4HGLA

Crystal structure of ck1g3 with compound 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
302
structure length
302
Chain Sequence
GSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase I isoform gamma-3
publication title Structure-Based Design of Potent and Selective CK1 gamma Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 302
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hglA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hglA01
1DI8A 2WZJA 5J9YA 2WTWA 3NIZA 2B52A 1ZYSA 1XWSA 3LFEA 3S4QA 4CZTA 3GGFA 2PZIA 4GL9A 4FV0A 3DNDA 4JBPA 5AADA 3ZS5A 3R2BA 3LZBA 3BKBA 3R2YA 2HW6A 5HNBA 3MSSA 4E5BA 2W96B 4MNEA 4F6SA 1OZ1A 3DJ6A 3HMMA 4KWPA 4F7JA 3MPMA 3OXZA 4DG2E 3W2RA 5L3AA 3CCNA 3TKUA 3U4WA 2BRBA 5DE2A 4ZY4A 4YLJA 4FUYA 1XH6A 4FG8A 4B8MA 4UYAA 2UW7A 2AYPA 4ANBA 1BKXA 2OBJA 2OU7A 4R78A 2QLUA 3F61A 5EHYA 3CKXA 4F1MA 1U5QA 1OBGA 4FUXA 2J2IB 2JKMA 3KKVA 3UIXA 1E1VA 1Y8GA 4EWHA 4IWQA 3BLQA 3NPCA 4HGSA 3HYHA 1SVHA 4JG7A 2IZTA 2WMWA 3R7EA 4BCOA 2ITXA 3I4BA 2WTJA 3QTQA 3NAYA 2JDSA 4O86A 5AR5A 4FNWA 4QNYA 5BVEA 5G6VA 4L01A 1KWPA 4MNFA 5CU4A 1JSVA 5IZFA 3W2CA 2A4LA 3DBFA 2W5HA 3IDPA 4R77A 2UZUE 3UC3A 4F70A 3RAWA 3JUHA 2X39A 4ACHA 2F2CB 4ACGA 3S1HA 5KO1A 3ACJA 4LUEA 3LXNA 2G2IA 2J0KA 2ZDTA 3DBEA 5I5ZA 2CKPA 3R7GA 3NUXA 4AUAA 2HW7A 2PZRA 2XJ0A 4X6QC 5HE1A 4II5A 4EL9A 3QQLA 3E3PA 4UWCA 5C8MA 3CR0A 2J0MB 2FH9A 4ZTHA 3FPQA 4EOSA 2V55A 2OWBA 4FG9A 5J7BA 5IUIA 2FA2A 3IW6A 4PV0A 3HA6A 4HYSA 2YERA 4FTKA 3UIMA 4YLKA 3RCJA 2GHLA 1L3RE 3ZRKA 5EYMA 2AUHA 2YCRA 5DG5A 3ZYAA 3SG9A 2ERKA 5AJQA 2AC3A 2JD5A 4I5PA 4QQCA 4FICA 2XF0A 5F95A 3FSFA 1Z57A 4FL1A 4V0GA 5HVYA 3VS3A 3WYXA 1V0OA 5CI7A 4UXLA 2C5VA 4M12A 1IG1A 4ENYA 4DF3A 2PZ5A 5DN3A 3IOPA 2YM3A 1GZKA 4Y83A 2Y4IC 4DC2A 2BDJA 5KZ0A 3KCFA 4BICA 1G8SA 2WFYA 5BNJA 3AC8A 3NLBA 5I9XA 3I5NA 3BE2A 2X2KA 2Z7SA 1ND4A 3MJ2A 3ULZA 2CN8A 5CAQA 3HA8A 1G3NA 3KXHA 2UW8A 3KULB 3PVWA 2BZJA 3DAKA 3SC1A 4PF4A 4OBQA 3CTHA 4MQ1A 1PXIA 3QCQA 2FB8A 3P86A 1EH4A 1OL5A 1XQZA 2HYYA 4FEQA 1SM2A 5JQ8A 4CMTA 4HCVA 4M66A 5KUPA 5HIDA 3MY5A 2J50A 4DG3E 5AP1A 5HIBA 3EYHA 3LJ0A 4ZZMA 4FT0A 4I5CA 4XG6A 3HVCA 5HD4A 3NR9A 2QG5A 1IA8A 2FGIA 2XJ2A 3EZRA 3QX4A 2BMCA 5AR7A 2X8IA 2BFYA 4J97A 5CAPA 5K0XA 4BI0A 4UN0C 2ITTA 4YTFA 4C4JA 3RNYA 5LCJA 1TKIA 2HWOA 3FC2A 3FXXA 1M2RA 4PNKA 5JFSA 2YCFA 1WCCA 1PY5A 4DINA 2BALA 3G0EA 4WT6A 1YWNA 4TN6A 5F94A 4LL0A 4QMWA 4H05A 2R3NA 4C57A 4PMPA 4DEIA 5CF4A 4GSBA 4HOKA 4F9BA 4ITIA 5E1EA 1QL6A 3L9MA 5EQPA 2X7OA 4AU8A 3WI6A 4WNPA 2YN8A 4FV1A 4UZDA 4YJUA 3UO5A 4AE6A 4GT5A 3A4OX 3A7GA 1JKTA 3ZO4A 3QZFA 2RG5A 2VTQA 5BVWA 4C8BA 2XIXA 3DQXA 4NU1A 4ZSJA 3LQ3A 5T68A 4ZSGA 2OZOA 5AP3A 1WFCA 2V62A 4KIPA 4QTBA 5IF1A 1QPEA 3W2OA 3WARA 5HO6A 4BCIA 4NUSA 3I1AA 1JKLA 3WYYA 3ZLXA 4O7NA 4BI2A 4RJ7A 2WEVA 3B2TA 3FMDA 3FYJX 3D5UA 5GHVA 1Q3WA 4TWPA 3Q4UA 2Y6OA 4V0GB 1ZMWA 3IQ7A 3PIYA 4GFOA 5LVNA 4IM2A 1HOWA 4NFNA 4J53A 3R9NA 4K2RA 5A3XA 3TI1A 5ANKA 5HNIX 4BGGA 4DE4A 2DUVA 4C3FA 2B54A 4X3JA 2VO3A 3UOHA 2V5QA 3JPVA 3VS0A 4A9RA 3TT0A 3CKWA 2OJGA 2PULA 5HI2A 4FV7A 5D12A 2I0YA 4BI1A 3FQSA 3BIZA 1OL1A 1UWJA 4KD1A 4LGHA 3TKHA 2GS7A 3CPBA 3RPYA 4O84A 4IWOA 4DH3A 5C4LA 5ETFA 1PF8A 4XOYA 2PZYA 4AZEA 4O7RA 1H0WA 1MRVA 1XJDA 3FMEA 3PY3A 4FSQA 4N6YA 4PP9A 1PXPA 3D14A 4FTIA 4MXCA 4MQ2A 2ETKA 4IVBA 3BLRA 5CT0A 3NUYA 4FKOA 1M7NA 3VS6A 1F0QA 4S2ZA 4KRCA 5KHXA 4F63A 3BV2A 3ID6C 4M69B 4PTGA 3ATSA 3MVJA 5FD2A 4PTCA 2X4FA 4OT6A 4E73A 4BF2A 4WKQA 4BDDA 4O7LA 4F09A 3OCBA 5AUVA 3TCPA 2QVSE 2JAVA 4FIEA 3H9OA 5DFPA 3GOPA 2QU6A 4E4MA 1NW1A 3UZRA 4YZ9A 1WBNA 4Z7GA 4KNBA 2IO6A 2ZM3A 2CCIA 3VBTA 4DFYA 3NW5A 4JT3A 4EC8A 4NTTA 3PG3A 5DOSA 3V04A 4EK8A 2IVTA 3NYXA 1PKDA 4Y5HA 3E5AA 5CEIA 2ITWA 3SXRA 2UZBA 5LCKA 4EOKA 4RIYA 4W4WA 2WU7A 4O0RA 4AN3A 2H34A 3IECA 5HG9A 2QO2A 2PMLX 1FGIA 3GUBA 4NSTA 2UW5A 3VBYA 3MA6A 4BCFA 4YO6A 3G2FA 5ETIA 4AP7A 5ITAA 2HZ4A 2CMWA 2R3RA 2XBJA 3PJ1A 4QMUA 4XV1A 4QNAA 3G51A 3UNKA 2GQSA 4K8AA 3PRFA 2OXDA 3EQDA 4ZZNA 3DBQA 3MFTA 3LXLA 3BYSA 2VTMA 3W8LA 4QMZA 3HGKA 2ZV7A 5DWRA 3WBLA 3R28A 3IOKA 2R3OA 3QL8A 2XRUA 4XRLA 4C7TA 4EKLA 4HCTA 3C9WA 4ASXA 4LOPA 4TRLA 3NUSA 1H4LA 3R9HA 4RC4A 5AP0A 5KZIA 2WTKC 4TT7A 2X8DA 5J9ZA 2WQNA 3R6XA 3V51A 4F1OA 5LQFA 3DZQA 1ZWSA 3NWWA 5EW8A 5BUJA 4A9TA 5CQUA 3QZIA 3MH0A 4PRJA 1J3HA 5IDPA 1DM2A 5BVDA 2BZKB 4Q2AA 3ORMA 2O8YA 3LFCA 5F9EA 1JQHA 4FZ7A 4JDHA 4QMMA 4BDIA 3AD6A 3R8LA 1W8CA 3ITZA 1ZY5A 2FSTX 4RVTA 4AZSA 3W32A 1SMHA 3PIXA 5K3YA 4HVIA 3SW7A 2W1EA 2B9FA 2IW9A 2QO7A 3EFKA 1FMOE 3BELA 4GVAA 5HQ0A 4IAIA 5E90A 5FEQA 2XK3A 5C9CA 1CM8A 2EB2A 1OPLA 2GS6A 2J90A 4M7IA 4F0IA 1OKVA 3TV4A 4Z16A 5IA4A 2UW6A 3MA3A 4UEUA 4G9CA 3ZLYA 2A0CX 3NUPA 4AAAA 3GB2A 4QP3A 2JDOA 3R71A 4ZAUA 5BYZA 3PJCA 4FTCA 1APME 3NYNA 2IG7A 5EYDA 4WUNA 3G90X 3EFWA 5HE2A 1UNGA 3FKNA 5HGIA 2WMSA 4JIKA 4BKZA 4BCMA 3EKNA 2Z02A 1OPJA 2XK7A 4LFIA 4J52A 2CGWA 3IKAA 4RX5A 2B1PA 1H1PA 3R1NA 3MFUA 1WVYA 4FSMA 1JAMA 4GYGA 4QMTA 2ZM1A 2QLQA 3FDNA 1CKJA 3ZHPC 2J5EA 4EOMA 4USDA 4L53A 4QP6A 2B0QA 3TDVA 4QTCA 2C3IB 5IUGA 4ANNA 