4EH2A

Human p38 map kinase in complex with np-f1 and rl87
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
337
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 337
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh2A01
2VTSA 5CAUA 3IQ7A 2NRYA 4CG9A 3EN4A 3QD2B 3IOPA 3IW6A 4RMZA 1Y8YA 2PZPA 5IA4A 3Q6WA 5AX3A 5ANIA 2C1BA 3CQEA 1GIHA 3PRFA 4WHZA 2ZV2A 4QQCA 4FYOA 2BDJA 1AGWA 1TQIA 2G9XA 3H10A 5FP6A 3VW8A 4IWPA 3CQWA 3KRXA 4RFZA 3TDWA 4AQCA 1HCKA 5HU9A 1SNXA 4RIWB 4CKJA 4D28A 2BIKB 4LV8A 3FDNA 1OIRA 4BHNA 4F0IA 2OIQA 4CFXA 4V05A 1JBPE 3KN6A 4GEOA 5TF9A 5HLNA 4EONA 5DYJA 1H07A 4X2JA 1YKRA 3U9NA 4B8MA 4I0TA 4NU1A 1IAJA 5HG8A 3LMGA 3D7TB 3W10A 3NNVA 3VS1A 2OU7A 4F9BA 5M07A 1H1WA 3NW6A 4H39A 4AAAA 4JLCA 3V01A 4NL0A 5F4NA 4MWIA 4LYNA 3FZRA 4QTCA 3CLYA 2XIXA 3HV5A 4FKOA 4I22A 2PVJA 3VBVA 3FMNA 3D9VA 4YPSA 4E8AA 4J97A 5GJGA 3IK3A 4YUQA 3ZOSA 3QUPA 3S2PA 2C4GA 4I5MA 2PL0A 4JNWA 1J7UA 3CCNA 4GKIA 4NK9A 4I4FA 3FAAA 3NZ0A 4QMZA 3VS4A 1YWNA 1LR4A 3RZBA 4F08A 5GZ9A 4GK3A 5D10A 5LCKA 3V8TA 5JFXA 4XV9A 3CY3A 4BCNA 4DE4A 3QKMA 4ZSAA 4QMLA 2Q0NA 2Y6MA 5M4FA 2QR7A 4GMYA 5AM7A 2QLQA 3W33A 3ACKA 5BVFA 4AG8A 4FYNA 3H3CA 3NNWA 3HRFA 2R3MA 4FTRA 4MXXA 3DXPA 3CQUA 1Q3WA 2ONLA 4BWPA 5LMKA 3BPRA 3OT8A 3LFNA 3TNQB 4XMOA 3KVWA 2PE1A 4FODA 3FWQA 4BDFA 4F9AA 2ITQA 2UZOA 2VTMA 3MV5A 4ANSA 4QMNA 3HAMA 2XUUA 3GFEA 3UMWA 3MDYA 3MTFA 2G2FA 5K4IA 2GNLA 2R3NA 1Y57A 2W7XA 4CYJA 1OKYA 5DA3A 4BGHA 4YHTA 4D1SA 4D5KA 4EC8A 1GZKA 2Y9QA 4PMTA 2O5KA 1XBCA 1BYGA 2VTIA 2C6IA 4FL2A 4IJPA 5DE2A 1FPUA 3FE3A 5M06A 4GSBA 5J7HA 3ORKA 2X7FA 4AXAA 4O83A 4EOOA 4MTAA 3LAUA 1VYWA 2IZUA 5E8TA 1OM1A 3LFQA 1UVRA 5LVMA 2YIQA 4OT5A 5F95A 4X7QA 5HTCA 2UUEA 2UZWE 5KMOA 2P3GX 2QOQA 4QMYA 5C8MA 4O7VA 1WAKA 4D2SA 4ZZNA 2X7GA 2YM8A 5HCXA 3PY1A 4BDJA 4D4YA 5IMEA 3EYGA 3UQCA 1Q5KA 2FSOX 3G2FA 5JRSA 4ACGA 3AGLA 3FMLA 5E7RA 4A9TA 3GU7A 4D5HA 3JXWA 1E1XA 3DBQA 2VWZA 1W0XC 3IDPA 3K54A 1AD5A 4M7IA 4RVTA 3ZRMA 3ZSIA 1J7LA 3VS2A 3ELJA 2W99B 2VX3A 4NIFA 1M17A 5BNJA 3N9XA 1Q41A 3ANRA 1PXPA 1WBPA 3VBYA 3FEGA 2R2PA 5HVKA 2Y8OA 4DBNA 1IAHA 3KA0A 3TNPC 5EOBA 3HZTA 5EI8A 3EQIA 1WVYA 3OTVA 4PMPA 2QOBA 2O0UA 4JAIA 3R8ZA 3DB8A 5ANEA 3VUHA 3DTWA 4V04A 2VWXA 2VWIA 4HGSA 4LI5A 3NUPA 4RLLA 4F64A 5M4IA 4IDVA 3PPJA 4DG2E 4ITJA 4O7NA 1SNUA 2YM3A 4ZSLA 4GT4A 4XG3A 3QQKA 4ZXTA 4CKRA 1PMVA 3P7CA 4FKPA 2VU3A 3SV0A 5LCJA 3F7WA 3W2QA 3PYYA 4IZ5A 4BDBA 5L6WL 4R8QA 3NUAA 4ZY4A 4BCKA 4QTBA 3PIXA 3MH1A 4L9IA 4GG5A 5JMSA 5FD2A 4LOOA 3OMVA 4E5WA 4RIWA 3S3IA 2WQOA 2RL5A 1XH8A 3EZRA 3LM0A 3PY0A 4D1XA 5HLPA 1WBSA 2VTJA 2CKQA 4GUBA 3L9NA 5KO1A 3P1AA 4I3ZA 1TQPA 4O96A 2BRNA 4OTDA 3BLQA 4U40A 3QTIA 4AE9A 5FBNC 4K18A 4FIHA 4EOKA 5L3AA 4V0GB 4QQTA 2XRUA 3AXWA 4HGEA 3M11A 4FMQA 2JITA 1OMWA 2FH9A 3Q4UA 4XEYA 5TKDA 3ZONA 3TT0A 3ZM9A 2C5NA 3MGYA 5K3YA 1Z9XA 4EJNA 2UVZA 2VGPA 3P5KA 5BVWA 2OI4X 3VUDA 4CGAA 2IVVA 5JEBA 4L8MA 4O7SA 4R3CA 5M55A 2PVFA 3GB2A 4JIAA 4GL9A 4KSQA 4I1ZA 5D7AA 4F1MA 3U4UA 4CRLA 4LGHA 4BICA 4O7TA 3EN6A 4K1BA 4D1ZA 1KE8A 3ZUVA 4IX5A 3IOKA 4FKUA 3RAHA 1UKIA 5A4CA 1S9IA 4FIGA 5DI1A 2HY81 4KIOA 3FZTA 3ZC6A 4FIIA 4XOZA 3COIA 4CT1A 1M52A 1PF8A 4AF3A 1WBNA 2XK6A 3R1SA 5CEPA 4UWCA 4A9RA 2BR1A 4RQVA 4RBLA 4JOAA 5LQFA 1JQHA 3HMOA 3R7GA 4N4SA 5HNGA 2C5VA 3VRYA 4IX3A 3BELA 3HV3A 4DEHA 4OAUC 1CM8A 4O2PA 3AC4A 4FEVA 3OZ6A 3CXWA 3CY2A 4IVCA 2O3PA 2HOGA 2WQMA 3EFJA 4FTNA 4U3YA 1ZZLA 3PFQA 1H1PA 2X8EA 2YCRA 3KCKA 3H9FA 4MYGA 4RWLA 5I9UA 4RVMA 4F09A 1WVXA 3RPVA 3CPBA 2J5EA 1BKXA 1JPAA 2UW3A 3UIXA 2RKUA 2UVYA 3OXIA 1RJBA 1PYXA 3KY2A 4IJ9A 4G3DA 3OROA 4TYEA 5M57A 3BYOA 2PVNA 4RZWA 4JG6A 4FZ6A 3E63A 4IDTA 4E4LA 4H3QA 1H4LA 3QFVA 4A4XA 2I1MA 2SRCA 1EH4A 3TNHA 4RWIA 2P2IA 3SRVB 3PG1A 2QOHA 3Q2JA 4ACCA 3NW7A 4ANMA 4CT2A 3QZHA 4EKLA 3PA3A 1J1BA 4FTMA 1SVGA 4U9AA 3C1XA 4UXLA 3QA0A 3RJCA 4C38A 4C35A 1UU8A 4FEWA 2OH0E 3DOGA 4DINA 2O63A 2IWIA 2JAVA 3P0MA 4O38A 4AZEA 5FTOA 3QC9A 2X4ZA 2VN9A 5BPYA 4D2WA 2PUNA 4IWOA 4J71A 4YO4A 2XS0A 3MI9A 3OXZA 4M97A 3ORZA 5FXSA 4TNDA 4H1MA 3TKUA 3A7IA 3DK7A 3MIAA 2CMWA 2R4BA 4XJ0A 3BYSA 4YZMA 4JL9A 4C02A 4KRDA 1H28A 5CNNA 5A4EA 2C6MA 3QLGA 2BDWA 2QHMA 2W5HA 4DFZE 3TUCA 4ZAUA 1SZMA 2RG5A 2YJSA 3PP0A 3CD8A 2GNJA 3BQRA 2XRWA 4A7CA 2PVRA 5IDPA 4TYJA 4K9YA 5H2UA 5LOHA 3JR1A 3QTSA 4AW5A 4CCUA 1G8SA 1YWRA 2JBPA 3H0ZA 4XP0A 2H34A 4KIKA 3PY3A 4EWHA 3SXFA 3NGAA 2ERZE 3PSDA 5H3QA 5KNJA 3MH0A 4WNKA 4USEA 4MD9E 3QLFA 4TWOA 4GK2A 2P55A 1T45A 1NXKA 4FEQA 3D5UA 4FZAB 4NEUA 1RW8A 5AV2A 3UIBA 5HGIA 3R28A 5HBEA 4C33A 1YXVA 3PXRA 3A2CA 2AC3A 4DEIA 4Z7HA 3UPZA 1MQBA 4I6HA 4C36A 5JSMA 2P33A 4AUAA 4J1RA 1CMKE 2XK3A 5J1VA 4L46A 3WI6A 1XBBA 4F1OA 1M2PA 4E4MA 4PNKA 2I0EA 3LJ2A 3FZOA 4ANQA 5IDNA 4IACA 4RA5A 4FTIA 2UW4A 3R22A 3W2RA 4R3RA 3WF7A 3R9OA 3RZFA 5CVFA 5AWMA 3C0HA 1W7HA 3KMUA 1G8AA 4RFYA 4IFGA 4Q5EA 2OKRA 3NAXA 5IEVA 4I93A 3TWJA 3KREA 1FVRA 3R02A 4FK6A 5DR6A 4NCTC 1P5EA 4ZTLA 3IONA 4RGJA 4YC3A 2VTOA 4DGMA 2JDVA 2QURA 2X2LA 4P2KA 4MHAA 3ZTXA 1FINA 1DI9A 3O0GA 4RT7A 4AT5A 2X0GA 3BYUA 4EK6A 