4EH2A

Human p38 map kinase in complex with np-f1 and rl87
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
351
structure length
337
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 337
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh2A01
4YJNA 4FTTA 5F9EA 4FZFB 2VU3A 4KKGA 4C02A 4U9AA 3NGAA 3E62A 5LOHA 2UW9A 5FUTA 2ONLC 3Q2MA 1Q61A 1O6YA 4QPAA 1PXOA 5JZNA 5FWKK 4S32A 4UMRA 5T3QA 1WBPA 1ZARA 3DDPA 3BIZA 5DR2A 5EDQA 2BKKA 4CKJA 1OUKA 3RHKA 5C8KA 3DAKA 4AW5A 3FJQE 2QOCA 2XKDA 4D2RA 3DDQA 4IVDA 5AJQA 5FXQA 5G1XA 1M7NA 2CGXA 3CTQA 3I7CA 3U4UA 1FVTA 3QALE 4G9CA 2QURA 4ANSA 4GU6A 4I21A 3OTVA 4AACA 3WBLA 3UP2A 3VBQA 4BKJA 3FZSA 2IPXA 4EI4A 3MB6A 5E4HA 5EM6A 5M09A 3KF7A 3WE8A 3KULB 4TWCA 5M4UA 1VEBA 4IAFA 1BX6A 4KSQA 5F20A 4BWXA 5AV4A 4YP8A 1JKSA 3F7WA 3D7TB 2BKZA 3RCJA 4OTDA 3SG8A 3Q4CA 2VTTA 4ZTNA 3GQIA 4FL2A 3E8NA 4WKQA 5ITAA 3AMYA 2C0TA 3HMIA 4U3YA 5CAVA 4O2PA 4KUJA 4EOOA 3ZFXA 2W1HA 4RJ5A 4ANLA 4LV5A 1O9UA 4C37A 4YSMA 3VBWA 2PUPA 4RJ6A 3NW6A 4F7NA 3U8WA 5CF6A 5CSVA 4U97A 3QD4A 4YZMA 4BY9E 5HVJA 2C6IA 4IHPA 2QOBA 2ZAZA 5L8JA 2JDTA 3EHAA 4YUQA 4ZAUA 4OTGA 4L42A 4G6OA 1PXPA 3ITZA 5HG7A 3EQHA 2ZM1A 3DK3A 3E3PA 2GNHA 4U6RA 3LLAA 2RG6A 2VO6A 3FSKA 4IAAA 4P90A 4CD0A 5HZNA 3PWDA 3QFVA 4TW9A 2Y4IB 1HCKA 3DU8A 3VUIA 2UZNA 2X7OA 3AC8A 3FAAA 4BHNA 5FDPA 3QUEA 4DH7A 2OWBA 2P33A 4F0FA 2CKOA 5EQPA 3R9DA 4F7LA 2QODA 2WQNA 3MA3A 5CSHA 5EM5A 2JAMA 3FMDA 4L44A 4FTMA 4BCQA 4RWJA 3E8CA 3QQUA 3UIMA 2W4KA 1FGIA 3KRXA 4MKCA 4PL5A 1I09A 2X2LA 4FODA 4FGRA 3O51A 1PMVA 4EZ3A 3ZUVA 4O0XA 5ANOA 2Y7JA 4IANA 4CFVA 4CMUA 2QO2A 3KRRA 3NUSA 4MD7E 4O0TA 4ENXA 4U3ZA 3FPQA 4EH9A 2GQSA 4MNEA 5F95A 2XCKA 3ZZWA 3CIKA 4CZYB 4U40A 4NM7A 4EH2A 5HGIA 3PPZA 4TN6A 1XKKA 5TT7A 4IVBA 2CKEA 3PXRA 3MPTA 4CNHA 5IQFA 4DGOA 4HVHA 2XKCA 3KRLA 4YC3A 5B2MA 4ZTSA 3FDNA 3A7IA 3CSVA 1K3AA 3I7BA 4O7VA 3ORIA 3W8QA 4W4WA 4CKIA 2W1FA 4B9DA 4U79A 4RC2A 1K2PA 4FSUA 5CEIA 3N4VA 2I0EA 1GZKA 3QZFA 4K9YA 4C3FA 3NNWA 4BWPA 1ZOHA 3A60A 3NYOA 1ZMWA 4F6UA 2C4GA 5C8NA 2JD5A 3HL7A 5LMAA 3IDBA 2R4BA 2YISA 1WVXA 3DCVA 3LXNA 2UUEA 3Q4TA 4APCA 2UW4A 2YIXA 3OOMA 3FKLA 2XNEA 3LMHA 2R3QA 4EC9A 1G8SA 3NNVA 4ZP5A 5AUUA 5DRDA 4D4SA 3JY9A 2X6EA 4JAIA 2UZEA 1ZOGA 4I92A 3UIBA 3NMUF 2JGZA 4BI2A 5DHJA 1H28A 1JQHA 1WBOA 2B7AA 2JBPA 4YJSA 3HAVA 1PXMA 3FI2A 2XEZA 3I60A 4YC6A 3UTOA 4BCJA 4YTFA 4BCOA 4DFYA 5HE2A 4N4SA 5AEPA 2VTSA 3BRBA 4EKKA 3D4QA 3Q5ZA 4YPDA 5D41A 2W1ZA 3PA4A 2ZJWA 4XG6A 2IZUA 4E4NA 4WG5A 2W1IA 1GNGA 1H00A 2VTPA 4O38A 1T46A 3EIDA 3FLWA 4BTFA 4FYOA 2JC6A 2WB8A 3ZDIA 5CAPA 5L6OA 3R2BA 2A1AB 4I93A 4L3LA 4BC6A 3HV7A 3LXLA 4RGJA 4M8TA 4N6ZA 2NNWB 3QLFA 5M07A 2BUJA 5CSWA 4PV0A 5EKOA 2EU9A 5HE0A 3UMXA 5KHXA 4N6YA 5CAOA 2O2UA 3EL7A 3VRYA 1PYEA 1XH7A 1YWVA 3COMA 4FT5A 5HNIX 2QOQA 4A9TA 4QMYA 1XBCA 5ANKA 1SVGA 5G6VA 3RI1A 2BFXA 4UYAA 1DS5A 5K5XA 1KV2A 1I44A 4F1TA 3VS0A 3PDTA 4RX7A 1E9HA 3HP2A 3KXNA 3FZPA 4I5MA 1UU8A 5HVKA 3PRFA 3R7UA 1WVWA 3RMFA 4EHGA 2OH4A 2BALA 3F5PA 1P5EA 4QO9A 2F2CB 2R3MA 3H0YA 3M11A 1OM1A 3RPYA 4JQ7A 4ASEA 1REJA 4LMNA 2WQMA 4PTGA 2R3LA 2YM4A 4FKIA 3VO3A 2BZJA 4C57A 4CYJA 3U9CA 5HG8A 4Q9ZA 1XH8A 2BCJA 3LFBA 3W10A 2CSNA 4DT9A 2OF2A 2WTDA 3TN8A 3EFWA 3QTQA 2HXQA 4DLJA 2QR7A 4FEQA 1W98A 3ZO1A 2WTJA 3KVXA 2YIRA 4PDOA 2ZV7A 2R0IA 4H58A 4K6ZA 5C27A 3G51A 3PA5A 3BYMA 4I5CA 3ZM4A 1Q41A 4MCVA 1H01A 2JBOA 3EN6A 4GV1A 2J90A 4OTIA 3OEZA 1ZWSA 2REIA 5D11A 5GINE 3QYZA 3R30A 4EH8A 5AUZA 1HOWA 3ROCA 3G9LX 2PVHA 1YHWA 1UVRA 4XH6A 3FEGA 1ZYSA 5IH4A 3E64A 4EWHA 4NL0A 1PXLA 4FIFA 2WMTA 3F9NA 3UNKA 4IE9A 4F9BA 1SMHA 4NCTC 4RA5A 4Y5QA 3SKCA 3WZDA 3PE2A 4D9UA 5L2WA 4MWHA 4IM3A 1URCA 4G3DA 4R3PA 4EYMA 2YM6A 4YHFA 2XNNA 3HRCA 5E8SA 5E8VA 4AP7A 4B99A 3DGKA 2A2AA 5IQDA 1OKWA 2J6MA 2W9FB 2ZDUA 2JKMA 3DV3A 3E8DA 2VTMA 4ORKA 2OZAA 3WZKA 5HU3A 4XV9A 2BAQA 3QQFA 3VRZA 4ZTHA 5CANA 3CXWA 3EQGA 4AOIA 2CNVA 2RSVA 3A8WA 3FMMA 3BE9A 1WVYA 4OAVB 2DYLA 2ZYBA 4DFUA 3QXPA 3TTJA 3TKHA 1Q8TA 3ANRA 4L01A 4DBNA 4CMTA 3LMGA 3TM0A 2QONA 3DJ7A 3WZUA 3IW6A 2WMQA 4WRGA 5HCYA 5AAFA 4DFZE 3H10A 4EUUA 5FXRA 5J8IA 1KE8A 3F6XA 4XLIA 2C3JA 3LCSA 