4TYJA 3MFSA 5AUWA 2Q83A 2CDZA 3DJ5A 3EQHA 3LMGA 2W1GA 3MVHA 3Q9WA 3QQGA 4RFZA 3THBA 4CRLA 3KL8A 3A7JA 4OTFA 2VO0A 4U7ZA 4WOVA 5F4NA 5L6OA 5FDXA 2X6DA 1ZY4A 4NL0A 2J6MA 4QPAA 2VWIA 4KA3A 1M2QA 3G6HA 4IXPA 4UZHA 4M84A 4IX4A 4RGJA 1OIQA 1H25A 2UVYA 4IC8A 2WMAA 4Z9LA 1WAKA 3GU7A 4F08A 1NXKA 1H0VA 1OKWA 3GC9A 3QUPA 1QCFA 3LIJA 5FG8A 3VUMA 5HBJA 2CNUA 1YXVA 5AV3A 2PL0A 4AXAA 3HLLA 4I4FA 4IM0A 2PVYA 4CKJA 2EXCX 3LOKA 3TNIA 3ET7A 3WE4A 3PDTA 4O38A 4E3CA 3HZTA 3UOLA 3IONA 2GHMA 1OB3A 3KVXA 4UV0A 5FP6A 4HYUA 5I4NA 4K33A 3RNIA 1OGUA 1XBAA 5CSHA 5CXHA 4O0VA 4NJDA 3SQQA 5EQEA 5HVJA 2XM8A 3AC3A 3KCKA 4DH5A 1E9HA 4FF8A 2R64A 3SHEA 4ZTRA 2JIIA 3G0FA 3DGKA 3RVGA 4ALUA 3P7CA 4JDIA 5EHLA 5AR2A 3EHAA 4FKUA 3R8ZA 2YAKA 4JBOA 3AC5A 3ENHA 4W8DA 4R7HA 2NNWB 4W9XA 1GOLA 3TV7A 2BHHA 4DEGA 2C5NA 4RX9A 4TYHB 4Q5HA 3QYZA 3R22A 4L43A 4PPCA 3UNZA 1W0XC 3B2WA 4JQ7A 4BTMA 5IMXA 5JH6A 3OEFX 3ALOA 5AR3A 3D5VA 3QD0A 1VYZA 1P4FA 3C50A 4PNIA 4KRDA 2ITQA 5DEWA 2WELA 5LXMA 4D58A 3WZKA 3CQEA 2CLXA 4EONA 4FEUA 1FGKA 3FE3A 3WZDA 2IZUA 4GUBA 4M15A 3PA4A 5A46A 3FLZA 3I6WA 4XLVA 4RC2A 2UW9A 5KE0A 3U4UA 1L8TA 2PE2A 3OWPA 5DI1A 4BCQA 2NP8A 4NKSA 2BVAA 4C61A 2R9SA 4EK6A 4ZTQA 3FHRA 2ITOA 3LFNA 4USEA 5HO7A 5LVOA 3HDMA 4MD7E 4RIWB 4KIKA 1SYKA 2ZOQA 4IDTA 4IVCA 4RG0A 3ZO1A 1NVQA 3VWAA 2J0IA 3KK8A 4HNFA 3SLSA 4BWPA 4AN2A 5JGAA 2YIRA 1PKGA 2IN6A 3DTCA 3KXGA 5HCYA 1NA7A 3MYGA 2E9VA 3O8TA 5HU3A 5IA1A 1M17A 3L1SA 3HV5A 3TZMA 3BHYA 3ELJA 4TY1A 1X8BA 4XV9A 5CSVA 5CEMA 3GP0A 3LCDA 4HPUE 5HBEA 3LCSA 2VZ6A 4BDKA 1YI3A 2CKEA 2YWPA 4I1ZA 5HE3A 4TWOA 3RI1A 3WF6A 2VUWA 3F2NA 3G9LX 2XIRA 4O0WA 5M56A 1YXSA 3HV6A 1OIYA 3IGGA 4YBKA 4FMQA 4OAUC 4GFGA 5CEQA 4WBBB 4XRJA 2QU5A 4BGQA 5CS6A 3WILA 2RKUA 2PVKA 3PXYA 4EH8A 4NM0A 1Q5KA 3BBWA 4IX3A 4D2WA 3OROA 3FY2A 5B2KA 3BZ3A 4O7SA 3QQUA 5JGDA 1T45A 2VRXA 2XRWA 3LQ5A 1YOLA 1YWRA 2VO7A 3O71A 3CIKA 4GG5A 5DRDA 3QKLA 3HMPA 4DFBA 4FV3A 1IAJA 1KV1A 4BKJA 4JS8A 4O7WA 5FWKK 2BRNA 4UB7A 3ZTXA 1WBPA 4G3EA 4YHTA 4G2FA 1UWHA 2YISA 4HNIA 3FLNC 4XBRA 2R4BA 3EL8A 2LAVA 2QR8A 3PFQA 3QF9A 4FT7A 4JR3A 2UUEA 2PVRA 1NVSA 3TN8A 3BGZA 4JOAA 3KC3A 4ZLYA 5EKOA 3OWLA 4D1ZA 5HCXA 2VWUA 3ZC5A 2F7XE 3R8VA 4LRJA 3OS3A 2P2HA 2ETRA 4MXZA 3FLWA 2DYLA 4XG9A 3RBWA 3VHEA 5AX3A 4APCA 4M68A 2VTTA 5EH0A 4CFWA 4PX6A 5JEBA 4DFUA 2DS1A 4EOJA 4R3RA 4IC7A 5BMMA 2BKKA 3W18A 4OUCA 4UYNA 5I9VA 5L6WL 2BAJA 3FZRA 1LPUA 4UY9A 3ZXTA 1MUOA 3F7ZA 3T9IA 3TJCA 3HMIA 4L7FA 4WNMA 5A54A 1BL7A 2G15A 3E8EA 1I09A 4U44A 5DH3A 2I0HA 3CC6A 3W10A 5HLWA 3ORTA 3OUKA 1MRYA 4AACA 5DIAA 5E8TA 3EIDA 4CV8A 1VJYA 4CXAA 4F64A 1LP4A 3DXPA 2QQ7A 3AQVA 3EQPA 4QMOA 5CVHA 4IWDA 4J98A 3R9DA 3W2QA 4S30A 1BUHA 3QC9A 4I94A 2WMBA 2R0UA 2PZPA 3BHVA 4TW9A 4Y72A 2CPKE 4YZNA 5IH6A 4O7TA 5ICPA 4BCHA 4DG0E 3JR1A 1JLUE 4L68A 4FKSA 2J4ZA 3KRLA 2YABA 3F9NA 4AGDA 3O50A 4AGUA 3C7QA 2JDTA 3HV7A 3HEGA 1UVRA 3TL8A 3UQCA 3VUGA 2R3HA 2VTHA 3PXKA 4MAOA 4MF1A 5TKDA 4KKHA 4CQGA 4F1TA 4MX9A 4QMPA 4YLLA 3U87A 2XYNA 3QGWA 4U42A 2B7AA 2KTYA 2WPAA 3E93A 3FQHA 4BN1A 2ACXA 2C6LA 3RWQA 3AGLA 2QODA 5JRSA 4ERKA 4HVDA 4FR4A 3S0OA 4I3ZA 4ZP5A 4G3GA 2ZB0A 3D15A 4EUTA 4HZSA 2HXLA 2OI4X 3PXQA 3MTLA 3TJDA 1XH4A 4FZDB 4YTHA 5CSXA 3W33A 2WB8A 3ORZA 2Z2WA 4BDFA 3BGPA 3PVGA 4WO5A 3RPOA 4BR3A 3HMNA 2OFVA 4YPDA 3SXSA 4G6NA 4BB4A 4CT1A 4FVPA 4G6OA 4RIXA 4D2VA 1NVRA 3PLAE 3CP9A 4QRCA 1A48A 4E4LA 3E8NA 2CGUA 3SV0A 2X7FA 4CFXA 5HNGA 4BC6A 1KUTA 4GVJA 4BDHA 3RPRA 3BLHA 4BHNA 4LRKA 3E7OA 3RPSA 2YM5A 3BGQA 5FP5A 4BBFA 4EZ7A 2E2BA 4GRBA 5CEPA 1FINA 2HCKA 3HAMA 5E8ZA 3VUIA 4IM3A 5HLPA 5CU0A 3OEZA 2IVVA 3S00A 2HOGA 4CV9A 4QQJA 3TUBA 4V04A 3TKIA 2RFNA 5EM7A 1ZYCA 5IH4A 2REIA 2R3QA 5IQGA 3DY7A 3ANRA 3ZONA 3Q32A 4OTQA 1Q24A 3ZLWA 1RW8A 2R7IA 3N4VA 4KB8A 4O83A 4ZTMA 5L4QA 3F3TA 5LMKA 1H28A 2WHBA 4JDKA 2YM6A 2Z7QA 3O2MA 3OT8A 4IW0A 4G5PA 3H0YA 4MH7A 5DEYA 2YHVA 4PL5A 5EFQA 3W55A 3OUNB 1FBNA 3V8TA 4S33A 4AGCA 3NMUF 1XKKA 3FKOA 5E7RA 5L6PA 5KBRA 3R30A 3FI3A 5HLNA 1WVWA 4D9UA 4IHPA 5DA3A 4H3QA 5L2IA 3DV3A 2O65A 1W82A 2O3PA 3GU4A 4EH9A 1RQQA 4X2JA 5D9HA 5FXRA 2R7BA 3N4UA 2JBPA 2FUMA 3KF4A 3WZEA 2UZWE 4RVMA 1PYEA 4KBAA 4FV9A 2PYWA 2GMXA 1GY3A 3I0QA 4K9YA 5B0XA 5HD7A 4WSYA 5IISA 2O64A 3II5A 4AN9A 5EQYA 2PMNX 5IEYA 1STCE 3RK7A 1OL6A 3FBVA 3CTJA 3LHJA 3KRJA 3HX4A 2PU8A 4MD8E 3HP5A 4GT3A 5EI8A 2QOKA 2ERZE 3MIYA 5ANDA 4J8MA 3VUHA 4D0WA 3QWJA 3QRTA 5H2UA 5ETCA 3FI4A 5BVKA 4BFMA 3NX8A 3HRBA 4B99A 5IQHA 3RZBA 5CTPA 3V5WA 4F4PA 4W9WA 5ANEA 3UO4A 4E5AX 5H8EA 1YXXA 4JQEA 3U9CA 3VVHA 4CTCA 2XYUA 3MH3A 5M55A 3PY1A 5A9UA 1UNLA 4RIXB 1H07A 2BR1A 4APPA 4YURA 2OF2A 4CCUA 3R9OA 4FSTA 4RWJA 5BPYA 3TUCA 2HY0A 4O6LA 3WF9A 4E4NA 5HE0A 2QOHA 4XYFA 5BYLA 4ACCA 3C13A 4AZVA 4PDPA 5AMNA 3QZHA 3BE9A 3PSDA 5HOAA 5M4CA 4Q9ZA 4FNXA 3UVRA 3D0EA 3DNEA 3Q3BA 4ONAA 4FSZA 5H8BA 3VJNA 4EYMA 3KXZA 2HIWA 5DLSA 3VW6A 2XBAA 4ITHA 1Y8YA 4L3PA 3P23A 4QPSA 3VS2A 4D4YA 4LGGA 4X2GA 2JC6A 3PJ8A 4EEVA 1Q8YA 2HK5A 5HO8A 2PE1A 2GDOA 3EN5A 4DH1A 4O1OA 3EZVA 5AIRA 4IBMA 2YIQA 4AA4A 5FLFA 3O0GA 3ALNA 4FKQA 3Q4TA 4O27B 4QTDA 1ZYLA 1S9IA 