4HGLA

Crystal structure of ck1g3 with compound 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
302
structure length
302
Chain Sequence
GSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase I isoform gamma-3
publication title Structure-Based Design of Potent and Selective CK1 gamma Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 302
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hglA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hglA01
2UZDA 4KBKA 5DEWA 2W5BA 3DLZA 2RIOA 4IB3A 4JDHA 5AP2A 3SRVB 4LOOA 5IQHA 2PHKA 4RBLA 3H30A 4FOBA 1NW1A 4KNBA 3IW7A 1BL6A 1M2PA 3FLNC 3PG3A 5HD7A 5J8IA 3R9OA 3TUDA 1J1BA 3FUPA 5D1JA 5DWRA 2UZOA 4I23A 1YXTA 4MXAA 3V3VA 3BE2A 2ZMCA 4Z7GA 2XM9A 3EFJA 2BKZA 3ZZEA 2HW7A 4FZ7A 5EM8A 1M52A 1KE7A 3GU4A 3GFWA 4I1ZA 5H3QA 1YHVA 3U4UA 3DK3A 3IK3A 5C01A 4ZAUA 3BLQA 3OCTA 4GK4A 4R5SA 4FIGA 1GOLA 3LFNA 3Q60A 4ZSEA 3CQWA 1ZRZA 4WD5A 2HYYA 5E1EA 1KE6A 3R7IA 1M17A 3F9NA 3KULA 3ORXA 5M07A 4EOKA 4RSSA 4NL0A 3A7HA 4NWMA 4FYOA 4DEAA 3QTRA 4KBAA 4V0GB 5A6NA 2C6MA 4R3RA 3A7GA 3PP1A 4KS7A 3VUHA 4EK6A 4FTUA 5ETFA 3NCZA 4H1JA 3ATSA 5AAEA 4CZUA 3WF9A 4TXCA 3PUPA 4BGQA 2GMXA 3DA6A 1Y91A 2W1ZA 5AP6A 3O8UA 2XEZA 3UO6A 4C61A 4D2WA 5IG1A 5KCVA 2W1DA 3VHEA 1OL2A 2Y0AA 3CPCA 3EHAA 4IC7A 5KNJA 4FTAA 3PA4A 2EB2A 5CNNA 1PHKA 2ITQA 5T3QA 2QNJA 1OIYA 4YJPA 3VN9A 4N0SA 2E9NA 2O63A 1Q8YA 2ZMDA 1VYZA 4A9TA 2IWIA 4C34A 2XCHA 4ZZOA 1OGUA 2XRWA 3ITZA 2OWBA 4MBLA 2RG6A 3CLYA 4Y72A 2H34A 4LRMA 4EH9A 4K6ZA 4UX9A 3C50A 3NYXA 4OTFA 1H1PA 1U59A 2IZUA 3QCQA 4EC9A 2J7TA 4JG8A 4F9WA 1LPUA 4N6YA 2YIQA 4Z3VA 2RL5A 3OCBA 4EZ3A 5DN3A 5A4LA 5C9CA 3Q9WA 3DBQA 2IVVA 2OZOA 3UIBA 4C57A 4DGOA 1ZLTA 1OI9A 3OCSA 4M14A 3AT4A 5HLPA 4BIDA 4WG3A 4C4JA 5M4CA 1M7QA 3COHA 3DKCA 4EH5A 3OY1A 4DFZE 2PUIA 1NVQA 4TNBA 3A4PA 5IUIA 4MK0A 2KULA 2UW5A 4XJ0A 5E8XA 3AG9A 3VS5A 3WF8A 1UNLA 4BBMA 1S9IA 4JIKA 4KWPA 3OTVA 5HNGA 4DH7A 5M56A 1OL5A 1H01A 2V7OA 1LR4A 3G5DA 5BVWA 5HG9A 3TNIA 5M08A 3FKNA 2E9UA 4FGBA 4U0IA 5IDPA 1J7IA 5C27A 3QRKA 5J79A 2ZV7A 4IANA 3OMVA 2P0CA 4MF1A 4CTCA 4RX5A 5E8TA 4YJQA 1T46A 4S34A 5M4IA 2ZB0A 4KABA 3CXWA 3KRRA 4FK6A 5DPVA 3EQFA 4QD6A 3F2NA 4ZTSA 3HYHA 4YZCA 1FMKA 4MWHA 4TWCA 4QYFA 3UVQA 5FTOA 2WU7A 3NUXA 5LCKA 4BDFA 4R7BA 3AD6A 3O7LD 2Y4PA 3D2IA 4FV7A 5G1XA 3VRYA 3COIA 3UVPA 2HOGA 1FBNA 1O6LA 4BB4A 3GB2A 2QOBA 2WU6A 1W82A 2XK6A 3BIZA 3KEXA 3QHRA 3RGFA 3LCDA 4AW5A 4CFUA 4F9CA 4GKIA 3FKOA 2RFDA 4S32A 4C2VA 1IASA 3EJ1A 4O6EA 2FGIA 4AN3A 4DLJA 2PE0A 4DEGA 1CTPE 3F5XA 4MQ1A 5EFQA 1OKYA 5F94A 5HG5A 4DN5A 4D2VA 5F20A 2XBAA 3IPHA 4LOPA 3DJ7A 3V5JA 4QMNA 3SHEA 3PFQA 3CE3A 4AG8A 4EH7A 5D41A 5AUTA 4TKSA 4BTMA 4FI1A 5IPJA 2BRMA 2QHMA 3QRJA 4WBOA 2P4IA 4G6LA 4XX9A 2UW7A 4NKAA 5HO6A 4AT3A 4FE2A 2O3PA 3V5PA 2R3FA 4EOOA 3JY9A 2JFLA 1PKDA 2J5EA 2PWLA 3QQUA 1JNKA 4M66A 5I9VA 2Z7QA 3TNQB 3HUBA 3L9MA 3O17A 2PVKA 4G5PA 4H1MA 4M67A 3PIXA 1R3CA 2JKMA 4NFNA 4OTQA 4TYEA 4K1BA 1UU3A 2AUHA 2BTSA 2CGVA 3DY7A 2J2IB 4EJ7A 3HP2A 4BY9E 2YM7A 3GP0A 4PUZA 3RAKA 5L2IA 4RZVA 4ERKA 2J0LA 3MIYA 3G51A 3B8RA 4ACCA 2BVAA 4AE6A 4R6VA 4A4OA 5HEZA 4M8TA 3FL5A 5HGIA 3TKIA 5IDNA 4D2PA 2O65A 4C8BA 5CT7A 4ANQA 1IAHA 4YP8A 3GU6A 3TKUA 2YLFA 2C6LA 2OH4A 1XH8A 4XHKB 4B7TA 4DH1A 4EH4A 5FUTA 3LFSA 1R78A 4BL1A 5JK3A 2G1TA 2GS7A 3ZU7A 3MJ1A 2JFMA 5HTBA 2WNTA 3L9PA 3P78A 3G0EA 2BDFA 3UZRA 4RJ8A 2ZVAA 5E9EA 4F63A 2OICA 2UZLA 3KFAA 2I0EA 4D28A 2FB8A 3O23A 2Q0NA 3E8EA 4L7SA 3MB6A 2QURA 2QHNA 2JC6A 3NUYA 4ZP5A 1OL1A 1IEPA 2W9ZB 4ACDA 3LMHA 3BLRA 5CNOA 4DTAA 4DFYA 3PZHA 3SA0A 4RWLA 3BYVA 1UWJA 3ZSHA 4K77A 3FC2A 4RLLA 4R7HA 4UMUA 3RTPA 3EQHA 5CEOA 3R71A 3SXSA 2R3PA 4EHZA 3UZTA 1WCCA 4GT5A 5EDRA 4FSRA 4G31A 4JXFA 5ANDA 3ZCLA 4DYMA 5HX6A 4ANLA 3QQJA 4ZSGA 5HLNA 2BRHA 1BI8A 4OW8A 4HVIA 4EOSA 5EQEA 5J1WA 4MTAA 4XG7A 1GZ8A 2BRNA 2YISA 3L8PA 2PL0A 2JBOA 4KBCA 2B1PA 2GSFA 2ZV9A 5TF9A 2QLUA 5E7RA 4L42A 5HX8A 3R02A 3ULIA 4YPSA 4YC6A 4JBVA 5GZ9A 2V5QA 5L8JA 4F08A 2JAMA 5ICPA 4FGRA 4USFA 3G6GA 1YWVA 4DTBA 3BKBA 4S2ZA 3M11A 3ERKA 2W1CA 3TZ8A 3GUBA 4IE9A 1Z57A 3PJ2A 2C6OA 3UDBA 4FOCA 3MIAA 3M1SA 3DQWA 3DNDA 4FVQA 4D1SA 4YTIA 3RVGA 4MF0A 4O0SA 4J7BA 2NRYA 1APME 2Q83A 4C62A 2PVMA 3E88A 3ORTA 3NNWA 2EWAA 4IDVA 3FLZA 2NRUA 5IA4A 3KA0A 3T8OA 4BICA 4EKLA 4PMTA 2WTKC 4GT4A 1HCLA 4CEGA 3R1YA 1L8TA 1SNUA 3P7CA 4L01A 5F1ZA 3KK9A 4DCAA 5B2LA 4HCUA 4GFOA 3K2LA 5J9YA 2B53A 4OBOA 2RSVA 5CU4A 4BKZA 3AMYA 4GMYA 4YZ9A 3PJ1A 4YJNA 2C6KA 4GK3A 4QTAA 1PMUA 2OIDA 3MGYA 4X2NA 2UZNA 4X3FA 2ZM3A 2OXYA 5FBOA 4YZBA 5BUJA 3UNJA 3FSKA 3QYWA 3VS3A 4O1PA 3QTIA 4C37A 4ZY4A 3ORPA 3ALOA 4QOXA 5EYCA 3RZBA 1YVJA 5AV0A 3PPKA 4L9IA 4DG0E 2VU3A 2XIYA 4NEUA 1WBOA 3PP0A 4CZYB 3MESA 4M0ZA 2XJ2A 4IACA 2ZDTA 4EQMA 4TYHA 3P7AA 3R8LA 2QOHA 4NJDA 4D0WA 3DS6A 5CF8A 2VAGA 3AC2A 2XNPA 5AR5A 3RPOA 3R7UA 5HZNA 2W1EA 1A06A 1H26A 4FZFB 4EQUA 1P4FA 3MVLA 3LOKA 3R1QA 1UNHA 2BMCA 3QGWA 4NCTA 2HWOA 4J52A 3WF7A 1IRKA 2WKMA 5I9UA 4X3FB 5I9YA 1NVRA 3S0OA 4O0XA 3C0GA 3FLWA 1NVSA 2ETMA 2QQ7A 3L1SA 4GS6A 4NJ3A 2YM3A 5FBNC 5AV2A 2IW9A 3GENA 5AP3A 4RIYA 