3V6RA 2VTHA 3UYTA 5A46A 1ND4A 1J1CA 4JDIA 2ZB0A 2AC5A 3PXYA 4I23A 4U42A 2B9IA 2R3OA 2X8DA 2W99B 4F4PA 3UPXA 3RHXA 3QTIA 5K3YA 4G3GA 2PTKA 5HTIA 4IB5A 2YJRA 4QTDA 2RG5A 5DR6A 5BUEA 4JDJA 4IXPA 3DAEA 4IAYA 1OIQA 1OL2A 2VWUA 3BLRA 3C5IA 2CN5A 2HY81 2HYYA 4BKYA 4E3CA 2VNYA 4CEGA 2Y0AA 5EK7A 2FA2A 5LVPA 2GNIA 4YURA 2UVZA 3UP7A 4O22A 3QXOA 4H3PA 2HW7A 4U45A 4C2WA 4D2WA 4FSNA 2YDIA 2WTKC 4O96A 3F61A 4PF4A 4NK9A 4MVFA 4DC2A 1JOWB 1MRVA 3NIEA 3QCQA 4B7TA 5E9EA 3VS3A 2W7XA 3S1HA 3AC3A 3DFCB 4KRCA 5F4NA 4QMQA 5KMKA 5IQBA 3OS3A 3GFWA 4XEYA 1YI3A 3W2PA 2UZUE 2YCFA 1DAYA 1U5QA 5KZ0A 2G01A 1LUFA 4X3JA 3IOPA 3DPKA 2PMLX 3MFTA 4GKHA 3EYHA 3KN6A 4Z16A 2OIBA 1ZY4A 4X3FC 3LLTA 5CVFA 4AS0A 4NYEA 4I6QA 4NW6A 4ZSJA 4EOKA 2BAKA 3L1SA 2X9FA 3QTSA 4R1VA 4EK5A 4C59A 4J97A 4X2FA 4CGAA 1Z5MA 3MV5A 2B53A 4BDIA 5FTOA 3F66A 2PULA 2XNGA 2BR1A 3OUKA 3KXHA 2OJGA 4L7SA 4FIHA 4FKVA 4QMLA 5EYDA 4L00A 2HXLA 4JBVA 3KCFA 4K1BA 4KINA 4AA4A 4O7WA 4X2JA 3OG7A 3RWQA 3QRKA 4DGGA 3MTLA 3RPOA 4FSQA 5CZHA 5FBNC 1GAGA 4AGWA 4ZY6A 3DBQA 4FIEA 3II5A 4E4LA 2F49A 3ERKA 3A7HA 3JVRA 3UNZA 5E90A 4EBVA 4ACCA 5EHOA 2WU7A 5KKRB 2FVDA 4IB3A 2JDSA 4ERWA 3RAWA 3SVVA 4JS8A 5AP2A 4WOVA 4CFWA 1T45A 3ZLYA 3KEXA 5HG5A 4S2ZA 4C35A 2WHBA 4F65A 4DH3A 5E91A 1QMZA 5AUWA 4XV2A 4M67A 5HICA 3VUGA 3ZHPC 3AT4A 5DNRA 3FZTA 4DITA 4FV3A 5K9IA 4JIKA 2WNTA 4U41A 5BYYA 3QKKA 2J5FA 4FT0A 4KA3A 4NTSA 2XM8A 2P4IA 1RDQE 4DCEA 4AGCA 5AWMA 3SGCA 5GNKA 3HA6A 4FIIA 4E5BA 1OKZA 2ZM4A 4L6QA 2C5NA 3FV8A 4IZAA 4RRVA 2W1EA 3GCPA 3H3CA 4ITJA 4I6FA 3QQGA 2XK6A 4JDKA 4E4MA 4YLKA 3FI3A 3ZRKA 2BFYA 4GT5A 1CKJA 4AAAA 3E87A 5IUGA 2F57A 2ONLA 2BVAA 4GSBA 4R3RA 2W5BA 4USDA 3CD8A 4YLLA 2RF9A 2IW9A 4JX3A 3V5PA 4S34A 4PP7A 5IEXA 1WBNA 4FC0A 2YM7A 2EUFB 4O7TA 4Q5EA 3UC4A 4DEIA 3E7OA 4G9RA 4PMSA 4EOQA 5DEWA 1IRKA 2J2IB 5BX0A 4PY1A 1FMKA 3CY2A 5JT2A 3PLSA 4P4CA 3FC2A 4JXFA 4BI0A 4HW7A 2UV2A 3BELA 4CLJA 2JEDA 2WGJA 4L68A 2LAVA 3D2IA 4F0IA 3O0GA 4IEBA 2B4SB 4AZEA 3IONA 3DAJA 3OOGA 5HE3A 4P2KA 2OFVA 4BDCA 1H1PA 1WAKA 5CEKA 2VGOA 4BDEA 5A6OA 5IQCA 1H26A 2XYNA 3GFEA 2YEXA 3KVWA 5ANEA 1FVRA 2AYPA 3OTUA 5AUXA 2Q0BA 2OH0E 4RC4A 4OAUC 4MXAA 4AE6A 1ZYJA 3G33A 1KSWA 2QVSE 3OY1A 3QWJA 4BCKA 4JQ8A 5CU3A 4DTBA 3Q96A 4H3QA 3PVWA 4NM5A 4XRJA 3RK7A 4E26A 4O21A 4APPA 2J0MB 5J9ZA 3GU6A 5IQIA 3U4WA 4W9WA 2YA9A 2Z60A 3FMKA 4GH2A 5TO8A 5AIRA 4TWNA 2PVMA 4AGUA 3ZUTA 2X2KA 4D1ZA 1R1WA 2G2HA 1Q99A 3KK8A 3AD6A 5BMMA 3T9TA 4EKLA 1ZAOA 3R0TA 5ANJA 3ID6C 4O1PA 4NT4A 2SRCA 3UG2A 4CT2A 1GJOA 4F9WA 3EZVA 4F09A 4XG2A 3O2MA 2YLFA 4WRSA 5CY3A 4D2VA 3GOKA 4G34A 5L8LA 4FKRA 1H1QA 5DH3A 3EB0A 5A3XA 4DBXA 3QX2A 4KSPA 4QYHA 3K54A 1PXJA 3I0QA 3AC2A 2AC3A 2V0DA 5F94A 4RWLA 3DBEA 4R5YA 4AF3A 4MXZA 2J50A 2VWYA 4YO4A 2VX0A 4RBLA 3MIYA 4BIDA 5AM6A 3W2QA 2OGVA 2ITXA 3ZDUA 2KULA 5IQHA 3IGGA 2BIYA 3VS4A 2C3IB 4PMTA 3R8PA 3TDVA 2CPKE 1SM2A 2OF4A 4K11A 3C4XA 4XLVA 1RJBA 5IA0A 4LM5A 3P08A 3PJ2A 3GI3A 3F7ZA 3CJGA 4FNZA 1XBAA 4YU2A 3AT3A 2WXVA 3TL8A 2VRXA 3UVQA 5AV2A 4O27B 1XQZA 3GXLA 5TR6A 2P3GX 4HCVA 5BYZA 4D2SA 4GL9A 4QD6A 3VBXA 4DLIA 5HIEA 4FTCA 1J1BA 4ANOA 3K5UA 4F6WA 5AA9A 3I1AA 5T68A 2OZAB 4XOYA 3R1QA 4IIRA 5KNJA 2VO3A 3N4UA 5EW3A 3F2AA 5GZAA 4OTFA 4GW8A 2Y6OA 4J98A 3TUBA 2C5XA 3F3ZA 2HW6A 1F0QA 2ITPA 4M12A 3QD0A 4HVIA 2GU8A 4K18A 3LHJA 3QGYA 4CFFA 5BVDA 3UZRA 3G6HA 2EXMA 5E1SA 3LQ8A 2VO7A 4CFMA 3DJ5A 4LMUA 5AP5A 3IPHA 3ZM9A 1YDRE 2R7BA 2Y4PA 3NYXA 4ZOGA 5JKGA 3KY2A 3MB7A 2OSCA 4FTLA 4DAWA 5JGBA 5CEMA 3Q9ZA 2DS1A 4Q2AA 5CU6A 5EG3A 4CT1A 5E8TA 5KO1A 3NCGA 3MH2A 5ETAA 3QQJA 2VO0A 4J95A 3BE2A 2PY3A 5IEYA 2UW0A 3D5UA 4C8BA 4KABA 2G15A 4OTPA 4MF0A 4CLIA 3UE4A 2BZKB 4AZVA 3LM0A 1J7IA 5EM7A 4DFLA 2IO6A 2FO0A 2V22A 2I6LA 2UZDA 3O8TA 4FZ7A 4RIOA 3ALNA 2E9PA 1VR2A 3OWJA 3DLZA 3OCTA 3GQLA 2ETMA 3PP0A 2VZ6A 3QD2B 4XG7A 5KZIA 2QI8A 3FZ1A 3IO7A 3VQHA 3D7ZA 4RJ8A 4QMNA 3ATSA 3OWPA 5B2KA 1KE9A 4XYFA 3IKAA 3OFMA 1XO2B 3LIJA 4ZJJA 4FT7A 4GUBA 5M51A 4DF3A 1MP8A 3PXFA 3EJ1A 4RX8A 5C26A 4C2VA 5CWZA 4V05A 4FKLA 3FKOA 2GTNA 1YKRA 1P4OA 4QYYA 3OCSA 4BTJA 3BV3A 4C4FA 2ETRA 2VNWA 5AAGA 3SHEA 2YN8A 1XJDA 3E5AA 3KC3A 