3ZSIA 1GZOA 2CN5A 2CSNA 3BQRA 3COMA 3QHWA 3B8RA 3OC1A 5EW9A 3KFAA 1Q99A 3DFAA 3KMMA 3PG1A 4CCBA 3QTSA 4DGMA 2Y4IB 3C4CA 4FX3A 4KABA 5GZ8A 5LOHA 3V5QA 3OOMA 3HV4A 3OWKA 3R73A 2XKDA 5JT2A 3N51A 2WTVA 3KQ7A 1YRPA 3MFRA 1F5QA 3AC2A 4DTBA 3L8VA 3MS9A 5L8LA 3UDBA 4D55A 2RG6A 2RF9A 3V8WA 1KSWA 2CHLA 4YC8A 5IMEA 2PPQA 2EVAA 2UZLA 1YHWA 4NM5A 4R1YA 1RE8A 5CASA 4N70A 2F9GA 5EW3A 4L3LA 1UV5A 4QMVA 3GXLA 4A7CA 1GAGA 4CD0A 1ZZLA 2W17A 5LMKC 3VO3A 5KMKA 2R0IA 1XBCA 5AM6A 3UMWA 4FEWA 2W4KA 5HTIA 3QUDA 2B55A 5BMSA 3LJ1A 3E62A 4FKLA 4MNEB 4FZ6A 3D2IA 4F9CA 4XS2A 4Z7HA 2F49A 4D2TA 3REPA 2R3LA 2QCSA 1TVOA 1Y6AA 4G5JA 3UMXA 3K5VA 3QD2B 2XCKA 5TE0A 2GCDA 2WEIA 4L00A 4P7EA 5CNNA 1UU9A 1UKIA 1IEPA 2YJRA 4QP1A 4YJNA 2WD1A 3ZBFA 4J96A 4FSUA 2VX3A 2YM4A 4GEOA 2XKCA 3FSKA 4MVFA 4EKKA 3VBVA 1M2PA 3W8QA 1A06A 5L2TA 2JGZA 1TQIA 4R1VA 2OIQA 2QKWB 3G6GA 4AX8A 4J8NA 4GKHA 2W5AA 3HECA 4BHZA 1H27A 2OXXA 4X0MA 4P4CA 4R3PA 4G1WA 3V5JA 4TYIA 2B4SB 2VTAA 2BTRA 3GQLA 3PPKA 2VTSA 4X2FA 4GK2A 4QP2A 3P1AA 4CFUA 3F69A 5CSPA 4G3DA 1H1SA 4JAIA 3W1FA 3BWJA 2XNEA 2Y0AA 1JBPE 3C5UA 3UZTA 2OJIA 3SD0A 2X7GA 4NK9A 4QTEA 4FA2A 2XK4A 4YTIA 4FV6A 4AOIA 4PP7A 5DPVA 3QXPA 4WA9A 2X81A 3AT4A 3L8XA 1QPJA 5CAUA 2YIWA 3U55A 1E1XA 1ZRZA 2QNJA 1URWA 1REKA 1U46A 4D5KA 1JWHA 4RSSA 1H01A 1SNUA 4AW1A 1H1WA 3ZRMA 2R3FA 1RDQE 3D7TA 1HCLA 5EOBA 1R0EA 1P4OA 4GCJA 4I93A 2B9JA 1XH8A 3P0MA 4MHAA 3O17A 1UA2A 4C37A 5FUTA 1V1KA 3RPVA 2B9HA 2H9VA 3DTWA 2VWYA 4HYIA 2RFDA 5J5TA 5M4IA 3FZTA 4D28A 4NCTA 1FOTA 4U79A 2XVDA 2BAKA 4XJ0A 3ORXA 2JLDA 3FXZA 1XH7A 2VNYA 4FIJA 4O91A 5CF8A 3N9XA 4FTNA 4O2ZA 1ZOEA 4F9YA 5A6OA 5A4TA 3I81A 1OI9A 3NNUA 4OBOA 3W16A 3COKA 3E8DA 3QTZA 3SG8A 5FM3A 3IGOA 3DBCA 4YC6A 5K4IA 4OTWA 4BBEA 4U8ZA 4QPMA 3CJGA 5IA0A 1WBWA 2ZMCA 3HL7A 3ACKA 2VO6A 3KEXA 4IB5A 4ZSLA 3OMVA 4JQ8A 3BWFA 4BCGA 4BDCA 4BL1A 4U9AA 2Z7RA 3NW6A 1WBOA 2EUFB 2WMRA 5DHJA 5AM7A 4FVQA 4BZOA 2PHKA 4O1PA 3NUAA 5CZIA 1Z9XA 3Q4CA 4JVGA 1BLXA 3DS6A 3OTVA 3T9TA 2NO3A 3AG9A 4ZJVA 5D11A 5IDNA 2Q0NA 3UQFA 3QCYA 3M42A 4L67A 3Q9ZA 5C01A 4IVDA 5L8JA 3ORLA 1DS5A 3GCUA 4RIOA 3HV3A 5D41A 1WVXA 2C3LA 4O82A 5J9LA 4AW2A 3QX2A 2JIVA 3RMFA 3GFWA 3CEKA 4I6HA 4TXCA 4D4VA 3IDCA 3RHXA 4R7BA 5AFVA 4XG4A 4YJSA 3QKKA 4P5QA 4XV3A 3F5PA 1IRKA 3VNTA 2YJSA 2EB3A 5LVMA 3G15A 1P2AA 3O96A 2OF4A 4HJOA 4BCJA 3OY3A 1Q8WA 2JFMA 3O8UA 3H10A 2OH0E 4RJ8A 4DFZE 4U41A 3UOKA 3RM7A 3WIGA 3UBDA 4NKAA 2WTKB 3MWUA 4UMTA 3A7HA 4O0YA 5GNKA 4LMUA 3PSBA 3QHRA 3DBDA 1FVTA 2PTKA 3OWJA 2CCHA 5HICA 2YCQA 3CY3A 4CFNA 3SOAA 3CPCA 5AR4A 3P79A 4IAYA 4YP8A 2H6DA 4R6VA 2GHGA 4U80A 4V01A 1M52A 4BTJA 4C2VA 4NYEA 4I20A 5C4KA 2GS2A 2FYSA 4U40A 3DA6A 2QD9A 4AZTA 1PXKA 4HZRA 3VUKA 2UW4A 4JX3A 2ITVA 1FVRA 4W4XA 3IW4A 2BCJA 5AA8A 4YJQA 4R7IA 4V05A 3NCGA 4X3FA 5JK3A 4LMNA 4ID7A 3R21A 3QWKA 4D1XA 4MK0A 4N57A 3ZFMA 4ANQA 2WU6A 4RZVA 4CZUA 3KMUA 4R5SA 1Q8ZA 5AV0A 2ESMA 4IAKA 2UZDA 1Y91A 1U54A 2WOTA 4IZ7A 4F7LA 4RX8A 2C1BA 4PWNA 3FZ1A 4YGAA 4FKRA 1K2PA 4I22A 3C4XA 4U0IA 4ZJJA 3TTJA 4DEDA 5E1SA 3LMHA 5EI6A 1OPKA 3PXRA 3QKMA 1CDKA 2YACA 4IACA 2JKQA 4H1MA 3QTUA 4PMTA 1PJKA 4WD5A 2VWBA 2BRHA 2PY3A 4RJ3A 3D83A 1Q3DA 3UNJA 5FM2A 1H00A 3FC1X 4IWPA 3MVMA 4J95A 4EUUA 5JN2A 4JI9A 2A27A 1FMKA 3R1YA 3TWJA 1PXJA 2GU8A 5HG8A 3TV6A 3OVVA 5M51A 3SA0A 3E92A 5J8IA 5G1XA 4QO9A 4KKGA 4NCTC 4UALA 4EORA 1KV2A 2BROA 5D10A 3FLYA 2C0IA 3LLAA 3D4QA 1CKPA 1JSUA 4D2RA 3HDNA 4ZSEA 5JKGA 3LPBA 3QAME 3ZMMA 2WMXA 2JITA 2J7TA 1OECA 3VRYA 4RWLA 3GC7A 3O8PA 2WQBA 5TT7A 2V7OA 4C59A 4CT2A 3LCTA 2C6TA 5J1WA 4ZXTA 3UJGA 2XKEA 4FSWA 3IW8A 3WOWA 3I6UA 3LKMA 3PA5A 1ZMUA 4FBXA 3ZEWA 5ACBC 1H24A 1U5RA 3ZDIA 5BUEA 5FTGA 3DKCA 3R7IA 1XHAA 3DZOA 2C5OA 4C4GA 3IG7A 2G2FA 4DTAA 4ZIMA 4O0XA 1OITA 3DFCB 3AOXA 3VBWA 3CY2A 5GJFA 3V01A 4RIYB 5B2MA 3NGAA 4GU9A 5D7AA 3QZGA 4LG4A 4DBNA 3TIYA 4EOOA 2GTMA 5CEOA 4XG7A 1H1RA 4FKWA 5M09A 3AT2A 2Y6MA 3CQUA 1OUYA 1OVEA 4UXQA 3R8PA 5JZJA 3CD3A 2PVFA 3LW0A 1Q4LA 2W9FB 2XK6A 1Q62A 4E8AA 2ZJWA 4AZFA 3QQJA 4L46A 3EOCA 3KA0A 2KULA 1ERKA 2GPHA 3UIBA 2XNNA 3CGFA 4Q9SA 3MI9A 1R1WA 4QYYA 2QOOA 5DT4A 3JVRA 3MW1A 1MP8A 2E9PA 4QT1A 4CSVA 3F2RA 4DCAA 4PL4A 4GJ2A 2O2UA 4FKTA 1PMNA 2SRCA 4L9IA 5LVLA 3UZPA 4BDGA 2CLQA 4BVUA 2DQ7X 3TUDA 3F3ZA 1Q61A 3D2KA 4AT3A 2C6KA 3KXMA 4L42A 3S95A 4YJOA 4C4IA 5IQEA 2R2PA 3BU6A 3SRVA 2WTCA 3T3UA 1URCA 2A2AA 2HELA 3TIZA 1U4DA 4MD9E 3MPAA 5CEKA 4ZMEA 4ERWA 2H8HA 3Q6UA 4XOZA 3UGCA 3ZC6A 4RT7A 4NW6A 4JXFA 3OCTA 5KMMA 4TZRA 2WNTA 5EYKA 2YEXA 3DKFA 4FTRA 2G1TA 4X3FC 4IDVA 1VYWA 4FGBA 3ZZEA 1UU3A 3U6IA 2JAMA 4MYGA 3QUEA 2Z7LA 3R8MA 5L8KA 3QQFA 5JGBA 3QA0A 2XNMA 2C0OA 5HU9A 5I9YA 3TNWA 2PE0A 4CFMA 3EWHA 3ZU7A 3Q4ZA 3OY1A 4P90A 4MBIA 5E8XA 2F7ZE 2RGPA 5HG5A 3RWPA 3ZH8A 4Z3VA 4RFYA 4MXYA 3IDBA 4IJPA 4PMMA 3JY0A 3ZM4A 1DI9A 5C8KA 3E88A 4DN5A 3PVUA 3QQHA 4E26A 3TTIA 2W06A 3S2PA 4HVSA 1OL7A 2E9NA 3H30A 1KE7A 2HAKA 3E8CA 4RZWA 3AMAA 3OZ6A 3QYWA 3TG1A 2R3PA 3QU0A 3GFEA 5FTQA 3ULIA 4BBMA 4OTGA 4EHVA 4W4YA 5J1VA 1JSTA 2HY81 4EH6A 3KN5A 3D7ZA 5FEEA 4WHZA 4XG3A 2QOCA 1O6LA 3BHTA 4BCPA 5M08A 2OO8X 