4D4VA 5AP0A 5EYMA 3O7LB 3KXGA 4GIIA 4W4WA 2BFXA 3EN4A 3VS0A 5F4NA 4WKQA 2XF0A 3QRIA 2HIWA 3NNVA 3QD0A 5HVKA 5CTPA 1XH6A 2WTCA 4EH6A 3C4ZA 2IVTA 4AW0A 4ONAA 4M3QA 4MNFA 5AJQA 5BUIA 2ERKA 5HCZA 3BYSA 2YEXA 3HV7A 2BAJA 4TYHB 3WE8A 2YCFA 5HNBA 4CFFA 3UYTA 1A48A 2IVSA 1QL6A 3UMWA 4K2RA 4PY1A 3N9XA 5L6WL 3UC3A 3VS6A 4BZNA 3R63A 5BX0A 4TTHB 3PPJA 3R9DA 2F49A 4JQEA 5IEVA 4IHPA 4QP7A 3R7EA 3RAWA 3KXNA 3O51A 5DBXA 4BCGA 2VWYA 4I6HA 4ANNA 4BYIA 5BVOA 4CLJA 5JN2A 3VAPA 2VO3A 5M57A 1DAWA 3E8CA 3ZUVA 1J91A 4TPTA 2ZV8A 3QL8A 5LMKA 2GFCA 3PXFA 3IONA 3IW6A 3WF6A 1UV5A 1E1VA 3HECA 3NUPA 4HVGA 2OJJA 3L8VA 4I93A 4O0YA 3HMOA 4BCOA 2BFYA 3FZPA 3L9NA 3OXZA 3FSFA 5HIDA 3I7CA 2H6DA 3A8XA 4FNWA 4U7ZA 2QOIA 5KMJA 3RALA 3TV6A 3UIUA 1OIQA 3S3IA 4F7LA 2WEVA 2W17A 3HV4A 4LGGA 1O9UA 2VRXA 2XNOA 2PVNA 5AIKA 2QO2A 4FV2A 4BHNA 5EI2A 2VO0A 3QQHA 3UOJA 3EQBA 4I3ZA 3C51A 3W33A 3GCQA 4E3CA 3NUAA 4QP8A 3GOKA 5AADA 1J3HA 2WQMA 4UZHA 3ZOSA 5DI1A 4HCTA 4FTNA 3ZLSA 3HA6A 4C4IA 3K54A 2B7AA 1XHAA 3OOMA 4XS2A 4D5KA 4YU2A 5HG7A 3ANRA 3QC4A 5AR2A 5CI6A 1DI8A 3LXLA 5HVJA 4TL0A 2JEDA 4FZ6A 3UG1A 1FINA 3AC1A 3ALNA 3C4CA 2ONLA 2WMXA 3OG7A 2FSOX 4KRDA 3W55A 1MRVA 4X6QC 4GUEA 2UW8A 2DS1A 4H3BA 4JNWA 5HORA 4F70A 3UIXA 2UZTA 1GY3A 3FY0A 3DCVA 3BEGA 5E8ZA 4C0TA 2O0UA 1JKLA 1P14A 2UW3A 3D5XA 3TIZA 4FG7A 4O0UA 4UYNA 3ROYA 4C7TA 1MRYA 4CCBA 2OFUA 4I24A 2JIVA 4YLJA 3EB0A 4MEDA 3NAXA 3TZMA 2EUFB 4OTPA 4RX8A 4HVDA 2QG5A 4IM2A 4L3PA 4QYGA 1YXVA 5DHJA 4D2RA 4CV9A 2C3JA 3FL4A 5IKWA 3DKFA 3P0MA 2GQGA 3FLQA 1M7NA 4YSMA 4H3QA 4BVUA 2ZYBA 2CCIA 4XLVA 4E4LA 3QZFA 4XP2A 4ZY6A 5FDXA 3OXIA 2GTMA 3DBFA 4CVAA 2ITWA 4FUXA 3TDWA 5I0BA 4BKYA 3IO7A 5GIOE 3FMLA 2R3OA 4G3CA 3G9LX 4NM5A 1XO2B 3D14A 2X2MA 3QX2A 4RC4A 2W5HA 4DEEA 2CKOA 3PJCA 4FTCA 4LG4A 3S2PA 5IQDA 3RMFA 4LOQA 3TTIA 3ZM9A 2ITVA 2G15A 3F3WA 4FV3A 2OKRA 1YI6A 4RPVA 5FP6A 3R7VA 3CEKA 3EFLA 5CXZA 1Q41A 3V8SA 4M12A 2E9PA 4D1ZA 3KXHA 4DAWA 5JGDA 1YKRA 3EZRA 2BAKA 3FYJX 4WUNA 2VTAA 4KSQA 4YJTA 4RZWA 3QXOA 4HNIA 3C5IA 3BPRA 3FMEA 2YCSA 2QLQA 3FZRA 2PZYA 3WE4A 3ATTA 2VWBA 3D83A 3GU5A 4UALA 4O81A 3S00A 2R3NA 2OI4X 2C5NA 5J5SA 5B2KA 4UMPA 4KIPA 4YO6A 4CRLA 3DB8A 3WILA 3LIJA 1I09A 5AV1A 2QOOA 3A99A 2ZOQA 3FPMA 4MYGA 4PMMA 5AAGA 3MY5A 5KKRC 3HMNA 1UU8A 2A0CX 3FZTA 1OL7A 2Z02A 5T6KA 3R2YA 2XK4A 4DGLC 3E62A 3FMJA 4B6LA 3UE4A 5CAUA 2VX0A 4YJOA 4XOZA 3HKOA 4MXXA 2VTSA 4A07A 4OBPA 3LXPA 4QP3A 3CTHA 4FL3A 4BRXA 4W9XA 4CCUA 2FYSA 4CLIA 3PLAE 3Q2MA 4F9BA 4IZ5A 3ZXZA 3ORKA 2OBJA 4APCA 3AGLA 4GL9A 2PSQA 4RFYA 3ZRMA 3QWJA 3PE2A 1RJBA 3JPVA 4H58A 4A4LA 4L00A 3ORIA 4DG2E 4EORA 4QNYA 4FL1A 5A4TA 4BKJA 4ZSAA 1AQ1A 3ENHA 3OY3A 1ZMWA 2VWIA 4YTCA 2HZIA 4I94A 2BAQA 2R3MA 1YWNA 4WOVA 3WF5A 4MVFA 4RMZA 3PY3A 4KIOA 4LUDA 3OCGA 3PE1A 4E5WA 2V55A 3ZEWA 1XWSA 3RPRA 3DFCB 4GU9A 3II5A 4D2TA 4Y5HA 1U54B 3QZIA 5CZIA 4FTLA 5K0KA 3DKGA 1WVYA 1WBSA 4FSWA 4QMPA 4BTJA 2J51A 5IQIA 2GHLA 3ODYX 2CLXA 4IM3A 2H8HA 2JIIA 5TOZA 5L4QA 3FMDA 4C59A 4C33A 3D15A 3GFEA 2Z7LA 3HRCA 3PVWA 3PY1A 2BHEA 4J8MA 3DOGA 4CYIA 3QTXA 2X4FA 2XH5A 3OXTA 2DWBA 4RQVA 3VUGA 2CN8A 2GHMA 1OKVA 1SVGA 4O38A 3EKNA 4MQ2A 2I0HA 4C38A 4I6QA 2ITOA 4ZLZA 4C36A 5CEMA 3O0GA 1ZYDA 3JR1A 3SD0A 4ASDA 5D10A 4FKQA 4L43A 4RFMA 4O7TA 3E8NA 5EW3A 3LFCA 1G3NA 2WOUA 3UP7A 4CSVA 2R3HA 4HW7A 3F6XA 3AD5A 5LCJA 5LARA 4H3PA 4NW5A 2WGJA 1URWA 1W7HA 4HPUE 3H0YA 2IW8A 4F0IA 5JZJA 4L68A 1UKIA 4AGWA 2HXQA 2XNEA 3QA8A 1Q8WA 1B38A 4N70A 3P86A 4AZEA 2OW3A 4UV0A 3D5UA 4FKIA 4Y8DA 4QTBA 4CRSA 3QKMA 4E6DA 4R5YA 2X9EA 5DH3A 1R39A 4GV1A 4KKGA 4I6BA 4MNEA 2CSNA 4ZTNA 4IX4A 4O1OA 4D4SA 3MV5A 4XP0A 4USEA 3ZLYA 4YGAA 2R5TA 5BQ0A 2F4JA 5JQ5A 3ROCA 3SRVA 3CKWA 3WIKA 3ZC6A 1Q8ZA 3U51A 2BR1A 2XP2A 1VJYA 4RVLA 4YJUA 3MWUA 3HA8A 3I5ZA 4BI1A 5IQBA 3QF9A 4IX6A 1OM1A 3LAUA 2W5AA 2O64A 1TQMA 3KC3A 4JR7A 5FEQA 4DTKA 5E4HA 4UYAA 1PXNA 1WBTA 3QRUA 4PTEA 5DT4A 2O2UA 3Q5IA 5LMAA 3R8ZA 3VBQA 3VHKA 4FKSA 3C4WA 1K3AA 3Q9YA 2WZJA 3JYAA 1Q3DA 2UV2A 3VQHA 2X2LA 5CU2A 3LMIA 4EL9A 4CQEA 1WBNA 2R7IA 3OOGA 5IUHA 1UWHA 1WMKA 4OT5A 4XMOA 4B8LA 5HO7A 4JDJA 4X2FA 5C03A 3DT1A 4RT7A 4MNEB 2VWVA 4IAKA 5ACKA 3ZFXA 4AS0A 1B39A 4IEBA 3MFUA 3Q52A 3SVVA 4IVCA 3O96A 3K5VA 3MY0A 2O8YA 1GZNA 3JVSA 4LL0A 5ACBC 4BN1A 5HE0A 3FPQA 3FQEA 2Y4IB 4O96A 1R0EA 3EN9A 1UU7A 2BZJA 3ET7A 4UBAA 3R7GA 3V5LA 5L6PA 4AQCA 1OVEA 2A27A 4J97A 4AOTA 1PJKA 4L7FA 3Q9ZA 1M2QA 4BGGA 5BMMA 4D9UA 2OO8X 4EJNA 4DE4A 1ZZ2A 3VVHA 4FKWA 4P7EA 2VWZA 4Q9ZA 3PDTA 3R04A 4RX9A 2PMIA 4XG2A 4IC8A 5CEQA 4EHGA 4M15A 4FUYA 4ZTLA 1M14A 3DAJA 2BKKA 4QYYA 1YHSA 3H9FA 5EDQA 4F99A 4FA2A 1E1XA 4KKHA 4FSYA 4BWPA 4F6SA 2R3QA 4FIEA 3UP2A 3UPXA 5HE2A 4RIWB 4R8QA 3BWFA 5C8NA 3U55A 4QMXA 5BYLA 4GFMA 4QP1A 4HGEA 4IX3A 4JG7A 1PRYA 3P23A 3K3JA 3LQ8A 3V51A 3K3IA 3V6SA 4B99A 5HKMA 2YERA 5JGAA 1IA9A 4ALWA 2CN5A 5IQEA 4A9SA 3HMIA 4GW8A 5CVHA 3ORMA 5ANOA 4Z9LA 3ZEPA 3W2CA 4I92A 2QOFA 4RA4A 2EXCX 3Q4ZA 5FP5A 1H4LA 3EL8A 5AUUA 3LFAA 2C30A 3VJNA 4CXAA 2CKEA 3W2PA 5IQCA 3KXZA 4QO9A 4RQKA 4J96A 2W05A 4DEDA 4USDA 3DBEA 2YM4A 3QTZA 1OUKA 3VUIA 4HZRA 4AA5A 4PX6A 