4PX6A 2GQRA 3FE3A 3F3WA 3HYHA 4Y8DA 2WTCA 1JNKA 4JJRA 3RPSA 1OPJA 3EQBA 3OCGA 4U44A 3SXFA 5LWMA 4FK6A 2XNPA 4ZS4A 5I5ZA 4TWOA 4DN5A 4UMUA 1TQPA 4HVSA 1Q8ZA 4PDSA 5CQWA 3EN4A 1JPAA 4K77A 3L8PA 1GOLA 1M7QA 5FGKA 2XIRA 3RM7A 3SOAA 3OEFX 4I6HA 5I3RA 4J71A 4I24A 5KE0A 3R8ZA 5I9ZA 3ZLWA 2W1GA 3ORZA 4CRSA 5DR9A 5KBRA 1NA7A 5IMEA 1OB3A 5JRQA 4BRXA 4OBQA 5TF9A 1XH5A 4FSWA 4EYJA 3P78A 3NDMA 4CCUA 4W4XA 1B38A 2YWPA 4NKAA 3OMVA 4RMZA 4GEOA 5CZIA 4QMWA 2ZOQA 2UZTA 2QU6A 2XS0A 4ZLYA 4UWYA 4MXOA 4TZRA 4AG8A 3IDPA 3LFQA 2XIKA 1KV1A 4KIQA 2O3PA 2O64A 4MH7A 3VN9A 4KRDA 5DT0A 4G5PA 5CX9A 5IKWA 3CC6A 4AW2A 2WZJA 3OT8A 1U46A 3QA8A 1Y91A 4IQ6A 4MXYA 4W4VA 1Y8GA 2ITNA 3ZFYA 4E4XA 1JLUE 2YM3A 1W0XC 3LKMA 4K2RA 2IW6A 2CLXA 5IA2A 3FC1X 5H9BA 4ZEGA 4ITIA 4BCNA 2C5YA 1XH4A 4FG9A 4GYGA 4IFGA 5I9YA 1OL7A 3JS2A 4QPSA 5DYJA 4BKZA 2X39A 4EK6A 1LP4A 2C1BA 3JUHA 3HNGA 4UXQA 4RPVA 3NUYA 4EQCA 2VTRA 4L53A 4MBJA 1W82A 4YJTA 4H3BA 2WMRA 4TPTA 5EYMA 3G0FA 3N9XA 4TRLA 3UO6A 3DBCA 4WSQA 4BGHA 1G5SA 3GU7A 3PY3A 3B8RA 3EKKA 5TE0A 2YCSA 5IISA 1QL6A 1XH9A 3LPBA 3MVHA 3P9JA 5HBEA 2XKFA 2EXEA 2IZSA 3F2RA 2A0CX 2GFSA 5FP5A 4O81A 3H9RA 2C6OA 4GFMA 3TZ8A 4BBFA 4CFNA 4BDHA 2GNGA 3I0OA 3O7LD 1OUYA 3MN3A 4KIOA 4MTAA 1A48A 3QGWA 4RVMA 3W2OA 3HEGA 3ZO4A 2Y4IC 3NYVA 4NFMA 4X21A 1NY3A 5GHVA 4QMVA 2YM5A 1PHKA 3GBZA 3RAKA 4EK8A 3DTCA 3PSBA 3N4TA 3W55A 3V51A 1CTPE 3AT2A 1TQMA 5HIBA 4P5ZA 4CMOA 1PKDA 3GC7A 5KMMA 3AC4A 1PMNA 2B9JA 3FHIA 4HGLA 4IWPA 4HGTA 3DNDA 3HZTA 3Q32A 3BPRA 3O50A 2ZV2A 4ZTMA 4BDJA 4E5WA 3QU0A 4O7LA 4DFXE 5AUTA 3HKOA 2BTSA 1QPDA 4B8LA 5DVRA 5H2UA 4LGGA 3NLBA 2R9SA 4QTBA 3VHEA 4FTIA 3F3UA 3A7FA 4QP8A 1A06A 5EI2A 3E93A 3VUTA 3W2RA 4O84A 3ELJA 4G1WA 3SX9A 3COIA 4BDGA 4YR8A 4UWBA 1ZYLA 2ITQA 4ONAA 3FHRA 1BYGA 1OBDA 3CPBA 3OHTA 5AP7A 1OECA 3SW7A 3U6JA 2VAGA 2JITA 3D83A 3EQCA 2R3HA 3FY0A 2I1MA 4KS7A 2YM8A 1Y8YA 4CKRA 3SC1A 3Q53A 3IW7A 3KCKA 5CXHA 2YIYA 4M14A 2W4OA 1DI8A 2OJFE 4W4YA 5HCZA 1OBGA 3UNJA 2PUUA 4HZSA 3ZFMA 5BMSA 3TKUA 3ZSIA 4BCIA 2VTJA 4I41A 4GMYA 2W0JA 3R73A 3VF9A 3TNQB 4X3FA 4HVDA 3D2KA 4MYGA 3TTIA 2OJIA 3NEWA 3TDWA 4FVQA 4TNDA 3EQRA 5GZ8A 2XRUA 3MJ1A 4C7TA 2HIWA 3QC4A 2XIYA 2IVSA 2WKMA 4NW5A 1F5QA 4HPTE 4JBPA 2HK5A 4HYUA 1YOLA 2O63A 3SQQA 4C4IA 3DLSA 3C5UA 3WF6A 2WIPA 5C8MA 5BVKA 4PNKA 1IEPA 3BX5A 3LFDA 2PU8A 3QTZA 5LXMA 3I79A 3EH9A 4DGMA 3U6IA 2R3JA 1PW2A 4RX9A 3R9HA 4BGQA 3A62A 1PF8A 3LCKA 2QC6A 3BHHA 1RQQA 5L4QA 4BCHA 5JGDA 3VS2A 5C01A 4BFMA 3NWWA 1IAJA 2PUIA 5J79A 3WZJA 4CCBA 4MQ1A 3RNYA 3FL5A 3QRUA 5L3AA 5M4IA 4NIFA 5JRSA 2PVRA 4WA9A 4XG4A 3PUPA 2ZV9A 3D0EA 4M84A 2XIXA 3F3TA 2CLQA 2VWWA 4OUCA 2LGCA 4O0RA 4DH8A 4ZJIA 4X6RA 4RX5A 1XBBA 2XUUA 1KUTA 2UZWE 3W18A 1UU7A 4IACA 5CF4A 3EFJA 2HENA 3ANQA 4RFMA 3O17A 3ZH8A 4ANBA 5CSPA 3JR1A 3QZHA 2GHMA 4FTNA 4O7ZA 3DFAA 3LFEA 4RA4A 4UB7A 3U54A 1WBSA 3O8UA 5IH6A 4QPMA 2GMXA 4O0SA 2BAJA 1H07A 3D5WA 3ZXZA 1MQ4A 3NYNA 1YVJA 3R7EA 1OIYA 3GCSA 4FUYA 4RWKA 4ASDA 2GNFA 4IZYA 4ASXA 3KU2A 2VTLA 4NEUA 3M42A 5JH6A 3ORXA 4PRJA 3RM6A 3VAPA 5JFVA 2ZM3A 2BZHB 4U0IA 4XCUA 1BLXA 4E6AA 1ZYDA 5IA5A 1KWPA 4WD5A 3R00A 2YDJA 4F9YA 2WTWA 1JWHA 2JKKA 3BHYA 2W5HA 3HV3A 2PK9A 4KIKA 2WMUA 4Y85A 3RCDA 3T3VA 1Y57A 3UIUA 5E1EA 3ODZX 4EOIA 4ZZNA 5LCJA 2VTNA 4YBKA 5CYIA 4FKTA 1Q8UA 4QYFA 3L9NA 5EDPA 5H3QA 4AN9A 1YXUA 3P23A 3OVVA 3QKMA 4XRLA 1STCE 1YXTA 1J3HA 4BI1A 2X81A 1H27A 3Q2JA 1H1WA 2J0IA 3EKNA 2WQEA 4FSMA 2B0QA 1IR3A 3FZOA 4AZTA 4A9UA 4EH3A 4DT8A 3MPAA 2ZV8A 3HX4A 4A4XA 4QTAA 5FLFA 2WMBA 5KMNA 3ACKA 5I9UA 5FEQA 4I0RA 2PVJA 4H05A 2UW8A 4WG4A 3EN5A 1OIRA 3E3BX 4C3PA 2FB8A 3CJFA 4RWIA 2ITVA 4FNWA 5JK3A 3T8OA 4GJ2A 4FTUA 4NJ3A 3NSZA 5K0XA 1XH6A 4ZMFA 3ZBFA 1GIJA 2BPMA 2FSTX 4ACMA 3PYYA 3DT1A 1V0OA 4YJRA 3OBGA 1XR1A 5EDRA 2PL0A 1QPEA 2BDWA 4AT4A 4HYHA 3CTHA 2IVVA 2UVXA 3FUPA 4FV0A 5L8KA 4R1YA 1FVVA 3FZRA 5FM3A 4XG8A 4FV5A 5HE1A 4LYNA 1UWJA 4ARKA 5HX6A 4DEHA 4JNWA 4YNEA 4C62A 3AD4A 4G2FA 5TKDA 4ZZMA 5L2SA 3TZ9A 2XKEA 4BHZA 3MFRA 3SOCA 5I4NA 3CPCA 3TV6A 3V01A 2C1AA 2JFLA 2O0UA 3IQ7A 3OXTA 1CKPA 3DB8A 4GT3A 3WARA 4Z7HA 3M2WA 4FYNA 4EWQA 4JX7A 3UMWA 2WTVA 3E92A 