4R5YA 1ZYJA 3JS2A 4UX9A 4K77A 1AD5A 3O23A 4H36A 3QTIA 4G3CA 2JIUA 3UODA 3VULA 4A4XA 2P3GX 4X21A 2HZ0A 5LWNA 2GNFA 4YHFA 4ZK5A 3C5IA 4DGGA 4OW8A 3OBJA 3UP2A 3PE2A 4G3FA 4BZDA 4QMNA 3LFFA 2CJMA 3DJ7A 4DGLC 4HW7A 3CS9A 3ODZX 3FMLA 3OCSA 5CALA 4HGLA 3F3VA 3QBNA 4EH2A 3NNXA 2GTNA 5K4JA 3M1SA 4PDYA 2CKQA 4HPTE 3VS5A 3LCKA 4BWKA 3L8PA 2W0JA 4FK6A 4NIFA 3K3JA 5DYJA 3GEQA 3GCQA 4IB1A 5C8NA 4USFA 4H58A 2GFCA 3PJ2A 3LJ2A 3VAPA 4ENXA 3QCXA 4TNBA 1MQBA 4BCNA 4JAJA 3EKKA 4C4EA 1A9UA 5JMSA 1PRYA 5CYIA 3DKGA 2OJ9A 4L6QA 5EDQA 3GQIA 3KY2A 3FKLA 1O6KA 3P08A 4WBOA 4DBXA 1YXTA 3OTUA 3FMNA 4FYOA 4L44A 3DK3A 3LVPA 4L52A 4D5HA 4FI1A 4ALWA 3CXWA 3C4FA 4EK5A 3RM6A 5EK7A 3DB6A 2NRUA 3PZEA 4I21A 1H08A 2XKFA 4XUFA 4C3RA 3P5KA 4FKGA 2CNVA 4I6QA 3FWQA 3OXIA 1WBSA 2YLEA 4RQVA 2CNQA 2R3KA 3GC8A 2XK8A 3O7LD 4MWIA 3WZUA 4ZMFA 3PPJA 4J99A 3CSVA 5B7VA 3Q04A 3QD4A 5IU2A 5AIKA 5E9EA 3CE3A 4S32A 3S3IA 1YDRE 4RLKA 4YC3A 1P5EA 3L9LA 3L8SA 4I0RA 3ZCLA 5L2SA 4FV2A 3H4JA 4FIHA 5KKRB 3U6JA 4QMXA 5CI6A 3LCOA 3ETAA 3F66A 1J1CA 4FOCA 2IJMA 1Y6BA 5I9ZA 2Y8OA 3BQCA 2XP2A 2I6LA 3QRIA 2W5BA 4IAFA 3SKCA 5EKNA 1YDSE 2C6IA 2BRMA 2UZOA 3BV3A 4CZYB 4JIAA 3VRZA 4FTLA 3COIA 5CX9A 4M3QA 4L7SA 3GNIB 4KINA 4KIKB 2WOUA 1R0PA 5EM6A 4Z55A 2JKOA 4MBLA 4AFEA 1Q8UA 3A2CA 4I6BA 3VN9A 5TR6A 4CKRA 2W1IA 3HP2A 5FRIA 3MB6A 2QOBA 4D4SA 1R3CA 4U5JA 4M14A 3ZZWA 4FKJA 3QA8A 5H9BA 4C4HA 1ZMVA 4RC3A 5M4FA 3KRWA 4CNHA 3R63A 1FPUA 2QOQA 2W9ZB 4M67A 4OGRA 5IA5A 5DGZA 4DA5A 2XMYA 3FZSA 3UVQA 2O63A 3CGOA 2GQGA 4HCUA 2PUNA 1W98A 5KMIA 4CGAA 4P5ZA 5CF6A 4PTEA 5BVFA 1OKYA 2BPMA 3OW4A 5IH5A 3TZ8A 4K6ZA 3UPXA 3HNGA 4YJVA 2QHMA 3FMKA 1ZOGA 3PPZA 5CU3A 4DH7A 4ZZOA 3OOGA 1ZAOA 2GNLA 3Q9XA 4IMYA 4IX5A 1CTPE 2I0EA 2RFEA 4X7QA 5LMAA 4GU6A 3EB0A 3D94A 3MB7A 4N6ZA 4CKIA 2RL5A 4BY9E 4AOTA 1Q97A 1KE6A 3GVUA 3Q2MA 3V5LA 4DFXE 1J7LA 2W1ZA 3MY1A 4MWHA 2P55A 5DMZA 2WTDA 2VGOA 3HRFA 1H1QA 2PMOX 1XBBA 1ZOHA 3I0OA 2I0VA 3Q52A 3UYTA 4C34A 5CANA 2VWXA 1R78A 2CGVA 1PW2A 3UOJA 2OW3A 5JZNA 4DEEA 4DHFA 2XH5A 3E3BX 3EN4A 3MDYA 1BYGA 3ODYX 3P7BA 5H3QA 3OT3A 3R1SA 4ASZA 5AP6A 4CLIA 2OKRA 3AMBA 4QQTA 3NW7A 4U6RA 4FEVA 5CNOA 5AEPA 4D1SA 4B4LA 3DKOA 4FIGA 5A14A 5CU2A 1OMWA 4IAAA 1DAYA 4I41A 4LUDA 4EYJA 2X8EA 4GJ3A 3A60A 1YOMA 2OICA 4G6LA 3QALE 3QRJA 4WG3A 3PLSA 5A4CA 4FE2A 3WE8A 2VTJA 4QMSA 2BIKB 1JVPP 3FMHA 4X6RA 4JG6A 4D2SA 3U6HA 4P2KA 3AD5A 4FT5A 3PXZA 4Y73A 4YPSA 4PY1A 5CXZA 3BCEA 1KOBA 2R3JA 4RBLA 3DLZA 5AWMA 4F7SA 4GFMA 2XJ1A 2QOFA 4U81A 2A1AB 1JPAA 4UWYA 4LL5A 3HMOA 5IPJA 4FIFA 3ROYA 3RAHA 3SW4A 2W05A 3NAXA 3R7OA 3CTQA 2OSCA 5F20A 4EZ5A 2DWBA 4I0SA 4NWMA 3FZOA 5AP7A 2XB7A 4RVLA 4WSQA 2OLCA 5TO8A 3GCVA 1GNGA 1Z5MA 4Y95A 2XIKA 1VR2A 2JDRA 3EMGA 2G9XA 2OJJA 2XA4A 3I7BA 4ZTNA 1QMZA 2W1HA 3BHHA 2XK9A 3EH9A 1ZYDA 4LV8A 3W2SA 5J95A 5L2WA 5IQDA 3UTOA 5DBXA 4EJ7A 4DCEA 5DNRA 4EH5A 5CAVA 4WRSA 5HX6A 4ZS4A 3BU3A 3A99A 2BIYA 4C36A 3BYUA 3VUTA 1YVJA 1OM1A 4UMRA 3F3UA 4O21A 4YNEA 1XH9A 5IA2A 2C6MA 2WQMA 2A19B 3LM0A 3OW3A 5M53A 3KULA 4O22A 3QTWA 2BILB 4GT4A 3HUCA 2UZTA 4UWBA 2C3JA 2WTIA 4FKPA 2BZIB 5AUYA 3F5UA 3NVMB 5HHWA 3LQ8A 2X9FA 3Q60A 3EQCA 5K9IA 4WNKA 2WIHA 5EDRA 4AG8A 5AAEA 2BDWA 3SVVA 4ZTSA 4OAVB 2P0CA 4H39A 4MBJA 4QD6A 3WF5A 4EK4A 4EOIA 4JBQA 3DPKA 4RLLA 3ZUUA 2PSQA 2C69A 2WGJA 1JNKA 3UP7A 2UW0A 5LWMA 3PA3A 3QTXA 4O0UA 3T3VA 1O9UA 3KK9A 4XEYA 5E8SA 4YR8A 5BQ0A 3FQEA 2X6EA 3R9RA 1MQ4A 2OG8A 4JG8A 5LJJA 4QMQA 2P33A 5ANIA 3ZUTA 4BIBA 2ZVAA 4GG7A 5IEXA 3FI8A 3BPRA 3DDQA 3NCZA 3OG7A 4O96A 3EFJA 4DEHA 2J9MA 2IZRA 4FNYA 1J7UA 3C4EA 3NRMA 2YZLA 1OUKA 4S31A 2F7EE 5GIOE 4C3PA 5HCZA 3R0TA 4OTRA 2VWVA 3GT8A 3AC4A 4I24A 3DLSA 5FEDA 3NNVA 5J79A 1KE8A 2WQOA 3NUNA 3BYOA 4QMYA 5AP4A 5IQIA 5KMNA 4G34A 2WKMA 3OCGA 4AA0A 1I44A 3EQGA 4IB3A 4LV5A 4NTSA 2P4IA 4YZBA 3ZDUA 2NPQA 4A4LA 4F6WA 3E87A 1OIUA 1UU7A 3BEAA 4IEBA 4UMPA 5KBQA 1NY3A 2ZV9A 3I60A 4FODA 4BKYA 2WMQA 3HUBA 5K5XA 2ONLA 4E93A 3FMJA 3JXWA 5BVNA 4O7ZA 2VU3A 1Y57A 4M13A 4YTCA 4KSQA 3UO6A 4AE9A 4E5WA 2ZV8A 3UPZA 2IW6A 4YU2A 3NS9A 5CU6A 2VAGA 1YDTE 3GBZA 1MRUA 4U3YA 4XG2A 5ANJA 2CGXA 5FGKA 5FDPA 4XBUA 4H3PA 1GIHA 4G31A 4FOBA 3R1QA 3TNHA 3FLQA 2FVDA 3NSZA 4ZY5A 3ENMA 1UNHA 4KSPA 1B38A 1JKKA 2PWLA 5CZHA 5IA3A 5E8YA 3PE1A 4CTBA 2J0JA 4UMUA 1PMUA 4OTDA 1H8FA 3D5WA 3DB8A 3FV8A 4BYJA 5KX8A 4DLIA 3Q6WA 3FEGA 3FHIA 3PWDA 5A6NA 5I9WA 1RJBA 2O5KA 2VTIA 2EXEA 4A06A 3MJ1A 3ZM9A 4M69A 2IZSA 2YZAA 4W8EA 5AA9A 3PVBA 2PVJA 3NIEA 4FTTA 4KAOA 2ITPA 2QURA 3ZOSA 4AZWA 4KBCA 1ZXEA 4ALVA 4EJNA 4JL9A 4HVHA 5DVRA 2YA9A 5M06A 4WNOA 3BBTB 3I7CA 3DU8A 1JKSA 5EDPA 4EOLA 4IIRA 1B39A 3QC4A 3AGMA 4B0GA 3QLGA 2W4JA 4CRSA 4EH7A 5CAOA 3W2PA 4DEAA 4CG9A 3LFBA 5BUIA 2UW3A 3QXOA 3F5GA 4ZLOA 3DQWA 4XLIA 2F57A 3ZSHA 3JYAA 2YCSA 5EG3A 3VS7A 2ZM4A 5H8GA 3TZ9A 4DGOA 4YJRA 5E8UA 3V6SA 4MXOA 4K11A 2PK9A 3M2WA 1IR3A 2WQEA 3DAJA 4UBAA 3UVPA 3ZFYA 3VUDA 2I7QA 3DDPA 2JDVA 3K2LA 4NFMA 4JR7A 4XHKB 4BIDA 4C0TA 4IANA 2RFSA 4DITA 5KCVA 3GENA 3GU5A 2QR7A 3LFSA 4GIIA 4NH1A 4W4VA 3RK9A 3MGYA 3OFMA 4LRMA 3LLTA 3CQWA 4U97A 4ACDA 4RVKA 4H3BA 2UVXA 1BL6A 