMDA 5EOLA 1O6LA 2WIHA 3GT8A 3LZBA 2PUIA 2F57A 3DKOA 3DZQA 2ITVA 4XRJA 4FK6A 4BZNA 4DEEA 5CASA 3AC2A 2BR1A 2O63A 5DT0A 2EVAA 3I7BA 5AV0A 1YXUA 3TUCA 4DEBA 3QU0A 4FKJA 4O27B 2OXYA 1DAYA 2C69A 3G51A 5ANKA 2UW4A 4GIIA 3RCDA 1MQBA 3WIGA 5HO6A 1WCCA 3FLWA 4XV3A 4U41A 3DPKA 3KQ7A 3GFEA 1H01A 4TWCA 3HMMA 5CI7A 4EKKA 3C5IA 2Y9QA 5CEPA 4V0GA 3VBXA 2YAAA 4C4HA 2WFYA 3EN7A 3E62A 3Q6UA 4YJPA 5L3AA 1R1WA 4BDIA 3OWLA 5KZIA 2IJMA 4WG4A 4FZFB 3HNGA 1SM2A 3M11A 5KZ0A 2WQNA 4YJVA 4H36A 2BFXA 2XP2A 4IVDA 1P5EA 2H34A 4R7HA 4FT7A 2PVHA 3OROA 4O7VA 3EQRA 3C4CA 3BHYA 2VX0A 3BI6A 3P23A 2PVYA 3C4FA 5LVNA 4R6VA 3RAHA 3KRXA 4X3FA 1ZLTA 2XZSA 4JX3A 5I9UA 3VS1A 3QXPA 3E8DA 4XOZA 3P86A 1OUKA 1LEWA 5AFVA 2C6OA 4JRVA 1H08A 4ANNA 2CDZA 1MRYA 3IW5A 2YABA 3D5XA 3FMNA 4D55A 1PXKA 2O3PA 3QAME 3ZZWA 5I9YA 4DFZE 3RPRA 4TYHA 2R4BA 5M4FA 2RGPA 1U59A 3CJGA 3BGQA 4H3BA 4F7LA 4K2RA 5A4EA 3KVWA 3OXTA 2PVMA 2W1FA 4HVGA 4DG2E 5AP2A 3ENHA 4BDGA 1IASA 2V22A 2UZBA 1YVJA 4JBOA 4E8AA 3FMKA 4CZYB 1ZYJA 2P3GX 4FL2A 4RVMA 4FV0A 4M7IA 2B4SB 4DG0E 2UZUE 3K3IA 4A4XA 4BCJA 3NEWA 4AAAA 4EBWA 5LOHA 4EYJA 3WIKA 3A7IA 3WF8A 4AW1A 5IH4A 1IRKA 4KNBA 4AGDA 4PWNA 3UBDA 3UYTA 3C0IA 4M0ZA 1XO2B 2QHMA 3F6XA 3W2SA 4A9SA 1KE9A 3KXMA 4KIKA 5B0XA 2ZJWA 3CXWA 3S4QA 4J53A 4IWQA 4GV1A 2PE2A 5D1JA 4ZLZA 4J1RA 2WD1A 4F0IA 4D0XA 1OUYA 3KCFA 3P4KA 5EKOA 5KHXA 4BICA 3A60A 3WARA 3MFSA 4F7JA 1SNUA 4UN0C 2VO3A 3PFQA 5BUEA 4HCVA 3C9WA 2IW6A 3FKNA 3FKLA 3DGKA 3QCXA 4NEUA 4AU8A 5CAVA 1IA8A 5JQ8A 3ENMA 4QTEA 5CEKA 3D4QA 4FZ7A 3QHWA 4QP7A 4ZY6A 3R9DA 5GZ8A 3LXPA 4BIBA 3OTUA 2PVKA 4FTCA 4PQNA 4QPSA 1Q5KA 2F7ZE 4YC3A 5KBRA 1NT2A 3FQEA 3Q04A 3CQEA 2DS1A 4R5SA 4ANLA 4AP7A 4IFGA 5CWZA 4F9WA 5LXMA 5BYLA 4G34A 3OWKA 3PJ8A 1JKSA 2WTWA 3E3BX 3EJ1A 1X8BA 4JAJA 4BTJA 2VTOA 4CT2A 1OI9A 4IW0A 3QUEA 2WOUA 3QD2B 3WF5A 4O0RA 5M4IA 5C4LA 2JDOA 3R28A 1H0WA 2VTNA 3R9RA 1YHWA 3HV4A 4M14A 3CY3A 4Y73A 4DHFA 4FKWA 2R3IA 2XCHA 5EW8A 5BVOA 2ESMA 3FPMA 4OT6A 4XG6A 1KUTA 2PUNA 5AIRA 3C0GA 3COHA 4OBOA 2VD5A 2QQ7A 5JT2A 2C0IA 3CIKA 1OL1A 5AUZA 2FGIA 4MHAA 2C4GA 4AE6A 1UVRA 3TXOA 5C01A 3PLSA 4YTCA 4LI5A 4FTTA 2VWXA 5M56A 3VAPA 4QPMA 4NCTC 