4IDVA 5CAQA 3OW3A 2CN8A 3CQWA 4BVUA 4U81A 3S95A 4YTCA 3L8SA 4H1MA 4ZJVA 1OIUA 5FG8A 1FBNA 3PLAE 4F0GA 3CP9A 3V3VA 4C58A 4D1XA 1ZY5A 3F5UA 2OG8A 3NIZA 3PSDA 3G0EA 3AGLA 1PMEA 2R5TA 1BUHA 4U8ZA 2F7ZE 4Q5HA 4NTTA 3KXXA 5C4LA 3CS9A 2XCHA 2PZ5A 1M17A 5H8BA 1PY5A 3SDJA 5DWRA 4Z55A 1SVHA 5IF1A 4FZDB 4WHZA 2Q83A 4I0SA 5AP3A 3GNIB 4M7IA 1UNGA 1W83A 3R9NA 1URWA 4XMOA 5CEPA 5E8YA 2NRUA 3GB2A 1ERKA 3OBJA 3AOXA 4HCTA 1FQ1B 2QCSA 3TI1A 4J99A 4WBBB 3O71A 4P5QA 3P79A 4HPUE 4B6LA 4WSYA 3RINA 3CQUA 3V5WA 1R3CA 3TV4A 4YTHA 5ANGA 5DEYA 4UV0A 3FY2A 3PSCA 4M15A 3TJCA 3GU5A 4PWNA 2PZYA 2RFDA 2JDOA 4O0WA 2R3FA 2XK9A 4V0GA 5C03A 2QOKA 2B52A 3CY3A 3R63A 3LCDA 3QL8A 5A4TA 4WNOA 1OI9A 4A07A 2H9VA 3VC4A 5AX3A 4CV8A 4EOLA 2FSOX 5LMBA 1OVEA 2O65A 4G6LA 4D1SA 2BDFA 5C1QB 4G3EA 1EH4A 4M13A 1LEZA 3VNTA 3ZO3A 4EUTA 5E8ZA 4A9SA 2YAAA 3AQVA 3C4FA 3MYGA 5CLPA 2WEIA 2QHMA 3IW8A 3TV7A 5LVMA 3LVPA 3TNIA 4F7SA 1OITA 2R7IA 4PQNA 2I0VA 4AQCA 2QO7A 4ALVA 4NFNA 3EFKA 4ZMEA 5AR3A 2Y8OA 2J51A 3NW7A 3UC3A 2YLEA 3WYXA 4UY9A 3BEGA 1WBTA 4RQVA 3BU3A 1HCLA 3C13A 3MIAA 4MXCA 4WNMA 3ZBXA 4BZDA 3ULIA 4BCGA 1P2AA 4D4VA 2C6KA 5D7VA 3L9PA 5IPJA 3R04A 4L7FA 2XZSA 3I6WA 3FMJA 4II5A 3F2NA 4ZTQA 2HELA 4AWIA 4C4JA 5HIDA 2J4ZA 3P86A 5A54A 4OBOA 4FKQA 3BKBA 2JDVA 3PA3A 4LV8A 1J7UA 4ZS0A 3MVMA 2CNUA 4GKIA 4YJPA 4M3QA 4AZWA 5IA4A 3S4QA 3LXKA 5D7AA 5LQFA 1IAHA 4MHAA 5AR7A 4ZSLA 3UQGA 4D5HA 4CYIA 2OFUA 4LUEA 1DAWA 5JN2A 4DFBA 2HWOA 4MNEB 3R8MA 3C7QA 1AD5A 1ZMVA 4DYMA 4GVAA 4IX3A 1WCCA 2DQ7X 5I9XA 1M2PA 3MDYA 4RZWA 4FTKA 4X3FB 3NRMA 3QUPA 4GVJA 5CSXA 4CXAA 4FMQA 1GZNA 4AZFA 4AXAA 4E5AX 4FSTA 3JXWA 2QQ7A 5F1ZA 2PVNA 2FSMX 5DT4A 3WF5A 3LOKA 3THBA 1IASA 4PL4A 4KBKA 3LCOA 4QRCA 3DQXA 4YZBA 3S2PA 4N0SA 1Q3DA 3ACJA 5DFPA 3ETAA 5HVYA 4ALWA 2QG7A 3KGAA 5EW9A 3R1SA 4AZSA 2PYWA 4PUZA 3UQFA 2EB3A 2XBJA 4D5KA 4PPBA 3D14A 4DEGA 2XA4A 5ICPA 4FE2A 3KA0A 4EH5A 3RAHA 3ZOSA 3TWJA 3UYSA 3C4EA 4O0UA 3UVRA 3LCTA 4GRBA 2YHVA 3TCPA 3TXOA 4DEAA 4EL9A 3QTXA 4TXCA 4ZTLA 1XWSA 3KK9A 4JBQA 5LMKC 1W84A 2GNJA 2VX1A 3IECA 1Y6BA 2XJ2A 4FOBA 4EH4A 3ORKA 4QQTA 4WNKA 4GG7A 1APME 3F5XA 4QP9A 4JG6A 3UO5A 1PXNA 2OKRA 3PE1A 4BDAA 4BL1A 4DH1A 1L8TA 5AP0A 4NIFB 4JQEA 3PIZA 4V04A 4R7IA 5E8WA 4ALUA 3HMPA 5M4CA 3DTWA 1YHSA 4GCJA 4F7JA 2F2UA 5HQ0A 4IX6A 3BZ3A 4QP6A 3HUBA 2I40A 3MPMA 3ORPA 3Q6WA 5GIOE 4KWPA 1JKLA 2QLQA 2G9XA 4GUEA 4FTQA 4L3JA 3TIZA 3D7TA 4EH7A 4PPCA 2UZOA 3L9MA 4GK2A 4BZOA 5DGZA 2C6LA 4E93A 3R7YA 1OL5A 3V5TA 2R0UA 3PXKA 3ZXTA 4BWKA 3QX4A 4LL0A 3ROYA 3HMMA 2CGUA 2XNOA 4D2PA 4AA5A 3ZO2A 4FG7A 2PE2A 4O83A 3SG9A 3RPRA 3HAMA 4IM2A 1BKXA 4IMYA 3D5XA 4YJOA 2HZIA 1KOBA 3EQPA 4IAZA 4B8MA 4YJQA 3FQSA 3GEQA 3R22A 4UYNA 3W16A 2EXCX 1YDSE 2BHEA 3DJ6A 3GC0A 4HOKA 3V8SA 4IDTA 3PPKA 4OTWA 4ZIMA 2PE1A 4F6SA 4Z7GA 2H34A 3CLYA 5ANDA 4ZXTA 4F9CA 5M56A 1H0WA 4LRJA 3Q4UA 5JFWA 3NR9A 4IVAA 3W33A 4R7BA 3IW4A 3QRJA 5IQAA 4EK4A 5I9WA 3EQDA 4ITHA 4KKHA 4UWCA 4R7HA 4GU9A 5KHWA 3DKGA 5L2TA 2IZTA 4S33A 5EI6A 3S00A 4WT6A 3TKIA 1ZZLA 5EYCA 4RSSA 3VULA 3ODYX 3ENMA 2OXXA 3FMEA 3NPCA 3OROA 1V0PA 4CQGA 4D2TA 5KMOA 4EHEA 3QHRA 4M69A 4OGRA 4UALA 4ZZOA 4BF2A 3NUNA 4QP7A 3OY3A 5DE2A 5I9VA 3R1NA 2V7AA 3RP9A 2JIVA 4QMPA 1QCFA 3V5QA 3UPZA 1L3RE 4FEUA 3A2CA 3GT8A 2PVLA 3BQRA 2GQGA 1ZRZA 2HCKA 4YO6A 5AV3A 4UMPA 2HWPA 4WBOA 5EYKA 4FEVA 4A9RA 4FEXA 3PP1A 3D9VA 2QOIA 3VQUA 4J53A 5E7RA 4NU1A 3QTWA 2QLUA 1GZ8A 3DXQA 2WIHA 3TACA 3MESA 4FICA 4E1ZA 3OCBA 2E9UA 2YWVA 4E8AA 4USEA 3BHUA 3DBDA 3KF4A 1YHVA 4EQUA 1U4DA 2FUMA 4J7BA 4XS2A 5EOBA 2JAVA 4J52A 4YTIA 3ULZA 2ZVAA 1UNLA 2X4FA 3C0GA 3PVGA 4XP0A 2XK4A 3W1FA 3A4OX 4RIWA 3P5KA 4G17A 1FINA 4QMMA 3UG1A 3WZEA 4BZNA 4GFOA 2IZRA 3K2LA 3VUDA 1M52A 4QMZA 3QHWA 2C47A 5CF5A 2BIKB 5FBOA 3R6XA 4I6BA 4HYSA 4AW0A 2IG7A 2Y9QA 4FUXA 3AMAA 3AG9A 5KUPA 3O8PA 3BGZA 4TYJA 1X8BA 1H1SA 2A27A 2XP2A 3RK5A 4JIAA 5AR5A 3ZC6A 3PJCA 3M1SA 4O7NA 3PY0A 4HNIA 3GENA 3RPVA 4B0GA 4OTRA 5KMLA 3O96A 2R3RA 1FPUA 4V01A 3ZRLA 5FXSA 2YDKA 3G90X 3COKA 4L8MA 4X2GA 3A99A 4JR7A 4QQCA 5T6KA 5H8GA 2B9HA 4L43A 1TQIA 2R3NA 4KKEA 4Q9SA 3Q60A 5LWNA 2B55A 4NZWB 4PDYA 3UOJA 3MVJA 3CGFA 3AD5A 