2PUPA 3QD3A 1NT2A 2E9OA 3LXPA 2R5TA 4IZYA 5TF9A 4EH3A 4K1BA 2WAJA 1QPDA 3MH2A 3NYOA 4XMOA 4AQCA 4YMJA 3O51A 4PMSA 1YI4A 1YQJA 2ZMDA 4C62A 4HVGA 2C0TA 3K54A 4Y5QA 5CWZA 3VC4A 4ANMA 5T3QA 3ZLSA 4EQCA 4TYEA 2WO6A 3AMYA 4QOXA 3EQIA 4GV1A 4AW5A 2QG7A 3AXWA 3C0IA 3AT3A 4I4EA 4EOPA 4M0YA 4R3CA 3UC4A 3H9RA 4TKSA 4EH4A 2XIZA 4TL0A 3QFVA 4E20A 2ONLC 2W1CA 4YZCA 3V5PA 4WUAA 1PXNA 3FYKX 1PXLA 5T6KA 4M8TA 3D9VA 4GYIA 3TACA 4FT3A 4BTKA 4O81A 3QGYA 4KIOA 5FXQA 1TQPA 4TWNA 4BDBA 3KB7A 2R3GA 4ASDA 3PTGA 2WXVA 3QRUA 4Q5EA 2C4GA 4C33A 4OBPA 2PVNA 2GNGA 3F5XA 5I3RA 2ZAZA 2XM9A 3C51A 4EI4A 3DXNA 2H96A 4IVAA 2LGCA 5C27A 3GU8A 3GC0A 3KVWA 3PZHA 5E8VA 3UE4A 1AGWA 2VWZA 5ANOA 3ZXZA 2XNGA 5EM8A 3U8WA 5EHOA 1SZMA 2IVUA 4FKIA 4IFGA 1T46A 3F7WA 5DRBA 3WF7A 4DYMA 2J0LA 4I5MA 3FL5A 2QC6A 1WBVA 1UKHA 4B7TA 4GW8A 4AT5A 1KE5A 4D0XA 4RA5A 4FSRA 4JBVA 4AT4A 3U54A 3R83A 4YBJA 4PUZA 4YZMA 3PP1A 1PXMA 2BTSA 2C5YA 3PYYA 4G16A 4KBKA 4BCKA 1REJA 1S9JA 4YJTA 4E6AA 5HORA 4IFCA 4TPTA 1GZ8A 4F9AA 4NW5A 4GIHA 3UYSA 3EN7A 4GK4A 3ZO2A 1LR4A 3EQBA 3QCSA 4FG7A 4C4FA 5HIEA 5IQFA 3LAUA 5C03A 4YSJA 4XNEA 5I3OA 2V0DA 3CD8A 4IH8A 2EU9A 3U9NA 3ZBXA 3D7TB 2Y4PA 2C5XA 4JLCA 4MTAA 3MVLA 1G8AA 2X1NA 5KMJA 3O7LB 4QP4A 5HKMA 4C38A 2GFSA 2ETMA 3R7VA 2J51A 2UV2A 4FSYA 5F1ZA 3I5ZA 4GS6A 3PSCA 4KS8A 3V8SA 4ANOA 2Q0BA 4X2NA 1LUFA 5AP2A 3MY0A 3UG1A 1VZOA 4FK3A 3V5TA 1WZYA 3MV5A 3P7AA 3VS1A 4BDEA 1FQ1B 3NEWA 1IASA 2VTRA 3KGAA 4JNWA 4QYGA 4FEXA 5AV1A 3RTPA 1BI7A 3A8WA 2V7AA 2I40A 2C3KA 5EOLA 3TNQB 4B9DA 2PMIA 3C4ZA 3R7YA 3PRIA 5JSMA 5KHWA 3E63A 3MTFA 3RKBA 4ARKA 3VJOA 3L9NA 4EZ3A 4TYHA 5CVGA 4BDJA 5CF5A 2BAQA 3A62A 1PYXA 2V22A 1YW2A 5EYCA 4U3ZA 4EOQA 4I92A 2W1FA 1WMKA 4LOQA 3IS5A 4ORKA 3KXNA 2WMTA 1Q8TA 3BRBA 4OTHA 1GIIA 1CKIA 4QP8A 4FL2A 3OHTA 5GJGA 4A9YA 2Z8CA 1DAWA 2F2UA 1O6YA 3TZ7A 4C2WA 4DFNA 4EBWA 2AC5A 2O0UA 2YM8A 4FL3A 1BX6A 3KF7A 4LGDA 4OLIA 4RPVA 3IK3A 4YSMA 4AOJA 1M14A 4XV2A 4H1JA 4FTAA 5CY3A 4RQKA 4FV5A 3SX9A 4U45A 2C6EA 2I1MA 4EC9A 4DT9A 2X0GA 4X2KA 5DR9A 2VGPA 3EFLA 4JRVA 4RFMA 5CVFA 4YNOA 2OH4A 3EL7A 2QHNA 2UVZA 1J91A 1CMKE 3C0GA 3PP0A 2Y7JA 4E4XA 1U59A 2JBOA 1OBDA 5BX0A 4AS0A 5ANGA 5B2LA 2IW8A 3MESA 4F99A 4K18A 4M97A 4PPAA 3P4KA 3UG2A 3FMMA 4ASEA 2UZVA 4FTUA 4L3JA 4RIWA 3EQFA 3LM5A 4ZLZA 3KN6A 5HESA 3MIAA 4BZNA 3FPMA 5K5NA 3RAIA 4D2PA 4GK3A 2Z60A 1W83A 1WBTA 1KOAA 2OZAA 1LEWA 3A7FA 2VD5A 1PMVA 4IZAA 3H9FA 1XH5A 4D4RA 3PUPA 5IQAA 1SVGA 3RGFA 4XG8A 5IKWA 2YIYA 4Y46A 3V3VA 2OFUA 5ETAA 4CMOA 5GINE 3TDWA 4EBVA 1FVVA 3RCDA 3ZFXA 4DGNA 3FI2A 4X3FB 4BTFA 4F0FA 3FL4A 2GNJA 5HTBA 5IUHA 2VX1A 4GH2A 4N4SA 3SAYA 4AGWA 5JFWA 1IAHA 2GQRA 3ATTA 4O7YA 4LOOA 4MCVA 1SVEA 4WRGA 3LFQA 4OR5A 2ITUA 5BVOA 1PHKA 2BFXA 4GKIA 4KIQA 1U54B 2VNWA 4RJ4A 5AP5A 1ZZ2A 4C58A 1OKZA 3A4PA 4NZWB 2JFLA 3GU6A 2UZNA 3QRKA 3R7UA 2FSLX 2XUUA 4BDAA 3VHKA 3MPTA 5J7HA 2YM7A 5HTCA 2ITNA 2OIBA 4RWIA 4F65A 3F6XA 3ROCA 2PVMA 4A9SA 4F9WA 2HENA 2HZNA 4O7VA 3ORKA 1SNXA 3FLSA 2VTLA 2FSOX 3FAAA 4XP0A 4Y8DA 5I9UA 4EK3A 3HRCA 5K0KA 4DLJA 3F2AA 4IE9A 3FUPA 4D9TA 5E91A 4FYNA 4RWKA 5TOZA 2VX0A 5M57A 3CLYA 3QLFA 3VS4A 2PUIA 3P9JA 3POOA 5AUTA 4DT8A 4O0TA 3R04A 3IO7A 5KMLA 4BIEA 3RALA 3NNWA 4QP7A 3CBLA 3DT1A 4QP9A 2C47A 3EQRA 3ZEPA 5HZNA 1F3MC 3NYVA 3T8OA 3A61A 5A4LA 2B53A 2XIYA 3Q96A 4NM7A 1W84A 4U43A 4FVRA 2FO0A 4Y85A 5M44A 3WF8A 4BGHA 3BEGA 4IZ5A 5DR6A 3LXKA 3VQHA 3D5XA 3MN3A 4TWCA 4E6QA 2FSMX 2YIXA 3E64A 4QQ5A 4RX7A 2RSVA 3FJQE 2BRGA 2ZV2A 3DOGA 4FZFB 5CT7A 2BHEA 3NDMA 3VIDA 2R3IA 5CLPA 2EWAA 3PIZA 3RINA 5J5SA 4LI5A 3LFAA 3Q5ZA 5E92A 3ZO3A 4C35A 2ZB1A 4ZJIA 3RP9A 3ZSGA 4E7WA 5LARA 2VTPA 3H3CA 3K3IA 4FTQA 4CVAA 3GCPA 4KS7A 5M4UA 4MXAA 2VTOA 5CENA 4O0SA 5IEVA 3LMIA 2UZEA 4L8MA 3A8XA 4ANLA 4WIHA 5AAGA 5EI2A 2YWVA 3C0HA 1IA9A 3ORPA 5A4EA 3ZUVA 3MH1A 3WZJA 4AFJA 1XR1A 1YKRA 2WMVA 2OZAB 4PQNA 3WIKA 2HZIA 3JVSA 1H26A 4FV8A 1YXUA 1ZLTA 4EHEA 5JFVA 5GZ9A 4QTAA 4RA4A 4ZY6A 5FBNC 2C1AA 5A4QA 1JOWB 2VTNA 3OXTA 3PJ3A 3EYGA 4FZAB 5AR8A 3SOCA 4DH8A 5ACKA 2QOIA 1J1BA 4QYHA 3AD4A 3MBLA 4YZDA 3SRVB 4QMLA 3VF9A 3BYMA 4E6DA 3A7IA 2WMUA 3COHA 3P78A 4OTPA 4RJ5A 5AUXA 3OBGA 3L9PA 4JDJA 3SDJA 4DTKA 4F6UA 1YHVA 2B9IA 2XNPA 5C26A 4L45A 4ZEGA 3IPHA 2G01A 2OK1A 3B8QA 3F82A 4FT9A 2IWIA 2GNIA 2YDKA 3Q53A 3DCVA 3KMWA 3ORNA 3IW5A 4AW0A 5IQBA 1PMEA 4XP3A 3ORIA 5J87A 3N4TA 3G33A 4MF0A 4YHJA 5C1QB 5HVKA 3LE6A 4FNZA 4I5HA 3TNPC 4GMYA 4QYEA 4UMQA 4CMUA 4G17A 4FV4A 2VWWA 1K3AA 4JRNA 5GZAA 3GOKA 4LYNA 4FTJA 4KKEA 1BI8A 2RIOA 2YLFA 4DEBA 5HBHA 3RK5A 5AUZA 5CSWA 3V6RA 5JFXA 4F7NA 2C68A 1J7IA 3PWYA 3TEIA 5KKRC 3C4WA 4J1RA 4M0ZA 3RZFA 3KREA 5LMBA 3R8UA 1OIRA 4IADA 1V0BA 2XS0A 4I6FA 3UIUA 5EM5A 3EN6A 5CQWA 3KXXA 1GZNA 4CYIA 4HYHA 4CFFA 4TYGA 4NT4A 3BX5A 1K9AA 5LVPA 4EQMA 2VN9A 4MEDA 3FY0A 2BZHB 3BYVA 4RMZA 1BMKA 4FC0A 4YO4A 2XEYA 4MKCA 3TXOA 4CFVA 3ANQA 2IPXA 1AQ1A 4LM5A 5IG1A 4YUQA 2EXMA 1HCKA 3F88A 5KMOA 2YFXA 4HGEA 2XCHA 4AWIA 1ATPE 3VBQA 4DFLA 3LFDA 4XCUA 5FBOA 4BWXA 2C6OA 3EJ1A 4JX7A 3RJCA 3BU5A 4ZS0A 4HGTA 3KRRA 2OJFE 4RRVA 4C02A 4F0GA 4ACMA 3DK7A 4DAWA 3OF0A 4WG5A 