4CFVA 2I6LA 4OTQA 2YN8A 4DT8A 3MPTA 3OCGA 5EYCA 4QOXA 2X8DA 3FC1X 2WAJA 2HY0A 3HAVA 2FGIA 3F5UA 3CIKA 2R3HA 4FBXA 3O7LB 3FMJA 5CU0A 2UZUE 4BYJA 2J0LA 4K6ZA 5J7BA 1O9UA 3HKOA 3B8RA 4HVHA 2W1CA 1I09A 3GU8A 3O23A 3LKMA 3QQJA 2PZIA 4F9YA 4BL1A 4E5BA 2WKMA 2ZM4A 2O65A 3NUUA 4YP8A 4CV8A 4FSZA 2B4SB 3NW5A 5EM5A 4I6BA 4DBXA 1H01A 5CAQA 4KKHA 2BUJA 4I23A 3D2IA 1K3AA 1I44A 3KK8A 4JBPA 1ERKA 1K2PA 4KBKA 3W8QA 2NO3A 1QPCA 4FOCA 4NW5A 1G3NA 5E90A 2I0HA 2RFDA 3DA6A 4WUNA 2QO2A 3ROCA 3W8LA 4C7TA 4EHEA 3QTUA 3QD0A 3GFWA 3PJ3A 2XKEA 4OR5A 4FIJA 2W4KA 3WZKA 4L3JA 3VQUA 3FSKA 4WNPA 1PMEA 3F2NA 4XBRA 3H30A 5EFQA 3IGOA 4IAKA 1U4DA 4ZJJA 3EQFA 4L3LA 4XOYA 3A4PA 4RIXA 1Z57A 2R3KA 3MPMA 4GVJA 1FGIA 3ZEPA 2W5BA 4IVAA 2Y6OA 4R3PA 4AZFA 2CSNA 4P7EA 4DEDA 2B9IA 1NT2A 2PUPA 2AYPA 3FHIA 2RIOA 2EU9A 4BVUA 2IZSA 2EXCX 2UW9A 3F3ZA 4R1VA 4CZYB 4ZLYA 4GH2A 1Q62A 4RC4A 1WVWA 3RTPA 4O6EA 5CT0A 4AZSA 4QMUA 3QQGA 3F69A 3TZ7A 4X3FB 4ACDA 2A27A 4QP6A 2BAQA 3I5NA 1OPKA 4MVFA 4ASDA 4CQEA 4JIKA 4N70A 3DKGA 3T3VA 3M1SA 5KMMA 2ZMCA 3AG9A 4BBEA 5C01A 3G15A 2WNTA 1YHSA 5IA0A 5CQWA 2I0VA 3DK3A 5E8SA 2OZAA 4XBUA 5E8YA 3EZVA 2CN5A 4FV3A 4FNZA 5GIOE 3QX4A 2HCKA 4WG3A 3DKCA 4UBAA 4WRSA 1XH4A 3P86A 5DLSA 1OL5A 4GFGA 4DT9A 3KULA 3NCGA 4FGBA 4HPTE 4TRLA 5HE1A 5FTGA 5AR2A 3OD6X 2OJJA 2WMQA 3U8WA 4GW8A 4MEDA 5CAOA 4AT3A 4L45A 1Q8WA 3LZBA 4CTBA 2WPAA 4GUEA 3DJ6A 4Z7GA 2ERKA 4NM7A 5CQUA 2C69A 3P78A 3VF9A 1PY5A 4EHVA 4ZY5A 4U42A 1ND4A 1Y8GA 3ORLA 5JRQA 2WQNA 3PJ1A 2GFSA 2PVLA 2YISA 1JSVA 4AN9A 2OGVA 5HG7A 3BWJA 3W1FA 4Y46A 3IW8A 2YCQA 3RI1A 2YITA 1LUFA 5DIAA 2HAKA 3GC0A 1KV2A 4FZ7A 4QP3A 3FBVA 1JKKA 3FI2A 3R9HA 4A07A 3ZM4A 3NNUA 3C9WA 3OWKA 3C0IA 4DHFA 5J9YA 2J7TA 3FC2A 5E1SA 4F9WA 3BLHA 4AW0A 3TZ9A 5HICA 4D0WA 3QXOA 3FLWA 4FZFB 3LOKA 3DT1A 4YC8A 4GKHA 2XIRA 5IA3A 2JKKA 2XB7A 3AOXA 2YA9A 4ZMFA 3SC1A 1Q61A 4H3PA 4EK3A 4F65A 5BUIA 5EYMA 4ZSGA 2YACA 3VRZA 4BGQA 1OI9A 3JS2A 3NDMA 4EC9A 2OF4A 5EG3A 1ZAOA 4D0XA 4DTAA 3NNXA 2BALA 4XHKB 4AA0A 4MXAA 4UEUA 5CYIA 1OIQA 2NPQA 3OEFX 3LCOA 2OW3A 5AR7A 2W05A 4A4LA 3DDPA 3QC4A 3QZFA 3QCSA 4QMPA 3UC3A 4L68A 2JDTA 4O81A 2WEIA 3KXZA 3DY7A 4IBMA 4PP9A 4M15A 2C6KA 3PJCA 3BV2A 3ORIA 4BTJA 2IVTA 4IW0A 2XH5A 3VUMA 2DS1A 2ETKA 2JFMA 1M7QA 4G16A 5C9CA 3ET7A 5CU6A 4XYFA 3QKLA 1PXIA 4FTCA 2R3IA 5IQIA 4ENYA 4HZSA 3E93A 4JBOA 2P0CA 2CGWA 2VNWA 2FO0A 2J0JA 2QC6A 4MBLA 4ONAA 4BB4A 4EOLA 2YDIA 3BRBA 4W9WA 3RCJA 3SW7A 3ZFMA 3A8WA 1YRPA 3MBLA 4Y83A 5DRDA 2YCFA 1GY3A 3VBTA 4C2WA 5KBRA 3R1YA 4F6SA 5GZ8A 5HEZA 2VNYA 2WQBA 5CASA 2HW7A 5AUUA 4D4SA 5LWMA 3C50A 1PYEA 3TKIA 5IH4A 2W1HA 3D94A 3C5IA 3OHTA 4L43A 1GZ8A 5AADA 5A14A 2GQGA 3RM7A 1ZYLA 3ATTA 1YI6A 2WTKC 3LFSA 3R73A 4GG7A 5FLFA 3TZMA 4C58A 3BGPA 4UYAA 3ZS5A 2HZ4A 4CZUA 2GS7A 2AUHA 4D58A 4EOIA 3MB6A 1CKIA 1BI8A 1Y91A 2VO6A 3GQIA 4V01A 5HNBA 4IZYA 5BMSA 2RG6A 5I9YA 3PZHA 5HHWA 4XG9A 2WQEA 4FR4A 4QP1A 4XG7A 1GJOA 2C6EA 3LIJA 3KXGA 4B0GA 1P14A 3A7GA 4II5A 3JPVA 2VTLA 2F49A 3SDJA 4I21A 3E5AA 5EK7A 4IIRA 3ZEWA 3GC8A 3BWFA 4C0TA 3GXLA 3P7BA 3R7VA 1H1RA 4KIQA 4LRJA 1L3RE 3Q4ZA 4X3FA 3MFSA 5CLPA 4WT6A 4QMTA 4EUTA 2B52A 2UZLA 4F7LA 5H9BA 3O50A 1VEBA 3MIYA 4OW8A 2W1DA 3SHEA 1YHWA 5FRIA 4WNOA 4G17A 1XR1A 4U80A 4N6ZA 4EKKA 3BEGA 2OK1A 5HBJA 3FL4A 4ITIA 1PXOA 2BROA 5AX9A 2X81A 5IQBA 2A0CX 4E3CA 3BHTA 1CKPA 4G2FA 3DXNA 4FK3A 4KKEA 4UY9A 5EM8A 2WTIA 3OW4A 3ZYAA 3OUKA 3QQHA 3TZ8A 2YWVA 4NIFB 2C6LA 4IH8A 1OITA 2QCSA 3QYWA 3H4JA 2JKOA 2BAKA 5EKNA 2ZV9A 1LP4A 4RA4A 3FZPA 4DC2A 4JVGA 1OL2A 1V0OA 2V22A 4I5PA 4AGUA 3G33A 4K8AA 4PUZA 1B39A 2JIUA 3G0EA 2XEYA 4Y73A 2WO6A 3I81A 4GFMA 4JQ8A 3RWQA 4E26A 5HU3A 5FDPA 4PMMA 1OGUA 4NW6A 2G1TA 3DBCA 4RJ4A 3Q4TA 4WO5A 2PMIA 3RAIA 3ZBFA 4OBQA 3PG3A 3QF9A 1TVOA 4N0SA 3HMPA 3Q52A 4UMQA 3VQHA 4CMOA 1FVVA 2WZJA 4BDHA 2XNBA 1ZMWA 3UZTA 2CKEA 3S95A 1HOWA 2UW8A 1LPUA 3B8QA 3BHHA 3R1NA 4WIHA 5C1QB 1F0QA 4MF1A 4TT7A 5AUVA 1STCE 1B6CB 4X2GA 1JSTA 4DAWA 3HX4A 3PVWA 4TY1A 1OL1A 4F7JA 5CF4A 2RF9A 5CF8A 3DLSA 1JKTA 3NS9A 2QONA 3E8NA 3F7ZA 4ALVA 3VAPA 4TWCA 2XMYA 4AFEA 4F70A 3BKBA 3AC1A 5JFSA 4IQ6A 4O22A 5CANA 2PSQA 1UNLA 1V1KA 1J91A 5TOZA 5ETFA 4QYHA 3FLQA 3ODZX 4FV5A 3ZO3A 5F9EA 4YJSA 1XH6A 4IXPA 4MBJA 3RAKA 4HVIA 4M0ZA 4NJDA 3QRIA 3R8UA 4X0MA 3T9TA 4AOIA 4K2RA 3REPA 2R3RA 1OVEA 3LM5A 5HCZA 2GTNA 3NVMB 2Z7SA 4O1OA 2WU6A 3VUKA 4G5JA 3CGFA 3MFRA 4IX4A 3BHYA 2R7IA 3PZEA 4B7TA 1OB3A 3KQ7A 2F2CB 5K5NA 3MTLA 5F20A 4PWNA 2PZYA 3UTOA 1H25A 3V5LA 3DAEA 3DJ7A 3DDQA 3ENMA 4FV6A 3RINA 2PUIA 3V51A 3I79A 3FHRA 3VUTA 3VS7A 3ZFYA 4LM5A 3OOMA 5JQ8A 1APME 4IB1A 1OKVA 3ZXZA 2IZTA 2J0IA 4EYJA 5CF6A 3BBTB 3FY0A 4C3FA 4ZS0A 4ZTRA 4IZ7A 4NTTA 3U6IA 3DLZA 2OFUA 1ZOHA 4O7RA 4AZVA 1QMZA 2PVKA 3PTGA 2HELA 3FPQA 5IZFA 2VWVA 1OKZA 3HUCA 4RRVA 3T3UA 3FLYA 4O27B 3PJ8A 4FGRA 4PX6A 3NMUF 2F7ZE 3DBFA 1RDQE 2QKWB 4ZZMA 4CKIA 1U54A 3DQWA 2C0IA 5KZ0A 4ANNA 4DH7A 3GC7A 1J7IA 4TNBA 4UB7A 4JRVA 5AP5A 3IPHA 4PRJA 4TL0A 5KHXA 3DFAA 4PDYA 5K5XA 3PXFA 1ZMUA 4MXOA 5I9ZA 1WBOA 4YNEA 1VYZA 1XBAA 4IC8A 1XQZA 3CD3A 4FIFA 2GTMA 