3PPJA 3QTRA 4AFJA 2OU7A 5IH5A 1DM2A 4C33A 4CVAA 3Q9XA 4A7CA 5L2IA 3PIYA 3UGCA 4D28A 3BYOA 3KRJA 4LFIA 4DA5A 3FPMA 4FZAB 3PXZA 4U43A 5HLPA 3GU4A 2PWLA 4OTQA 2IVUA 3DBFA 2X8EA 4EJNA 5EQEA 3OWLA 3SAYA 2VTAA 4O7RA 3IS5A 3ZLSA 3BLQA 5CASA 2P2HA 1UNHA 2E9VA 4FI1A 3VS5A 2WU6A 4I20A 4QMSA 2BROA 2CGVA 2VN9A 4O0YA 4EJ7A 5CVHA 3PVUA 3VJNA 4A06A 4AGDA 4ACDA 2WO6A 1H08A 4IB1A 4BDFA 3GOPA 5L6PA 4I94A 5EI8A 2RFSA 4MF1A 3UQCA 5KMJA 4FKOA 1Z9XA 5HNGA 3HMNA 1Q8YA 5JQ5A 4FV1A 2ERZE 2GS6A 4BTMA 4ZY4A 3BBTB 5DMZA 4C61A 5IUHA 4C0TA 2GPHA 2WAJA 3R01A 4AOJA 2EB2A 2NPQA 1WBVA 3FLZA 3FL4A 3LFAA 4I3ZA 4O82A 3FMNA 5DN3A 2UZVA 3NZ0A 3WF8A 4JOAA 3HUCA 3PZHA 4TT7A 3PWYA 3NAYA 3HDNA 3P4KA 3UOHA 2RKUA 2G2IA 1OGUA 2UZLA 4YHTA 5D9HA 5HTBA 4ASZA 3RTPA 4FSRA 4QOXA 2EWAA 1UKHA 4FTRA 3Q5IA 4HGSA 3A4PA 5B7VA 5J1WA 4CG9A 4LQMA 2VD5A 4TNBA 5GZ9A 5GIPE 5HD4A 4QP3A 1WZYA 1YDTE 3QQHA 4LI5A 3K3IA 4H1JA 1ZYCA 4EONA 3ORTA 1FMOE 3EMGA 4FTJA 4KBCA 4NH1A 4RIXA 4CG8A 2QD9A 5CI7A 3QYWA 3E63A 4C4EA 3U55A 2BRGA 3QRIA 5IU2A 1YW2A 3UODA 4NWMA 5LVLA 5A4LA 5M08A 4E6QA 3DKCA 1R0EA 2I0YA 5HI2A 4CRLA 4EHZA 4GIIA 3HRBA 4TYHA 5EKNA 2WPAA 3NNXA 1SVEA 4I5PA 3QC9A 4DH5A 3E8EA 1BL6A 4I22A 3SXRA 2BZIB 3QCSA 4GIHA 1Q3WA 4RIYA 2C6MA 4AU8A 5HLNA 4OLIA 3ALOA 2X6DA 4FBXA 1UU3A 3T3UA 3LZBA 5DPVA 5BVFA 1SNUA 5EW8A 2F7XE 4LRMA 3NUXA 2NP8A 4NCTA 2C3KA 4KS8A 4F1MA 1ATPE 4HYIA 5CU0A 1ZLTA 3BU5A 3W8LA 1JKTA 5FTQA 5IA1A 2YCRA 3VWAA 5HLWA 3POOA 3IK3A 1IG1A 3V8TA 5CVGA 3SV0A 3LFSA 4FTOA 4YC8A 4L9IA 3OXIA 2UW6A 3QF9A 4ANNA 2UW5A 3QQLA 3TIYA 2HZNA 4HVGA 2QOFA 3D5VA 4OW8A 1OKVA 5J5TA 5J5SA 2JKQA 4QT1A 3CTJA 1VYWA 3DA6A 4ZSAA 2Z8CA 4O1OA 2VUWA 1NVQA 3TJDA 4IX5A 4QMXA 4EZ5A 4IX4A 3HV6A 3C4WA 3OD6X 2J0JA 4WO5A 4AN3A 3U51A 4FT3A 3PIXA 3WI6A 3GUBA 5DG5A 2QOHA 2X7FA 4D4RA 2UW3A 4YZNA 3C0IA 5JSMA 2YJSA 2YZLA 2XM9A 4Z3VA 1VZOA 2E9NA 2ITUA 3ATTA 4Y46A 2XK7A 3TNWA 4FNYA 5CEQA 1OL1A 2PMOX 4IVCA 4PL3A 3IOKA 4IZ5A 2YAKA 3KMMA 3FKNA 5AM7A 4ZK5A 4QMOA 3VBVA 2ZDTA 4EEVA 5LCKA 2X1NA 3P1AA 5FDXA 2ITWA 5E8UA 2ZMCA 2XK3A 3EL8A 4JDHA 5LVOA 3P7BA 4QP2A 5HO8A 3FI4A 2ITOA 3G6GA 2PE0A 4FSZA 4CZTA 2F9GA 5JGAA 2YABA 4MWIA 2OJ9A 2PZIA 5IA3A 2FSLX 3R8VA 3NCZA 3ZS5A 4YSJA 3O23A 4O0VA 3KMUA 4JG7A 4MD8E 3QCYA 4G3CA 1KE7A 4OT6A 3O7LB 5D1JA 5AAEA 3MVLA 2RIOA 2WMVA 5H8EA 2C68A 5IQEA 3D94A 3LFNA 4ZTRA 4UZDA 3MTFA 4TTHB 2WMAA 2VWXA 2HY0A 3EQFA 1RE8A 3FLQA 4IAKA 4RZVA 1MRUA 4BDDA 4PTCA 3C1XA 2QO9A 3MSSA 4DHFA 4QP1A 4FK3A 4H36A 4EOPA 4FOCA 5CEOA 1JSUA 3EN7A 2OJJA 5CALA 3R71A 4M69B 2CCIA 5FEEA 1OPLA 4BTKA 3NUUA 3OT3A 5FM2A 2GDOA 3RKBA 1UU9A 3CEKA 2YITA 2PHKA 3R2YA 4HGEA 3UOKA 3WILA 5HCXA 2PVYA 3TNPC 4CFUA 1YOMA 1UA2A 4MBLA 1SNXA 3KREA 1LR4A 5D12A 3RVGA 2BTRA 1IA8A 2Z7SA 3HMOA 4FKWA 1U59A 1FGKA 1LPUA 2OK1A 1SYKA 4GJ3A 4HCUA 3GGFA 2GS2A 4DEBA 1E1VA 2ERKA 2JIIA 4CZUA 4DEEA 4J1RA 4JBOA 2PVFA 2C30A 1CSNA 2Q0NA 3SRVA 1YXSA 5DT3A 4XX9A 1JKKA 3BYSA 2C6EA 2GCDA 2JLDA 3UZTA 2QNJA 2BILB 4PMMA 4R6VA 4XUFA 4C34A 5HEZA 2A4LA 1PYXA 4BCMA 4FGBA 3A7JA 4FKJA 3C4ZA 3UJGA 2OIDA 2OO8X 3UVPA 1AGWA 2JKOA 3MY1A 2PZRA 2XF0A 3EYGA 3HGKA 5J9LA 5CAUA 3LQ3A 4NM0A 4PNIA 3LAUA 4RIWB 2QKRA 4BYIA 2YIWA 4G31A 4WUAA 4FV8A 1Q4LA 2V62A 4KAOA 2J0KA 2YERA 4IFCA 1H0VA 4BIEA 5A9UA 3BCEA 4ANMA 1H25A 2QG5A 3VW6A 4W8EA 3EN9A 5HBHA 1OPKA 4GK4A 3D15A 5AP1A 2FH9A 1TVOA 2BRBA 2YZAA 4M97A 3F69A 3FWQA 4OT5A 3RK9A 4D55A 3FI8A 1MRYA 3TNHA 4FV4A 4JAJA 2V5QA 3W2SA 1H8FA 3FSFA 4FL1A 5B2LA 2C0IA 2W4JA 3I5NA 5CU2A 4EC8A 5LVNA 3KRWA 2BRNA 1NW1A 2XB7A 3BI6A 3F82A 5JQ8A 4J8MA 3BGPA 1VJYA 4RQKA 1YXVA 4FVRA 5E92A 3EWHA 5JZJA 2H8HA 1PMUA 3F3VA 3A7GA 4R77A 3CCNA 4I0TA 2R64A 5LMKA 2W96B 4S31A 2X7GA 3MA6A 4R3CA 5TOZA 4RT7A 3ET7A 4J8NA 3OWKA 3MH3A 5AR8A 4CTCA 1A9UA 4G6NA 4I4FA 2V7OA 4LGDA 3BYVA 4USFA 5C9CA 3G2FA 3NNUA 2XH5A 4LG4A 2OW3A 4XV1A 4ACGA 3S0OA 4FKSA 5IMXA 4F70A 3K5VA 3REPA 2WQBA 2B1PA 3FMHA 4GG5A 1IA9A 3OXZA 5ETFA 1H1RA 1WBWA 2WMSA 2JFMA 2Z2WA 2E9OA 5IQGA 3S3IA 4F63A 1Y6AA 2WELA 5J95A 2IW8A 4QYEA 2X4ZA 3HV5A 3VUHA 4D58A 3R8UA 5A6NA 4BDKA 5HO7A 4N70A 1B6CB 3RNIA 2BRMA 3FMLA 5CXZA 4AW1A 4RVLA 2QR8A 3FXXA 3PVBA 4LUDA 