4R8QA 5AUUA 2QONA 5DT0A 4LQMA 2BUJA 4QYFA 5JRQA 5IQCA 1YI6A 5DR2A 3QQKA 4PPBA 4RJ6A 3OP5A 2ITYA 2Y9QA 3OD6X 4S34A 4A07A 4IB0A 5DT3A 2JKKA 1YWVA 2W4OA 2PVHA 1Q41A 4WG4A 3RHKA 4EHGA 5AV2A 2ZDUA 3NVKI 2NRYA 4J7BA 4FGRA 4I0TA 4ZTLA 3Q2JA 2R3MA 1G5SA 4CQEA 3R02A 4BYIA 2ZYBA 3NUUA 4PL3A 4E1ZA 4NIFB 3IW7A 5E8WA 4A9UA 1LEZA 3FZPA 3DXQA 4I23A 2PUUA 1V0PA 4NEUA 5L2QA 1KE9A 3CJFA 4OTIA 2QO9A 4CYJA 2W99B 3NZ0A 3KRXA 4XH6A 4A4OA 2BDFA 3I79A 3H0ZA 2GNHA 4TNDA 4KUJA 3FXWA 4NJ3A 4YJPA 1W7HA 5BYYA 1YHSA 2X2LA 5HEZA 1XO2B 2OGVA 3DK6A 2QOLA 3HKOA 4TTHB 2X2MA 3BI6A 4IQ6A 1VEBA 4PDOA 3VF8A 3BHUA 3GCSA 3TM0A 1PXOA 5E4HA 2C30A 5D7VA 2G2HA 1B6CB 3RAKA 2YAAA 3Q5IA 4N0SA 2HWPA 2CKOA 3K5UA 4PDSA 5AAFA 3JY9A 2HXQA 2W1DA 3G9NA 1GJOA 4AF3A 4BRXA 2XNOA 3ERKA 5FXSA 5GJDA 3SXFA 3F3WA 2P2IA 4EHZA 4CEGA 1TQMA 1UU8A 3G5DA 2X4ZA 3AC1A 2GSFA 3VW8A 2WIPA 3SGCA 4JJRA 2XEZA 2JEDA 5AV4A 4OT5A 2XZSA 4XX9A 5FQDC 4CG8A 3PY0A 5M07A 1ZARA 5JQ5A 3R00A 4ANSA 4J71A 5KNJA 4IAZA 3R01A 5HG7A 3E7VA 4FTMA 3Q9YA 2F4JA 2IVSA 2YITA 3M11A 4EWQA 4ZOGA 2QI8A 5HX8A 2QKRA 3VBXA 3QTRA 4FKVA 5I0BA 2J5FA 3EN9A 4EQUA 4B6LA 3HAVA 4IX6A 3U51A 5GIPE 3DAEA 1CSNA 3ZRLA 3UQGA 1M7QA 3GI3A 4B8LA 1QPCA 2X9EA 4NM3A 2E9UA 2BKZA 2C6DA 2ITZA 4IJ9A 4ITJA 1GIJA 4FSNA 2OXYA 4MXXA 4CLJA 4E6CA 2YDJA 2VV9A 2XNBA 4GUEA 3C1XA 4FIIA 2W7XA 4O2PA 2YDIA 3PXFA 1P14A 3VQUA 1YOJA 3POZA 4XP2A 1R39A 4G9RA 5D1JA 1OL2A 5AX9A 4AA5A 4ZSAA 4K0YA 2OIDA 4FTOA 3KU2A 4O6EA 5FTOA 2PVLA
chains in the Genus database with same CATH superfamily
1DI8A 2WZJA 5J9YA 2WTWA 3NIZA 2B52A 1ZYSA 1XWSA 3LFEA 3S4QA 4CZTA 3GGFA 2PZIA 4GL9A 4FV0A 3DNDA 4JBPA 5AADA 3ZS5A 3R2BA 3LZBA 3BKBA 3R2YA 2HW6A 5HNBA 3MSSA 4E5BA 2W96B 4MNEA 3NFGB 4F6SA 1OZ1A 3DJ6A 3HMMA 4KWPA 4F7JA 3MPMA 3OXZA 4DG2E 3W2RA 5L3AA 3CCNA 3TKUA 3U4WA 2BRBA 5DE2A 4ZY4A 4YLJA 4FUYA 1XH6A 4FG8A 4B8MA 4UYAA 2UW7A 2AYPA 4ANBA 1BKXA 2OBJA 2OU7A 4R78A 2QLUA 3F61A 5EHYA 3CKXA 4F1MA 1U5QA 1OBGA 4FUXA 2J2IB 2JKMA 3KKVA 3UIXA 1E1VA 1Y8GA 4EWHA 4IWQA 3BLQA 3NPCA 4HGSA 3HYHA 1SVHA 4JG7A 2IZTA 2WMWA 3R7EA 4BCOA 2ITXA 3I4BA 2WTJA 3QTQA 3NAYA 2JDSA 4O86A 5AR5A 4FNWA 4QNYA 5BVEA 5G6VA 4L01A 1KWPA 4MNFA 5CU4A 1JSVA 5IZFA 3W2CA 2A4LA 3DBFA 2W5HA 3IDPA 4R77A 2UZUE 3UC3A 4F70A 3RAWA 3JUHA 2X39A 4ACHA 2F2CB 4ACGA 3S1HA 5KO1A 3ACJA 4LUEA 3LXNA 2G2IA 2J0KA 2ZDTA 3DBEA 5I5ZA 2CKPA 3R7GA 3NUXA 4AUAA 2HW7A 4MUQA 2PZRA 2XJ0A 4X6QC 5HE1A 4II5A 4EL9A 3QQLA 3E3PA 4UWCA 5C8MA 3CR0A 2J0MB 2FH9A 4ZTHA 3FPQA 4EOSA 2V55A 2OWBA 4FG9A 5J7BA 5IUIA 2FA2A 3IW6A 4PV0A 3HA6A 4HYSA 2YERA 4FTKA 3UIMA 4YLKA 3RCJA 2GHLA 1L3RE 3ZRKA 5EYMA 2AUHA 2YCRA 5DG5A 3ZYAA 3SG9A 2ERKA 5AJQA 2AC3A 2JD5A 4I5PA 4QQCA 4FICA 2XF0A 5F95A 3FSFA 1Z57A 4FL1A 4V0GA 5HVYA 3VS3A 3WYXA 1V0OA 5CI7A 4UXLA 2C5VA 4M12A 1IG1A 4I6LA 4ENYA 4DF3A 2PZ5A 5DN3A 2AEGA 3IOPA 2YM3A 1GZKA 4Y83A 2Y4IC 4DC2A 2BDJA 5KZ0A 3KCFA 4BICA 1G8SA 2WFYA 5BNJA 3AC8A 3NLBA 5I9XA 3I5NA 3BE2A 3W0QA 2X2KA 2Z7SA 1ND4A 3MJ2A 3ULZA 2CN8A 5CAQA 3HA8A 1G3NA 3KXHA 2UW8A 3KULB 3PVWA 2BZJA 3DAKA 3SC1A 4PF4A 4OBQA 3CTHA 4MQ1A 1PXIA 3QCQA 2FB8A 3P86A 1EH4A 1OL5A 1XQZA 2HYYA 4FEQA 1SM2A 5JQ8A 4CMTA 4HCVA 4M66A 5KUPA 5HIDA 3MY5A 2J50A 4DG3E 5AP1A 5HIBA 3EYHA 3LJ0A 4ZZMA 4FT0A 4I5CA 4XG6A 3HVCA 5HD4A 3NR9A 2QG5A 1IA8A 2FGIA 2XJ2A 3EZRA 3QX4A 2BMCA 5AR7A 2X8IA 2BFYA 4J97A 5CAPA 5K0XA 4BI0A 4UN0C 2ITTA 4YTFA 4C4JA 3RNYA 5LCJA 1TKIA 2HWOA 3FC2A 3FXXA 1M2RA 4PNKA 5JFSA 2YCFA 1WCCA 1PY5A 4DINA 2BALA 3G0EA 4WT6A 1YWNA 4TN6A 5F94A 4LL0A 4QMWA 4H05A 2R3NA 4C57A 4PMPA 4DEIA 5CF4A 4GSBA 4HOKA 4F9BA 4ITIA 5E1EA 1QL6A 3L9MA 5EQPA 2X7OA 4AU8A 3WI6A 4WNPA 2YN8A 4FV1A 4UZDA 4YJUA 3UO5A 4AE6A 4GT5A 3A4OX 3A7GA 1JKTA 3ZO4A 3QZFA 2RG5A 2VTQA 5BVWA 4C8BA 2XIXA 3DQXA 4NU1A 4ZSJA 3LQ3A 5T68A 4ZSGA 2OZOA 5AP3A 1WFCA 2V62A 4KIPA 4QTBA 5IF1A 1QPEA 3W2OA 3WARA 5HO6A 4BCIA 4NUSA 3I1AA 1JKLA 3WYYA 3ZLXA 4O7NA 4BI2A 4RJ7A 3UDTA 2WEVA 3B2TA 3FMDA 3FYJX 3D5UA 5GHVA 1Q3WA 4TWPA 3Q4UA 2Y6OA 4V0GB 1ZMWA 3IQ7A 3PIYA 4GFOA 5LVNA 4IM2A 1HOWA 4NFNA 4J53A 3R9NA 4K2RA 5A3XA 3TI1A 5ANKA 5HNIX 4BGGA 4DE4A 2DUVA 4C3FA 2B54A 4X3JA 2VO3A 3UOHA 2V5QA 3JPVA 3VS0A 4A9RA 3TT0A 3CKWA 2OJGA 2PULA 5HI2A 4FV7A 5D12A 2I0YA 4BI1A 3FQSA 3BIZA 1OL1A 1UWJA 4KD1A 4LGHA 3TKHA 2GS7A 3CPBA 3RPYA 4O84A 4IWOA 4DH3A 5C4LA 5ETFA 1PF8A 4XOYA 2PZYA 4AZEA 4O7RA 1H0WA 1MRVA 1XJDA 3FMEA 3PY3A 4FSQA 4N6YA 4PP9A 1PXPA 3D14A 4FTIA 4MXCA 4MQ2A 2ETKA 4IVBA 3BLRA 5CT0A 3NUYA 4FKOA 1M7NA 3VS6A 1F0QA 4S2ZA 4KRCA 5KHXA 4F63A 3BV2A 3ID6C 4M69B 4PTGA 3ATSA 3MVJA 5FD2A 4PTCA 2X4FA 4OT6A 4E73A 4BF2A 4WKQA 4BDDA 4O7LA 4F09A 3OCBA 5AUVA 3TCPA 2QVSE 2JAVA 4FIEA 3H9OA 5DFPA 3GOPA 2QU6A 4E4MA 1NW1A 3UZRA 4YZ9A 1WBNA 4Z7GA 4KNBA 2IO6A 2ZM3A 2CCIA 3VBTA 4DFYA 3NW5A 4JT3A 4EC8A 4NTTA 3PG3A 2XANA 5DOSA 3V04A 4EK8A 2IVTA 3NYXA 1PKDA 4Y5HA 3E5AA 5CEIA 2ITWA 3SXRA 2UZBA 5LCKA 4EOKA 4RIYA 4W4WA 2WU7A 4O0RA 4AN3A 2H34A 3IECA 5HG9A 2QO2A 2PMLX 1FGIA 3GUBA 4NSTA 2UW5A 3VBYA 3MA6A 4BCFA 4YO6A 3G2FA 5ETIA 4AP7A 5ITAA 2HZ4A 2CMWA 2R3RA 2XBJA 3PJ1A 4QMUA 4XV1A 4QNAA 3G51A 3UNKA 2GQSA 4K8AA 