1K9AA 5JZNA 3R9NA 3RMFA 5JFWA 4NT4A 4D9UA 3E87A 2Y4IC 4DLJA 4FE2A 3OCTA 5IQAA 3OCSA 4FI1A 4J52A 3Q9ZA 4C4FA 4G3GA 3GP0A 3RPRA 2GNHA 4YPDA 4AT4A 1PW2A 4BKJA 4EUUA 3ZXTA 3DTCA 3Q5IA 4B9DA 4KB8A 5C03A 2QQ7A 3VIDA 3OXTA 4DFNA 2I40A 3TKHA 5GIPE 3BX5A 4HNIA 3R2BA 4APCA 1WZYA 3BU5A 4ANBA 1PJKA 3BHVA 2YZLA 3QU0A 4BTMA 2X6DA 3E64A 5A4QA 2R3PA 3IW7A 4C4HA 3HMNA 4U41A 2WGJA 4AWIA 4EOSA 3M42A 2X4FA 2H6DA 2QR8A 3TJCA 3UVQA 3AMBA 4R77A 4FKRA 4ALWA 5I9VA 5CEQA 4FEUA 4O0SA 4NSTA 5KBQA 4UYNA 3TNIA 1IA8A 4IB3A 4PPAA 3KK9A 1GOLA 2XA4A 2C6TA 3MFUA 5AA9A 1OBGA 2GU8A 5IQGA 4FSNA 2JDSA 2BKKA 3WZJA 3TN8A 5CI6A 3MY5A 3TUBA 2NRUA 4M68A 5ETCA 3QQUA 4L67A 2CNVA 1YXSA 3C4WA 3OBGA 3OTUA 4QMSA 5CSHA 3EQDA 4AX8A 2XK7A 4O0TA 4BZOA 4FV9A 2YLFA 4NKSA 3TCPA 4DH1A 1UNHA 5AUTA 5FM3A 3VN9A 4FTKA 3LXLA 3EQGA 3P4KA 3FMDA 1OBDA 3WIGA 2PE0A 2GSFA 2ITWA 3R2YA 4KIKB 4FSMA 5E8UA 4I6FA 4I6QA 4DFXE 1JAMA 4KAOA 1YOLA 2R0IA 2XEZA 1P4OA 3V6RA 3ZH8A 3Q4CA 3BI6A 4FUYA 4QNYA 3GCUA 3T9IA 4DH5A 3AD6A 3PIZA 5J5TA 2H96A 5CEKA 3W32A 3WIKA 3BU3A 1JLUE 3WZDA 2YDJA 1FBNA 2CPKE 4X2KA 2HXQA 3ZLYA 3BGQA 3A60A 3ROYA 2WXVA 2YIYA 3OWPA 2Z8CA 3G6GA 4GIHA 4ZOGA 4Y5HA 4R7BA 3IO7A 3VHEA 4BCPA 5CEOA 5TT7A 3MVJA 2GHLA 4LFIA 5D41A 2JFLA 3NWWA 4KINA 4EH8A 4JG8A 4CZTA 2ETRA 2YFXA 3SAYA 1KOBA 4M13A 4YGAA 3WF8A 4R5YA 2IVSA 3UDBA 2B7AA 4YTCA 3MWUA 3ODYX 2JDRA 5AAEA 4GFOA 2DUVA 3RNYA 2QHNA 3GUBA 3QHRA 3D7ZA 5JQ5A 3TDVA 2QG5A 2C3LA 4HCVA 2LAVA 3LPBA 1VJYA 3VVHA 2CLXA 3GENA 3W2OA 3QA8A 4Y85A 5CVGA 5D7VA 2BPMA 2QD9A 3FKNA 3KXHA 3KRJA 2YIXA 4WUAA 5L8KA 2O64A 2WOTA 4UN0C 5IQCA 4ZEGA 2PZ5A 3QUDA 2PMLX 5FEQA 5FP5A 3EQHA 4TYHA 4C4EA 4EQUA 2UZDA 3PE1A 2ITUA 4BRXA 3R8LA 1GZOA 4K33A 4XX9A 3K5UA 4A9SA 2VWWA 3CJGA 3V8WA 5LMKC 3D0EA 1H1QA 4X2NA 1YI4A 4ZTMA 5IISA 2V5QA 4CCBA 3TTIA 3HV7A 5LMBA 3N51A 4IHPA 4ZTNA 3VS3A 3OEZA 2QG7A 5I3RA 1CDKA 4IB0A 4H58A 4MBIA 4RWJA 4BIEA 4Q5HA 3D5VA 3K5VA 4FTQA 3ZUTA 2XYUA 4R7IA 3Q96A 2J0MB 3OS3A 4NCTA 4I5CA 4D2VA 1Y6AA 3R04A 3KRWA 3MVMA 5AIKA 3PA5A 5EKOA 4S30A 3R6XA 5C27A 2XNNA 3UE4A 4PPBA 4JDHA 5AP7A 3DB6A 2IZRA 4G3CA 2G01A 4L53A 3D14A 4BDCA 3QBNA 4IEBA 4EHGA 2C0OA 4EYMA 2XM9A 2W17A 5M53A 5M44A 3D15A 4BCIA 2PPQA 4I24A 4RX8A 2PHKA 2QOIA 3BCEA 3L9PA 3QQLA 4I0SA 4QMMA 3EFKA 3KC3A 1UA2A 4RIXB 2ZM1A 5FDXA 5FQDC 2R3LA 1Q24A 4N6YA 2J6MA 4U6RA 3RPYA 3UODA 5C4LA 2BCJA 5CVHA 2R7BA 4PV0A 4DEGA 5JGBA 4YTHA 3AT2A 4DLIA 5L6OA 3UQGA 5BYLA 3PXZA 2XK9A 3JUHA 2HYYA 2WTCA 2PK9A 4NWMA 1URCA 2WMXA 4QYYA 3F2RA 4EBWA 1ZOEA 2ESMA 5IG1A 4ZTQA 4IB5A 2BZKB 5A3XA 2CNQA 3WZUA 3PE2A 5J79A 4LRMA 3LCKA 3ORTA 4XUFA 3C7QA 3HDNA 2G2HA 2ZYBA 3BV3A 2PYWA 1CSNA 4AE6A 2XNOA 5K9IA 1PXLA 3G6HA 2W5AA 1R0EA 3K2LA 4JDIA 2CCHA 2GNGA 2QO7A 4YZBA 4UZHA 4BCMA 4EK4A 1ZYJA 5CEIA 3DKOA 4QP2A 3G9LX 2VTRA 4EWQA 3CSVA 5H8EA 4ANOA 5EM7A 2BVAA 2OZAB 1FGKA 1SVEA 2PY3A 3IW5A 4WA9A 3DXQA 1HCLA 3JVRA 4DG3E 3F2AA 4XCUA 4JX7A 5I3OA 5HD7A 4USFA 1FMOE 4EQCA 3A8XA 4CLJA 5KMKA 4ORKA 2QODA 4QPSA 3RHKA 4BBMA 2IW6A 5LMAA 4F6UA 3KULB 3AD4A 4BIBA 4F9CA 1M7NA 1LEWA 4I0RA 4YJPA 1MQ4A 2YM4A 2B53A 3W2SA 4C37A 2VTPA 2BRMA 4DN5A 2CGUA 4EOJA 3TV7A 1QPJA 3HNGA 5JH6A 3PXQA 3EWHA 2BTSA 1OZ1A 3QTRA 2H8HA 4RJ8A 3V8SA 5I5ZA 2ZVAA 2W1EA 2ZMDA 1JNKA 4IAIA 3ENHA 4OTFA 3I4BA 5FM2A 4YJQA 2WTDA 1L8TA 3E7VA 2WMRA 4XP2A 3EJ1A 3FMEA 3ZC5A 4BCOA 4RSSA 3IS5A 3LQ8A 4MX9A 4JR3A 1IG1A 4J8MA 4RQKA 5CSPA 3QCQA 2EVAA 3FXWA 3GC9A 4DTKA 2ITYA 5GZAA 4ZZOA 2XVDA 4ZTSA 3HMMA 2F4JA 4MF0A 4MWHA 2UV2A 2BAJA 3PUPA 4JG7A 2V7OA 5DBXA 5BUEA 3TJDA 5KKRB 3UJGA 1UU7A 5HNIX 1PRYA 3KVXA 3FLNC 3R9RA 2GNFA 3FMHA 4FT3A 1FQ1B 4NH1A 4PTEA 4BCHA 3KXMA 3PVUA 1MP8A 3SVVA 2Z7QA 4QMVA 4M0YA 1DM2A 1TQMA 3UVRA 3MH3A 3SA0A 1KV1A 3COMA 2BZHB 3KGAA 1MRUA 3UZPA 5A54A 3UNZA 3U6HA 2W1FA 4C2VA 1DAYA 2AC5A 2IJMA 4L7SA 2HIWA 3QTXA 3TTJA 2XJ1A 5JGDA 4HGLA 4QT1A 1JOWB 3RAWA 4QP9A 5ETIA 4IZAA 2JDOA 5ANGA 2YM7A 5BQ0A 4GCJA 3QD3A 3UVPA 3AT4A 2GQSA 4WD5A 1YDSE 1H00A 3GCPA 4IADA 3CE3A 3O71A 2QOKA 4FKGA 3E8EA 4LRKA 4BF2A 4KIPA 1WBWA 1Z5MA 2B9JA 3HL7A 3O17A 5IQDA 1W83A 2X2KA 3DNDA 3VJOA 4PL5A 1IEPA 3HRBA 1OL7A 2GNIA 4OTIA 3C4CA 1A06A 3RWPA 1WBVA 3LMHA 3EOCA 5EHOA 3O8UA 5AR3A 5LARA 2WOUA 3QWJA 3WYYA 4J95A 1UWHA 2EXEA 4PF4A 5DT0A 3MSSA 4I94A 4Y8DA 1BL6A 3GT8A 2X6EA 3HYHA 3RALA 5GNKA 4FG9A 3LFAA 2F57A 4U44A 3U87A 4NTSA 1KE7A 4D4VA 3ZLXA 4F7SA 3KXXA 2PULA 4U5JA 2FSMX 4GV1A 4CXAA 2HWOA 3PPKA 5EW9A 4FTJA 3ORNA 3UGCA 4DFUA 3C4EA 4MQ2A 2XKFA 4EH2A 4FUXA 1ZARA 3R21A 3QCYA 5EDRA 4FV4A 1XH7A 3DQXA 1XH5A 3I0QA 3TACA 5J9ZA 1QCFA 3UIUA 3F82A 3RGFA 4EK5A 4D2RA 3FI4A 4E7WA 2XIYA 4YHJA 4C34A 5AUXA 4BBFA 2C6OA 3QXPA 5HG5A 2R3GA 5GINE 4BGGA 3ZMMA 4NJ3A 4ID7A 3PRIA 3QALE 3VNTA 3AC2A 3LQ3A 3R7IA 2YWPA 3U55A 5TO8A 5CU4A 4JR7A 3KEXA 3ZBXA 5LWNA 3AT3A 3EL8A 4L44A 4QP7A 4YJTA 5HI2A 1QL6A 4YURA 1DS5A 3IG7A 3KRRA 3LXNA 3U51A 3LXPA 2XK8A 3BHUA 4QNAA 4YMJA 4LGDA 4OTRA 2A1AB 4LG4A 4XS2A 3QL8A 4JDKA 4KSPA 4X3JA 3SQQA 4BCFA 2BZIB 3B2WA 2Q83A 4AZWA 2J90A 4MAOA 3EFWA 1NW1A 3RVGA 2WMVA 4YLKA 3COKA 5AUYA 2YZAA 3Q2MA 1ZRZA 5IA5A 