2F7XE 4FK3A 5EDPA 4I0TA 3RHKA 3U6IA 3UJGA 1VYWA 2VTTA 3MDYA 3P7BA 4AAAA 4QMTA 5LMBA 2B54A 3KRXA 4RJ6A 3PXYA 4FR4A 2Y7JA 3R7YA 3POZA 3T3UA 4P5QA 3A7FA 3BELA 3FKLA 1H07A 1P5EA 1MQBA 2X8EA 3LCKA 4GH2A 4WSQA 4QQCA 4FICA 2JDVA 5JMSA 1Q97A 4X3JA 2DYLA 4ASZA 3W10A 3SV0A 3R9NA 4L3JA 4PDYA 1H25A 4L52A 3NYOA 2QOCA 4L6QA 3FXXA 4AGDA 3ELJA 4TWPA 3OF0A 5J7HA 3VS7A 3JVRA 5CT0A 3ZO4A 4UWCA 2PVHA 2A4LA 3W18A 4A7CA 4BDGA 3LLTA 4XG8A 4FYNA 1XJDA 3E7OA 4F0GA 2QC6A 2XUUA 1ATPE 4O0VA 3FWQA 3KRWA 3ZHPC 2YDKA 4M97A 4S33A 4G16A 3SG9A 4O84A 1Q61A 5IH4A 3AD4A 3UQGA 2GNIA 4XG9A 2R7BA 4EOQA 1VEBA 5FM2A 5KBRA 3QTWA 1PF8A 3KREA 3GCUA 2OK1A 4E20A 1XBAA 3DKOA 3TJDA 3ZTXA 4CKRA 5I4NA 2IVUA 3L8XA 4H36A 3U87A 1U5QA 3E3BX 4MBIA 5K4IA 4W9WA 2XIXA 2I0YA 5LVNA 3QD2B 5CLPA 4UXLA 4HJOA 2HWPA 4RIXA 3IDPA 4YJRA 2VX3A 2CMWA 3T3VA 3ZDIA 4TYIA 4BZOA 4NTSA 2C68A 2W1IA 2ESMA 2VN9A 4GYIA 4F7JA 4FF8A 2R3LA 4QTDA 3DJ5A 3S4QA 2F7ZE 3LFFA 5LVMA 2Y6MA 5IISA 3LXNA 3R30A 1UA2A 5AFVA 3Q32A 3MVMA 4LMNA 4R3CA 3V5WA 3OWKA 3MYGA 2ZDUA 3EYHA 3WBLA 1QCFA 4FTOA 4O7RA 3DJ6A 5E8YA 1YXSA 3DQXA 5DOSA 3UG2A 3LJ1A 4JRNA 4GG7A 2UZEA 3I6WA 4O22A 4XLIA 1W8CA 4F7NA 3EN7A 4NKSA 2WMWA 3UGCA 1J7UA 5DMZA 4J1RA 5EW8A 1OIRA 4IH8A 3ZONA 5K3YA 4BDDA 3VC4A 4C4EA 5CQWA 3RHXA 3D5WA 4G2FA 4U3ZA 3ZO2A 1NY3A 1W83A 3O50A 3PSBA 4LGDA 5FG8A 4AX8A 4CFWA 1O6YA 1Y8YA 3EH9A 4YNEA 4PQNA 2OSCA 1WVWA 2H9VA 2X39A 3E93A 3PZEA 3OUNB 4RIXB 2YLEA 5T68A 4EWQA 2WELA 1BL7A 4ZJJA 2GNFA 3MH0A 4P90A 4X21A 3KY2A 1J7LA 4ZMEA 3OFMA 2P55A 2QONA 5KMOA 2VD5A 3B8QA 2BIYA 3NLBA 4CMOA 1F3MC 2WOTA 3KRLA 4YZNA 1JQHA 2XYNA 5TT7A 5AUYA 3C0HA 3H3CA 5AAFA 3UQFA 1EH4A 4JQ8A 1H1WA 4XYFA 5CS6A 5BYZA 4JDKA 4FG8A 3ZFMA 3O71A 2VGOA 2IW6A 5IA2A 4JT3A 2GFSA 4IZYA 2NNWB 1ZAOA 3CIKA 4AFEA 4XNEA 2WAJA 5IA0A 3VS4A 1W98A 4XV1A 2AC5A 3AOXA 4X2GA 3PLSA 5CVGA 2R2PA 4DHFA 5A4EA 1JSVA 5AP7A 3SOAA 2WEIA 5IU2A 5ANGA 4EYMA 3OROA 3LE6A 5A46A 4I0SA 3CGFA 1TVOA 3FZ1A 1KV2A 3KCKA 2GNGA 2X4ZA 2WMVA 2XK7A 1KWPA 2HZ0A 4UZDA 5I9XA 3R9RA 3F2AA 3ZXTA 3F66A 3ZO1A 3NCGA 3VJOA 3LFBA 5M09A 1H08A 3G15A 3V5QA 4U41A 1ZY5A 4R1VA 2YIXA 3VW8A 2J90A 4TWOA 3FI2A 3R1SA 4L44A 3RK9A 5K9IA 3V8WA 3U6HA 4YLKA 2B52A 4G34A 2QODA 4YJVA 4FG9A 5D12A 2BRGA 4O86A 1XQZA 5ANJA 4DFUA 3WYYA 3OEZA 2C0IA 1ZMVA 3DBCA 2AYPA 2YIWA 4WT6A 3CR0A 4AGCA 4FTRA 2PVJA 3QCXA 3A2CA 3MTLA 3ZBXA 4L3LA 4BDJA 3AC4A 4J95A 4JAJA 4D0XA 4RWIA 3SOCA 3COKA 4IVBA 3JY0A 4QPMA 5I3OA 3DZOA 3VWAA 4QQTA 4FKOA 4DBXA 3BBWA 2F9GA 5IA5A 3CD8A 5AA8A 3P1AA 2GHGA 1RW8A 3EYGA 3MFTA 4FSQA 4C02A 4U40A 3H10A 2XZSA 5DR6A 5GHVA 4BCNA 5LOHA 4HYHA 4N6ZA 4BFMA 4Y83A 2RGPA 4FTTA 2UW6A 2QKWB 5IH6A 4AZVA 4L67A 3F3ZA 5D7VA 3I4BA 4R78A 4FTQA 2IZTA 2GPHA 1PXIA 2DUVA 4AU8A 1GZKA 1ZOEA 2J0IA 2R0IA 4ASEA 5FXRA 3R00A 4MWIA 4O2PA 3CJGA 2XIRA 4NU1A 3HLLA 3F5UA 4TY1A 3VRZA 4C3RA 3DXPA 4N4SA 2I1MA 3GCPA 5FTGA 3W1FA 3BLHA 2PVRA 4FT0A 5EM5A 3H4JA 4KAOA 2UVYA 3ZS5A 3LPBA 2FVDA 4AGUA 4ACHA 2WQNA 4LM5A 3RBWA 1Q24A 4ZK5A 2AC3A 3UMXA 4YUQA 3UQCA 2Z60A 2BZKB 4ZSJA 3FAAA 3G9NA 5M53A 4YR8A 4YO4A 5BYYA 4BBFA 3V01A 3Q5ZA 4XV2A 3DLSA 5JFVA 1G8AA 4GUBA 3QQFA 1RE8A 2C3IB 4HYIA 2ZJWA 1STCE 4GJ2A 3FI3A 4R1YA 5JT2A 4ZTQA 2JKOA 1Q8UA 1P4OA 4LGHA 4QP4A 1B6CB 4V04A 4PL4A 2VGPA 4FIHA 4DH8A 2XKEA 4CT1A 3SX9A 3Q6WA 5TE0A 4L8MA 5IA1A 2UZBA 5EKNA 2VTQA 1FOTA 3SG8A 2PE2A 3M42A 3IW8A 4WRSA 5L2SA 4ENYA 3ULZA 5IMXA 3ZYAA 4BDCA 3R28A 3QD4A 4IB5A 3E92A 5EHLA 4DGGA 4FEXA 2WB8A 2YIRA 4FMQA 3RCJA 5CEPA 1OIUA 3LMGA 5DRDA 2G2IA 5KUPA 4CV8A 4EOLA 5AUZA 1H0WA 4C3FA 4XV9A 2J0KA 4JBQA 1YXUA 2RFEA 1OL6A 3IW5A 3PVBA 4LRKA 4FL2A 4B8MA 2UVXA 4F09A 3TUBA 2PK9A 1CKIA 4Q5EA 4DFLA 2OGVA 4V05A 4G9RA 5CSPA 4GYGA 3BV2A 5ITAA 2PVYA 2XKCA 4O0WA 4AA4A 4S30A 1OB3A 3SLSA 4IZ7A 3R01A 2VZ6A 1XH4A 3NVKI 1Y6AA 3HDMA 3QALE 4DA5A 4IQ6A 4JI9A 3JXWA 4QNAA 4QQ5A 5HE1A 2OH0E 1Y8GA 2FA2A 3KF4A 3LVPA 3QUDA 4U3YA 2XIZA 4O27B 4HGTA 3ZSIA 3ZZWA 4FNZA 1Q5KA 5AUWA 3A7IA 3DPKA 5EOLA 3IS5A 2PPQA 3QC9A 4BCFA 4BCKA 4M13A 4DH3A 2ITUA 2UUEA 5HBEA 1Q3WA 5IUGA 3KQ7A 4YZDA 4F9AA 4RVMA 4FC0A 4YTHA 1NA7A 3A60A 5GNKA 4CZTA 4QYHA 2H96A 2PUNA 4AT4A 4BI0A 2G01A 4CFVA 3E87A 3FXZA 1YI4A 3LQ3A 2WTDA 2BIKB 3V04A 5TO8A 4PL5A 1AGWA 2C69A 4RIOA 3U6JA 2CJMA 4F7SA 4BWKA 2GTNA 2Z8CA 4V01A 5AM7A 4YMJA 5CF4A 1PXPA 3DXNA 3RAIA 2A1AB 1JSUA 4CKIA 4F64A 3WOWA 1FGIA 3NAYA 4G3GA 1WBWA 4RRVA 2C5OA 4QMVA 2ZM1A 3W2OA 3ZUTA 4RA5A 5ETIA 3WZJA 5HOAA 3VBYA 4EBWA 2Y6OA 3CBLA 2WHBA 3IECA 2BZHB 4XG6A 2IPXA 2GS6A 2B9JA 2WQOA 3RINA 5BVDA 5M06A 3EN6A 5E8UA 4BCHA 3F3UA 4DGMA 5AV3A 1KOAA 4Z16A 5D11A 2X8DA 2C4GA 3GGFA 1QPJA 3UNZA 4E6AA 3GOPA 4U5JA 3THBA 3SGCA 1OKWA 3DAEA 3VUTA 3ORZA 4U6RA 3ZH8A 2WXVA 3ZM4A 4R77A 3JUHA 5BVFA 2Z7SA 2OXDA 2XEYA 5FRIA 1RDQE 2PMLX 4XH6A 5HIEA 3I6UA 4GSBA 3HRFA 3LCSA 3LHJA 4RWJA 5E90A 4MBJA 3MSSA 1TKIA 3AQVA 4O2ZA 4EUUA 2CNQA 4FEVA 4DT8A 4U45A 2WMRA 3TEIA 3P9JA 4D9TA 4F4PA 4XBUA 3BI6A 4Y73A 3WZKA 5JFWA 2LAVA 3DFAA 2X81A 4M84A 2E2BA 4I5MA 5BVEA 3PXKA 3UODA 4EK5A 3HRBA 3CY2A 1QPDA 2VNWA 4JQ7A 4AZSA 1G5SA 4RX7A 3V6RA 3TXOA 3SAYA 3VS1A 4WSYA 5KHWA 4ZZNA 