2IZRA 4FSRA 4GVAA 3UGCA 2ONLC 4ZTNA 4WHZA 3DXNA 4CV8A 2JFLA 4DC2A 5IA4A 4A9YA 4M0YA 3ULZA 4H3QA 2O5KA 3K3JA 3CR0A 3WZEA 3MJ1A 3U54A 4D4RA 2WTKC 3RP9A 2OXDA 3AD5A 1ZMWA 2YJSA 2HXLA 2ETRA 3MY1A 3ODYX 4MNEB 3UVPA 2B9HA 1NA7A 4XG4A 5JRSA 4C4JA 3DDPA 5CEMA 3VF8A 3O8TA 4O6LA 5CT7A 2QLQA 4FSYA 4GUBA 5ANGA 4M67A 1VZOA 3N9XA 1I44A 3W55A 2G15A 4CT1A 3F3UA 2PVRA 4I4FA 1Z57A 3AD4A 3R7YA 4FX3A 1W84A 3TKIA 1M2RA 4RX9A 4FT3A 2RKUA 3DK6A 4YHJA 1H00A 3C5UA 1PXPA 1JVPP 4M69A 3U55A 4JQ8A 5K0KA 3I6WA 4O82A 2J5EA 3EL7A 4TWNA 3N4TA 4E26A 3ROYA 4PNKA 4PRJA 5C4KA 4AZEA 4YNOA 4DBXA 3OS3A 3BHUA 4XOYA 3TJDA 4F6SA 5AP3A 3D7TA 1W7HA 4FYNA 4U79A 4PY1A 3KRWA 1LPUA 5AADA 4L45A 3UIBA 4F0FA 5F9EA 3JVRA 3E92A 4PPCA 3OT8A 4JRNA 4L53A 1P14A 5C9CA 1OECA 4ZZOA 2I0YA 5HTCA 4YU2A 4KINA 2XKCA 5IKWA 4U3ZA 2C1BA 1Y57A 3EFWA 4UWYA 5HLNA 3NGAA 4CVAA 4BKZA 2IO6A 2RG6A 1YRPA 1PXMA 4F4PA 3QL8A 3NUPA 5DFPA 4A9RA 1Q4LA 3BE9A 4OUCA 5GJGA 2W05A 4E1ZA 2VTJA 1H07A 2WMXA 3I0QA 3PSBA 4EOPA 5JQ5A 1JSVA 1KOAA 2JKQA 4O7YA 5HNGA 4DLJA 3L8PA 3MVLA 4RWJA 5DR2A 4EH7A 3JR1A 4RZVA 4YHFA 4IZ7A 3PP1A 3RWQA 3ZBXA 2ZB1A 1O6YA 3ZXTA 3FC2A 3C13A 2G2IA 5KMJA 3EKNA 3AC1A 5HORA 4BY9E 4ZY4A 4ZTLA 3TZ9A 3GCUA 4FKLA 5KX8A 1YHSA 2CKQA 4FOBA 2ITOA 4OGRA 4F1TA 2QO7A 3FLZA 2CN5A 2BIKB 4L46A 4C59A 3FYKX 3GVUA 5E9EA 2NNWB 4RIWB 5AV2A 3EMGA 3PPZA 5AAGA 3H9RA 1J1BA 3TWJA 3BHHA 3LOKA 4EK4A 2P4IA 4NM0A 3R8UA 3NUXA 3ZHPC 5HVJA 3C51A 5FQDC 3UO6A 1WZYA 2O64A
chains in the Genus database with same CATH superfamily
3Q4CA 4GK3A 4IEBA 4IJPA 3H4JA 4O1OA 5IA2A 3WYYA 5E8ZA 5IA1A 3ZEPA 5DN3A 5HI2A 4I5HA 5L2TA 3FMHA 4YJOA 4ZIMA 4QQTA 3PA4A 4GH2A 3SHEA 2BDFA 3ZDIA 3U9CA 4ALUA 4QPAA 3E7OA 5AUXA 2CGUA 4RWKA 1YWVA 3F82A 4PPBA 3SW4A 2QR7A 2EUFB 4DHJA 3NW5A 5LVOA 4ZMEA 1BMKA 3HRCA 3IW4A 4S34A 5DA3A 4YMJA 2GNGA 3H0ZA 5LJJA 4IX5A 4KSQA 4M12A 4YBKA 3EN9A 3R1NA 2AUHA 4OTDA 1YDTE 4O83A 1Q8UA 3QCSA 2JBOA 5A3XA 4EQCA 3A4OX 5FXSA 3R21A 4S32A 5AR7A 4D0WA 2XKFA 3HV3A 3QCQA 2A98A 2XK4A 3F2NA 1XH7A 1P4OA 2IWIA 4UMUA 3AKJA 4FV1A 1W83A 3E8CA 1BLXA 4QOXA 3P79A 2VWUA 4YPSA 1R78A 3RAIA 5BVDA 4D4SA 5CF5A 3UPZA 4C3FA 3GFWA 1PXOA 2WTVA 3MH3A 3PJ3A 