3I1AA 3TIYA 3LCTA 4UMRA 2GQRA 2R3OA 3PA4A 1XJDA 3F5GA 3R0TA 2WMUA 4FNYA 2WTVA 3G51A 4O2ZA 2KULA 2C1AA 3K3JA 4FSYA 4G6OA 2CJMA 2PE2A 4C57A 5KX8A 3NYOA 3SGCA 2F7XE 3HV6A 4KS7A 4NFNA 5L2SA 3SW4A 3PVGA 2XNMA 2XNGA 5HESA 5E8XA 5ACBC 5AAGA 3FMMA 2RGPA 4BN1A 4O86A 4FSWA 3E8CA 5EYDA 3LFFA 4L01A 2GDOA 2C30A 2VWBA 4X6RA 4C3RA 4TYGA 4J96A 4FT7A 4CFUA 5CY3A 4EH7A 3EN9A 3QTWA 5AP4A 2WIPA 2RFNA 3PLSA 3GOKA 2J0KA 4GYIA 3P23A 4KD1A 4HVDA 2J2IB 5BX0A 4ZTHA 4TTHB 4FT5A 3FJQE 3HEGA 4FOBA 3SOAA 2VO0A 5AV4A 5KMNA 5DVRA 3OFMA 4ERKA 5ITAA 1T46A 1ZY5A 3L8SA 3Q9YA 2CHLA 4KA3A 2VX1A 1FMKA 3KB7A 3Q9WA 3NR9A 3P08A 4AU8A 3PDTA 3PXYA 3C4FA 3LJ1A 3NAYA 3CR0A 2BKZA 2PMOX 4QD6A 5E8ZA 2VD5A 3TI1A 3QUEA 3AC5A 3OY3A 4FTTA 4LOPA 3U9CA 3W2CA 4E4NA 1E9HA 4RVKA 5FEDA 4FV8A 4AW1A 4JQ7A 1SM2A 4KABA 5KMJA 3QTZA 3BE2A 2P4IA 5IUHA 3QTQA 1H08A 2XF0A 5T68A 4BCGA 5E4HA 5HX6A 3ALNA 1YI3A 5AA8A 5CAVA 5LVNA 4RIYA 2CKOA 2HXLA 5ETAA 4J98A 4QPMA 3DGKA 4K11A 4AFJA 3OC1A 2UZNA 3UQFA 2ZM3A 3AC8A 2R0UA 2BZJA 3O7LD 2OH4A 4JBVA 4YTFA 4BWXA 3D5WA 3E88A 4DYMA 4Y95A 3VUIA 5HORA 3JYAA 4RWKA 2C68A 1V0BA 4ACHA 4FTOA 4Q9SA 1W8CA 4BWKA 3KN5A 4FIEA 4HYHA 4PNIA 4DTBA 1IR3A 3D5XA 5E91A 3Q53A 3LFEA 4WKQA 2CLQA 3ATSA 2JAMA 3ZSHA 4OTGA 5CI7A 3DAJA 2QOFA 1Q97A 3H9RA 4Q9ZA 5HO6A 4G6NA 4WRGA 3O51A 2XNEA 5M4CA 1S9JA 3QWKA 1ZZ2A 1U54B 2Z7RA 3A7FA 3F88A 3HECA 3ORMA 4LQMA 3F3WA 1UNGA 4FKVA 5D12A 4D55A 4U8ZA 1U59A 2GFCA 2W4JA 4F1TA 4CFFA 3QD4A 4FKLA 2OICA 2PMNX 3CTQA 5KMIA 5IQHA 2P2HA 3QHWA 3FKLA 3K3IA 4O7LA 4HW7A 4PDOA 4L00A 4W8EA 5HVYA 3ZSGA 4GVAA 3UPXA 4MK0A 3SG8A 4FVPA 3SD0A 2OSCA 3R30A 3RNIA 2O8YA 4M12A 5DNRA 1KE9A 5DPVA 5HQ0A 1R78A 2QO9A 3GU5A 3F9NA 3UIMA 3UMXA 3N4VA 3V3VA 1TKIA 2RFEA 4Y5QA 4DGGA 4Z3VA 4H36A 2VZ6A 3POZA 5A4LA 1M14A 4JT3A 4D2PA 3VF8A 3JY0A 1OIYA 5IQEA 2B55A 4PTGA 2HENA 3C5UA 1R1WA 5M09A 4RIOA 2JKQA 4QMXA 4DITA 5B2MA 4DCEA 4QQ5A 2RSVA 1WFCA 3TV4A 5L2QA 2OG8A 4W4XA 4A9YA 4Z16A 4HJOA 5BYYA 4AGWA 3HA6A 5AR4A 3ULZA 2FSTX 3UC4A 3UYTA 1GAGA 1JVPP 4HOKA 4HYIA 4I20A 2C3JA 2WFYA 1KE5A 2X1NA 1ZWSA 5EYKA 4RJ6A 4DEAA 4ZY6A 3TXOA 3MVHA 4QMQA 1Y6BA 1YQJA 3KXNA 1ZLTA 2HWPA 2VRXA 3MY0A 3MH2A 4IM2A 2UZEA 4ZSEA 4EJ7A 4M69A 3ACJA 4FSRA 5DEWA 2Z60A 5F1ZA 5HO8A 1LEZA 3TL8A 4S34A 3WBLA 4D2TA 3CP9A 2V7AA 4K0YA 3V5QA 4E4XA 4EH9A 4F7NA 1GIJA 4HYUA 4BI2A 2G2IA 3EQCA 3ID6C 4GRBA 4H05A 4W4WA 3W55A 4IAZA 1IRKA 3MJ2A 4IM3A 4MXYA 2BFYA 3GNIB 3MB7A 3LW0A 2WD1A 4UMPA 3LFDA 2E9UA 3HGKA 4RX5A 3FZSA 3CEKA 3T8OA 1OKWA 3VS0A 5L2TA 4DCAA 5F94A 4QPAA 5AV0A 4C4JA 5EHLA 5D11A 4RZVA 4QMWA 4FL1A 5FXRA 2B54A 3IGGA 4D4RA 5J5SA 3BYVA 1UKHA 5CENA 2FUMA 1U5RA 3AD5A 3QZIA 5H8GA 3EKKA 2ITVA 4WSYA 3ZO1A 2UZBA 3I7CA 3V5TA 5CSWA 3ZDIA 4NYEA 3R8MA 1J1CA 3LVPA 2V62A 3QRJA 2XBAA 4H1JA 3G5DA 5C8NA 3PPZA 2XCHA 3Q32A 4HPUE 5LVLA 4MD7E 1VZOA 1KOAA 4O6LA 2QOCA 4L52A 4M14A 2DWBA 4IFCA 3BZ3A 4ACMA 4IAFA 5HVJA 3MESA 5HE3A 4M3QA 2BHHA 2OIDA 4BI1A 4U97A 5E92A 1O6YA 3LFBA 2R5TA 2VTTA 4PDPA 5G1XA 4CMUA 5L2IA 4UX9A 3N4UA 2OO8X 3KRLA 2IO6A 5IQFA 2E9VA 3ZLSA 4DH3A 4ENXA 1M2QA 2ZDTA 5A46A 3FQHA 4C8BA 2OXYA 2W4OA 3ERKA 4FKSA 3NX8A 4FV7A 2YERA 1MRYA 4TYHB 4AOJA 1XKKA 1A9UA 2DQ7X 4MNEA 5FGKA 4MCVA 1YDRE 4FT9A 4YBJA 4EZ3A 4ASXA 4TWNA 3F66A 3CTHA 4FG7A 5HX8A 2QI8A 4RJ5A 4TXCA 3BIZA 5AM6A 5EM6A 2H9VA 3DKFA 5CZIA 5B2LA 4U45A 2YABA 3QAME 3SLSA 3VUGA 4ALUA 4O0YA 4YJUA 4G3FA 2JIIA 5LXMA 2ACXA 4DF3A 3BEAA 3EL7A 4J8NA 5JN2A 3TNWA 3DS6A 3F5PA 3OWJA 3CJFA 4UWBA 4FZDB 3SKCA 3KFAA 4KBCA 4PTCA 3PSCA 3A7HA 1ZYCA 4YHFA 1O6LA 3LXKA 4NZWB 3UYSA 4PQNA 4O21A 4E6CA 3AQVA 4YZCA 1BUHA 2ZAZA 4Q2AA 2FA2A 3NEWA 4R5SA 3LHJA 3PXKA 4E6AA 2WMTA 1JKLA 2UW6A 4IVBA 4RPVA 4TN6A 4X3FC 2LGCA 5BYZA 3Q3BA 4E20A 2JC6A 3GOPA 5CSVA 4P5ZA 2B0QA 4PL3A 2YIWA 3UNJA 4E1ZA 5EQYA 3UOKA 2XZSA 3DZQA 3R7EA 2XP2A 3BBWA 1XH9A 4KS8A 2PVHA 1YXXA 1NA7A 1W98A 3GVUA 5J95A 2BHEA 3WARA 1OPLA 3WE4A 3ZHPC 2BFXA 3OT3A 4OBPA 4HVSA 4JXFA 3JVSA 3A61A 3O96A 5FUTA 4NM5A 4AA5A 4FICA 2X8IA 3NPCA 4USDA 4YLLA 3OCBA 5HD4A 2WMSA 2QU5A 4LV5A 3QRKA 3VS5A 4FT0A 4BDDA 3ETAA 3RKBA 5IH6A 5GJDA 5DMZA 4L42A 2R9SA 2BRGA 4W9XA 5M56A 4TWPA 4M8TA 4M67A 4FKQA 4EI4A 2CDZA 2VO3A 5TR6A 5I9XA 2JKMA 4AW2A 2QU6A 4JQEA 2A4LA 4S33A 2ETMA 4G1WA 3U4WA 4WBOA 4QTEA 3RCDA 3FUPA 1CTPE 1P4FA 3FI8A 1PMNA 2ITXA 4AACA 4CSVA 4RC3A 4UXQA 5CNOA 4IVDA 4OBOA 3QQFA 4UWYA 3WILA 3OUNB 2VAGA 4DGOA 4LOQA 4ASEA 4BTFA 3MPAA 2X9FA 3NLBA 2FSLX 3V5JA 2B9FA 4BDEA 4TPTA 3SXRA 3BE9A 1YDTE 3F6XA 4AS0A 5H8BA 3MS9A 4BKZA 4F0GA 2UW5A 5HCYA 4I4EA 4BY9E 2XYNA 2ZB0A 4FTAA 5KE0A 3LLAA 4C61A 1FVTA 2IW9A 3CBLA 4C4IA 4QP8A 3CGOA 4IC7A 4LMUA 2R3QA 1PKGA 1Q8YA 2F9GA 2C6DA 4R1YA 5FWKK 2WB8A 4A06A 4ZLOA 2ITZA 5CAPA 2VX0A 2ITTA 3HV4A 2I0YA 4AGCA 4U79A 4OAVB 3I5ZA 3R83A 3C4XA 5EI2A 4L3PA 4FTUA 3DNEA 1H27A 3ZFXA 3R01A 3FYJX 4OLIA 3H9OA 4EL9A 1WCCA 3UG1A 2W96B 4G34A 3MN3A 5AIRA 5HIDA 5IPJA 3I0OA 4IE9A 2VUWA 3R9DA 3H0YA 4RFMA 5AAFA 3LCDA 5LVOA 4JBQA 2JIVA 1O6KA 2ZJWA 2X7OA 3DJ5A 3OP5A 2QLUA 5AMNA 5ANDA 4XLIA 4NUSA 3VO3A 4FSQA 2OJIA 1E1VA 3CKXA 2XJ0A 4CD0A 3C51A 