3DNEA 4IAIA 2IN6A 4OTHA 3PJ8A 4FF8A 4RVTA 4M0ZA 3BWFA 1G8AA 2OICA 5DA3A 2XK8A 4C38A 3HP5A 3ZUUA 3Q4ZA 2QKWB 5EH0A 4EHVA 4EOJA 5CU4A 3BLHA 4W8DA 5IG1A 1FOTA 4IC7A 1CKIA 3ZTXA 1QPJA 3AXWA 4BICA 1B39A 5KBQA 3FXZA 4IADA 4RG0A 5HX8A 4WNPA 3R7GA 4FZ6A 1S9JA 4TYGA 4NJDA 4DTKA 1YRPA 4G3FA 3I81A 4O2ZA 4FKUA 4AUAA 3LFCA 3MFUA 4NM3A 5AR4A 3U9NA 2VX3A 1BI7A 3POZA 3TEIA 3LQ5A 3LE6A 5HORA 1Q5KA 4IJ9A 5IDNA 5AP4A 2DWBA 4EH6A 2QOLA 2A19B 1Q62A 5HO6A 4R78A 1YWRA 1S9IA 2CDZA 2WOTA 3V5LA 5IDPA 1YI6A 4IWQA 4ZSEA 5BVWA 4MQ2A 4KB8A 4DGNA 4RIXB 2B54A 4DEDA 3R9RA 4HNFA 3RWPA 4JRVA 4UEUA 3Q6UA 1MUOA 3I5ZA 3BGQA 2G1TA 2GNLA 2W1DA 2OIQA 1JAMA 3E88A 4LGHA 3FLYA 4FIGA 4E20A 2BRHA 1PXKA 4X0MA 2Z7QA 3GU8A 4JT3A 3VS6A 4BN1A 4F1OA 2WD1A 4TYHB 3DK7A 5M44A 4GYIA 3BV2A 2GFCA 4XG3A 2RGPA 2IVTA 3LJ2A 5JEBA 5HNBA 4RIYB 5ACKA 4A9YA 3DOGA 4H39A 2VTIA 4CSVA 1REKA 3BEAA 2J7TA 1AQ1A 3OC1A 3CE3A 4EOMA 4TKSA 3F5GA 1R78A 1E1XA 1P4FA 4NSTA 1XHAA 4MNFA 4W9XA 2W5AA 2C6TA 5CT0A 4P7EA 4QTEA 1BI8A 4F99A 1NVSA 1P14A 4L52A 3PY1A 3TUCA 2C5OA 4YZ9A 2UW7A 5K0KA 4UN0C 4DE4A 3LMIA 3DQWA 5HD7A 5A14A 3IG7A 3FQHA 2B9FA 3NAXA 3GCVA 3BQCA 1R39A 2NRYA 3KMWA 4TL0A 1QPCA 4FNXA 4TYEA 4G5JA 2W17A 4UZHA 3DZQA 4AT3A 4BBEA 1UV5A 3DK6A 4MXXA 3WOWA 4YMJA 4UBAA 5K5NA 4Y73A 5M4FA 5J1VA 4GT4A 3PRIA 3RZBA 5I3OA 2P2IA 4B4LA 3NVMB 2WOUA 4KD1A 3F88A 4CFXA 3ORLA 4ID7A 4RLLA 3RGFA 3QBNA 5CENA 5CI6A 3OW4A 3PXQA 4M66A 2C69A 4UMTA 3CQEA 3LM5A 4MEDA 1RW8A 4AFEA 1ZXEA 4RVKA 4FL3A 2I7QA 3EQIA 4JI9A 2GHLA 4MX9A 1U54A 2OBJA 2CKQA 5CF8A 1M2RA 3QQKA 3UO4A 4C3RA 1CDKA 3ZZEA 4ZLZA 1M2QA 3CKXA 4XJ0A 4PMPA 2GS7A 1GZOA 1LEWA 1OZ1A 3FXWA 3N51A 3ORNA 5HOAA 2O8YA 4IB0A 4QMUA 4R5SA 4UMQA 5AUYA 3UBDA 3DKFA 2P0CA 2VWZA 4IW0A 4E73A 5BPYA 2J5EA 4LRKA 4JVGA 4XBUA 2YCQA 5KX8A 1ZMUA 5CTPA 3R8LA 3DXNA 1O6LA 3L8XA 4Y95A 3C4CA 3EZRA 4L67A 3ZU7A 4EORA 3P7CA 4D9TA 3JYAA 1WMKA 3QLGA 5AX9A 3UOLA 4UX9A 4JR3A 2XYUA 3VS1A 2WTKB 3ORMA 2F4JA 5KKRC 1PJKA 3NX8A 4M68A 4BIBA 4FIJA 3VBYA 4JL9A 4K8AA 3R21A 4LL5A 3ZEPA 1Z57A 2W06A 4GK3A 3QKLA 3PG3A 2WMWA 4UXLA 3DKOA 4FKGA 3ZC5A 2PVKA 2W05A 5KMIA 5DRBA 1CMKE 3MH0A 4YNOA 3UDBA 1BL7A 3W32A 3RALA 3H9FA 5IZFA 2X8IA 3HV4A 4ENYA 3BWJA 3DS6A 5HG9A 3UIXA 4IZ7A 4AOTA 3LW0A 2W9ZB 4Y5HA 4YJUA 2ZB1A 2ESMA 1KE5A 3FYJX 4JG8A 3GCUA 4EQMA 3SXSA 3C0HA 5C4KA 4O7SA 2G2FA 4L45A 3ZSGA 4MBIA 3QCXA 4PPAA 2WTIA 3U87A 2C6DA 3KXZA 5FD2A 4BCFA 5JFXA 2XEYA 3AMBA 3NUPA 1UKIA 2GTMA 2QHNA 2E2BA 2X9EA 4CV9A 4N57A 4YBJA 1Q8WA 5DLSA 4XNEA 3I6UA 4OR5A 2RL5A 2XMYA 4FV6A 3NW5A 3JY0A 3KKVA 4DFNA 1YOJA 2VV9A 5M55A 2HZ0A 2XJ0A 3SRVB 1GIIA 5EFQA 4A4OA 1YI4A 4FTAA 4BDBA 4QTCA 2OI4X 1ZOEA 4I4EA 4BYJA 4GFGA 5HHWA 3R1YA 3V5JA 3HA8A 4L3PA 5K4JA 2GSFA 3H0ZA 1Q97A 3BHVA 3BU6A 5GJDA 4DTAA 1Q24A 3MJ2A 4Y72A 4O86A 2BMCA 3K3JA 1KE6A 2Z02A 1OKYA 4S30A 2UZBA 3OF0A 1YQJA 3GP0A 3KQ7A 1NVRA 5J87A 3FLSA 2HZ4A 5EHYA 2ITYA 5BUIA 2PUNA 2OZOA 4E6DA 4LOOA 4LOPA 4RJ4A 3C9WA 1H24A 4EK3A 3RAIA 4QQJA 3WIKA 3MY0A 2OXDA 4F08A 2JDRA 5EHLA 5K4IA 3QZIA 3GC8A 4MAOA 2Z7LA 2RFNA 2IWIA 4YJVA 3TUDA 3PG1A 3KULA 5D10A 5L6WL 4A4LA 2H6DA 3T9IA 3OUNB 1MQBA 4FV7A 4L46A 4J96A 5EM8A 3B2TA 5IEVA 2R3PA 2KTYA 2O5KA 2RFEA 3IW5A 5AIKA 2ETKA 3WF9A 4K33A 1GIHA 5HTCA 5BYLA 5ETCA 5HESA 2CKPA 3LJ0A 4MK0A 2ITZA 3VVHA 4LOQA 4NUSA 4ACHA 4D4YA 3R9OA 3AC1A 4XG9A 4AE9A 4MD9E 4CTBA 3PJ3A 3LJ1A 3TT0A 2CMWA 2H96A 3GCQA 4D0WA 3DZOA 3TZMA 3ZYAA 2X2MA 3E7VA 1W7HA 3Q9YA 3VUMA 5AFVA 4U7ZA 2I0HA 1PKGA 4BB4A 3WF7A 1TKIA 2BHHA 4BBMA 2WMXA 4OBPA 2XVDA 4KIKB 4X7QA 3ZRMA 3ZSHA 4D0XA 2PMNX 2YACA 5AP6A 2OXYA 1SZMA 4QP4A 3R7OA 3V04A 4F64A 4QMTA 5EOLA 4JRNA 4ZLOA 4ZY5A 1KOAA 3FBVA 3QRTA 4TYIA 4U5JA 2PPQA 2YFXA 5FEDA 1DI9A 2WEVA 3JVSA 3C51A 3R02A 3L9LA 3RJCA 5LJJA 4WUNA 3VF8A 3H4JA 1WFCA 2P55A 2XIZA 3COHA 3MFSA 4DGLC 1G3NA 2VWVA 3SA0A 2YIQA 4I5HA 5ACBC 4HJOA 5AR2A 3NVKI 3Q52A 1NXKA 4XOZA 4IH8A 4QNYA 5AADA 4E7WA 3OP5A 1J7LA 4AA0A 1GY3A 1YXXA 3QTUA 3Q9WA 4KBAA 4U80A 5DOSA 5L2QA 4O91A 3U6HA 3ZONA 4KNBA 1OL6A 1W8CA 2R2PA 2X0GA 2C3LA 4EZ7A 3HECA 5AV1A 3CD3A 2F7EE 3MWUA 5ANIA 3HVCA 5E8XA 3GVUA 5CQUA 4QYGA 4I1ZA 4FVPA 5CNNA 4ZSGA 5J7BA 