4YZBA 2YACA 2YIWA 3MH2A 3VQUA 4D2TA 4ERKA 4QMWA 4QMXA 3ZLYA 1Q8TA 3GI3A 5LVLA 3FXZA 4MH7A 5AX3A 4ZXTA 2VRXA 4RC2A 3W0QA 5BVWA 3RPVA 2I7QA 5CVFA 3OW4A 4R7IA 3NFGB 3FJQE 3FY2A 4RQVA 2OXXA 3FZRA 3DFAA 3NCZA 3ZCLA 5CY3A 4Z16A 5FXRA 1F5QA 4HYUA 4EQMA 1ERKA 4QYHA 5JN2A 3RAWA 4FKOA 4YZDA 3AGMA 3D9VA 1Q8ZA 2QI8A 2W5HA 4JR3A 2XK9A 5CU3A 3UMWA 2WQEA 3E3PA 3RHXA 1KV2A 2HCKA 3B8RA 2QOQA 4GSBA 3BV2A 3G9NA 3H10A 3GU5A 4IQ6A 4ZAUA 4ZJIA 4ZP5A 3PTGA 3KK8A 3SQQA 3RK9A 4F7SA 4JDKA 3VF9A 4BTFA 4IB3A 3QZFA 4JDHA 4L7SA 5B7VA 1WBPA 4I24A 3F88A 4O0XA 1FMKA 5A54A 4RX8A 1PY5A 4D2RA 3PPKA 2XBJA 3FAAA 4KRDA 3U87A 5L2QA 3RINA 4BDJA 4BRXA 3SGCA 5CSHA 2XNMA 3IECA 4ANMA 2RFNA 3QUPA 4NTSA 2IVUA 2OW3A 4EEVA 1KE6A 2UW7A 4RIXB 4CKJA 5K9IA 5I3RA 1O6KA 4QMZA 3P5KA 2ITNA 1QCFA 5D7AA 2F4JA 3TUDA 4ALVA 5I0BA 4FTQA 3R7VA 2Q0BA 5KKRB 4FVPA 1MUOA 2R7BA 3BYVA 4WD5A 3QD3A 3ELJA 3VW8A 4NFMA 4I6FA 1Q62A 4XCUA 2O65A 1W0XC 3WZKA 2VGPA 4IAFA 5HG5A 2UZWE 5C27A 4EH6A 2PHKA 3ERKA 2Q0NA 3DQWA 2YM5A 2Y4PA 2FSTX 3QRJA 4MBJA 3UVQA 3PJCA 4DGLC 5EK7A 3A8WA 4N4SA 5A46A 4EHZA 5HVKA 5K4IA 2NYAA 4EOKA 4JG8A 4DEIA 3HV7A 5HE0A 2XNPA 3CY2A 4PMTA 4E4NA 3A61A 3MTLA 3H3CA 5AUWA 3IO7A 4ERWA 2XEYA 2EXEA 3KXXA 1H25A 4II5A 4EZ3A 1H27A 3CLYA 3QQKA 5AV1A 2OLCA 3TT0A 3E88A 3TMOA 1WBTA 4QYGA 5ITAA 5J5SA 2CGVA 4QP2A 4OR5A 4TKSA 3PXQA 1Q97A 4GEOA 2UUEA 3FBVA 3GBZA 3LAUA 5I9XA 4C0TA 4FKQA 3UC3A 3VS5A 4NSTA 4FSQA 4I5PA 2XNOA 4PL4A 1BX6A 2QODA 2X1NA 4GK4A 4J98A 5DIAA 5FLFA 3TZMA 3EYGA 4CRSA 4E5AX 2GS6A 2VO0A 3VHEA 5I4NA 4UYAA 2QR8A 5IUHA 5CZIA 1HCKA 2PE1A 2R3QA 4O4DA 4BDFA 4WT6A 3SA0A 4UZDA 4K77A 3U6IA 2EXCX 3DAEA 2RG5A 4GU9A 5AP5A 3V6RA 2B1PA 4BDCA 4PP7A 1CM8A 3KMUA 3DJ7A 4XP3A 3WZUA 1KV1A 1J7UA 2R0UA 2QOHA 2X2KA 4NIFB 4U6RA 4UEUA 5KMLA 2J0IA 3QZGA 3GQLA 3L8XA 3NRMA 3NUYA 3QX4A 3BKBA 5JSMA 2ZAZA 3TTJA 4MNFA 4IDTA 4ORKA 5C03A 1NW1A 2GNIA 3KVXA 4L3LA 3H9OA 2PUPA 2PL0A 3D0EA 2YCRA 3ANRA 2OJ9A 3ORPA 4CD0A 5L4QA 3G90X 5J1WA 5EYDA 3AC3A 3MIAA 4FSMA 1H1PA 2ZM4A 2ZV9A 3AT4A 4LOQA 4NJ3A 4TXCA 4PMSA 4CFWA 5I5ZA 2JBPA 5KHWA 1H1RA 4C4EA 3DDQA 2R3OA 3NAYA 1Y6AA 3POZA 3NSZA 4YJNA 4IAAA 3GENA 3GCQA 5G1XA 5HX6A 4FKIA 