1NVRA 5EDPA 3V5WA 5K0XA 1R3CA 1KWPA 1FOTA 4OGRA 1W84A 4DFBA 4MNFA 1SYKA 3MA6A 3MY1A 3DU8A 4FKWA 2YM6A 3D7TA 3FQSA 4JX3A 2GHGA 4XV1A 4UZDA 2REIA 5B0XA 3LQ5A 4IWQA 5DWRA 2BIYA 3ZDUA 3G90X 3NYNA 5AJQA 3F61A 5A4TA 2CKPA 4FA2A 3C13A 3POOA 5CSXA 1IA9A 5D9HA 1YVJA 1XHAA 3EFLA 5DEYA 2ONLC 4BCQA 3R7OA 4EH6A 5BVEA 3IDCA 4YJOA 4R6VA 4RJ3A 3GI3A 2OJGA 4FX3A 3NCZA 4U3ZA 1ATPE 5EHYA 1ZYDA 4FSTA 1OECA 4GU9A 1PXMA 1YHVA 1CKJA 3AMYA 4MQ1A 3QGWA 2WU7A 2ZV7A 4GYGA 4PDSA 5CS6A 1J3HA 3F5XA 3RK9A 5CALA 2WMAA 3EMGA 3KMWA 4E73A 1Q8ZA 2W9ZB 4G31A 5CEMA 3D2KA 3V04A 4CFWA 4CG8A 1YOJA 5DR9A 4BTKA 1OL6A 1BL7A 2ITNA 2R64A 5B7VA 2WTJA 4F6WA 2OJ9A 1QPDA 2EWAA 2QOOA 3RPOA 5DG5A 3O2MA 2EB2A 2HK5A 2C3KA 4DFLA 1JSUA 3ORXA 3L8XA 4BZNA 2E9NA 3DK6A 3EN7A 1Q3DA 3MW1A 4O0VA 1UU9A 3FMKA 5HIBA 4YTIA 4EH4A 5BVDA 1BX6A 4P90A 4LMNA 4P5QA 1SMHA 2PZRA 5K0KA 1R39A 4UV0A 3I6WA 5BMMA 4RJ7A 5FBOA 4WSQA 3VBXA 4EH5A 3RM6A 2UZTA 2C47A 2VWYA 4FSUA 5AR5A 3SX9A 4GJ2A 3WF9A 4WG4A 3Q6UA 3LE6A 4YJNA 4YU2A 2QKRA 4O0WA 2G15A 4O91A 4OT6A 3ZO4A 4EH3A 2ZB1A 2IVUA 3A62A 5GJFA 2XBJA 4F63A 2WHBA 4GK4A 5T6KA 3GBZA 3VBWA 4AN2A 3FI3A 3LMIA 3UOHA 3QX2A 3UP2A 5ANKA 3NVKI 3Q9XA 4B99A 4BDGA 1BMKA 4HCTA 3E3BX 4UALA 3SXSA 4XV3A 4EZ7A 4CRSA 2OLCA 2KTYA 2WMWA 2WTKB 4LUEA 4AN3A 1BI7A 4BI0A 1NVQA 4QYFA 5CF5A 1P2AA 3PIYA 4L7FA 2VTNA 4XG6A 5JZJA 3DV3A 4K77A 3D4QA 3VWAA 2J50A 4GT3A 5L8LA 2X2MA 3WYXA 3N4TA 4YZ9A 1KUTA 5BVNA 3HA8A 4YJVA 3A99A 2C3IB 5I0BA 5HKMA 4ZJIA 3UO6A 5IA2A 4ZSJA 1H0WA 3KF7A 5IU2A 4ASZA 1U5QA 3FV8A 3WF5A 2JLDA 5C26A 3WE8A 5CZHA 3TIZA 5A6NA 3VBQA 4FC0A 2UVXA 2WELA 3NUNA 4GT5A 2W06A 4PL4A 2GPHA 4EOMA 3HDMA 2VWUA 3QRUA 3UNKA 4J7BA 4PMSA 4EHZA 4WNMA 5BUJA 2YCSA 3IKAA 3FY2A 3D83A 3IW4A 4JJRA 1AQ1A 4O1PA 2FYSA 2VGOA 2JD5A 4BDKA 5J9LA 4BKYA 2YDKA 4YJRA 5IUIA 1U46A 4LL5A 5KHWA 4EQMA 3UOJA 2OIBA 2E2BA 5B2KA 4CYIA 3TM0A 3C4ZA 3EQBA 5J87A 5DOSA 4O7WA 4X21A 3MFTA 5L8JA 1OPJA 4BCJA 4AA4A 1OUYA 2XM8A 5I4NA 3E8DA 3NRMA 1MUOA 4KNBA 2IG7A 5CU3A 4FV1A 3HP5A 3PSBA 3A7JA 3ZZWA 4F0FA 3KL8A 2Y4PA 3HUBA 2BDFA 2V55A 2VTHA 3OY1A 4ERWA 2CNUA 5AR8A 5M4UA 4O0RA 3Q5ZA 4A9UA 3DAKA 5ANJA 1IASA 2PVMA 4FKJA 1VR2A 4XP3A 2BILB 4TZRA 1F3MC 4QTDA 4ZIMA 2GS2A 5EH0A 2PUUA 5JKGA 4UMTA 4BDAA 4V0GA 2YLEA 2VO7A 4IX6A 4N57A 5ICPA 3OWLA 4M66A 4Z9LA 5BVKA 4AGDA 5JFVA 4U0IA 5KMLA 4GU6A 4O0UA 4AZTA 4BDIA 4ZJVA 3RK7A 3FL5A 3L9MA 4RIYB 5EI6A 3PWDA 2E9OA 3ZLWA 4O7ZA 5HO7A 2YAAA 3VJNA 4FVQA 3GCVA 3QGYA 4LL0A 4QYGA 4YNOA 4BZDA 3LLTA 3QCXA 3Q60A 4P4CA 1YOMA 5AUWA 5JK3A 2UW0A 5GHVA 3S00A 1BLXA 3ZRKA 3TG1A 1YWVA 4DH8A 1V0PA 3O8PA 3ULIA 1ZXEA 3E7OA 4QMOA 3RK5A 3ZUUA 3NIZA 4NM0A 4QP4A 5AP2A 5EQEA 4WBBB 5E8WA 3OG7A 5HTIA 4G9CA 5KCVA 2HZ0A 3WOWA 4RLKA 3R8VA 5FXQA 3RPSA 2IPXA 3HRCA 3NSZA 5DT4A 1UWJA 2W1GA 3OF0A 2WTWA 3U6JA 4C62A 3DZOA 3QRTA 5FTQA 5G6VA 2Z02A 2OWBA 3FZ1A 5AV1A 5C8KA 1A48A 4CLIA 2JGZA 5AV3A 5EDQA 3NYVA 3BLRA 3OVVA 4XRLA 3ZZEA 4ANLA 5EW3A 2QNJA 2EXMA 4FEXA 1RQQA 3FXZA 3TV6A 5AP6A 1GZNA 2J5FA 5IA1A 1Q8TA 4U81A 3AC3A 4DA5A 1GIIA 4OTPA 2Z7LA 4CEGA 1W82A 4FF8A 3ANQA 3GCQA 5AP3A 4EK8A 5JGAA 4WG5A 2OXXA 4W4VA 4RVLA 2GHMA 4AP7A 2R3JA 2XIKA 3IDBA 4PY1A 2NP8A 3DBDA 4DEEA 4EBVA 4G9RA 5HOAA 4EOPA 4G3EA 4X2FA 3PP1A 4CNHA 1ZY4A 4BIDA 1MRVA 3VW6A 4YZDA 4HVGA 4IMYA 1ZYSA 3MVLA 5AP0A 4DG0E 3R71A 4F99A 1QPEA 3ORPA 3AMAA 4KWPA 1H8FA 4XG8A 3F3TA 3SRVA 4BC6A 2PU8A 2OBJA 4FVRA 4JRNA 2F2UA 3UBDA 4E6DA 4YLJA 4GJ3A 2DYLA 4ARKA 3L8VA 4IM0A 5CXZA 5E8VA 5JT2A 1REJA 3C0GA 5DRBA 2B9HA 4F4PA 3ZO2A 3PLAE 5ANOA 2EUFB 3NYXA 5IEXA 3R63A 4XV2A 3SOCA 5E9EA 4EEVA 2Y4IB 5HZNA 3U54A 5T3QA 3QKKA 3RP9A 4B6LA 3A4OX 3BGZA 1DI8A 2WEVA 5CXHA 2HZNA 4M69B 4YSJA 1ZMVA 2OFVA 2VTQA 5HTBA 3GU4A 3UG2A 3VC4A 2PTKA 5DHJA 5IEYA 3HP2A 5EQPA 3FLSA 4Z55A 2V0DA 4XG4A 2YM5A 4L6QA 5LVPA 1M2RA 5CTPA 2YEXA 3OBJA 3LFCA 3R7YA 3R8PA 4E6QA 3UO5A 3OW3A 3THBA 3F3UA 3JY9A 2W0JA 3I60A 4I41A 2C5YA 5DR2A 4O7YA 4FNWA 5M08A 1SVHA 4H3BA 3G9NA 4FV2A 4NM3A 2JEDA 3WZEA 2BRBA 4ZP5A 3NUXA 4BR3A 2R3FA 4FNXA 3I6UA 4CFNA 5TE0A 3I7BA 3FKOA 3DBEA 1NY3A 3UZRA 2A19B 2YHVA 2X9EA 4R78A 3VHKA 3WF6A 3CKWA 4CFMA 3CS9A 4AOTA 4QTAA 4JAJA 2W1ZA 1XO2B 3TEIA 1KE6A 2HZIA 3II5A 1REKA 4MD8E 4EORA 4QRCA 4KBAA 4KUJA 3ALOA 1Q99A 2QOLA 4NFMA 4EOQA 4BHZA 3PJ2A 4CQGA 5A9UA 4QO9A 2OF2A 4GIIA 3HLLA 4S2ZA 2ZOQA 3EYHA 4DFYA 2F7EE 2YAKA 5L2WA 2WIHA 4KKGA 3V5PA 5AP1A 5CT7A 1UU3A 3EQRA 4DEBA 3HMIA 5BVOA 3EQPA 4U7ZA 1B38A 4XNEA 3S1HA 2JBOA 4MXCA 3GGFA 4QYEA 2EB3A 4RX7A 5FG8A 3EHAA 3P79A 4C4GA 4TYIA 4ZK5A 4C3PA 1Q4LA 2FB8A 2GS6A 3M2WA 4MH7A 1WBTA 2IN6A 4TKSA 4YBKA 5DFPA 2NNWB 1X8BA 5DH3A 2ZV8A 4R7HA 2CN8A 3P9JA 1JKSA 1WMKA 3R1QA 4HGTA 4G5PA 3NUSA 2ZDUA 4UMUA 3W16A 1H0VA 3IECA 4O84A 1PHKA 3GEQA 1JWHA 2Q0BA 4IAAA 2E9PA 4XLVA 5HLWA 4MNEB 4LUDA 3KF4A 5HE0A 1XWSA 2A2AA 4A4OA 2XK4A 3PVBA 2XJ2A 4ZLZA 4X6QC 3MYGA 4W8DA 4B8LA 4FKTA 3PWYA 4ITHA 4E5AX 5J1WA 4WOVA 3S0OA 3QYZA 5CX9A 4OTHA 4B4LA 3AGMA 1F5QA 2BMCA 4XG2A 2YIRA 4W4YA 4OUCA 4QQJA 3TUDA 1OIUA 2CCIA 2OXDA 2ITPA 2PWLA 3NIEA 1G5SA 3EH9A 4M84A 1H24A 2C5XA 4HYSA 4APPA 