3PRFA 2OXDA 3EQDA 4ZZNA 3DBQA 3MFTA 4AQKA 3LXLA 3BYSA 2VTMA 3W8LA 4QMZA 3HGKA 2ZV7A 5DWRA 3WBLA 3R28A 4QDEA 3IOKA 2R3OA 3QL8A 2XRUA 4XRLA 4C7TA 4EKLA 4HCTA 3C9WA 4ASXA 4LOPA 4TRLA 3NUSA 1H4LA 3R9HA 4RC4A 5AP0A 5KZIA 2WTKC 4O4EA 4TT7A 2X8DA 5J9ZA 2WQNA 3R6XA 3V51A 4F1OA 5LQFA 3DZQA 1ZWSA 3NWWA 5EW8A 5BUJA 4A9TA 5CQUA 3QZIA 3MH0A 4PRJA 1J3HA 5IDPA 1DM2A 5BVDA 2BZKB 4Q2AA 3ORMA 2O8YA 3LFCA 5F9EA 1JQHA 4FZ7A 4JDHA 4QMMA 4BDIA 3AD6A 3R8LA 1W8CA 3ITZA 1ZY5A 2FSTX 4RVTA 4AZSA 3W32A 1SMHA 2ZFYA 3PIXA 5K3YA 4HVIA 3SW7A 2W1EA 2B9FA 2IW9A 2QO7A 3EFKA 1FMOE 3BELA 4GVAA 5HQ0A 4IAIA 5E90A 5FEQA 2XK3A 5C9CA 1CM8A 2EB2A 1OPLA 2GS6A 2J90A 4M7IA 4F0IA 1OKVA 3TV4A 4Z16A 5IA4A 2UW6A 3MA3A 4UEUA 4G9CA 4O4BB 2A0CX 3NUPA 3ZLYA 3P5JC 4AAAA 3GB2A 1TZDA 4QP3A 2JDOA 3R71A 4ZAUA 5BYZA 3PJCA 4FTCA 1APME 3NYNA 2IG7A 5EYDA 4WUNA 3G90X 3EFWA 5HE2A 1UNGA 3FKNA 5HGIA 2WMSA 4JIKA 4BKZA 4BCMA 3EKNA 2Z02A 1OPJA 2XK7A 4LFIA 4J52A 2CGWA 3IKAA 4RX5A 2B1PA 1H1PA 3R1NA 3MFUA 1WVYA 4FSMA 1JAMA 4GYGA 4QMTA 2ZM1A 2QLQA 3FDNA 1CKJA 3ZHPC 2J5EA 4EOMA 4USDA 4L53A 4QP6A 2B0QA 3TDVA 4QTCA 2C3IB 5IUGA 4ANNA 4TYJA 3MFSA 5AUWA 2Q83A 2CDZA 3DJ5A 3EQHA 3LMGA 2W1GA 3MVHA 3Q9WA 3QQGA 4RFZA 3THBA 4CRLA 3KL8A 3A7JA 4OTFA 2VO0A 4U7ZA 4WOVA 5F4NA 5L6OA 5FDXA 2X6DA 1ZY4A 4NL0A 2J6MA 4QPAA 2VWIA 4KA3A 1M2QA 3G6HA 4IXPA 4UZHA 4M84A 4IX4A 4RGJA 1OIQA 1H25A 2UVYA 4IC8A 2WMAA 4Z9LA 1WAKA 3GU7A 4F08A 1NXKA 1H0VA 1OKWA 3GC9A 3QUPA 1QCFA 3LIJA 5FG8A 3VUMA 5HBJA 2CNUA 1YXVA 5AV3A 2PL0A 4AXAA 3HLLA 4I4FA 4IM0A 2PVYA 4CKJA 2EXCX 3LOKA 3TNIA 3ET7A 3WE4A 3PDTA 4O38A 4E3CA 3W0OA 3HZTA 3UOLA 3IONA 2GHMA 1OB3A 3KVXA 4UV0A 5FP6A 4HYUA 5I4NA 4K33A 3RNIA 1OGUA 1XBAA 5CSHA 5CXHA 4O0VA 4NJDA 3SQQA 5EQEA 5HVJA 2XM8A 3AC3A 3KCKA 4DH5A 1E9HA 4FF8A 2R64A 3SHEA 4ZTRA 2JIIA 3G0FA 3DGKA 3RVGA 4ALUA 3P7CA 4JDIA 5EHLA 5AR2A 3EHAA 4FKUA 3R8ZA 2YAKA 4JBOA 3AC5A 3ENHA 4W8DA 4R7HA 2NNWB 4W9XA 1GOLA 3TV7A 2BHHA 4DEGA 2C5NA 4RX9A 4TYHB 4Q5HA 3QYZA 3R22A 4L43A 4PPCA 3UNZA 1W0XC 3B2WA 4JQ7A 4BTMA 5IMXA 5JH6A 3OEFX 3ALOA 5AR3A 3D5VA 3QD0A 1VYZA 1P4FA 3C50A 4PNIA 4KRDA 2ITQA 5DEWA 2WELA 5LXMA 4D58A 3WZKA 3CQEA 2CLXA 4EONA 4FEUA 1FGKA 3FE3A 3WZDA 2IZUA 4GUBA 4M15A 3PA4A 5A46A 3FLZA 3I6WA 4XLVA 4RC2A 2UW9A 5KE0A 3U4UA 1L8TA 2PE2A 3OWPA 5DI1A 4BCQA 2NP8A 4NKSA 2BVAA 4C61A 2R9SA 4EK6A 4ZTQA 3FHRA 2ITOA 3LFNA 4USEA 5HO7A 5LVOA 3HDMA 4MD7E 4RIWB 4KIKA 1SYKA 2ZOQA 4IDTA 4IVCA 4RG0A 3ZO1A 1NVQA 3VWAA 2J0IA 3KK8A 4HNFA 3SLSA 4BWPA 4AN2A 5JGAA 2YIRA 1PKGA 4DHJA 2IN6A 3DTCA 3KXGA 5HCYA 1NA7A 3MYGA 2E9VA 3O8TA 5HU3A 5IA1A 1M17A 3L1SA 3HV5A 3TZMA 3BHYA 3ELJA 4TY1A 1X8BA 4XV9A 5CSVA 5CEMA 3GP0A 3LCDA 4HPUE 5HBEA 3LCSA 2VZ6A 4BDKA 1YI3A 2CKEA 2YWPA 4I1ZA 5HE3A 4TWOA 3RI1A 3WF6A 2VUWA 3F2NA 3G9LX 2XIRA 4O0WA 5M56A 1YXSA 3HV6A 1OIYA 3IGGA 4YBKA 4FMQA 4OAUC 4GFGA 5CEQA 4WBBB 4XRJA 2QU5A 4BGQA 5CS6A 3WILA 2RKUA 2PVKA 3PXYA 4EH8A 4NM0A 1Q5KA 3BBWA 4IX3A 4D2WA 3OROA 3FY2A 3AKLA 5B2KA 3BZ3A 4O7SA 3QQUA 5JGDA 1T45A 2VRXA 2XRWA 3LQ5A 1YOLA 1YWRA 2VO7A 3O71A 3CIKA 4GG5A 5DRDA 3QKLA 3HMPA 4DFBA 4FV3A 1IAJA 1KV1A 4BKJA 4JS8A 4O7WA 5FWKK 2BRNA 4UB7A 3ZTXA 1WBPA 4G3EA 4YHTA 4G2FA 1UWHA 2YISA 4HNIA 3FLNC 4XBRA 2R4BA 3EL8A 2LAVA 2QR8A 3PFQA 3QF9A 4FT7A 4JR3A 2UUEA 2PVRA 1NVSA 3TN8A 3BGZA 4DHIB 4JOAA 3KC3A 4ZLYA 5EKOA 3OWLA 4D1ZA 5HCXA 2VWUA 3ZC5A 2F7XE 3R8VA 4LRJA 3OS3A 2P2HA 2ETRA 4MXZA 3FLWA 2DYLA 4XG9A 3RBWA 3VHEA 5AX3A 4APCA 4M68A 2VTTA 5EH0A 4CFWA 4PX6A 5JEBA 1XMLA 4DFUA 2DS1A 4EOJA 4AXCA 4R3RA 4IC7A 5BMMA 2BKKA 3W18A 4OUCA 4UYNA 5I9VA 5L6WL 2BAJA 3FZRA 1LPUA 4UY9A 3ZXTA 1MUOA 3F7ZA 3T9IA 3TJCA 3HMIA 4L7FA 4WNMA 5A54A 1BL7A 2G15A 3E8EA 1I09A 4U44A 5DH3A 2I0HA 3CC6A 3W10A 5HLWA 3ORTA 3OUKA 1MRYA 4AACA 5DIAA 5E8TA 3EIDA 4CV8A 1VJYA 4CXAA 4F64A 1LP4A 3DXPA 2QQ7A 3AQVA 3EQPA 4QMOA 5CVHA 4IWDA 4J98A 3R9DA 3W2QA 4S30A 1BUHA 3QC9A 4I94A 2WMBA 2R0UA 2PZPA 3BHVA 4TW9A 4Y72A 2CPKE 4YZNA 5IH6A 4O7TA 5ICPA 4BCHA 4DG0E 3JR1A 5BV3A 4QEBA 1JLUE 4L68A 4FKSA 2J4ZA 3KRLA 2YABA 3F9NA 4AGDA 3O50A 4AGUA 3C7QA 2JDTA 3HV7A 3HEGA 1UVRA 3TL8A 3UQCA 3VUGA 2R3HA 2VTHA 3PXKA 4MAOA 4MF1A 5TKDA 4KKHA 4CQGA 4F1TA 3W0PA 4MX9A 4QMPA 4YLLA 3U87A 2XYNA 3QGWA 4U42A 2B7AA 2KTYA 2WPAA 3E93A 3FQHA 4BN1A 2ACXA 2C6LA 3RWQA 3AGLA 2QODA 5JRSA 4ERKA 4HVDA 4FR4A 3S0OA 4I3ZA 4ZP5A 4G3GA 2ZB0A 3D15A 4EUTA 4HZSA 2HXLA 2OI4X 3W0MA 3PXQA 3MTLA 3TJDA 1XH4A 4FZDB 4YTHA 5CSXA 3W33A 2WB8A 3ORZA 2Z2WA 4BDFA 3BGPA 3PVGA 4WO5A 3RPOA 4BR3A 3HMNA 2OFVA 4YPDA 3SXSA 4G6NA 4BB4A 4CT1A 4FVPA 4G6OA 4RIXA 4D2VA 1NVRA 3PLAE 3CP9A 4QRCA 1A48A 4E4LA 3E8NA 2CGUA 3SV0A 2X7FA 4CFXA 5HNGA 4BC6A 1KUTA 4GVJA 4BDHA 3RPRA 3BLHA 4BHNA 4LRKA 3E7OA 3RPSA 2YM5A 3BGQA 5FP5A 4BBFA 4EZ7A 2E2BA 4GRBA 5CEPA 1FINA 2HCKA 3HAMA 5E8ZA 3VUIA 4IM3A 5HLPA 5CU0A 3OEZA 2IVVA 3S00A 2HOGA 4CV9A 4QQJA 3TUBA 4V04A 3TKIA 2RFNA 5EM7A 1ZYCA 5IH4A 2REIA 2R3QA 5IQGA 3DY7A 3ANRA 3ZONA 3Q32A 4OTQA 1Q24A 3ZLWA 1RW8A 2R7IA 3N4VA 4KB8A 4O83A 4ZTMA 5L4QA 3F3TA 5LMKA 1H28A 2WHBA 4JDKA 2YM6A 2Z7QA 3O2MA 3OT8A 4IW0A 4G5PA 3H0YA 4MH7A 5DEYA 2YHVA 4PL5A 