3LJ0A 2ZDUA 5LWNA 4FGBA 4W4WA 5FWKK 1G5SA 3QC9A 4FC0A 3QYZA 3VNTA 3CKXA 4R7BA 4L44A 4RPVA 2RSVA 4KKEA 5D11A 3IS5A 3W2QA 1UNHA 5ACBC 2WMUA 4GU6A 4X2NA 4AZSA 1DI9A 3Q52A 3SD0A 3D15A 3OOGA 3A7HA 2R5TA 4DG3E 2YDIA 5CYIA 2ITWA 5CU6A 2X8EA 3QLFA 2C1AA 2R3PA 2YIQA 2UVYA 3ULIA 3UOHA 3UIUA 1L3RE 3PE2A 4E6CA 4QTBA 1OKYA 5E90A 2XMYA 3FQHA 2P0CA 3Q53A 2UW9A 3ZYAA 4Q2AA 2CNQA 2OF4A 2BZIB 3JXWA 3LFEA 1YDRE 2VTHA 4G3GA 4O7RA 2YN8A 3JPVA 3TEIA 5IEYA 4R77A 3DB6A 4HCTA 3F3TA 4RWLA 3PXYA 4L3JA 4Q5HA 4O91A 4RVLA 5DBXA 3BIZA 4JG7A 4X2FA 3BQRA 3ORMA 1CTPE 2PVLA 3ACKA 3TACA 3TV4A 3MYGA 3L1SA 3FHRA 4JQEA 3HRBA 3AC4A 1PXNA 3BU5A 3R02A 3R7OA 2Y4IC 3I6UA 4D5KA 4MTAA 3BL9A 4UMPA 3NUAA 2XK6A 4H39A 4FOCA 4QYEA 5M55A 2WELA 4U8ZA 4OTWA 2QHNA 3FLYA 2REIA 4FG9A 4HNFA 4QT1A 4H1JA 4XV9A 3HDMA 3SXFA 4TNBA 1M7QA 1YOJA 1Q99A 2PMNX 4DN5A 4IFCA 2QURA 4QD6A 4QP9A 5K5XA 5CXZA 4AZTA 2F7EE 2PMIA 4X2JA 2R3KA 3FXXA 3OFMA 2W1EA 4GG7A 4DFBA 3LVPA 5IA0A 5HTIA 3RHKA 2DWBA 2YIRA 2WMVA 2PYWA 3CCNA 2AQXA 3I5ZA 2C6MA 2A0CX 4AGUA 3EN4A 3Q3BA 4G5JA 1Q24A 4IBMA 4O1PA 5JH6A 2WMWA 2X7GA 5IQAA 4G9RA 2C30A 3O23A 5CU2A 2YLEA 4NM5A 4LV7A 4HGTA 2YM4A 4DFUA 3COIA 3DKCA 4QEBA 4M8TA 4Z3VA 1Q8YA 2QOLA 1ZMUA 3W0OA 4XV2A 5T6KA 3QGWA 5L2IA 5TKDA 3OCBA 3MW1A 2IG7A 1Q3DA 1R0PA 2JDVA 2XKEA 1YXTA 2QKWB 4U42A 4YSMA 2JDSA 4EHGA 2C5XA 4QTAA 4IANA 3IGGA 2WHBA 4J7BA 3V5LA 1XBBA 5HU3A 1W8CA 1K2PA 2PTKA 2EU9A 4WA9A 4CRLA 1PYEA 2O2UA 4MBLA 4RJ7A 3S2PA 3ORNA 3UQFA 5FDPA 4OAVB 2WAJA 5AWMA 4TTHB 4FV5A 1U46A 3QD4A 4H3PA 4KIPA 3VN9A 3VUKA 3WBLA 5A4QA 4BDKA 3U6JA 2OSCA 4WSYA 2YCQA 3A8XA 3C1XA 3NR9A 5IQDA 1JPAA 2BILB 4BI2A 2VGOA 5EM7A 5IU2A 4FEWA 3DNEA 4EOLA 3CGFA 3C4XA 3CD3A 2EB2A 1K9AA 4FTIA 4I1ZA 4KBKA 5AR5A 2CMWA 3OBGA 4YZNA 2IEWA 3BZ3A 3FL4A 3LM0A 4GS6A 2PK9A 3QLGA 2HY81 4PMMA 4WUNA 4UV0A 2LAVA 4HCUA 3W33A 3ZM4A 4LRMA 3EFJA 4DGMA 1YKRA 4WNMA 2E9PA 3GEQA 3NW6A 3QKMA 4LUEA 3IW6A 4PPAA 4CNHA 3ZO3A 4PDYA 5AR4A 4KBAA 4M15A 4BGHA 2FSMX 3FQSA 4JJRA 4DH3A 4JBVA 4IWPA 4X21A 3G6GA 3VVHA 3E63A 3CC6A 2CNUA 3ZH8A 3ID6C 1VYWA 4EQUA 5F20A 4QMQA 4S31A 5A6OA 3EQPA 4X7QA 5AP6A 3HMOA 4F70A 1OZ1A 2VWBA 4W8EA 4E5BA 1PKDA 4GT3A 