4LV5A 4NM7A 2JDOA 3GBZA 1WAKA 3PYYA 4KINA 2YABA 1PXJA 5ANEA 4L46A 5AR7A 5CU3A 4AFJA 2C3KA 3IOKA 5K0XA 1Z5MA 2EVAA 4IMYA 5HCYA 3HMPA 3TUCA 1G8SA 5KMKA 4F1MA 1BLXA 5AM6A 2BUJA 3HNGA 4IBMA 2JD5A 4E6CA 5ETAA 4D4YA 2GQRA 5CASA 4KS8A 3MVHA 1JKSA 4UWBA 4FTJA 4EH2A 4YPDA 4G6OA 5CEIA 1J1CA 1OPLA 4XRJA 2FH9A 2WPAA 3CC6A 5J9ZA 3KN5A 2EXMA 3HL7A 4BCQA 4R7IA 5LVOA 4G9CA 5AIRA 3WIGA 2BROA 3EN5A 1KOBA 1PMEA 5E91A 1OITA 3F82A 4CG8A 4XOYA 2LGCA 1NXKA 2I6LA 1GIIA 3DU8A 3NSZA 2P2HA 3UZPA 4E73A 2OF4A 5AP1A 3F61A 2VWUA 3BGQA 3PJ8A 3S95A 1JBPE 5JRQA 3E8DA 5D7AA 3N51A 4BIBA 4XG4A 3TV7A 4DT9A 1FGKA 4OLIA 3KCFA 5FXQA 2OU7A 4RJ5A 2C5VA 2QU6A 2WTWA 4CTBA 4D2SA 2UZWE 5H8GA 3R83A 2X7GA 3SW7A 2W4KA 4PP9A 3SKCA 1YW2A 3GC8A 1LUFA 3HZTA 5CYIA 4MD8E 3QA0A 1YDSE 4PRJA 4XV3A 3ZDUA 2ITZA 3EQPA 5TKDA 4F65A 1U54A 2UW4A 2BZIB 2X0GA 1PXLA 2UW0A 1YI3A 2NO3A 4HZSA 2GNHA 2WMAA 3NRMA 4GIHA 4Q2AA 5CSWA 4E7WA 5CAVA 3PWYA 5CXHA 2XYUA 5HE3A 3CTQA 4U43A 3N4UA 2E9OA 4NIFB 3LW0A 3FY2A 3NVMB 3HX4A 4Q9SA 4ASXA 1E9HA 3I60A 4GVJA 1CM8A 1JOWB 1PXMA 4GT3A 4JR3A 5LQFA 4FZAB 3Q6UA 2FSTX 4U81A 5C8MA 4BC6A 2HENA 5CX9A 3GEQA 4E4MA 4O6LA 1ND4A 1QPCA 1V1KA 5CEKA 3PTGA 3BU3A 5DVRA 3QXPA 3VS2A 4AUAA 3R9HA 3IG7A 4MAOA 2WTKB 3IOPA 3NNUA 3TV4A 2VTLA 3NW5A 4JAIA 5M44A 4FV5A 3CP9A 4W4YA 3KF7A 3D7TA 4I22A 2WQEA 4G3FA 4X0MA 1YHWA 2WIPA 2ITYA 4JL9A 5H9BA 4PPBA 3R2BA 2HELA 3EQIA 4EUTA 3RNIA 3LJ2A 4ACGA 4AW1A 1FPUA 3OP5A 4F6UA 4ANSA 3FBVA 4FKTA 4OTDA 4NK9A 3NYVA 3U8WA 3W2RA 2GCDA 3BX5A 3UVRA 4I6FA 3C13A 3PA5A 4NT4A 4D1XA 3RM6A 3PVGA 4EOIA 2QI8A 4O7LA 2DQ7X 2XNMA 4FKGA 4O7ZA 3LFEA 1H28A 1BMKA 3OC1A 4GG5A 4K33A 3R8MA 4PMSA 3PXRA 2NP8A 3I0OA 4EZ7A 2YN8A 3H9OA 1K9AA 4JS8A 2V7AA 4OBQA 4YTFA 4GU6A 4K8AA 3BHTA 5A6OA 2CGUA 1CKJA 1GZOA 3DZQA 5HICA 2QR8A 4NW6A 5I9ZA 5CF6A 4PPAA 4RJ4A 5HU9A 1FMOE 3VULA 2IZRA 3AMBA 2UW9A 4UXQA 1KSWA 2ZV2A 4QYEA 1SYKA 4FKLA 5KMIA 1FVTA 1H1QA 1OMWA 2X6DA 2XM8A 4JRVA 2WD1A 4BDAA 5IZFA 2XS0A 2B55A 2J50A 2PVFA 3MVJA 3NNXA 1PMVA 3D7TB 4BI2A 2XVDA 1GIHA 3ZUUA 2QG7A 2XRUA 4J8NA 4NYEA 4E4XA 5FGKA 2W0JA 3MW1A 4I4FA 5AR4A 4WNMA 3C0IA 2YHVA 2C1BA 3R0TA 1JPAA 4ANOA 4EZ5A 4JLCA 1U4DA 2Y9QA 2BCJA 3CCNA 4QT1A 4D58A 4F0FA 1Q8TA 2W9FB 1UVRA 3OVVA 4QQJA 3UTOA 4G5JA 4YZMA 2VX1A 4II5A 3BGPA 3BE9A 3QKLA 3NDMA 4KSPA 5C8KA 2XK8A 4WG4A 4UY9A 4ZMFA 4FT5A 3R22A 3D7ZA 3HDNA 4G1WA 1SM2A 4PTCA 3FMHA 4KB8A 1BYGA 1F5QA 5M4FA 3G0FA 5AR8A 5C1QB 4TN6A 4AOJA 5J1VA 2G2HA 2A19B 3W2SA 2X8IA 4FTKA 4I0RA 3FC1X 4RVTA 3IGOA 3MPAA 3P08A 5I3RA 3TM0A 3NIEA 4TZRA 2OXXA 4PNIA 3RJCA 3U4WA 2OIQA 3HVCA 4M7IA 5K5XA 3OWLA 3COMA 3OT8A 4BCMA 4IWDA 5L2WA 3U9NA 3MY1A 4W8EA 4IAYA 3RWPA 1KUTA 4ALUA 4TT7A 3CY3A 1ZARA 5DA3A 4AF3A 5IA3A 4RIWA 4V0GA 5A14A 3QBNA 4E8AA 4OTWA 5DE2A 5CZHA 2W06A 4RVKA 4O21A 2CPKE 4FVRA 4GVAA 5AUVA 3TZ9A 3KGAA 4GKHA 3ORLA 4MXCA 2VTIA 3KXXA 4Y5QA 3REPA 2RFSA 2RG5A 3AGMA 4B0GA 4JBPA 4DG3E 4PL3A 4AT5A 3PG1A 3GXLA 3BEAA 4FSNA 2X7FA 3QTQA 3EKKA 4M0YA 4RC3A 2JDSA 5L2TA 4O0RA 4AN9A 1GNGA 4ZEGA 3Q4TA 2C6EA 2F2CB 4ZLOA 3DDPA 3BU5A 2YZLA 2PZPA 4D4RA 1MP8A 1XH7A 3R8PA 5DG5A 4ANBA 2OJFE 3R7OA 3QD3A 4BWXA 2JITA 5DNRA 5ETCA 2YDJA 3GI3A 4O7YA 2WMSA 4KIKA 2R9SA 4IX5A 2C5XA 4I4EA 2OZAA 3CJFA 3FI8A 4ZY5A 2Z7RA 4DEHA 3UBDA 4IADA 3W8LA 3GC9A 5KO1A 3LM5A 4A9RA 2UVZA 1OPJA 3FEGA 3C4XA 1V0OA 4PWNA 3LFQA 2YJSA 1I44A 4FV0A 2CGWA 4ITHA 3MH3A 3QUEA 3SQQA 1DS5A 2OJIA 4CQGA 1SMHA 2EU9A 1QPEA 5F9EA 5A4CA 3PJ3A 3FQHA 3R1NA 5EHOA 2XK9A 4QMUA 3GQLA 3TCPA 2CKQA 4ZLYA 3DXQA 3R21A 3BHUA 2I40A 4IM0A 4XCUA 5A9UA 3VBTA 4YSJA 5JRSA 2PTKA 5IF1A 3TDVA 4C4FA 3UOKA 5B0XA 2Q0BA 3A61A 3ACJA 3BRBA 2HZ4A 1OECA 3R73A 4YNOA 3QYZA 3TNHA 5LJJA 2GQSA 3QQLA 3BYOA 3KKVA 2XJ1A 3DK7A 2JAVA 5EYDA 3RKBA 1PXOA 4E1ZA 4JDIA 4YBJA 4WHZA 4AE9A 3DB6A 3MFSA 4BDKA 2ERZE 4KIKB 4C3PA 1V0BA 4AXAA 2PU8A 5AMNA 2OZAB 4ANMA 4IIRA 2I7QA 2CNUA 3ZBFA 3F2RA 2YZAA 2XNNA 4RLKA 4R3PA 4QMYA 3A4OX 4FEQA 3ETAA 5EG3A 1W0XC 3OT3A 1OZ1A 1H24A 2XA4A 2CHLA 4IFCA 4TWNA 3NWWA 4DFXE 5BPYA 3A7JA 4QMMA 1H1RA 2G9XA 4IWOA 4PPCA 2O5KA 1H0VA 1OBGA 5HQ0A 1GIJA 3OBJA 4J98A 5BVKA 4DCEA 4HYUA 4JX3A 2VTOA 4K18A 4MH7A 3EFKA 4DFNA 4DLIA 2YWVA 4HNFA 2C3LA 1VZOA 5AX9A 3AXWA 5FLFA 3QQGA 4X3FC 1PW2A 1DI9A 1BX6A 1KE5A 2QOQA 2XBJA 4ARKA 4PDSA 3NW6A 1YOLA 5TR6A 4IAFA 1FVRA 5HI2A 3KULB 2F57A 4NTTA 2YCRA 1YRPA 4I5PA 3PA3A 2JKKA 3GU7A 4BYJA 4F1TA 4CKJA 5KKRB 3P79A 3BBTB 3MJ2A 4J53A 1ZXEA 4JX7A 3V8TA 5HLWA 4FBXA 5J9LA 2J5FA 5J5TA 5LWNA 3R6XA 2VTJA 4YC3A 2YM8A 4EOMA 3U9CA 5CENA 1Z9XA 3GQIA 3P4KA 5C4LA 3UIMA 4MXZA 5FTQA 1ERKA 2YM6A 3QTSA 2QCSA 5HD4A 3OZ6A 3QAME 3H0ZA 3TI1A 4UWYA 4OTGA 3M2WA 3GU8A 3MBLA 4JVGA 4TYJA 4QTCA 3RI1A 3GC7A 3V5TA 4CD0A 5AR3A 4D55A 5BNJA 3HAVA 2QD9A 5HCXA 4JJRA 4NCTC 2UZUE 5B2MA 2YFXA 3ENMA 4OR5A 2ITNA 4EHVA 4HPTE 2SRCA 3BU6A 4TYGA 3D2KA 2GU8A 2ETKA 1R1WA 3EWHA 3HV6A 3PPZA 4LRJA 4ZJVA 4RJ3A 4P5ZA 5CAOA 4BZDA 2W4JA 5CSVA 2YWPA 3Q9XA 1LP4A 4RJ7A 4BIEA 4LMUA 4C4HA 3VF9A 3B2TA 1ZWSA 3FHIA 2YIYA 4H05A 4W4XA 3LQ5A 3FLSA 4FZDB 5AA9A 2R3KA 3RWQA 1KE9A 2W99B 4DBNA 5DYJA 3I5NA 4E5AX 2OF2A 1JVPP 4DEIA 3QFVA 