1ZOGA 5DN3A 4FG8A 3DPKA 2HW6A 4J99A 2UZVA 2XNPA 5D1JA 5EW8A 4S31A 3LCSA 1URWA 4CMTA 5DT3A 5K4JA 5IH5A 5LJJA 3MJ1A 4FV0A 4LGGA 1H1SA 2XCKA 4ZS4A 4NKAA 3EB0A 5FEEA 4DGNA 4CV9A 4MKCA 2W1IA 4HZRA 3RBWA 1RE8A 3FXXA 4XRJA 2J9MA 5CWZA 4ZMEA 4IANA 2XIZA 3HVCA 4JI9A 4YZNA 3UO4A 2BTRA 2QVSE 3QZGA 3G0FA 4O0XA 4RX9A 3UOLA 3Q04A 3OOGA 4PP7A 2Z2WA 4OTWA 4JS8A 3GCSA 3V6SA 2GCDA 3KKVA 4EZ5A 1YXTA 1PXJA 3KU2A 2IW8A 2FVDA 3FSFA 4YR8A 2XKDA 1YW2A 3L1SA 4KRCA 2C5OA 3BYMA 5J8IA 3E62A 4U43A 2CGVA 3MA3A 4PPCA 4FTLA 3DFCB 2VV9A 1OUKA 3CTJA 3FPMA 3COHA 3FYKX 1PKDA 5IF1A 2BRHA 3KMMA 1Q8UA 2Y7JA 2C0TA 4RG0A 2XKCA 3EKNA 4BFMA 3VS6A 3FLZA 4FL3A 4IWDA 3ZRLA 5E1EA 4Y72A 3CC6A 3LJ0A 3L8PA 3DCVA 2PVYA 5CU2A 2I7QA 3SG9A 5HIEA 3GU6A 2RFSA 5I9WA 4YC6A 1NVSA 3ZU7A 3NUYA 1PMUA 2GMXA 2J4ZA 5AFVA 3ITZA 3RHXA 3VULA 5KUPA 4YO6A 2OJFE 4HNFA 4I5HA 2UW7A 1PXKA 2O2UA 5DGZA 5HBHA 3W2PA 5ACKA 4E93A 1DAWA 2ITOA 2OZOA 4MXZA 5L6PA 3R00A 5C4KA 3FQEA 2B1PA 2Y0AA 4J53A 4IAYA 5A6OA 5AEPA 2YJRA 2J51A 4I92A 1PXNA 4C59A 4CVAA 4D9TA 1GNGA 4HCUA 5IUGA 4FKIA 5EOLA 4JDJA 4G6LA 5IKWA 5KKRC 3B2TA 2WMBA 4XH6A 3E3PA 4YSMA 3W18A 1UV5A 5KZIA 3EN5A 3GQLA 4DGLC 5L4QA 4O82A 3CPCA 4S32A 1KSWA 4CTCA 3E92A 2CGXA 3P7AA 3BQCA 5AUZA 5HG9A 3UP7A 5IMXA 2VTAA 4GS6A 2W9FB 3F3VA 1R0PA 3L9LA 3O8TA 3KCFA 3R7UA 1H26A 5HE2A 1YXUA 3EIDA 4TW9A 3S4QA 4BYIA 3ZCLA 2X39A 4RC2A 3BU6A 5M51A
chains in the Genus database with same CATH superfamily
2VTSA 5CAUA 3IQ7A 2NRYA 4CG9A 3EN4A 3QD2B 3IOPA 3IW6A 4RMZA 1Y8YA 2PZPA 5IA4A 3Q6WA 5AX3A 5ANIA 2C1BA 3CQEA 1GIHA 3PRFA 4WHZA 4O4CA 2ZV2A 4QQCA 4FYOA 2BDJA 1AGWA 1TQIA 2G9XA 3H10A 5FP6A 3VW8A 4IWPA 3CQWA 3KRXA 4RFZA 3TDWA 4AQCA 1HCKA 5HU9A 1SNXA 4RIWB 4CKJA 4D28A 2BIKB 4LV8A 3FDNA 1OIRA 4BHNA 4F0IA 2OIQA 4CFXA 4V05A 1JBPE 3KN6A 4GEOA 3BL9A 5TF9A 5HLNA 4EONA 5DYJA 1H07A 4X2JA 1YKRA 3U9NA 4B8MA 4I0TA 4NU1A 1IAJA 5HG8A 3LMGA 3D7TB 3W10A 3NNVA 3ML1A 3VS1A 2OU7A 4F9BA 5M07A 1H1WA 3NW6A 4H39A 4AAAA 4JLCA 4FRFA 3V01A 4NL0A 2XARA 5F4NA 4MWIA 4LYNA 3FZRA 4QTCA 3CLYA 2XIXA 3HV5A 4FKOA 4I22A 4FJVA 2PVJA 3VBVA 3FMNA 3D9VA 4YPSA 4E8AA 4J97A 5GJGA 3IK3A 4YUQA 3ZOSA 3QUPA 3S2PA 2C4GA 4I5MA 2PL0A 4JNWA 1J7UA 3CCNA 4GKIA 4NK9A 4I4FA 3FAAA 3NZ0A 4QMZA 3VS4A 1YWNA 1LR4A 3RZBA 4F08A 5GZ9A 4GK3A 5D10A 5LCKA 3V8TA 5JFXA 4XV9A 3CY3A 4BCNA 4DE4A 3QKMA 4ZSAA 4QMLA 2Q0NA 2Y6MA 5M4FA 2QR7A 2AQXA 4GMYA 5AM7A 2QLQA 3W33A 3ACKA 5BVFA 4AG8A 4FYNA 3H3CA 3NNWA 3HRFA 2R3MA 4FTRA 4MXXA 3DXPA 3CQUA 1Q3WA 2ONLA 4BWPA 5LMKA 3BPRA 3OT8A 3LFNA 3TNQB 4XMOA 3KVWA 2PE1A 4FODA 3FWQA 4BDFA 4F9AA 2ITQA 2UZOA 2VTMA 3MV5A 4ANSA 4QMNA 3HAMA 2XUUA 3GFEA 3UMWA 3MDYA 3MTFA 2G2FA 5K4IA 2GNLA 2R3NA 1Y57A 2W7XA 4CYJA 1OKYA 5DA3A 4BGHA 4YHTA 4D1SA 4D5KA 4EC8A 1GZKA 2Y9QA 4PMTA 2O5KA 1XBCA 1BYGA 2VTIA 2C6IA 4FL2A 4IJPA 5DE2A 1FPUA 3FE3A 5M06A 4GSBA 5J7HA 3ORKA 2X7FA 4AXAA 4O83A 4EOOA 4MTAA 3LAUA 1VYWA 2IZUA 5E8TA 1OM1A 3LFQA 1UVRA 5LVMA 3BL7A 2YIQA 4OT5A 5F95A 4X7QA 5HTCA 2UUEA 2UZWE 5KMOA 2P3GX 2QOQA 4QMYA 5C8MA 4O7VA 1WAKA 4D2SA 4ZZNA 2X7GA 2YM8A 5HCXA 3PY1A 4BDJA 4D4YA 5IMEA 3EYGA 3UQCA 1Q5KA 2FSOX 3G2FA 5JRSA 4ACGA 3AGLA 3FMLA 5E7RA 4A9TA 3GU7A 4D5HA 3JXWA 1E1XA 3DBQA 2VWZA 1W0XC 3IDPA 3K54A 1AD5A 4M7IA 4RVTA 3ZRMA 3ZSIA 1J7LA 3VS2A 3ELJA 2W99B 2VX3A 4NIFA 1M17A 5BNJA 3N9XA 1Q41A 3ANRA 1PXPA 1WBPA 3VBYA 3FEGA 2R2PA 5HVKA 2Y8OA 4DBNA 1IAHA 3KA0A 3TNPC 5EOBA 3HZTA 5EI8A 3EQIA 1WVYA 3OTVA 4PMPA 2QOBA 2O0UA 4JAIA 3R8ZA 3DB8A 5ANEA 3VUHA 3DTWA 4V04A 2VWXA 2VWIA 4HGSA 4LI5A 3NUPA 4RLLA 4F64A 5M4IA 4IDVA 3PPJA 4DG2E 4ITJA 2AEGA 4O7NA 1SNUA 2YM3A 4ZSLA 4GT4A 4XG3A 3QQKA 4ZXTA 4CKRA 1PMVA 3P7CA 4FKPA 2VU3A 3SV0A 5LCJA 3F7WA 3W2QA 3PYYA 4IZ5A 4BDBA 5L6WL 4R8QA 3NUAA 4ZY4A 4BCKA 4QTBA 3PIXA 3MH1A 4L9IA 4GG5A 5JMSA 5FD2A 4LOOA 3OMVA 4E5WA 4RIWA 3S3IA 2WQOA 2RL5A 1XH8A 3EZRA 3LM0A 3PY0A 4D1XA 5HLPA 1WBSA 2VTJA 2CKQA 4GUBA 3L9NA 5KO1A 3P1AA 4I3ZA 1TQPA 4O96A 2BRNA 4OTDA 3BLQA 4U40A 3QTIA 4AE9A 5FBNC 4K18A 4FIHA 4EOKA 5L3AA 4V0GB 4QQTA 2XRUA 3AXWA 4HGEA 3M11A 4FMQA 2JITA 1OMWA 2FH9A 3Q4UA 4XEYA 5TKDA 3ZONA 3TT0A 3ZM9A 2C5NA 3MGYA 5K3YA 1Z9XA 4EJNA 2UVZA 2VGPA 3P5KA 5BVWA 2OI4X 3VUDA 4CGAA 2IVVA 5JEBA 4L8MA 4O7SA 4R3CA 5M55A 2PVFA 3GB2A 4JIAA 4GL9A 4KSQA 4I1ZA 5D7AA 4F1MA 3U4UA 4CRLA 4LGHA 4BICA 4O7TA 3EN6A 4K1BA 4D1ZA 1ST0A 1KE8A 3ZUVA 4IX5A 3IOKA 4FKUA 3RAHA 1UKIA 5A4CA 1S9IA 4FIGA 5DI1A 2HY81 4KIOA 3FZTA 3ZC6A 4FIIA 4XOZA 3COIA 4CT1A 1M52A 1PF8A 4AF3A 1WBNA 2XK6A 3R1SA 5CEPA 4UWCA 4A9RA 2BR1A 4RQVA 4RBLA 4JOAA 5LQFA 1JQHA 3HMOA 3R7GA 4N4SA 5HNGA 2C5VA 3VRYA 4IX3A 3BELA 3HV3A 4DEHA 4OAUC 1CM8A 4O2PA 3AC4A 4FEVA 3OZ6A 3CXWA 3CY2A 4IVCA 2O3PA 2HOGA 2WQMA 3EFJA 4FTNA 4U3YA 1ZZLA 3PFQA 1H1PA 2X8EA 2YCRA 3KCKA 3H9FA 4MYGA 4RWLA 5I9UA 4RVMA 4F09A 1WVXA 3RPVA 3CPBA 2J5EA 1BKXA 1JPAA 2UW3A 3UIXA 2RKUA 2UVYA 3OXIA 1RJBA 1PYXA 3KY2A 4IJ9A 4G3DA 3OROA 4TYEA 5M57A 3BYOA 2PVNA 4RZWA 4AXDA 4JG6A 4FZ6A 3E63A 4IDTA 4E4LA 4H3QA 1H4LA 3QFVA 4A4XA 2I1MA 2SRCA 1EH4A 3TNHA 4RWIA 2P2IA 3SRVB 3PG1A 2QOHA 3Q2JA 4ACCA 3NW7A 4ANMA 