2NRUA 2CJMA 4IADA 5TR6A 1GZKA 3RPYA 4I5MA 5H9BA 2BALA 4ZSAA 5JFVA 1OKZA 2EB3A 5EOBA 5K3YA 3T8OA 5EH0A 4OTGA 4IXPA 4BI1A 2XJ1A 2OH0E 1WFCA 1ZWSA 5L6WL 5E7RA 2VWIA 3MV5A 5AJQA 3MJ2A 2WMBA 5J9LA 2UZOA 4RLLA 3M2WA 1ZXEA 3JYAA 4K33A 3LXKA 4AW2A 4I94A 4ENYA 2JIVA 4IM2A 3FUPA 2BHHA 2OJFE 3HECA 4XG9A 4LRKA 1Q41A 3G33A 4J52A 4FL1A 3W2CA 5HNIX 5IEVA 3NLBA 3L9MA 3AMBA 4P4CA 3LQ8A 3I60A 3OBJA 3BV3A 5ANEA 1OB3A 5B2KA 3OWPA 4XRLA 4B6LA 4EH8A 2GNHA 2XIZA 4MYGA 5HBHA 4QP1A 5HTBA 3SVVA 3UQGA 2HELA 4HYHA 4E4MA 4DITA 1JWHA 4PL5A 5D9HA 2CLQA 4JLCA 4EWHA 1YHVA 4MNEA 2XIXA 4MK0A 5EYKA 4ZTHA 3VC4A 4FRFA 1DAWA 2UZLA 4ID7A 5ANDA 5D41A 5L2WA 2WGJA 4LOPA 4RBLA 5HHWA 5F95A 4EOJA 3FL5A 5HE1A 5CAOA 5JFWA 4QMVA 3ZTXA 3PLAE 2J2IB 2WTCA 5EW9A 4FE2A 3ORTA 2XCKA 2I0HA 2UZDA 3FXWA 4XBRA 1IR3A 4B9DA 2C5VA 2YEXA 4O96A 4ITIA 3SDJA 1H28A 2ZB0A 1S9JA 5CNOA 4DCAA 5B2MA 3ZXZA 4XHKB 5GJFA 5ACKA 3SV0A 2J0LA 4EK8A 5CF8A 2J5FA 2QVSE 1FQ1B 4WIHA 1J3HA 3WF9A 1YXSA 2GS7A 4HJOA 3SRVB 1PKGA 1R0EA 3FV8A 2JD5A 3DB8A 4ITHA 4FNXA 2OK1A 5FEQA 4PUZA 3OG7A 2ZV8A 4AQKA 5AM7A 5LWMA 3FI8A 2FYSA 3FMMA 3KGAA 2W1CA 5CTPA 5FTOA 3EH9A 4QMYA 5M51A 4DAWA 3OWJA 2ZV7A 5KNJA 2BDWA 2W5AA 3FZOA 5DE2A 4CZUA 3ITZA 4CFUA 4EHVA 3A99A 2FVDA 3MFUA 1L8TA 3NDMA 3E5AA 4LM5A 4O0WA 2CKPA 3O8PA 3UIMA 3UNJA 3C4WA 3UVRA 4ZTMA 2BRHA 3BEGA 4P90A 5EQPA 1BKXA 1M2QA 3CP9A 4MX9A 3O8UA 4D58A 2UZNA 4XMOA 5CU0A 4O7NA 5BQ0A 1YWNA 3Q9YA 5HOAA 4F08A 2C6EA 1KSWA 4CFNA 3MFRA 3W0NA 4HYSA 2IPXA 1SMHA 2OZOA 3FE3A 4KWPA 5DT4A 5HCZA 4DGOA 5C1QB 4JDIA 4DA5A 3VBQA 1Y91A 2WQMA 3GC0A 3FLSA 4C57A 5I9VA 2BRNA 4CG9A 4F65A 4DEHA 3RPSA 4C58A 2OJJA 3FWQA 3R1YA 2BAJA 4LMUA 3C4ZA 3V8WA 4IMYA 4UXLA 2E2BA 3O17A 2B55A 4YC8A 3R83A 1E1VA 1T45A 3D2IA 3D5WA 4DTBA 4D9TA 3S0OA 4HPUE 4DHIB 5AA8A 2IVSA 4WBOA 3T9TA 4MWIA 2B54A 2Y4IB 4AOTA 3F5XA 3LFQA 4PTCA 4FNWA 4J8NA 3TDWA 3EQHA 4UB7A 3KRLA 4RMZA 4NW6A 2NO3A 3JY9A 1YW2A 5HIDA 5CI6A 3QBNA 1OL2A 3MS9A 3NYXA 4RZWA 4FI1A 4S30A 4FJVA 3LW0A 4X6RA 3KXZA 1GZNA 4N6ZA 4RIWA 4TPTA 4ANOA 4BJJB 3CQWA 3NCGA 2Z7SA 5EDQA 4OAUC 3KREA 3RZBA 3N51A 1ZYLA 2I6LA 4BB4A 2WNTA 3MH1A 5ICPA 3TNWA 2OIQA 3OMVA 2XM8A 3ZRMA 4E6QA 