1T45A 3RP9A 3TACA 4IB0A 3HAMA 3TNPC 2JGZA 2QO7A 4JIAA 4PDOA 5HHWA 5CANA 1ZZLA 2QO9A 3A62A 5JFSA 5JFXA 2PMOX 3PY0A 4EI4A 3CD3A 3LCTA 3TT0A 3OBGA 1ZYJA 5ANKA 4XEYA 3WI6A 1Q4LA 3FXWA 3IDBA 5KBQA 3FMMA 4QRCA 4EEVA 3DNEA 4I5HA 3VBXA 3QX4A 4TNDA 5HU3A 3IW4A 4OTIA 3NGAA 3EQRA 3FDNA 1YDTE 5LMKC 2IN6A 2XCKA 1JLUE 2R4BA 4NSTA 4QPSA 4OAUC 3HUCA 2WQBA 3PIZA 2HY81 5B7VA 2WMBA 3LM0A 5KZ0A 4PDPA 3LJ0A 3OW4A 2Y8OA 2WTJA 3BYMA 5EW9A 3VUKA 2P33A 4I20A 4A4XA 1PYEA 4P2KA 5CSHA 4E26A 1H27A 2GDOA 1XR1A 3HV3A 4UN0C 3D9VA 1H1SA 4GFGA 3ZLWA 5HBJA 4F9YA 2X7OA 3I81A 2XNGA 4D5HA 4CMTA 2YJRA 4O83A 4FKJA 3PSDA 1YOMA 1CMKE 5M51A 3I79A 4QMLA 4FT9A 4L45A 2R3RA 4AOIA 3FYKX 5LVPA 3IQ7A 1JSTA 4FEWA 3EQGA 3ZRLA 4APPA 1CDKA 2ONLC 4G17A 4PP7A 4O7WA 5HG8A 3RAHA 4BR3A 2W1HA 2CCHA 3F5PA 5IMEA 4CNHA 4FV1A 4BDIA 4E4NA 1ZOHA 2WTIA 5GIPE 4U42A 4MD7E 4OUCA 2VV9A 3RPVA 2PZRA 5E1SA 1LEZA 5F95A 3EQCA 1H8FA 5EH0A 5BMSA 5IH5A 3FZOA 4UMRA 3MH2A 1V0PA 3AT2A 4FODA 5BVNA 1IAJA 2HAKA 4C58A 3LXKA 3MN3A 3O2MA 3W16A 4A06A 4HVHA 4AP7A 3CSVA 2XJ0A 4KKEA 5CWZA 1IR3A 1PXKA 4ZIMA 3QHWA 4BBEA 1UKHA 1S9JA 3OW3A 4LI5A 2VTRA 2WFYA 1IG1A 3KRJA 3PIYA 2W7XA 4QP6A 4CGAA 3BV3A 3MS9A 3W2QA 3BQCA 5L3AA 2QU5A 3QTUA 5GJGA 4U8ZA 4CFMA 4X2JA 4I21A 3LFDA 1XBBA 3TJCA 2V62A 3NMUF 3G6HA 4W4VA 3AC5A 5AP5A 3UPZA 1MUOA 5GJDA 1Y57A 5JZNA 3MPMA 3NZ0A 2PUPA 2HZNA 4HOKA 3NYNA 3POOA 3G90X 2P3GX 4WUAA 3JS2A 3F3TA 3E3PA 2HY0A 5KZIA 3E64A 5GZAA 1CKPA 2YITA 3VBVA 1JKTA 4J99A 3FQSA 2PE1A 4ZTMA 1YOJA 5IQGA 2XK3A 4WNKA 1HOWA 3MFRA 3BQRA 3NUSA 3PXQA 4FKPA 4MCVA 3EMGA 4AACA 5CY3A 5I5ZA 4FKVA 5FD2A 4H39A 2JDTA 4IJ9A 1REJA 4FX3A 5FEEA 4CMUA 2PUUA 2VTPA 3L8SA 4DEBA 2XKFA 3ZLXA 4WRGA 4E5BA 3P5KA 3MA6A 3RPYA 2V22A 4MD9E 4IZAA 2J0MB 5GJFA 5C26A 2W4OA 2OG8A 5DRBA 3TKHA 4BCPA 4GK2A 4IFGA 4IWPA 4AA0A 4IVDA 3MH1A 1QMZA 1W84A 3BHHA 3I1AA 4RC2A 5KMMA 1SZMA 5G6VA 5J7BA 2CDZA 2WMQA 3VQUA 2VTMA 5FQDC 2BDWA 1U5RA 2OIBA 3F5GA 4IB1A 5FWKK 2C47A 1TQIA 2QOKA 3C5UA 5M55A 4LFIA 4X6RA 3F7WA 3WARA 1F0QA 5DEYA 4NH1A 3RNYA 5EI6A 1RQQA 2IO6A 4NFMA 3G2FA 3KN6A 4BDHA 1NT2A 3ZSGA 4IAAA 1PKGA 3AC3A 4ZS0A 4ZZMA 3C1XA 1KE8A 4PTGA 4IDTA 2ZAZA 5DR2A 3ZFYA 2PULA 4O91A 4W8DA 1WFCA 5KMLA 1KV1A 4TW9A 4UEUA 5E8WA 5FDPA 2XB7A 2B9HA 5D9HA 3UO5A 2E9VA 5EKOA 2WO6A 1PYXA 4OT6A 4WIHA 2HK5A 2WIHA 3CPBA 4Q5HA 4O7SA 4EWHA 4EKKA 3CKXA 2RFNA 4E6QA 2VWWA 3QWKA 3C4FA 3EIDA 1X8BA 4G3DA 3UOLA 3CQUA 3TZ7A 3MB7A 3EFWA 4FIFA 1OUYA 2R64A 4X7QA 5DT3A 4XUFA 3FZSA 2HW6A 3Q3BA 5M4UA 3TN8A 4HCVA 4QTEA 3VW6A 4CFXA 3D4QA 3LLAA 5EK7A 5C4KA 5K4JA 2R3IA 4FSTA 4DC2A 5EM7A 4LQMA 4U9AA 3Q53A 5EYKA 2JBPA 5HBHA 5IQAA 4QMWA 5HESA 5H8BA 3VIDA 4YBKA 4NM3A 1SVEA 4FV8A 3LZBA 2FSMX 3KL8A 3ID6C 4NZWB 2CNVA 3OHTA 2J4ZA 4EHEA 2OLCA 3KU2A 4OTHA 2Z2WA 4Y85A 5J87A 4A9UA 1BKXA 4KUJA 4BCIA 2R0UA 3UC4A 4C35A 4J71A 4ZOGA 4DH5A 3G33A 2B9FA 3ZRKA 3UNKA 4YHJA 5H8EA 4BDEA 2ETRA 3PXZA 5CF5A 5IEYA 4KA3A 2JDRA 4FTMA 2BDJA 5GINE 3C4EA 4AN2A 3W8QA 1MRUA 2VTHA 4YURA 2F2UA 5DLSA 3NEWA 4LV8A 4HVSA 3TWJA 5CI7A 4EH3A 4RIYB 2WTVA 3K5UA 4WBBB 4ERWA 1URCA 3B2WA 3NX8A 3KMUA 2B9IA 1O6KA 1IA8A 1Q99A 5GZ8A 1CSNA 5HNIX 1JWHA 5DR9A 4LYNA 2JLDA 3DAKA 4O0TA 3ACKA 4DITA 2QR7A 4ZJIA 4EH8A 5DT0A 5L8LA 2Y4IC 3NIZA 3Q96A 4QPAA 4NUSA 1K2PA 2OJ9A 3E7VA 3ZO3A 3KB7A 3TG1A 3DBDA 4DF3A 4O7VA 3AT3A 3D0EA 4BGHA 4JG6A 1GAGA 3EQDA 3HV5A 4QMOA 2C5YA 4CFNA 1YQJA 4EK8A 5KMNA 4EQCA 4OGRA 5CU0A 2XKDA 3CTJA 5E8SA 3E63A 4O82A 3GNIB 3IDCA 3WYXA 3FI4A 3CS9A 4ZTHA 2X9FA 2VO6A 3E5AA 2YAKA 4QP9A 5EI8A 5CALA 3T9TA 1WZYA 2C6TA 4JOAA 3PRFA 3UOHA 2QKRA 3Q2JA 5E8VA 3MA3A 1L3RE 4U79A 4QP2A 4YJSA 5KHXA 3NUUA 3HGKA 4DINA 4ITJA 4CG9A 1DAYA 1YWRA 3Q04A 2CLQA 4GCJA 2R3JA 3FMNA 2G2FA 4GRBA 4K9YA 2YM5A 5L6OA 4EYJA 3UYSA 3BHYA 2ZM4A 3TL8A 1MQ4A 4NIFA 3R8VA 1ZY4A 3QU0A 4O7NA 3OD6X 5HTCA 3OWJA 5CVFA 4B9DA 5JGBA 2FUMA 2VNYA 4CYJA 3BWJA 2REIA 4BHZA 4EC8A 1JAMA 3F69A 1WVXA 2JKQA 3F88A 2GNLA 2J0JA 5CAPA 4RGJA 3A8WA 3KXMA 4FNYA 4ALVA 4LL5A 1UNGA 4FIIA 4FKUA 4YLLA 3T9IA 1FQ1B 2J6MA 4UMQA 5IQFA 2OJGA 3DDQA 4HYSA 3HP5A 3ZMMA 1XBCA 2IZSA 4OTRA 4XRLA 3WZDA 1VR2A 2VTNA 3BHVA 3O8PA 4GEOA 5KX8A 4WNPA 4JBOA 2PVLA 2YAAA 4IW0A 4A9YA 1YDRE 3DTWA 4FSMA 3C7QA 3OTUA 2XNBA 4IAIA 4WA9A 4FT7A 3QLGA 1FVVA 4IWQA 4C2WA 4FNXA 2UZVA 3SW4A 3VBWA 1M2RA 4MXYA 1ZYCA 5H2UA 3FLYA 3WZEA 2V0DA 3SXRA 1PMNA 2CKPA 3OEFX 3F7ZA 1XKKA 3FE3A 2X2KA 3BCEA 4CT2A 1OPKA 2W1GA 1BI7A 5BUEA 1YXXA 2BALA 2IJMA 2WMTA 3QLFA 4ZTRA 3GT8A 3WZUA 1AD5A 2BHHA 3FJQE 4AZFA 5AEPA 3S1HA 2PYWA 3GVUA 3GCVA 4FV6A 3VUDA 3D5VA 3ANQA 2EXEA 3LKMA 3OUKA 2HXLA 4F6WA 4RWKA 3GCSA 3MI9A 3NUNA 4ENXA 5JKGA 2W1FA 4FSZA 3VUMA 3IGGA 2FSLX 2PZ5A 4FV9A 5A4QA 5DIAA 4G3EA 3SXFA 3PVUA 3QKKA 4KD1A 2A2AA 3QGYA 2P2IA 3U54A 3QCSA 5DFPA 5AX3A 4Z55A 1U46A 3VF8A 3OWPA 2VUWA 5LXMA 3EZVA 5L2QA 1P2AA 4BCJA 5JQ8A 4AW2A 1Y6BA 4S31A 4FT3A 1Q62A 3H9RA 5CSXA 1XH9A 1ZYSA 4IVAA 1SVHA 3QZHA 5JH6A 1WBPA 2HCKA 4PV0A 3N4TA 3PWDA 1DM2A 4YHTA 2R3GA 1UU9A 4ZSLA 4DGNA 4IJPA 5L8KA 2VO7A 3R8UA 5EQYA 5AUXA 3LCOA 4ID7A 4P4CA 5FM3A 5E92A 3SDJA 3VNTA 4MXOA 4FTIA 5KE0A 4ORKA 3RCDA 4MKCA 