4CT2A 3QZHA 4EKLA 3PA3A 1J1BA 4FTMA 1SVGA 4U9AA 3C1XA 4UXLA 3QA0A 3RJCA 4C38A 4C35A 1UU8A 4FEWA 2OH0E 3DOGA 4DINA 2O63A 2IWIA 2JAVA 3P0MA 4O38A 4AZEA 5FTOA 3QC9A 2X4ZA 2VN9A 5BPYA 4D2WA 2PUNA 4IWOA 4J71A 4YO4A 2XS0A 3MI9A 3OXZA 4M97A 3ORZA 5FXSA 4TNDA 4H1MA 3TKUA 3A7IA 3DK7A 3MIAA 2CMWA 2R4BA 4XJ0A 3BYSA 4YZMA 4JL9A 4C02A 4KRDA 1H28A 5CNNA 5A4EA 2C6MA 3QLGA 2BDWA 2QHMA 2W5HA 4DFZE 3TUCA 4ZAUA 1SZMA 2RG5A 2YJSA 3PP0A 3CD8A 2GNJA 3BQRA 2XRWA 4A7CA 2PVRA 5IDPA 4TYJA 4K9YA 5H2UA 5LOHA 3JR1A 3QTSA 4AW5A 4CCUA 1G8SA 1YWRA 2JBPA 3H0ZA 4XP0A 2H34A 4KIKA 3PY3A 4EWHA 3SXFA 3NGAA 2ERZE 3PSDA 5H3QA 5KNJA 3MH0A 4WNKA 4USEA 4MD9E 3QLFA 4TWOA 4GK2A 2P55A 1T45A 1NXKA 4FEQA 3D5UA 4FZAB 4NEUA 1RW8A 5AV2A 3UIBA 5HGIA 3R28A 5HBEA 4C33A 1YXVA 3PXRA 3A2CA 2AC3A 4DEIA 4Z7HA 3UPZA 1MQBA 4I6HA 4LDTA 4C36A 5JSMA 2P33A 4AUAA 4J1RA 1CMKE 2XK3A 5J1VA 4L46A 3WI6A 2IF8A 1XBBA 4F1OA 1M2PA 4E4MA 4PNKA 2I0EA 3LJ2A 3FZOA 4ANQA 5IDNA 4IACA 4RA5A 4FTIA 2UW4A 3R22A 3W2RA 4R3RA 3WF7A 3R9OA 3RZFA 5CVFA 5AWMA 3C0HA 1W7HA 3KMUA 1G8AA 4RFYA 4IFGA 4Q5EA 2OKRA 3NAXA 5IEVA 4I93A 3TWJA 3KREA 1FVRA 3R02A 4FK6A 5DR6A 4NCTC 1P5EA 4ZTLA 3IONA 4RGJA 4YC3A 2VTOA 4DGMA 2JDVA 2QURA 2X2LA 4P2KA 4MHAA 3ZTXA 1FINA 1DI9A 3O0GA 4RT7A 4AT5A 2X0GA 3BYUA 4EK6A 4CFVA 2I6LA 4OTQA 2YN8A 4DT8A 3MPTA 3OCGA 5EYCA 4QOXA 2X8DA 3FC1X 2WAJA 2HY0A 3HAVA 2FGIA 3F5UA 3CIKA 2R3HA 4FBXA 3O7LB 3FMJA 5CU0A 2UZUE 4BYJA 2J0LA 4K6ZA 5J7BA 1O9UA 3HKOA 3B8RA 4HVHA 2W1CA 1I09A 3GU8A 3O23A 3LKMA 3QQJA 2PZIA 4F9YA 4BL1A 4E5BA 2WKMA 2ZM4A 2O65A 3NUUA 4YP8A 4CV8A 4FSZA 2B4SB 3NW5A 5EM5A 4I6BA 4DBXA 1H01A 5CAQA 4KKHA 2BUJA 4I23A 3D2IA 1K3AA 1I44A 3KK8A 4JBPA 1ERKA 1K2PA 4KBKA 3W8QA 2NO3A 1QPCA 4FOCA 4NW5A 1G3NA 5E90A 2I0HA 2RFDA 3DA6A 4WUNA 2QO2A 3ROCA 3W8LA 4C7TA 4EHEA 3QTUA 3QD0A 3GFWA 3PJ3A 2XKEA 4OR5A 4FIJA 2W4KA 3WZKA 4L3JA 3VQUA 3FSKA 4WNPA 1PMEA 3F2NA 4XBRA 3H30A 5EFQA 3IGOA 4IAKA 1U4DA 4ZJJA 3EQFA 4L3LA 4XOYA 3A4PA 4RIXA 1Z57A 2R3KA 3MPMA 4GVJA 1FGIA 3ZEPA 2W5BA 4IVAA 2Y6OA 4R3PA 4AZFA 2CSNA 4P7EA 4DEDA 2B9IA 1NT2A 2PUPA 4JMQA 2AYPA 3FHIA 2RIOA 2EU9A 4BVUA 2IZSA 2EXCX 2UW9A 3F3ZA 4R1VA 4CZYB 4ZLYA 4GH2A 1Q62A 4RC4A 1WVWA 3RTPA 4O6EA 5CT0A 4AZSA 4QMUA 3QQGA 3F69A 3TZ7A 4X3FB 4ACDA 2A27A 4QP6A 2BAQA 3I5NA 1OPKA 5BV3A 4MVFA 4ASDA 4CQEA 4JIKA 4N70A 3DKGA 3T3VA 3M1SA 5KMMA 2ZMCA 3AG9A 4BBEA 5C01A 3G15A 2WNTA 1YHSA 5IA0A 5CQWA 3O5AA 2I0VA 3DK3A 5E8SA 2OZAA 4XBUA 5E8YA 3EZVA 2CN5A 4FV3A 4FNZA 5GIOE 3QX4A 2HCKA 4WG3A 3DKCA 4UBAA 4WRSA 1XH4A 3P86A 5DLSA 1OL5A 4GFGA 4DT9A 3KULA 3NCGA 4FGBA 4HPTE 4TRLA 5HE1A 5FTGA 5AR2A 3OD6X 2OJJA 2WMQA 3U8WA 4GW8A 4MEDA 5CAOA 4AT3A 2XANA 4L45A 1Q8WA 3LZBA 4CTBA 2WPAA 4GUEA 3DJ6A 4Z7GA 2ERKA 4NM7A 5CQUA 2C69A 3P78A 3VF9A 1PY5A 4EHVA 4ZY5A 4U42A 1ND4A 1Y8GA 3ORLA 5JRQA 2WQNA 3PJ1A 2GFSA 2PVLA 2YISA 1JSVA 4AN9A 2OGVA 5HG7A 3BWJA 3W1FA 4Y46A 3IW8A 2YCQA 3RI1A 2YITA 1LUFA 5DIAA 2HAKA 3GC0A 1KV2A 4FZ7A 4QP3A 3FBVA 1JKKA 3FI2A 3R9HA 4A07A 3ZM4A 3NNUA 3C9WA 3OWKA 3C0IA 4DHFA 5J9YA 2J7TA 3FC2A 5E1SA 4F9WA 3BLHA 4AW0A 3TZ9A 5HICA 4D0WA 3QXOA 3FLWA 4FZFB 3LOKA 3DT1A 4YC8A 4GKHA 2XIRA 5IA3A 2JKKA 2XB7A 3AOXA 2YA9A 4ZMFA 3SC1A 1Q61A 4H3PA 4EK3A 4F65A 5BUIA 5EYMA 4ZSGA 2YACA 3VRZA 4BGQA 1OI9A 3JS2A 3NDMA 4EC9A 2OF4A 5EG3A 1ZAOA 4D0XA 4DTAA 3NNXA 2BALA 4XHKB 4AA0A 4MXAA 4UEUA 5CYIA 1OIQA 2NPQA 3OEFX 3LCOA 2OW3A 5AR7A 2W05A 4A4LA 3DDPA 3QC4A 3QZFA 3QCSA 4QMPA 3UC3A 4L68A 2JDTA 4O81A 2WEIA 3KXZA 3DY7A 4IBMA 4PP9A 4M15A 2C6KA 3PJCA 3BV2A 3ORIA 4BTJA 2IVTA 4IW0A 2XH5A 1XMMA 4QEBA 3VUMA 2DS1A 2ETKA 2JFMA 1M7QA 3NFFB 4G16A 5C9CA 3ET7A 5CU6A 4XYFA 3QKLA 1PXIA 4FTCA 2R3IA 5IQIA 4ENYA 4HZSA 3E93A 4JBOA 2P0CA 2CGWA 2VNWA 2FO0A 2J0JA 2QC6A 4MBLA 4ONAA 4BB4A 4EOLA 2YDIA 3BRBA 4W9WA 3RCJA 3SW7A 3ZFMA 3A8WA 1YRPA 3MBLA 4Y83A 5DRDA 2YCFA 1GY3A 3VBTA 4C2WA 5KBRA 3R1YA 4F6SA 5GZ8A 5HEZA 2VNYA 2WQBA 5CASA 2HW7A 5AUUA 4D4SA 5LWMA 3AKKA 3C50A 1PYEA 3TKIA 5IH4A 2W1HA 3D94A 3C5IA 3OHTA 4L43A 1GZ8A 5AADA 5A14A 2GQGA 3RM7A 1ZYLA 3ATTA 1YI6A 2WTKC 3LFSA 3R73A 4GG7A 5FLFA 3TZMA 4C58A 3BGPA 4UYAA 3ZS5A 2HZ4A 4CZUA 2GS7A 2AUHA 4D58A 4EOIA 3MB6A 1CKIA 1BI8A 1Y91A 2VO6A 3GQIA 4V01A 5HNBA 3UDZA 4IZYA 5BMSA 2RG6A 5I9YA 3KIOC 3PZHA 5HHWA 4XG9A 2WQEA 4FR4A 4QP1A 4XG7A 1GJOA 2C6EA 3LIJA 3KXGA 4B0GA 1P14A 3A7GA 4II5A 3JPVA 2VTLA 2F49A 3SDJA 4AQKA 4I21A 3E5AA 5EK7A 4IIRA 3ZEWA 3GC8A 3BWFA 4C0TA 3GXLA 3P7BA 3R7VA 1H1RA 4KIQA 4LRJA 1L3RE 3Q4ZA 4X3FA 3MFSA 5CLPA 4WT6A 4QMTA 4EUTA 2B52A 2UZLA 4F7LA 5H9BA 3O50A 1VEBA 3MIYA 4OW8A 2W1DA 3SHEA 1YHWA 5FRIA 4WNOA 4G17A 1XR1A 4U80A 4N6ZA 4EKKA 3BEGA 2OK1A 5HBJA 3FL4A 4ITIA 1PXOA 2BROA 5AX9A 2X81A 5IQBA 2A0CX 4E3CA 3BHTA 1CKPA 4G2FA 3DXNA 4FK3A 4KKEA 4UY9A 5EM8A 2WTIA 3OW4A 3ZYAA 3OUKA 3QQHA 3TZ8A 2YWVA 4NIFB 2C6LA 4IH8A 1OITA 2QCSA 3QYWA 3H4JA 2JKOA 2BAKA 5EKNA 2ZV9A 1LP4A 4RA4A 3FZPA 4DC2A 4JVGA 1OL2A 1V0OA 2V22A 4I5PA 4AGUA 3G33A 4K8AA 4PUZA 1B39A 2JIUA 3G0EA 2XEYA 4Y73A 2WO6A 3I81A 4GFMA 4JQ8A 3RWQA 4E26A 5HU3A 5FDPA 4PMMA 1OGUA 4NW6A 2G1TA 3DBCA 4RJ4A 