4F9AA 2GHMA 2XM9A 5HU9A 2VU3A 1LP4A 4LOOA 3MY5A 3U8WA 2I0VA 3CE3A 4FNYA 4RFMA 2ZMCA 4OTFA 5LARA 5LCJA 2QG7A 3N4UA 2XYNA 2XJ2A 1FPUA 1YDSE 3UMXA 3DTWA 4CMTA 2BAQA 3MN3A 1STCE 4UYNA 4YBJA 5EQYA 4YO4A 1YQJA 2PWLA 2BCJA 5LMKC 4FMQA 4JDJA 4D2PA 3GXLA 1FVVA 3F9NA 3RVGA 4NL0A 3EQGA 2ETMA 4G9CA 3AXWA 3PVWA 2QCSA 4QDEA 2ZVAA 3QZIA 4Y8DA 4BYIA 2YIYA 3ZLXA 3W0SA 4PV0A 4F63A 3IOKA 4AN2A 3VRYA 2ITXA 3NUNA 3ZO2A 3RKBA 3PXFA 2X7FA 3QTZA 4O7SA 3LFSA 1XWSA 2NPQA 4ZTQA 2R3MA 3TNPC 3ZFXA 4QQ5A 4D4YA 4FKTA 4JI9A 4NWMA 4KS7A 1SZMA 4ENXA 2VTQA 4O4BB 5E8WA 1FMOE 3MVMA 2FB8A 3ZLSA 1UNLA 3II5A 5LMAA 4FG7A 5TO8A 3D14A 2Z2WA 3DJ6A 5J7BA 4LFIA 3ZZEA 1PJKA 3KK9A 1O9UA 1P4FA 3KRRA 4FKVA 5HE3A 2O8YA 5TOZA 2W06A 4G5PA 3F66A 4ZZNA 4FT9A 4RIOA 5LQFA 3PRFA 4G3CA 2IF8A 4I4EA 4YGAA 4OBQA 4AA0A 4A07A 3RCJA 5HO8A 1IAJA 4DINA 3VS4A 1M7NA 4L3PA 2PVJA 3RK7A 5HE2A 3QTSA 3GU4A 4GW8A 5HBEA 3BHVA 5BVNA 2PPQA 2WPAA 5H2UA 4Y85A 1Z5MA 4QQCA 1OKWA 4P5ZA 5KMOA 2ITYA 1BYGA 3PXKA 1J7IA 3UQCA 4FSNA 1H8FA 2G1TA 4KA3A 4BBEA 4ZJVA 4OT5A 2XF0A 3R2BA 3Q60A 2HZIA 3TZ8A 1KOBA 1FGIA 4AACA 4AGWA 5BVFA 4O7WA 4B0GA 3BL7A 4U7ZA 4O2ZA 5IQHA 2OO8X 1JSUA 4A4LA 1FGKA 4FIIA 5BUJA 3V6SA 4AA5A 4E7WA 3NMUF 1U4DA 1YI3A 3TN8A 4EOMA 1OM1A 3SKCA 1UU8A 4LGDA 4F0GA 3ACJA 4GFGA 4YJQA 2JEDA 4Y95A 4BHZA 4C4GA 2X9FA 2VZ6A 1ZMVA 1E1XA 3MDYA 3NNXA 4I6LA 2QO2A 4L9IA 3AOXA 4JXFA 4IJ9A 4D5HA 4AZVA 3E64A 4CFXA 2JDRA 4LGGA 3BYMA 3CJFA 5EFQA 3A4PA 5EKNA 1VJYA 2VTRA 5BPYA 2AYPA 3Q4UA 4W4XA 1V1KA 4TYIA 2ONLA 4RIXA 4RRVA 3I5NA 4FSWA 3EFKA 3VS2A 2R3RA 3WF6A 5HIBA 4IB5A 4AOJA 2NP8A 3FMEA 2IN6A 1DM2A 4C3PA 5CF6A 1APME 3C50A 4R3RA 4K6ZA 5FM3A 1J1CA 3PE1A 4YSJA 2VUWA 3VW6A 5JGAA 4ALWA 3L8VA 4QMTA 1M52A 2GNLA 2WQBA 4AWIA 3LFCA 4KB8A 2ACXA 1W2FA 3RNYA 1XQZA 4I0RA 4DT9A 2XK3A 4AG8A 3UNZA 4IZ5A 4IACA 4AXCA 4F6UA 5AP1A 4P7EA 4E20A 4ANSA 1NVSA 5J5TA 4CMOA 3S1HA 3DT1A 4IVAA 3GC7A 3VS6A 4I21A 3PZEA 3Q9WA 2YIXA 3ZSIA 5C8NA 4J96A 3S00A 1BI8A 3UZRA 2UW8A 3OCSA 3QQLA 2W4KA 4RA5A 3FSFA 2PMOX 2XUUA 4NJDA 5EYCA 3TNIA 3DU8A 3OW3A 4K8AA 4L6QA 4EK5A 1VEBA 3FI3A 3UNKA 2VV9A 2Y8OA 4KABA 4YLLA 3R9HA 2EWAA 2BIYA 2X6EA 3ORZA 1CSNA 5IQGA 4F9CA 