3QZGA 2OFVA 1OKZA 2PMNX 4AZWA 3KMMA 1ZOGA 1WBVA 5A3XA 5I9WA 4FVPA 4HGSA 3TTJA 3N4VA 4PNKA 4Z7HA 2ITXA 5EHYA 4HGLA 3RPSA 3NW7A 3DV3A 4I5CA 4RFZA 3EOCA 4X2KA 4ITIA 4NM0A 4U97A 4B4LA 3HMMA 2RKUA 2ITPA 5EQPA 4AZTA 4UMTA 3RM7A 4C4GA 4TRLA 1REKA 4G6NA 1SNXA 3TNWA 4XP3A 3UO4A 3BGZA 3DGKA 3FMKA 2IG7A 2WMUA 3ZC5A 5JSMA 4I41A 4FSUA 2BPMA 4BTFA 3AMAA 3MTFA 3O8TA 3L9LA 2QOLA 5CAQA 1PY5A 2C0TA 4Y46A 5A54A 3I0QA 4FEUA 3QQKA 4L53A 5AV4A 3KVXA 4KIQA 4QMSA 3W32A 4EK3A 4XG3A 4M68A 5FXSA 4GJ3A 3DK6A 4RG0A 5IEXA 3MPTA 4QMZA 1ZMUA 4K11A 4PMPA 3D94A 4U80A 3Q4UA 1BUHA 2C6DA 3CQEA 4FIJA 5AP4A 2BRBA 2YDIA 4FV4A 4WG5A 3RZFA 4PF4A 4LUEA 5CQUA 3I7BA 4M69A 4U44A 5HIBA 3AC8A 2KTYA 3DTCA 2YCQA 2PZIA 1GJOA 2C1AA 2EB3A 2GS2A 2W96B 3FHRA 3KMWA 2J9MA 2YACA 1HCKA 4WO5A 3SC1A 5ANIA 4BTKA 4FKRA 5EOBA 4EK4A 1H00A 1JKKA 3F3VA 2I0VA 2C6IA 4OAVB 2VWXA 2X1NA 5FEDA 5CU6A 3PRIA 4ZS4A 1R0PA 5K5NA 2RF9A 3FV8A 4QMQA 4UB7A 4EBVA 2GNJA 4XBRA 4YC8A 4E93A 1OBDA 3NS9A 3RK7A 4F1OA 4MHAA 4Y95A 4EOJA 2YA9A 2B0QA 4AWIA 3QRTA 3C9WA 4BF2A 3RK5A 2ACXA 2FO0A 2XMYA 4KRCA 4K0YA 5DGZA 1XH5A 4EONA 1ZYLA 4IAZA 5HVYA 1TQPA 3HEGA 2PY3A 5LVLA 5LWMA 5J95A 2ZB1A 3GC0A 4MX9A 3QCYA 3CGOA 5JEBA 3BZ3A 3KK8A 4M69B 3NR9A 1LEWA 2XIKA 2JIUA 3ORNA 4YHFA 3VO3A 2NPQA 4WNOA 2QVSE 2B4SB 2ITTA 3PSCA 3Q4CA 4BDBA 3QUPA 1A9UA 4N57A 4IXPA 2CGXA 5HTIA 3TIYA 3OS3A 2C0OA 2F7EE 3KVWA 4ACMA 5EM6A 3BYUA 4ZXTA 2BTRA 4DFBA 3EL7A 3IKAA 3NPCA 5HO8A 5AWMA 4EOPA 3ODZX 2X6EA 2BILB
chains in the Genus database with same CATH superfamily
2UZDA 4KBKA 5DEWA 2W5BA 3DLZA 2RIOA 4IB3A 4JDHA 5AP2A 3SRVB 4LOOA 2X0PA 5IQHA 2PHKA 4RBLA 3H30A 4FOBA 1NW1A 4KNBA 3IW7A 1BL6A 1M2PA 3FLNC 3PG3A 5HD7A 5J8IA 3R9OA 3TUDA 1J1BA 3FUPA 5D1JA 5DWRA 2UZOA 4I23A 1YXTA 4MXAA 3V3VA 3BE2A 2ZMCA 4Z7GA 2XM9A 3EFJA 2BKZA 3ZZEA 2HW7A 4FZ7A 5EM8A 1M52A 1KE7A 3GU4A 3GFWA 4I1ZA 5H3QA 1YHVA 3U4UA 3DK3A 3IK3A 5C01A 4ZAUA 3BLQA 3OCTA 4GK4A 4R5SA 4FIGA 1GOLA 3LFNA 3Q60A 4ZSEA 3CQWA 1ZRZA 4WD5A 2HYYA 5E1EA 1KE6A 3R7IA 1M17A 3F9NA 3KULA 3ORXA 5M07A 4EOKA 4RSSA 4NL0A 3A7HA 4NWMA 4FYOA 4DEAA 3QTRA 4KBAA 4V0GB 5A6NA 2C6MA 4R3RA 3A7GA 3PP1A 4KS7A 3VUHA 4EK6A 4FTUA 5ETFA 3NCZA 4H1JA 3ATSA 5AAEA 4CZUA 3WF9A 4TXCA 3PUPA 4BGQA 2GMXA 3DA6A 1Y91A 2W1ZA 5AP6A 3O8UA 2XEZA 3UO6A 4C61A 4D2WA 5IG1A 5KCVA 2W1DA 3VHEA 1OL2A 2Y0AA 3CPCA 3EHAA 4IC7A 5KNJA 4FTAA 3PA4A 2EB2A 5CNNA 1PHKA 2ITQA 5T3QA 2QNJA 1OIYA 4YJPA 3VN9A 4N0SA 2E9NA 2O63A 1Q8YA 2ZMDA 4AXFA 1VYZA 4A9TA 2IWIA 4C34A 2XCHA 4ZZOA 1OGUA 2XRWA 3ITZA 2OWBA 4MBLA 2RG6A 3CLYA 4Y72A 2H34A 4LRMA 4EH9A 4K6ZA 4UX9A 3C50A 3NYXA 4OTFA 1H1PA 1U59A 2IZUA 3QCQA 4EC9A 2J7TA 4JG8A 4F9WA 1LPUA 4N6YA 2YIQA 4Z3VA 2RL5A 3OCBA 4EZ3A 5DN3A 5A4LA 5C9CA 3Q9WA 3DBQA 2IVVA 2OZOA 3UIBA 4C57A 4DGOA 1ZLTA 1OI9A 3OCSA 4M14A 3AT4A 5HLPA 4BIDA 4WG3A 4C4JA 5M4CA 1M7QA 3COHA 3DKCA 4EH5A 3OY1A 4DFZE 2PUIA 1NVQA 4TNBA 3A4PA 5IUIA 4MK0A 2KULA 2UW5A 4XJ0A 5E8XA 3AG9A 3VS5A 3WF8A 1UNLA 4BBMA 1S9IA 4JIKA 4KWPA 3OTVA 5HNGA 4DH7A 5M56A 1OL5A 1H01A 2V7OA 1LR4A 3G5DA 5BVWA 5HG9A 3TNIA 5M08A 3FKNA 2E9UA 4FGBA 4U0IA 5IDPA 1J7IA 5C27A 3QRKA 5J79A 2ZV7A 4IANA 3OMVA 2P0CA 4MF1A 4CTCA 4RX5A 5E8TA 4YJQA 1T46A 4S34A 5M4IA 2ZB0A 4KABA 3CXWA 3KRRA 4FK6A 5DPVA 3EQFA 4QD6A 3F2NA 4ZTSA 3HYHA 4YZCA 1FMKA 4MWHA 4TWCA 4QYFA 3UVQA 5FTOA 2WU7A 3NUXA 5LCKA 4BDFA 4R7BA 3AD6A 3O7LD 2Y4PA 3D2IA 4FV7A 5G1XA 3VRYA 3COIA 3UVPA 2HOGA 1FBNA 1O6LA 4BB4A 3GB2A 2QOBA 2WU6A 1W82A 2XK6A 2IEWA 3BIZA 3KEXA 3QHRA 3LCDA 3RGFA 4AW5A 4CFUA 4F9CA 4GKIA 3FKOA 2RFDA 4S32A 4C2VA 1IASA 3EJ1A 4O6EA 2FGIA 4AN3A 4DLJA 2PE0A 4DEGA 1CTPE 3F5XA 4MQ1A 5EFQA 1OKYA 5F94A 5HG5A 4DN5A 4D2VA 5F20A 2XBAA 3IPHA 4LOPA 3DJ7A 3V5JA 4QMNA 3SHEA 3PFQA 3CE3A 4AG8A 4EH7A 5D41A 5AUTA 4TKSA 4BTMA 4FI1A 5IPJA 2BRMA 2QHMA 3QRJA 2XARA 4WBOA 2P4IA 4G6LA 4XX9A 2UW7A 4NKAA 5HO6A 4AT3A 4FE2A 2O3PA 3V5PA 2R3FA 4EOOA 3JY9A 2JFLA 1PKDA 1XMLA 2J5EA 2PWLA 3QQUA 1JNKA 4M66A 5I9VA 2Z7QA 3TNQB 3HUBA 3L9MA 3O17A 2PVKA 4G5PA 4H1MA 4M67A 3PIXA 1R3CA 2JKMA 4NFNA 4OTQA 4TYEA 4K1BA 1UU3A 2AUHA 2BTSA 2CGVA 3DY7A 2J2IB 4EJ7A 3HP2A 4BY9E 2YM7A 3GP0A 4PUZA 3RAKA 5L2IA 4RZVA 4ERKA 2J0LA 3MIYA 3G51A 3B8RA 4ACCA 2BVAA 4AE6A 4R6VA 4A4OA 5HEZA 4M8TA 3FL5A 5HGIA 3TKIA 5IDNA 4D2PA 2O65A 4C8BA 5CT7A 4ANQA 1IAHA 4YP8A 3GU6A 3TKUA 2YLFA 2C6LA 2OH4A 1XH8A 4XHKB 4B7TA 4DH1A 4EH4A 5FUTA 3LFSA 1R78A 4BL1A 5JK3A 2G1TA 2GS7A 3ZU7A 3MJ1A 2JFMA 5HTBA 2WNTA 3L9PA 3P78A 3G0EA 2BDFA 3UZRA 4RJ8A 2ZVAA 5E9EA 4F63A 2OICA 2UZLA 3KFAA 2I0EA 4D28A 2FB8A 3O23A 2Q0NA 3E8EA 4L7SA 3MB6A 2QURA 2QHNA 2JC6A 3NUYA 4ZP5A 1OL1A 1IEPA 2W9ZB 4ACDA 3LMHA 3BLRA 5CNOA 4DTAA 4DFYA 3PZHA 3SA0A 4RWLA 3BYVA 1UWJA 3ZSHA 4K77A 3FC2A 4RLLA 4R7HA 4UMUA 3RTPA 3EQHA 5CEOA 3R71A 3SXSA 2R3PA 4EHZA 3UZTA 1WCCA 4GT5A 5EDRA 4FSRA 4G31A 4JXFA 5ANDA 3ZCLA 4DYMA 5HX6A 4ANLA 3QQJA 4ZSGA 5HLNA 2BRHA 1BI8A 4OW8A 4HVIA 4EOSA 5EQEA 5J1WA 4MTAA 4XG7A 1GZ8A 2BRNA 2YISA 3L8PA 2PL0A 2JBOA 4KBCA 2B1PA 2GSFA 2ZV9A 5TF9A 2QLUA 5E7RA 4L42A 5HX8A 3R02A 3ULIA 4YPSA 4YC6A 4JBVA 5GZ9A 2V5QA 5L8JA 4F08A 2JAMA 5ICPA 4FGRA 4USFA 