2WQOA 1PRYA 4AN2A 2BDJA 3NS9A 4YZCA 4BGGA 3IGOA 2PZPA 3PTGA 3SLSA 1JVPP 5EQYA 2XJ1A 1R0PA 4IM0A 5GJGA 3JPVA 1NT2A 4KIPA 3W2CA 5BQ0A 4WG3A 2C5VA 2VWIA 3P0MA 4WIHA 5B0XA 4DINA 3ZLXA 3H30A 3P7AA 5DBXA 5AMNA 3ZMMA 3RZFA 5JMSA 5FP6A 3QAME 1VYZA 4XP2A 2CNQA 3LXPA 4EBWA 3CR0A 4YGAA 2R3IA 3HRFA 3FLNC 3EFLA 4QQ5A 2NO3A 3R83A 5AA8A 2DUVA 2R3GA 2Z7RA 4BR3A 4PDPA 3AC5A 4HZRA 3MW1A 3MBLA 4TY1A 4RFYA 2VGPA 1YWNA 2VWBA 2ACXA 4FX3A 5HBJA 5M06A 4C36A 1U5RA 4NKSA 5CT7A 3VHKA 4FKPA 3KXGA 1UWHA 4DG3E 4DG0E 4RJ7A 5FRIA 2OLCA 4FEWA 4IBMA 2WFYA 3MY5A 3A61A 2PSQA 3VBTA 3CGOA 3KXMA 4FA2A 4F9AA 2XNBA 3ENHA 2EVAA 3R7IA 1H4LA 4K0YA 4QNAA 4IWOA 2CJMA 5J7HA 3MS9A 2ITTA 3WE4A 3R7VA 5BVNA 4XV3A 5DI1A 3R28A 2IJMA 4DG2E 2J0LA 2UVYA 4G16A 3QWKA 3C50A 3KL8A 4RJ3A 5A4CA 1M14A 2AUHA 3CBLA 4XBRA 3BYUA 3HDMA 1K9AA 3G5DA 5JFSA 1F3MC 5HKMA 4V0GB 3V6SA 3ZCLA 3VIDA 4RLKA 5BUJA 2W1CA 3B8QA 4YLJA 2Y6MA 4GS6A 4YHJA 3WYYA 2JIUA 5BVOA 2R3KA 5HU9A 3VUKA 4IJPA 5DIAA 4FG8A 3MGYA 1ZZ2A 4CQEA 5FTGA 4Y83A 5LARA 3BBWA 1U54B 4RC3A 4TWPA 5BVEA 2PMIA 1JSTA 2FGIA 3HLLA 4XP3A 3Q04A 5A4EA 4JLCA 4M0YA 4RFZA 4FR4A 5I0BA 1V0BA 3SD0A 4YPSA 4FSYA 4Z9LA 2XRWA 3LFFA 3B2WA 3TG1A 2V55A 3QZGA 3OZ6A 5AUVA 4ERKA 5CNOA 3CKWA 1JSVA 4E6CA 2C0OA 3L8VA 5GJFA 5KCVA 3V8WA 4O6LA 4DCAA 4X6QC 5ETIA 3KB7A 5IUIA 1V1KA 3PJ1A 3QA0A 3VS7A 3EOCA 4PP9A 3I4BA 3DB6A 2FYSA 3FYKX 3KN5A 2CHLA 5BNJA 3MI9A 3PZEA 3RBWA 4C4HA 4IC8A 1CM8A 3KFAA 5M53A 4O7YA 2HOGA 4PTEA 4FT9A 4AX8A 4EOSA 2QU5A 2VTOA 3QD3A 2GHGA 3GC9A 4IWDA 4R8QA 4AT5A 4BCPA 5AV0A 2J9MA 2CCHA 3PFQA 1PXIA 3SW4A 4C4GA 1O6KA 1BMKA 5FQDC 5M57A 3VW8A 3VJOA 3QUDA 1OMWA 2ZMDA 3BHTA 5CS6A 2CGWA 1JBPE 5J9YA 2XNMA 4O6EA 1J91A 3MH1A 3UZPA 4ANQA 2VTQA 3DY7A 4YZDA 3TZ7A 4FV9A 4X2KA 3H9OA 2QOOA 3WIGA 3G9NA 3ZEWA 3NUAA 3DXPA 3A8XA 3IDCA 4XHKB 5A4QA 2HAKA 3AGMA 4X2NA 3G15A 2XBAA 3Q3BA 4FV2A 3FQEA
chains in the Genus database with same CATH superfamily
4YJNA 4FTTA 5F9EA 4FZFB 2VU3A 4KKGA 4C02A 4U9AA 3NGAA 3E62A 5LOHA 2UW9A 5FUTA 2ONLC 3Q2MA 1Q61A 1O6YA 4QPAA 1PXOA 5JZNA 5FWKK 4S32A 4UMRA 5T3QA 1WBPA 1ZARA 3DDPA 3BIZA 5DR2A 5EDQA 2BKKA 4CKJA 4LDTA 1OUKA 3RHKA 5C8KA 3DAKA 4AW5A 3FJQE 2QOCA 2XKDA 4D2RA 3DDQA 4IVDA 5AJQA 5FXQA 5G1XA 1M7NA 2CGXA 3CTQA 3I7CA 3U4UA 1FVTA 3QALE 4G9CA 2QURA 4ANSA 4GU6A 4I21A 3OTVA 4AACA 3WBLA 3UP2A 3VBQA 4BKJA 3FZSA 2IPXA 4EI4A 3MB6A 5E4HA 5EM6A 5M09A 3KF7A 3WE8A 3KULB 4TWCA 5M4UA 1VEBA 4IAFA 1BX6A 4KSQA 5F20A 4BWXA 5AV4A 3VONA 4YP8A 1JKSA 3F7WA 3D7TB 2BKZA 3RCJA 4OTDA 3SG8A 3Q4CA 2VTTA 4ZTNA 3GQIA 4FL2A 3E8NA 4WKQA 5ITAA 3AMYA 2C0TA 3HMIA 4U3YA 5CAVA 4O2PA 3W0PA 4KUJA 4EOOA 3ZFXA 2W1HA 4RJ5A 4ANLA 4LV5A 1O9UA 4C37A 4YSMA 3VBWA 2PUPA 4RJ6A 3NW6A 4F7NA 3U8WA 5CF6A 5CSVA 4U97A 3QD4A 4YZMA 4BY9E 5HVJA 2C6IA 4IHPA 2QOBA 2ZAZA 5L8JA 2JDTA 3EHAA 4YUQA 4ZAUA 2X0OA 4OTGA 4L42A 4G6OA 1PXPA 3ITZA 5HG7A 3EQHA 2ZM1A 3DK3A 3E3PA 2GNHA 4U6RA 3LLAA 2RG6A 2VO6A 3FSKA 4IAAA 4P90A 4CD0A 5HZNA 3PWDA 3QFVA 4TW9A 2Y4IB 1HCKA 3DU8A 3VUIA 2UZNA 2X7OA 3AC8A 3FAAA 4BHNA 5FDPA 3QUEA 4DH7A 2OWBA 2P33A 4F0FA 2CKOA 5EQPA 3R9DA 4F7LA 2QODA 2WQNA 3MA3A 5CSHA 5EM5A 2JAMA 3FMDA 4L44A 4FTMA 4BCQA 4RWJA 3E8CA 3QQUA 3UIMA 2W4KA 1FGIA 3KRXA 4MKCA 4PL5A 1I09A 2X2LA 4FODA 4FGRA 3O51A 1PMVA 4EZ3A 3ZUVA 4O0XA 5ANOA 2Y7JA 4IANA 4CFVA 4CMUA 2QO2A 3KRRA 3NUSA 4MD7E 4O0TA 4ENXA 4U3ZA 3FPQA 4EH9A 2GQSA 4MNEA 5F95A 2XCKA 3ZZWA 3CIKA 4CZYB 4U40A 4NM7A 4EH2A 5HGIA 3PPZA 4TN6A 1XKKA 5TT7A 4IVBA 2CKEA 3PXRA 3MPTA 4CNHA 5IQFA 4DGOA 4HVHA 2XKCA 3KRLA 4YC3A 5B2MA 4ZTSA 3FDNA 3A7IA 3CSVA 1K3AA 3I7BA 4O7VA 3ORIA 1TZDA 3W8QA 4W4WA 4CKIA 2W1FA 4B9DA 4U79A 4RC2A 1K2PA 4FSUA 5CEIA 3N4VA 2I0EA 1GZKA 3QZFA 4K9YA 4C3FA 3NNWA 4BWPA 2XAOA 1ZOHA 3A60A 3NYOA 1ZMWA 4F6UA 2C4GA 5C8NA 2JD5A 3HL7A 5LMAA 3IDBA 2R4BA 2YISA 1WVXA 3DCVA 3LXNA 2UUEA 3Q4TA 4APCA 2UW4A 2YIXA 3OOMA 3FKLA 2XNEA 3LMHA 2R3QA 4EC9A 1G8SA 3NNVA 4ZP5A 5AUUA 5DRDA 4D4SA 3JY9A 2X6EA 4JAIA 2UZEA 1ZOGA 4I92A 3UIBA 3NMUF 2JGZA 4BI2A 5DHJA 1H28A 1JQHA 1WBOA 2B7AA 2JBPA 4YJSA 3HAVA 1PXMA 3FI2A 2XEZA 3I60A 4YC6A 3UTOA 4BCJA 4YTFA 4BCOA 4DFYA 5HE2A 4N4SA 5AEPA 2VTSA 3BRBA 