5EFQA 3W55A 3OUNB 1FBNA 3V8TA 4S33A 4AGCA 3NMUF 1XKKA 3FKOA 5E7RA 5L6PA 5KBRA 3R30A 3FI3A 5HLNA 1WVWA 4D9UA 4IHPA 5DA3A 4H3QA 5L2IA 3DV3A 2O65A 1W82A 2O3PA 3GU4A 4EH9A 1RQQA 4X2JA 5D9HA 5FXRA 4AXEA 2R7BA 3N4UA 2JBPA 2FUMA 3KF4A 3WZEA 2UZWE 4RVMA 1PYEA 4KBAA 4FV9A 2PYWA 2GMXA 1GY3A 3I0QA 4K9YA 5B0XA 5HD7A 4WSYA 5IISA 2O64A 3II5A 4AN9A 5EQYA 2PMNX 5IEYA 1STCE 3RK7A 1OL6A 3FBVA 3CTJA 3LHJA 3KRJA 3HX4A 2PU8A 4MD8E 3HP5A 4GT3A 5EI8A 2QOKA 2ERZE 3MIYA 5ANDA 4J8MA 3VUHA 4D0WA 3QWJA 3QRTA 3BL7A 5H2UA 5ETCA 3FI4A 5BVKA 4BFMA 3NX8A 3HRBA 4B99A 5IQHA 3RZBA 5CTPA 3V5WA 4F4PA 4W9WA 5ANEA 3UO4A 4E5AX 5H8EA 1YXXA 4JQEA 3U9CA 3VVHA 4CTCA 2XYUA 3MH3A 5M55A 3PY1A 5A9UA 1UNLA 4RIXB 1H07A 2BR1A 4APPA 4YURA 2OF2A 4CCUA 3R9OA 4FSTA 4RWJA 5BPYA 3TUCA 2HY0A 4O6LA 3WF9A 4E4NA 5HE0A 2QOHA 4XYFA 5BYLA 4ACCA 3C13A 4AZVA 4PDPA 5AMNA 1TFFA 3QZHA 3BE9A 3PSDA 5HOAA 5M4CA 4Q9ZA 4FNXA 3UVRA 3D0EA 3DNEA 3Q3BA 4ONAA 4FSZA 5H8BA 3VJNA 4EYMA 3KXZA 2HIWA 5DLSA 3VW6A 2XBAA 4ITHA 1Y8YA 4L3PA 3P23A 4QPSA 3VS2A 4D4YA 4LGGA 4X2GA 2JC6A 3PJ8A 4EEVA 1Q8YA 2HK5A 5HO8A 2PE1A 2GDOA 3EN5A 4DH1A 4O1OA 3EZVA 5AIRA 4IBMA 2YIQA 4AA4A 5FLFA 1OGYA 3O0GA 3ALNA 4FKQA 3Q4TA 4O27B 4QTDA 1ZYLA 1S9IA 3ZSIA 1GZOA 2CN5A 2CSNA 3BQRA 3COMA 3QHWA 3B8RA 3OC1A 5EW9A 3KFAA 1Q99A 3DFAA 3KMMA 3PG1A 4CCBA 3QTSA 4DGMA 4JMQA 2Y4IB 3C4CA 4FX3A 4KABA 5GZ8A 5LOHA 3V5QA 3OOMA 3HV4A 3OWKA 3R73A 2XKDA 5JT2A 3N51A 2WTVA 3KQ7A 1YRPA 3MFRA 1F5QA 3AC2A 4DTBA 3L8VA 3MS9A 5L8LA 3UDBA 4D55A 2RG6A 2RF9A 3V8WA 1KSWA 2CHLA 4YC8A 1G8KA 5IMEA 2PPQA 2EVAA 2UZLA 1YHWA 4NM5A 4R1YA 1RE8A 5CASA 4N70A 2F9GA 5EW3A 4L3LA 1UV5A 4QMVA 3GXLA 4A7CA 1GAGA 4CD0A 4DDGA 1ZZLA 2W17A 5LMKC 3VO3A 5KMKA 2R0IA 1XBCA 5AM6A 3UMWA 4FEWA 2W4KA 5HTIA 3QUDA 2B55A 5BMSA 3LJ1A 3E62A 4FKLA 4MNEB 4FZ6A 3D2IA 4F9CA 4XS2A 4Z7HA 2F49A 4D2TA 3REPA 2R3LA 2QCSA 1TVOA 1Y6AA 4G5JA 3UMXA 4AAYA 3K5VA 3QD2B 2XCKA 5TE0A 2GCDA 2WEIA 4L00A 4P7EA 5CNNA 1UU9A 1UKIA 1IEPA 2YJRA 4QP1A 4YJNA 2WD1A 3ZBFA 4J96A 4FSUA 2VX3A 2YM4A 4GEOA 2XKCA 3FSKA 4MVFA 4EKKA 3VBVA 1M2PA 3W8QA 1A06A 5L2TA 2JGZA 1TQIA 4R1VA 2OIQA 2QKWB 3G6GA 4AX8A 4J8NA 4GKHA 2W5AA 3HECA 4BHZA 1H27A 2OXXA 4X0MA 4P4CA 4R3PA 4G1WA 3V5JA 4TYIA 2B4SB 2VTAA 2BTRA 3GQLA 3PPKA 2VTSA 4X2FA 4GK2A 4QP2A 3P1AA 4CFUA 3F69A 5CSPA 4G3DA 1H1SA 4JAIA 3W1FA 3BWJA 2XNEA 2Y0AA 1JBPE 3UDSA 3C5UA 3UZTA 2OJIA 3SD0A 2X7GA 4NK9A 4QTEA 4FA2A 2XK4A 4YTIA 4FV6A 4AOIA 4PP7A 5DPVA 3QXPA 4WA9A 2X81A 3AT4A 3L8XA 1QPJA 5CAUA 2YIWA 3U55A 3VONA 1E1XA 1ZRZA 2QNJA 1URWA 1REKA 1U46A 4D5KA 1JWHA 4RSSA 1H01A 1SNUA 4AW1A 2XARA 1H1WA 3ZRMA 2R3FA 1RDQE 3D7TA 2A98A 1HCLA 5EOBA 1R0EA 1P4OA 4GCJA 4I93A 2B9JA 1XH8A 3P0MA 4MHAA 3O17A 1UA2A 4C37A 5FUTA 1V1KA 3RPVA 2B9HA 4FRFA 2H9VA 3DTWA 2VWYA 4HYIA 2RFDA 5J5TA 5M4IA 3FZTA 4D28A 2X0PA 4NCTA 1FOTA 4U79A 2XVDA 2BAKA 4XJ0A 3ORXA 2JLDA 3FXZA 1XH7A 2VNYA 4FIJA 4O91A 5CF8A 3N9XA 4FTNA 4O2ZA 1ZOEA 4F9YA 5A6OA 5A4TA 3I81A 1OI9A 3NNUA 4OBOA 1VLRA 3W16A 3COKA 3E8DA 3QTZA 3SG8A 5FM3A 3IGOA 3DBCA 4YC6A 3TMOA 5K4IA 4OTWA 4BBEA 4U8ZA 4QPMA 3CJGA 5IA0A 1WBWA 2ZMCA 3HL7A 3ACKA 2VO6A 3KEXA 4IB5A 4ZSLA 3OMVA 4JQ8A 3BWFA 4BCGA 4BDCA 4BL1A 4U9AA 4LDTA 2Z7RA 3NW6A 1WBOA 2EUFB 2WMRA 5DHJA 5AM7A 4FVQA 4BZOA 2PHKA 4O1PA 3NUAA 3UDZA 5CZIA 1Z9XA 3Q4CA 4JVGA 1BLXA 3DS6A 3OTVA 3T9TA 2NO3A 4BJJA 3AG9A 4ZJVA 5D11A 5IDNA 2Q0NA 3UQFA 3QCYA 3M42A 4L67A 3Q9ZA 5C01A 4IVDA 5L8JA 3ORLA 1DS5A 3GCUA 4RIOA 3HV3A 5D41A 1WVXA 2C3LA 4O82A 5J9LA 4AW2A 3QX2A 2JIVA 3RMFA 3GFWA 3CEKA 4I6HA 4TXCA 4D4VA 3IDCA 3RHXA 4R7BA 5AFVA 4XG4A 4YJSA 3QKKA 4P5QA 4XV3A 3F5PA 1IRKA 3VNTA 4LV7A 2YJSA 2EB3A 5LVMA 3G15A 1P2AA 3O96A 2OF4A 4HJOA 4BCJA 3OY3A 1Q8WA 2JFMA 3O8UA 3H10A 2OH0E 4RJ8A 4DFZE 4U41A 3UOKA 3RM7A 3WIGA 3UBDA 4NKAA 2WTKB 3MWUA 4UMTA 3A7HA 4O0YA 5GNKA 4LMUA 3PSBA 3QHRA 3DBDA 1FVTA 2PTKA 3OWJA 2CCHA 5HICA 2YCQA 3CY3A 4CFNA 3SOAA 3CPCA 5AR4A 3P79A 4IAYA 4YP8A 2H6DA 4R6VA 2GHGA 4U80A 4V01A 1M52A 4BTJA 4C2VA 4NYEA 4I20A 5C4KA 2GS2A 2FYSA 4U40A 3DA6A 2QD9A 4AZTA 1PXKA 4HZRA 3VUKA 2UW4A 4JX3A 2ITVA 1FVRA 4W4XA 3IW4A 2BCJA 5AA8A 4YJQA 4R7IA 4V05A 3NCGA 4X3FA 5JK3A 4LMNA 3BLAA 4ID7A 3R21A 3QWKA 4D1XA 4MK0A 4N57A 3ZFMA 4ANQA 2WU6A 4RZVA 4CZUA 2IEWA 3KMUA 4R5SA 1Q8ZA 5AV0A 2ESMA 4IAKA 2UZDA 1Y91A 1U54A 2WOTA 4IZ7A 4F7LA 4RX8A 2C1BA 4PWNA 3FZ1A 4YGAA 4FKRA 1K2PA 4I22A 3C4XA 4U0IA 4ZJJA 3TTJA 4DEDA 5E1SA 3LMHA 5EI6A 4O4DA 1OPKA 3PXRA 3QKMA 1CDKA 2YACA 4IACA 2JKQA 4H1MA 3QTUA 4PMTA 1PJKA 4WD5A 2VWBA 2BRHA 2PY3A 4RJ3A 3D83A 1Q3DA 3UNJA 5FM2A 1H00A 3FC1X 4IWPA 3MVMA 4J95A 4EUUA 5JN2A 4JI9A 2XAOA 2A27A 1FMKA 3R1YA 3TWJA 1PXJA 2GU8A 5HG8A 3TV6A 3OVVA 5M51A 3SA0A 3E92A 5J8IA 5G1XA 4QO9A 4KKGA 4NCTC 4UALA 4EORA 1KV2A 2BROA 5D10A 3FLYA 2C0IA 3LLAA 3D4QA 1CKPA 1JSUA 4D2RA 3HDNA 4ZSEA 5JKGA 3LPBA 3QAME 3ZMMA 2WMXA 2JITA 2J7TA 1OECA 3VRYA 4RWLA 3GC7A 3O8PA 2WQBA 5TT7A 2V7OA 4C59A 4CT2A 3LCTA 2C6TA 5J1WA 4ZXTA 3UJGA 2XKEA 4FSWA 3IW8A 3WOWA 3I6UA 3LKMA 3TYKA 3PA5A 1ZMUA 4FBXA 3ZEWA 5ACBC 1H24A 1U5RA 3ZDIA 5BUEA 5FTGA 3DKCA 3R7IA 1XHAA 3DZOA 2C5OA 4C4GA 3IG7A 2G2FA