3G6GA 1YWVA 4DTBA 3BKBA 4S2ZA 3M11A 3ERKA 2W1CA 3TZ8A 3GUBA 4IE9A 1Z57A 3PJ2A 2C6OA 3UDBA 4FOCA 3MIAA 3M1SA 3DQWA 3DNDA 4FVQA 4D1SA 4YTIA 3RVGA 4MF0A 4O0SA 4J7BA 2NRYA 1APME 2Q83A 2X0QA 4C62A 2PVMA 3E88A 3ORTA 3NNWA 2EWAA 4IDVA 3FLZA 2NRUA 5IA4A 3KA0A 3T8OA 4BICA 4EKLA 4PMTA 2WTKC 4GT4A 1HCLA 4CEGA 3R1YA 1L8TA 1SNUA 3P7CA 4L01A 5F1ZA 3KK9A 4DCAA 5B2LA 4HCUA 4GFOA 3K2LA 5J9YA 2B53A 4OBOA 2RSVA 5CU4A 4BKZA 3AMYA 4GMYA 4YZ9A 3PJ1A 4YJNA 2C6KA 4GK3A 4QTAA 1PMUA 2OIDA 3MGYA 4X2NA 2UZNA 4X3FA 2ZM3A 2OXYA 5FBOA 4YZBA 5BUJA 3UNJA 3FSKA 3QYWA 3VS3A 4O1PA 3QTIA 4C37A 4ZY4A 3ORPA 3ALOA 4QOXA 5EYCA 3RZBA 1YVJA 5AV0A 3PPKA 4L9IA 4DG0E 2VU3A 2XIYA 4NEUA 1WBOA 3PP0A 4CZYB 3MESA 4M0ZA 2XJ2A 4IACA 2ZDTA 4EQMA 4TYHA 3P5JC 3P7AA 3R8LA 2QOHA 4NJDA 4D0WA 3DS6A 5CF8A 2VAGA 3AC2A 2XNPA 5AR5A 3RPOA 3R7UA 5HZNA 2W1EA 1A06A 1H26A 4FZFB 4EQUA 1P4FA 3MVLA 3LOKA 3R1QA 1UNHA 2BMCA 3QGWA 4NCTA 2HWOA 4J52A 3WF7A 1IRKA 2WKMA 5I9UA 4X3FB 5I9YA 1NVRA 3S0OA 4O0XA 3C0GA 3FLWA 1NVSA 2ETMA 2QQ7A 3L1SA 4GS6A 4NJ3A 2YM3A 5FBNC 5AV2A 2IW9A 3GENA 5AP3A 4RIYA 4D4VA 5AP0A 5EYMA 3O7LB 3KXGA 4GIIA 4W4WA 2BFXA 3EN4A 3VS0A 5F4NA 4WKQA 2XF0A 3QRIA 2HIWA 3NNVA 3QD0A 5HVKA 5CTPA 1XH6A 2WTCA 4EH6A 3C4ZA 2IVTA 4AW0A 4ONAA 4M3QA 4MNFA 5AJQA 5BUIA 2ERKA 5HCZA 3BYSA 2YEXA 3HV7A 2BAJA 4TYHB 3WE8A 2YCFA 5HNBA 4CFFA 3UYTA 1A48A 2IVSA 1QL6A 3UMWA 4K2RA 4PY1A 3N9XA 5L6WL 3UC3A 3VS6A 4BZNA 3R63A 5BX0A 4TTHB 3PPJA 3R9DA 2F49A 4JQEA 4LV7A 5IEVA 4IHPA 4QP7A 3R7EA 3RAWA 3KXNA 3O51A 5DBXA 4BCGA 2VWYA 4I6HA 4ANNA 4BYIA 5BVOA 4CLJA 5JN2A 3VAPA 2VO3A 5M57A 1DAWA 3E8CA 3ZUVA 1J91A 4TPTA 2ZV8A 3QL8A 5LMKA 2GFCA 3PXFA 4I6LA 3IONA 3IW6A 3WF6A 1UV5A 1E1VA 3HECA 3NUPA 4HVGA 2OJJA 3L8VA 4I93A 4O0YA 3HMOA 4BCOA 2BFYA 3FZPA 3L9NA 3OXZA 3FSFA 5HIDA 3I7CA 2H6DA 3A8XA 4FNWA 4U7ZA 2QOIA 5KMJA 3RALA 3TV6A 3UIUA 1OIQA 3S3IA 4F7LA 2WEVA 2W17A 3HV4A 4LGGA 1O9UA 2VRXA 2XNOA 2PVNA 5AIKA 2QO2A 4FV2A 4BHNA 5EI2A 2VO0A 3QQHA 3UOJA 3EQBA 4I3ZA 3C51A 3W33A 3GCQA 4E3CA 3NUAA 4QP8A 3GOKA 5AADA 1J3HA 2WQMA 4UZHA 3ZOSA 5DI1A 4HCTA 4FTNA 3ZLSA 3HA6A 4C4IA 3K54A 2B7AA 1XHAA 3OOMA 4XS2A 4D5KA 4YU2A 5HG7A 3ANRA 3QC4A 5AR2A 5CI6A 1DI8A 3LXLA 5HVJA 4TL0A 2JEDA 4FZ6A 3UG1A 1FINA 3AC1A 3ALNA 3C4CA 2ONLA 2WMXA 3OG7A 2FSOX 4KRDA 3W55A 1MRVA 4X6QC 4GUEA 2UW8A 2DS1A 4H3BA 4JNWA 5HORA 4F70A 3UIXA 2UZTA 1GY3A 3FY0A 3DCVA 3BEGA 5E8ZA 4C0TA 2O0UA 1JKLA 1P14A 2UW3A 3D5XA 3TIZA 4FG7A 4O0UA 4UYNA 3ROYA 4C7TA 1MRYA 4CCBA 2OFUA 4I24A 2JIVA 4YLJA 3EB0A 4MEDA 3NAXA 3TZMA 2EUFB 4OTPA 4RX8A 4HVDA 2QG5A 4IM2A 4L3PA 4QYGA 1YXVA 5DHJA 4D2RA 4CV9A 2C3JA 3FL4A 5IKWA 3DKFA 3P0MA 2GQGA 3FLQA 1M7NA 4YSMA 4H3QA 4BVUA 2ZYBA 2CCIA 4XLVA 4E4LA 3QZFA 4XP2A 4ZY6A 5FDXA 3OXIA 2GTMA 3DBFA 4CVAA 2ITWA 4FUXA 3TDWA 5I0BA 4BKYA 3W0NA 3IO7A 5GIOE 3FMLA 2R3OA 4G3CA 3G9LX 4NM5A 1XO2B 3D14A 2X2MA 3QX2A 4RC4A 2W5HA 3W0SA 4DEEA 2CKOA 3PJCA 4FTCA 4LG4A 3S2PA 5IQDA 3RMFA 4LOQA 3TTIA 3ZM9A 2ITVA 2G15A 3F3WA 4FV3A 2OKRA 1YI6A 4RPVA 5FP6A 3R7VA 3CEKA 3EFLA 5CXZA 1Q41A 3V8SA 4M12A 2E9PA 4D1ZA 3KXHA 4DAWA 5JGDA 1YKRA 3EZRA 4FRFA 2BAKA 3FYJX 4WUNA 2VTAA 4KSQA 4YJTA 4RZWA 3QXOA 4HNIA 3C5IA 3BPRA 3FMEA 2YCSA 2QLQA 3FZRA 2PZYA 3WE4A 3ATTA 2VWBA 3D83A 3GU5A 4UALA 4O81A 3S00A 2R3NA 2OI4X 2C5NA 5J5SA 5B2KA 4UMPA 4KIPA 4YO6A 4CRLA 3DB8A 3WILA 3LIJA 1I09A 5AV1A 2QOOA 3A99A 2ZOQA 3FPMA 4MYGA 4PMMA 5AAGA 3MY5A 5KKRC 3HMNA 4AAYA 1UU8A 2A0CX 3FZTA 1OL7A 2Z02A 5T6KA 3R2YA 2XK4A 4DGLC 3E62A 1W2FA 3FMJA 4B6LA 3UE4A 5CAUA 2VX0A 4YJOA 4XOZA 3HKOA 4MXXA 2VTSA 4A07A 4OBPA 3LXPA 4QP3A 3CTHA 4FL3A 4BRXA 4W9XA 4CCUA 2FYSA 4CLIA 3PLAE 3Q2MA 4F9BA 4IZ5A 3ZXZA 3ORKA 2OBJA 4APCA 3AGLA 4GL9A 2PSQA 4RFYA 3ZRMA 3QWJA 3PE2A 1RJBA 3JPVA 4H58A 4A4LA 4L00A 3ORIA 4DG2E 4EORA 4QNYA 4FL1A 5A4TA 4BKJA 4ZSAA 1AQ1A 3ENHA 3OY3A 1ZMWA 2VWIA 4YTCA 2HZIA 4I94A 2BAQA 2R3MA 1YWNA 4WOVA 3WF5A 4MVFA 4RMZA 3PY3A 4KIOA 4LUDA 3OCGA 3PE1A 4E5WA 2V55A 3ZEWA 1XWSA 3RPRA 3DFCB 4GU9A 3II5A 4D2TA 1TFFA 4Y5HA 1U54B 3QZIA 5CZIA 4FTLA 5K0KA 3DKGA 1WVYA 1WBSA 4FSWA 4QMPA 4BTJA 2J51A 5IQIA 2GHLA 4O4FA 3ODYX 2CLXA 4IM3A 2H8HA 2JIIA 5TOZA 5L4QA 3FMDA 4C59A 4C33A 3D15A 3GFEA 2Z7LA 3HRCA 3PVWA 3PY1A 2BHEA 4J8MA 3DOGA 4CYIA 3BLAA 3QTXA 2X4FA 2XH5A 3OXTA 2DWBA 4RQVA 3VUGA 2CN8A 2GHMA 1OKVA 1SVGA 4O38A 3EKNA 4MQ2A 2I0HA 4QDEA 4C38A 4I6QA 2ITOA 4ZLZA 4C36A 5CEMA 3O0GA 1ZYDA 3JR1A 3SD0A 4ASDA 5D10A 4FKQA 4L43A 4RFMA 4O7TA 3E8NA 5EW3A 3LFCA 1G3NA 2WOUA 3UP7A 4CSVA 2R3HA 4HW7A 3F6XA 3AD5A 5LCJA 5LARA 4H3PA 4NW5A 2WGJA 1URWA 1W7HA 4HPUE 3H0YA 2IW8A 4F0IA 5JZJA 4L68A 1UKIA 4AGWA 2HXQA 2XNEA 3QA8A 1Q8WA 1B38A 4N70A 3P86A 4AZEA 2OW3A 4UV0A 1G8JA 3D5UA 4FKIA 4Y8DA 4QTBA 4CRSA 3QKMA 4E6DA 4R5YA 2X9EA 5DH3A 1R39A 4GV1A 4KKGA 4I6BA 4MNEA 2CSNA 4ZTNA 4IX4A 4O1OA 4D4SA 3MV5A 4XP0A 4USEA 3ZLYA 4YGAA 2R5TA 5BQ0A 2F4JA 5JQ5A 3ROCA 3SRVA 3CKWA 3WIKA 3ZC6A 1Q8ZA 3U51A 2BR1A 2XP2A 1VJYA 4RVLA 4YJUA 3MWUA 3HA8A 3I5ZA 4BI1A 5IQBA 5E4HA 3QF9A 4IX6A 1OM1A 3LAUA 2W5AA 2O64A 1TQMA 3KC3A 4JR7A 5FEQA 4DTKA 2IF8A 4UYAA 1PXNA 1WBTA 3QRUA 4PTEA 5DT4A 2O2UA 3Q5IA 5LMAA 