3Q4TA 4WO5A 2PMIA 3RAIA 3ZBFA 4OBQA 3PG3A 3QF9A 1TVOA 4N0SA 3HMPA 3Q52A 4UMQA 3VQHA 4CMOA 1FVVA 2WZJA 4BDHA 2XNBA 1ZMWA 3UZTA 1ST4A 2CKEA 3S95A 1HOWA 2UW8A 1LPUA 3B8QA 3BHHA 3R1NA 4WIHA 5C1QB 1F0QA 4MF1A 4TT7A 5AUVA 1STCE 1B6CB 4X2GA 1JSTA 4DAWA 3HX4A 3PVWA 4TY1A 1OL1A 4F7JA 5CF4A 2RF9A 5CF8A 3DLSA 1JKTA 3NS9A 2QONA 3E8NA 3F7ZA 4ALVA 3VAPA 4TWCA 2XMYA 4AFEA 4F70A 3BKBA 3AC1A 5JFSA 4IQ6A 4O22A 5CANA 2PSQA 1UNLA 1V1KA 1J91A 5TOZA 5ETFA 4QYHA 3FLQA 3ODZX 4FV5A 3ZO3A 5F9EA 4YJSA 1XH6A 4IXPA 4MBJA 3RAKA 4HVIA 4M0ZA 4NJDA 3QRIA 3R8UA 4X0MA 3T9TA 4AOIA 4K2RA 3REPA 2R3RA 1OVEA 3LM5A 5HCZA 2GTNA 3NVMB 2Z7SA 4O1OA 2WU6A 3VUKA 4G5JA 3CGFA 4DDIA 3MFRA 4IX4A 3BHYA 2R7IA 3PZEA 4B7TA 1OB3A 3KQ7A 2F2CB 5K5NA 3MTLA 5F20A 4PWNA 2PZYA 3UTOA 1H25A 3V5LA 3DAEA 3DJ7A 3DDQA 3ENMA 4FV6A 3RINA 2PUIA 3V51A 3I79A 3FHRA 3VUTA 3VS7A 3ZFYA 4LM5A 3OOMA 5JQ8A 1APME 4IB1A 1OKVA 3ZXZA 2IZTA 2J0IA 4EYJA 5CF6A 3BBTB 3FY0A 4C3FA 4ZS0A 4ZTRA 4IZ7A 4NTTA 3U6IA 3DLZA 2OFUA 1ZOHA 4O7RA 4AZVA 1QMZA 2PVKA 3PTGA 2HELA 3FPQA 5IZFA 2VWVA 1OKZA 3HUCA 4RRVA 3T3UA 3FLYA 4O27B 3PJ8A 4FGRA 4PX6A 3NMUF 2F7ZE 3DBFA 1RDQE 2QKWB 4ZZMA 4CKIA 1U54A 3DQWA 2C0IA 5KZ0A 4ANNA 4DH7A 3GC7A 1J7IA 4TNBA 4UB7A 4JRVA 5AP5A 3IPHA 4PRJA 4TL0A 5KHXA 3DFAA 4PDYA 5K5XA 3PXFA 1ZMUA 4MXOA 5I9ZA 1WBOA 4YNEA 1VYZA 1XBAA 4IC8A 1XQZA 3CD3A 4FIFA 2GTMA 1K9AA 5JZNA 3R9NA 3RMFA 5JFWA 4NT4A 4D9UA 3E87A 2Y4IC 4DLJA 4FE2A 3OCTA 5IQAA 3W0QA 3OCSA 4FI1A 4J52A 3Q9ZA 4C4FA 4G3GA 3GP0A 3RPRA 2GNHA 4YPDA 4AT4A 1PW2A 4BKJA 4EUUA 3ZXTA 3DTCA 3Q5IA 4B9DA 4KB8A 5C03A 2QQ7A 3VIDA 3OXTA 4DFNA 2I40A 3TKHA 5GIPE 3BX5A 4HNIA 3R2BA 4APCA 1WZYA 3BU5A 4ANBA 1PJKA 3BHVA 2YZLA 3QU0A 4BTMA 2X6DA 3E64A 5A4QA 2R3PA 3IW7A 4C4HA 3HMNA 4U41A 2WGJA 1W2CA 4AWIA 3M42A 2X4FA 2H6DA 2QR8A 3TJCA 3UVQA 4EOSA 3AMBA 4R77A 4FKRA 4ALWA 5I9VA 5CEQA 4FEUA 4O0SA 4NSTA 5KBQA 4UYNA 3TNIA 1IA8A 4IB3A 4PPAA 3KK9A 1GOLA 2XA4A 2C6TA 3MFUA 5AA9A 1OBGA 2NYAA 2GU8A 5IQGA 4FSNA 2JDSA 2BKKA 3WZJA 3TN8A 5CI6A 3MY5A 3TUBA 2NRUA 4M68A 5ETCA 3QQUA 4L67A 2CNVA 1YXSA 3C4WA 3OBGA 3OTUA 4QMSA 5CSHA 3EQDA 4AX8A 2XK7A 4O0TA 4BZOA 4FV9A 2YLFA 4NKSA 3TCPA 4DH1A 1UNHA 5AUTA 3W0OA 5FM3A 3VN9A 4FTKA 3LXLA 3EQGA 3P4KA 3FMDA 1OBDA 3WIGA 2PE0A 2GSFA 2ITWA 3R2YA 4KIKB 4FSMA 5E8UA 4I6FA 4I6QA 4DFXE 1JAMA 4KAOA 1YOLA 2R0IA 2XEZA 1P4OA 3V6RA 3ZH8A 3Q4CA 3BI6A 4FUYA 4QNYA 3GCUA 3T9IA 4DH5A 3AD6A 3PIZA 5J5TA 2H96A 5CEKA 3W32A 3WIKA 3BU3A 1JLUE 3WZDA 2YDJA 1FBNA 2CPKE 4X2KA 2HXQA 3ZLYA 3BGQA 4F78A 3A60A 3ROYA 2WXVA 2YIYA 3OWPA 2Z8CA 3G6GA 4GIHA 4ZOGA 4Y5HA 4R7BA 3IO7A 3VHEA 4BCPA 5CEOA 5TT7A 3MVJA 2GHLA 4LFIA 5D41A 2JFLA 3NWWA 4KINA 4EH8A 4JG8A 4CZTA 2ETRA 2YFXA 3SAYA 1KOBA 4M13A 4YGAA 3WF8A 4R5YA 2IVSA 3UDBA 2B7AA 4YTCA 3MWUA 3ODYX 2JDRA 5AAEA 4GFOA 2DUVA 3RNYA 2QHNA 3GUBA 3QHRA 3D7ZA 5JQ5A 3TDVA 2QG5A 2C3LA 4HCVA 2LAVA 3LPBA 1VJYA 3VVHA 2CLXA 3GENA 3W2OA 3QA8A 4Y85A 5CVGA 5D7VA 2BPMA 2QD9A 3FKNA 3KXHA 3KRJA 2YIXA 4WUAA 5L8KA 2O64A 1W2FA 2WOTA 4UN0C 5IQCA 4ZEGA 2PZ5A 3QUDA 2PMLX 5FEQA 5FP5A 3EQHA 4TYHA 4C4EA 4EQUA 2UZDA 3PE1A 2ITUA 4BRXA 3R8LA 1GZOA 4K33A 4XX9A 1TFFA 3K5UA 4A9SA 2VWWA 3CJGA 3V8WA 5LMKC 3D0EA 3W0RA 1H1QA 4X2NA 1YI4A 4ZTMA 5IISA 2V5QA 4CCBA 3TTIA 3HV7A 5LMBA 3N51A 4IHPA 4ZTNA 3VS3A 3OEZA 2QG7A 5I3RA 1CDKA 4IB0A 3VONA 4H58A 4MBIA 4RWJA 4BIEA 4Q5HA 3D5VA 3K5VA 4FTQA 3ZUTA 2XYUA 4R7IA 3Q96A 2J0MB 3OS3A 4NCTA 4I5CA 4D2VA 1Y6AA 3R04A 3KRWA 3MVMA 5AIKA 3PA5A 5EKOA 4S30A 3R6XA 5C27A 2XNNA 3UE4A 4PPBA 4JDHA 5AP7A 3DB6A 2IZRA 4G3CA 2G01A 4L53A 3D14A 4BDCA 3QBNA 4IEBA 4EHGA 4DHZA 2C0OA 4EYMA 2XM9A 2W17A 5M53A 5M44A 3D15A 4BCIA 2PPQA 4I24A 4RX8A 2PHKA 2QOIA 3BCEA 3L9PA 3QQLA 4I0SA 4QMMA 3EFKA 3KC3A 1UA2A 4RIXB 2ZM1A 5FDXA 5FQDC 2R3LA 1Q24A 4N6YA 2J6MA 4U6RA 3RPYA 3UODA 5C4LA 2BCJA 5CVHA 2R7BA 4PV0A 4DEGA 5JGBA 4YTHA 3AT2A 4DLIA 5L6OA 3UQGA 5BYLA 3PXZA 2XK9A 3JUHA 2HYYA 2WTCA 2PK9A 4NWMA 1URCA 2WMXA 4QYYA 3F2RA 4EBWA 1ZOEA 2ESMA 5IG1A 4ZTQA 4IB5A 2BZKB 5A3XA 2CNQA 3WZUA 3PE2A 5J79A 4LRMA 3LCKA 3ORTA 4XUFA 3C7QA 3HDNA 2G2HA 2ZYBA 3BV3A 2PYWA 1CSNA 4AE6A 2XNOA 5K9IA 1PXLA 3G6HA 2W5AA 1R0EA 3K2LA 4JDIA 2CCHA 2GNGA 2QO7A 4YZBA 4UZHA 4BCMA 4EK4A 1ZYJA 5CEIA 3DKOA 4QP2A 3G9LX 2VTRA 4EWQA 3CSVA 5H8EA 4ANOA 5EM7A 2BVAA 2OZAB 1FGKA 1SVEA 2PY3A 3IW5A 4WA9A 3DXQA 1HCLA 3JVRA 4DG3E 3F2AA 4XCUA 4JX7A 5I3OA 5HD7A 4USFA 1FMOE 4EQCA 3A8XA 4CLJA 5KMKA 4ORKA 2QODA 4QPSA 3RHKA 4BBMA 2IW6A 5LMAA 4F6UA 3KULB 3AD4A 4BIBA 4F9CA 1M7NA 1LEWA 4I0RA 4YJPA 1MQ4A 2YM4A 2B53A 3W2SA 4C37A 2VTPA 2BRMA 4DN5A 1W2DA 2CGUA 4EOJA 3TV7A 1QPJA 3HNGA 5JH6A 3PXQA 3EWHA 2BTSA 1OZ1A 3QTRA 2H8HA 4RJ8A 3V8SA 5I5ZA 3PFYA 2ZVAA 2W1EA 2ZMDA 1JNKA 4IAIA 3ENHA 4OTFA 3I4BA 5FM2A 4YJQA 2WTDA 1L8TA 3E7VA 2WMRA 4XP2A 3EJ1A 3FMEA 3ZC5A 4BCOA 4RSSA 3IS5A 3LQ8A 4MX9A 3TMOA 4JR3A 1IG1A 4J8MA 4RQKA 5CSPA 3QCQA 2EVAA 3FXWA 3GC9A 4DTKA 4QDVA 2ITYA 5GZAA 4ZZOA 2XVDA 4ZTSA 3HMMA 2F4JA 4MF0A 4MWHA 2UV2A 2BAJA 3PUPA 4JG7A 2V7OA 5DBXA 5BUEA 3TJDA 5KKRB 3UJGA 1UU7A 5HNIX 1PRYA 3KVXA 3FLNC 3R9RA 2GNFA 3FMHA