3TL8A 1H1QA 3F61A 4XYFA 1OL5A 4HNIA 3LCTA 4IWDA 3CQUA 4Z9LA 2HZ0A 1TZDA 4RVKA 2B7AA 4O7ZA 1SNXA 3FPQA 2ZMDA 1CKJA 4H1MA 4NFNA 2CSNA 5CLPA 2C6TA 5E8UA 3MIYA 4RJ8A 2GFSA 1PYXA 4L43A 4AX8A 3ZUVA 2C6DA 3OEZA 1XH5A 3RK5A 1S9IA 2BZKB 4GCJA 4G3DA 4D1ZA 4EZ5A 2UZTA 2X4ZA 3R7UA 3KL8A 5CEOA 3G9LX 3GP0A 3O50A 4QP3A 2C6IA 3EOCA 4FNZA 4U80A 4ARKA 4BWKA 4JX7A 4TZRA 4NIFA 1XMLA 4YZMA 4CQEA 4YURA 3OD6X 4FA2A 3F7WA 4DHZA 3R7IA 5KBQA 3DAJA 4BCHA 3BHTA 3F2RA 4H05A 2BKZA 2V7AA 4QO9A 3HYHA 2QLUA 3BBWA 4BL1A 5CALA 1J91A 2QD9A 4FVQA 3HUBA 3SG9A 4DDIA 2BMCA 2W1ZA 4MXOA 3Q2MA 3MI9A 5J79A 4G2FA 2OBJA 3PY1A 2OFUA 5AUVA 1OIUA 2GQSA 5DGZA 4MF0A 1H24A 3JS2A 2VTIA 2UW3A 2VN9A 2XBAA 3IDBA 4JIKA 4OW8A 5HG8A 3VIDA 3QF9A 2WO6A 3W0PA 2JIIA 1F0QA 1OGUA 1G8KA 3C4EA 3PVGA 4UZHA 2G01A 3BU3A 5JFSA 4QMOA 4D4VA 3OY3A 3VBTA 4FV6A 4EH5A 3RM7A 3V51A 3HVCA 1WVXA 1CKIA 3FZTA 3R1QA 5FDXA 4O6EA 2RF9A 4CLJA 3MWUA 3DK7A 3UDBA 3HZTA 2B52A 2W4JA 4MXYA 4C02A 5IDNA 3SG8A 4BIDA 5E8VA 4JL9A 4U43A 4CTCA 3DBEA 4O4FA 3ZLWA 2HENA 3LFNA 2YM8A 4TWOA 4G6LA 3DY7A 4QMLA 4JMQA 4ANBA 5EDRA 4I92A 2PUUA 3CPCA 2KULA 4BCMA 4I6BA 4EH9A 3QALE 3FHIA 2R3JA 2XVDA 2B9FA 4K11A 2X2MA 4BF2A 1M17A 2JAVA 2Y7JA 3R7EA 4AW5A 3VBWA 1B38A 2R0IA 4RG0A 5EHOA 2GMXA 4RJ3A 5D12A 1G3NA 4C35A 3IDCA 5IMEA 4KUJA 3QUDA 4E3CA 2OG8A 4FZDB 2Z02A 1P2AA 3PSDA 4U45A 2WTKB 5E8TA 3SOAA 3DBCA 5IMXA 3OOMA 3QTQA 4O38A 2HWOA 4B7TA 1LR4A 3EB0A 3D5VA 4N6YA 2YZLA 5IA3A 1PMUA 2Z60A 3R6XA 4DE4A 1WBVA 4WNKA 4M68A 1GZ8A 4KIOA 2C6LA 5L8KA 1PMVA 2ZOQA 4CFMA 3DKFA 4ONAA 5EM6A 4I23A 4NYEA 2R7IA 2AC3A 3TNQB 1UKIA 1V0PA 3L9PA 2BTSA 4AS0A 2C0OA 1OPLA 2BRBA 2XNEA 3PXZA 4QMMA 3H30A 1SVHA 1EH4A 4F9BA 3QTUA 5I9WA 3BYUA 3GOPA 1GIHA 3TV7A 4U97A 2QNJA 4FTUA 4AT3A 4D28A 3BLRA 2GS2A 3W1FA 5DEYA 4KRCA 4BBMA 1XBAA 5IPJA 3MESA 3COMA 5CF4A 4XNEA 3BRBA 4XP0A 3QRKA 1PHKA 4CCBA 4V05A 3WYXA 2X2LA 2UVXA 4MCVA 3TIYA 2HXQA 3U4WA 5IQEA 2OWBA 3U51A 4TT7A 4TL0A 5HKMA 1WBNA 2JGZA 5CEIA 2UW6A 5HVYA 4MEDA 4RC4A 3P7CA 2ZM1A 4MQ2A 2GFCA 4M66A 3TCPA 5GJDA 4C34A 4L01A 2R3HA 4AZFA 2J0JA 4HGEA 5AV3A 2I1MA 1PXJA 3PY0A 4A4OA 5HBJA 2QU6A 2BAKA 4FYOA 2O0UA 4WKQA 3MB7A 4AT4A 5ETAA 