3R8ZA 3VBQA 3VHKA 4FKSA 3C4WA 1K3AA 3Q9YA 2WZJA 3JYAA 1Q3DA 2UV2A 3VQHA 2X2LA 5CU2A 3LMIA 4EL9A 3TMOA 4CQEA 1WBNA 2R7IA 3OOGA 5IUHA 1UWHA 1WMKA 4OT5A 4XMOA 4B8LA 5HO7A 4JDJA 4X2FA 5C03A 3DT1A 4RT7A 4MNEB 2VWVA 4IAKA 5ACKA 3ZFXA 4AS0A 1B39A 4IEBA 3MFUA 3Q52A 3SVVA 4IVCA 3O96A 3K5VA 3MY0A 2O8YA 1GZNA 3JVSA 4LL0A 5ACBC 4BN1A 5HE0A 3FPQA 3FQEA 2Y4IB 4O96A 1R0EA 3EN9A 1UU7A 2BZJA 3ET7A 4UBAA 3R7GA 3V5LA 5L6PA 4AQCA 1OVEA 2A27A 4J97A 4AOTA 1PJKA 4L7FA 3Q9ZA 1M2QA 4BGGA 5BMMA 4D9UA 2OO8X 4EJNA 4DE4A 1ZZ2A 3VVHA 4FKWA 4P7EA 2VWZA 4Q9ZA 3PDTA 3R04A 4RX9A 2PMIA 4XG2A 4IC8A 5CEQA 4EHGA 4M15A 4FUYA 4ZTLA 1M14A 3DAJA 2BKKA 4QYYA 1YHSA 3H9FA 5EDQA 4F99A 4FA2A 1E1XA 4KKHA 4FSYA 4BWPA 4F6SA 2R3QA 4FIEA 3UP2A 3UPXA 5HE2A 4RIWB 4R8QA 3BWFA 5C8NA 3U55A 4QMXA 5BYLA 4GFMA 4QP1A 4HGEA 4IX3A 4JG7A 1PRYA 2ZFYA 3P23A 3K3JA 3LQ8A 3V51A 3K3IA 3V6SA 4B99A 5HKMA 2YERA 5JGAA 1IA9A 4ALWA 2CN5A 5IQEA 4A9SA 3HMIA 4GW8A 5CVHA 3ORMA 5ANOA 4Z9LA 4AXDA 3ZEPA 3W2CA 3AKKA 4I92A 2QOFA 4RA4A 2EXCX 3Q4ZA 5FP5A 1H4LA 3EL8A 5AUUA 3LFAA 2C30A 3VJNA 4CXAA 2CKEA 3W2PA 5IQCA 3KXZA 4QO9A 4RQKA 4J96A 2W05A 4DEDA 4USDA 3DBEA 2YM4A 3QTZA 1OUKA 3VUIA 4HZRA 4AA5A 4PX6A 2F7XE 4FK3A 5EDPA 4I0TA 3RHKA 3U6IA 3UJGA 1VYWA 2VTTA 3MDYA 3P7BA 4AAAA 4QMTA 5LMBA 2B54A 3KRXA 4RJ6A 3PXYA 4FR4A 2Y7JA 3R7YA 3POZA 3T3UA 4P5QA 3A7FA 3BELA 3FKLA 1H07A 1P5EA 1MQBA 2X8EA 3LCKA 4GH2A 4WSQA 4QQCA 4FICA 2JDVA 5JMSA 1Q97A 4X3JA 2DYLA 4ASZA 3W10A 3SV0A 3R9NA 4L3JA 4PDYA 1H25A 4L52A 3NYOA 2QOCA 4L6QA 3FXXA 4AGDA 3ELJA 4TWPA 3OF0A 5J7HA 3VS7A 3JVRA 5CT0A 3ZO4A 4UWCA 2PVHA 2A4LA 3W18A 4A7CA 4BDGA 3LLTA 4XG8A 4FYNA 1XJDA 3E7OA 4F0GA 2QC6A 2XUUA 1ATPE 4O0VA 3FWQA 3KRWA 3ZHPC 2YDKA 4M97A 4S33A 4G16A 3SG9A 4O84A 1Q61A 5IH4A 3AD4A 3UQGA 2GNIA 4XG9A 2R7BA 4EOQA 1VEBA 5FM2A 5KBRA 3QTWA 1PF8A 3KREA 4QEBA 3GCUA 2OK1A 4E20A 1XBAA 3DKOA 3TJDA 3ZTXA 4CKRA 5I4NA 2IVUA 3L8XA 4H36A 3U87A 1U5QA 3E3BX 4MBIA 5K4IA 4W9WA 2XIXA 2I0YA 5LVNA 3QD2B 5CLPA 4UXLA 4HJOA 2HWPA 4RIXA 3IDPA 4YJRA 2VX3A 2CMWA 3T3VA 3ZDIA 4TYIA 4BZOA 4NTSA 2C68A 2W1IA 2ESMA 2VN9A 4GYIA 4F7JA 4FF8A 2A98A 2R3LA 3DJ5A 4QTDA 2F7ZE 3LFFA 3S4QA 5LVMA 2Y6MA 5IISA 3LXNA 3PUFC 3R30A 1UA2A 5AFVA 3Q32A 3MVMA 4LMNA 4R3CA 3V5WA 3OWKA 3MYGA 2ZDUA 3EYHA 3WBLA 1QCFA 4FTOA 4O7RA 3DJ6A 5E8YA 1YXSA 3DQXA 5DOSA 3UG2A 3LJ1A 1ST0A 4JRNA 4GG7A 2UZEA 3I6WA 4O22A 4XLIA 1W8CA 4F7NA 3EN7A 4NKSA 2WMWA 3UGCA 1J7UA 5DMZA 4J1RA 5EW8A 1OIRA 4IH8A 3ZONA 5K3YA 4BDDA 3VC4A 4C4EA 5CQWA 3RHXA 3D5WA 4G2FA 4U3ZA 3ZO2A 1NY3A 1W83A 3O50A 3PSBA 4LGDA 5FG8A 4AX8A 4CFWA 1O6YA 1Y8YA 3EH9A 4YNEA 4PQNA 2OSCA 1WVWA 2H9VA 2X39A 3E93A 3PZEA 3OUNB 4RIXB 2YLEA 5T68A 4EWQA 2WELA 1BL7A 4ZJJA 2GNFA 3MH0A 4P90A 4X21A 3KY2A 1J7LA 4ZMEA 3OFMA 2P55A 2QONA 5KMOA 2VD5A 3B8QA 2BIYA 3NLBA 4CMOA 1F3MC 2WOTA 3KRLA 4YZNA 1JQHA 2XYNA 5TT7A 5AUYA 3C0HA 3H3CA 5AAFA 3UQFA 1EH4A 4JQ8A 1H1WA 4XYFA 5CS6A 5BYZA 4JDKA 4FG8A 3ZFMA 3O71A 2VGOA 2IW6A 5IA2A 4JT3A 2GFSA 4IZYA 2NNWB 1ZAOA 3CIKA 4AFEA 3VONA 4XNEA 2WAJA 5IA0A 3VS4A 1W98A 4XV1A 2AC5A 3AOXA 4X2GA 3PLSA 5CVGA 2R2PA 4DHFA 5A4EA 1JSVA 5AP7A 3SOAA 2WEIA 1TZDA 5ANGA 5IU2A 4EYMA 3OROA 3LE6A 5A46A 4I0SA 3CGFA 1TVOA 3FZ1A 1KV2A 3KCKA 2GNGA 2X4ZA 2WMVA 2XK7A 1KWPA 2HZ0A 4UZDA 5I9XA 3R9RA 3F2AA 3ZXTA 3F66A 3ZO1A 3NCGA 3VJOA 3LFBA 5M09A 1H08A 3G15A 3V5QA 4DDGA 4U41A 1ZY5A 4R1VA 2YIXA 3VW8A 2J90A 4TWOA 3FI2A 4MUQA 3R1SA 4L44A 3RK9A 5K9IA 3V8WA 3U6HA 4YLKA 2B52A 4G34A 2QODA 4YJVA 4FG9A 5D12A 2BRGA 4O86A 1XQZA 5ANJA 4DFUA 3WYYA 3OEZA 2C0IA 1ZMVA 3DBCA 2AYPA 2YIWA 4WT6A 3CR0A 4AGCA 4FTRA 2PVJA 3QCXA 3A2CA 3MTLA 3ZBXA 4L3LA 4BDJA 3AC4A 4J95A 4JAJA 4D0XA 4RWIA 3SOCA 3COKA 4IVBA 3JY0A 4QPMA 5I3OA 3DZOA 3VWAA 4QQTA 4FKOA 4DBXA 3BBWA 2F9GA 5IA5A 3CD8A 5AA8A 3P1AA 2GHGA 1RW8A 3EYGA 3MFTA 4FSQA 4C02A 4U40A 3H10A 2XZSA 5DR6A 5GHVA 4BCNA 5LOHA 2XALA 4HYHA 4N6ZA 4BFMA 4Y83A 2RGPA 4FTTA 2UW6A 2QKWB 5IH6A 4AZVA 4L67A 3F3ZA 5D7VA 3I4BA 4R78A 4FTQA 2IZTA 2GPHA 1PXIA 2DUVA 4AU8A 1GZKA 1ZOEA 2J0IA 2R0IA 4ASEA 5FXRA 3R00A 4MWIA 4O2PA 3CJGA 2XIRA 4NU1A 3HLLA 3F5UA 4TY1A 3VRZA 4C3RA 3DXPA 4N4SA 2I1MA 3GCPA 5FTGA 3W1FA 3BLHA 2PVRA 4FT0A 5EM5A 3H4JA 4KAOA 2UVYA 3ZS5A 3LPBA 2FVDA 4AGUA 4ACHA 2WQNA 4LM5A 3RBWA 1Q24A 4ZK5A 2AC3A 3UMXA 4YUQA 3UQCA 2Z60A 2BZKB 4ZSJA 3FAAA 3G9NA 5M53A 4YR8A 4YO4A 5BYYA 4BBFA 3V01A 3Q5ZA 4XV2A 3DLSA 5JFVA 1G8AA 4GUBA 3QQFA 1RE8A 2C3IB 4DHZA 4HYIA 2ZJWA 1STCE 4GJ2A 3FI3A 4R1YA 5JT2A 4ZTQA 2JKOA 1Q8UA 1P4OA 4LGHA 4QP4A 1B6CB 4V04A 4PL4A 2VGPA 4FIHA 4DH8A 2XKEA 4CT1A 3SX9A 3Q6WA 5TE0A 4L8MA 5IA1A 2UZBA 5EKNA 2VTQA 1FOTA 3SG8A 3W0OA 2PE2A 3M42A 3IW8A 4WRSA 5L2SA 4ENYA 3ULZA 5IMXA 3ZYAA 4BDCA 3R28A 3QD4A 4IB5A 3E92A 5EHLA 4DGGA 4FEXA 2WB8A 2YIRA 4FMQA 3RCJA 5CEPA 1OIUA 3LMGA 5DRDA 2G2IA 5KUPA 4CV8A 4EOLA 5AUZA 1H0WA 4C3FA 4XV9A 2J0KA 4JBQA 1YXUA 2RFEA 1OL6A 3IW5A 3PVBA 4LRKA 4FL2A 4B8MA 2UVXA 4F09A 3TUBA 2PK9A 1CKIA 4Q5EA 4DFLA 2OGVA 4V05A 4G9RA 5CSPA 4GYGA 3BV2A 5ITAA 2PVYA 2XKCA 4O0WA 4AA4A 4S30A 1OB3A 3SLSA 4IZ7A 3R01A 2VZ6A 1XH4A 3UDSA 3NVKI 1Y6AA 3HDMA 3QALE 4DA5A 4IQ6A