1YWRA 1JKKA 4IDVA 2V62A 4FTJA 3EWHA 3SC1A 5CSVA 3DBQA 2OF2A 5T68A 3QQFA 3P7AA 3MA3A 3Q5IA 4GFMA 4NTTA 4O22A 4U3YA 4Y46A 5FD2A 5KMMA 2OH4A 3DZOA 3DXQA 4EUTA 5HGIA 4BFMA 4ZSGA 1FVRA 3KMMA 3OXIA 4L8MA 4XEYA 1IA9A 3U6HA 4FTLA 4QMPA 2QONA 5FBNC 4BKJA 5GHVA 2JKKA 4UMQA 4LYNA 5EI2A 4DF3A 3KIOC 4FVRA 5HEZA 2HZ4A 4HVHA 5HG7A 3M1SA 2ERZE 1JBPE 4K1BA 4O4EA 3R7GA 4ZMFA 2GU8A 3HMPA 2C6KA 2XIYA 3TKHA 4HVDA 5IDPA 2JITA 4BDEA 3E7VA 4FTRA 3RJCA 2VNYA 4AN3A 5DT3A 1PMEA 2DUVA 3FZSA 4QQJA 2RIOA 3MBLA 4GIHA 2P2IA 2H8HA 3OVVA 5HO7A 4BCQA 1ZOEA 4ZSLA 5EDPA 5BVEA 1DI8A 2A19B 2CN8A 4WG5A 3LXLA 4F9YA 3TJCA 2GPHA 3REPA 3OP5A 1JNKA 2ITTA 4MD9E 4B8MA 2XNNA 2YERA 4BCGA 2J0KA 2J51A 3AMAA 1ZY4A 2IZTA 2VX3A 4HOKA 4WNOA 3S95A 5IQCA 2PSQA 2Y0AA 4GJ2A 4YPDA 3TYKA 2C5NA 2YAKA 4IHPA 3SX9A 4O21A 3ZONA 1TKIA 2HK5A 3UO5A 4O7LA 5DWRA 4KBCA 5HD4A 2FA2A 1IEPA 4JR7A 3V01A 3Q2JA 2PULA 3BGZA 3KXHA 5FP6A 4JVGA 4I6HA 4I6QA 1H0VA 4YTHA 3S3IA 4ZTRA 4A9TA 4FG8A 4D2SA 5FG8A 3P9JA 3LE6A 1GZOA 2XIRA 4PDSA 4DBNA 2ETKA 3BCEA 5LVMA 5DLSA 4DH8A 4FEQA 3A62A 3OCTA 4ZSEA 5T3QA 4IAZA 4J99A 1KE8A 4K9YA 3ZEWA 3CGOA 1R39A 5KE0A 3ODZX 3NZ0A 5HG9A 3ZC6A 4FBXA 3BE2A 4BHNA 1ST0A 4M3QA 4RIYB 4ANQA 5E8XA 4EK6A 3N4VA 1ST4A 4PTGA 4HZSA 3GC9A 4IB1A 5FXQA 2CCHA 1JOWB 3VUGA 5KUPA 3TDVA 4FKSA 1YI4A 4ZOGA 5K5NA 5A4TA 3PPJA 2Q83A 3AGLA 4AW0A 4W9XA 5LVPA 5JK3A 2W7XA 3VBVA 5AV4A 5DEWA 2WMTA 3LMIA 4RWIA 2VWVA 4Y5QA 3ZUTA 2GCDA 1YOLA 5AR8A 3UG1A 4USEA 5GIOE 1RJBA 4MBIA 3R2YA 4NKSA 3HUCA 3HA8A 4C37A 3Q9ZA 4EH3A 2X7OA 4R1YA 3V5QA 4RX5A 5JEBA 5L6OA 4UWCA 4IC7A 3Q5ZA 1ATPE 4FICA 3SRVA 4X2GA 3ALNA 3QC4A 5J87A 4CSVA 2XYUA 3PVBA 4AXEA 3TIZA 4ASEA 3AQVA 4QMSA 4NZWB 1PF8A 3IG7A 2YITA 1ZOGA 4MKCA 3P0MA 3ZC5A 1G8SA 4GG5A 5JFXA 4JOAA 4FEVA 3PWYA 3OUNB 5BMSA 5L8LA 3IW7A 4USDA 4DEDA 3IQ7A 5H8EA 3QYWA 4O0YA 3UIXA 1YI6A 2ZYBA 4AFEA 1A9UA 4DYMA 4AOIA 3AT3A 2G9XA 1XKKA 1JLUE 4WUAA 3OF0A 4MQ1A 4JG6A 5AP4A 4FTNA 5FEDA 5IG1A 3QXOA 1JAMA 4X3FC 3KXNA 4HVSA 3GB2A 4RGJA 3CD8A 2E9UA 4K0YA 4Q9ZA 4W4VA 4E4LA 4XG2A 1PW2A 2WTIA 4PDOA 4ACGA 5M09A 1OMWA 2WMQA 2FSOX 3W2OA 3W2PA 3DBFA 3HV6A 3NUUA 1OPKA 4L42A 4P2KA 1HCLA 4GJ3A 2XAOA 4G31A