4EKKA 3D4QA 3Q5ZA 4YPDA 5D41A 2W1ZA 3PA4A 2ZJWA 4XG6A 2IZUA 4E4NA 4WG5A 2W1IA 1GNGA 1H00A 2VTPA 4O38A 1T46A 3EIDA 3FLWA 4BTFA 4FYOA 2JC6A 2WB8A 3ZDIA 5CAPA 5L6OA 3R2BA 2A1AB 4I93A 4L3LA 4BC6A 3HV7A 3LXLA 4RGJA 4M8TA 4N6ZA 2NNWB 3QLFA 5M07A 2BUJA 5CSWA 4PV0A 5EKOA 2EU9A 5HE0A 3UMXA 5KHXA 4N6YA 5CAOA 2O2UA 3EL7A 3VRYA 1PYEA 1XH7A 1YWVA 3COMA 4FT5A 5HNIX 2QOQA 4A9TA 4QMYA 1XBCA 5ANKA 1SVGA 5G6VA 3RI1A 2BFXA 4UYAA 1DS5A 5K5XA 1KV2A 1I44A 4F1TA 3VS0A 3PDTA 4RX7A 1E9HA 3HP2A 3KXNA 3FZPA 4I5MA 1UU8A 5HVKA 3PRFA 3R7UA 1WVWA 3RMFA 4EHGA 2OH4A 2BALA 3F5PA 1P5EA 4QO9A 2F2CB 2R3MA 3H0YA 3M11A 1OM1A 3RPYA 4JQ7A 4ASEA 1REJA 4LMNA 2WQMA 4PTGA 2R3LA 2YM4A 4FKIA 3VO3A 2BZJA 4C57A 4CYJA 3U9CA 5HG8A 4Q9ZA 1XH8A 2BCJA 3LFBA 3W10A 2CSNA 4DT9A 2OF2A 2WTDA 3TN8A 3EFWA 3QTQA 2HXQA 4DLJA 2QR7A 4FEQA 1W98A 3ZO1A 2WTJA 3KVXA 1VLRA 2YIRA 4PDOA 2ZV7A 2R0IA 4H58A 4K6ZA 5C27A 3G51A 3PA5A 3BYMA 4I5CA 3ZM4A 1Q41A 4MCVA 1H01A 2JBOA 3EN6A 4GV1A 2J90A 4OTIA 3OEZA 1ZWSA 2REIA 5D11A 5GINE 3QYZA 3R30A 4EH8A 5AUZA 1HOWA 3ROCA 3G9LX 2PVHA 1YHWA 1UVRA 4XH6A 3FEGA 1ZYSA 5IH4A 3E64A 4EWHA 4NL0A 1PXLA 4FIFA 2WMTA 3F9NA 3UNKA 4IE9A 4F9BA 1SMHA 4NCTC 4RA5A 4Y5QA 3SKCA 3WZDA 3PE2A 4D9UA 5L2WA 4MWHA 3AKJA 4IM3A 1URCA 4G3DA 4R3PA 4EYMA 2YM6A 4YHFA 2XNNA 3HRCA 5E8SA 5E8VA 4AP7A 4B99A 3DGKA 2A2AA 5IQDA 1OKWA 2J6MA 2W9FB 2ZDUA 2JKMA 3DV3A 3E8DA 2VTMA 4ORKA 2OZAA 3WZKA 5HU3A 4XV9A 2BAQA 3QQFA 3VRZA 4ZTHA 5CANA 3CXWA 3EQGA 4AOIA 2CNVA 2RSVA 3A8WA 3FMMA 3BE9A 1WVYA 4OAVB 2DYLA 2ZYBA 4DFUA 3QXPA 3TTJA 3TKHA 1Q8TA 3ANRA 4L01A 4DBNA 4CMTA 3LMGA 3TM0A 2QONA 3DJ7A 3WZUA 3IW6A 2WMQA 4WRGA 5HCYA 5AAFA 4DFZE 3H10A 4EUUA 5FXRA 5J8IA 1KE8A 3F6XA 4XLIA 2C3JA 3LCSA 3V6RA 2VTHA 3UYTA 5A46A 1ND4A 1J1CA 4JDIA 2ZB0A 2AC5A 3PXYA 4I23A 4U42A 2B9IA 2R3OA 2X8DA 2W99B 4F4PA 3UPXA 3RHXA 3QTIA 5K3YA 4G3GA 2PTKA 5HTIA 4IB5A 2YJRA 4QTDA 2RG5A 5DR6A 5BUEA 1OGYA 4JDJA 4IXPA 3DAEA 4IAYA 1OIQA 1OL2A 2VWUA 3BLRA 3C5IA 2CN5A 2HY81 2HYYA 4BKYA 4E3CA 2VNYA 4CEGA 2Y0AA 5EK7A 2FA2A 5LVPA 2GNIA 4YURA 2UVZA 3UP7A 4O22A 3QXOA 4H3PA 2HW7A 4U45A 4C2WA 4D2WA 4FSNA 2YDIA 2WTKC 4O96A 3F61A 4PF4A 4NK9A 4MVFA 4DC2A 1JOWB 1MRVA 3NIEA 3QCQA 4B7TA 5E9EA 3VS3A 2W7XA 3S1HA 3AC3A 3DFCB 4KRCA 5F4NA 4QMQA 5KMKA 5IQBA 3OS3A 3GFWA 4XEYA 1YI3A 3W2PA 2UZUE 2YCFA 1DAYA 1U5QA 5KZ0A 2G01A 1LUFA 4X3JA 3IOPA 3DPKA 2PMLX 3MFTA 4GKHA 3EYHA 3KN6A 4Z16A 2OIBA 1ZY4A 4X3FC 3LLTA 5CVFA 4AS0A 4NYEA 4I6QA 4NW6A 4ZSJA 4EOKA 2BAKA 3L1SA 2X9FA 3QTSA 4R1VA 4EK5A 3UDZA 4QDVA 4C59A 4J97A 4X2FA 4CGAA 1Z5MA 3MV5A 2B53A 4BDIA 5FTOA 3F66A 2PULA 2XNGA 2BR1A 3OUKA 3KXHA 2OJGA 4L7SA 4FIHA 4FKVA 4QMLA 5EYDA 4L00A 2HXLA 4JBVA 3KCFA 4K1BA 4KINA 4AA4A 4O7WA 4X2JA 3OG7A 3RWQA 3QRKA 4DGGA 3MTLA 3RPOA 4FSQA 5CZHA 5FBNC 1GAGA 4AGWA 4ZY6A 3DBQA 4FIEA 3II5A 4E4LA 2F49A 3ERKA 3A7HA 3JVRA 3UNZA 5E90A 4EBVA 4ACCA 5EHOA 2WU7A 5KKRB 2FVDA 4IB3A 2JDSA 4ERWA 3RAWA 3SVVA 4JS8A 5AP2A 4WOVA 4CFWA 1T45A 3ZLYA 3KEXA 5HG5A 4S2ZA 4C35A 2WHBA 4F65A 4DH3A 5E91A 1QMZA 5AUWA 4XV2A 4M67A 5HICA 3VUGA 3ZHPC 3AT4A 5DNRA 3FZTA 4DITA 4FV3A 5K9IA 4JIKA 2WNTA 4U41A 5BYYA 3QKKA 2J5FA 4FT0A 4KA3A 4NTSA 2XM8A 2P4IA 1RDQE 4DCEA 4AGCA 5AWMA 3SGCA 5GNKA 3HA6A 4FIIA 4E5BA 1OKZA 2ZM4A 4L6QA 2C5NA 3FV8A 4IZAA 4RRVA 2W1EA 3GCPA 3H3CA 4ITJA 4I6FA 3QQGA 2XK6A 4JDKA 4E4MA 4YLKA 3FI3A 3ZRKA 2BFYA 4GT5A 1CKJA 4AAAA 3E87A 5IUGA 2F57A 2ONLA 2BVAA 4GSBA 4R3RA 2W5BA 4USDA 3CD8A 4YLLA 2RF9A 2IW9A 4JX3A 3V5PA 4S34A 4PP7A 5IEXA 1WBNA 4FC0A 2YM7A 2EUFB 4O7TA 4Q5EA 3UC4A 4DEIA 3E7OA 4G9RA 4PMSA 4EOQA 5DEWA 1IRKA 2J2IB 5BX0A 4PY1A 1FMKA 3CY2A 5JT2A 3PLSA 4P4CA 3FC2A 4JXFA 4BI0A 4HW7A 2UV2A 3BELA 4CLJA 2JEDA 2WGJA 4L68A 2LAVA 3D2IA 4F0IA 3O0GA 4IEBA 2B4SB 4AZEA 3IONA 3DAJA 3OOGA 5HE3A 4P2KA 2OFVA 4BDCA 1H1PA 1WAKA 5CEKA 2VGOA 4BDEA 5A6OA 5IQCA 1H26A 2XYNA 3GFEA 2YEXA 3KVWA 5ANEA 1FVRA 2AYPA 3OTUA 5AUXA 2Q0BA 2OH0E 4RC4A 4OAUC 4MXAA 1W2DA 4AE6A 1ZYJA 3G33A 1KSWA 2QVSE 3OY1A 3QWJA 4BCKA 4JQ8A 5CU3A 4DHZA 3Q96A 4DTBA 4H3QA 3PVWA 4NM5A 4XRJA 3RK7A 4E26A 4O21A 4APPA 2J0MB 5J9ZA 3GU6A 5IQIA 3U4WA 4W9WA 2YA9A 2Z60A 3FMKA 4GH2A 5TO8A 5AIRA 4TWNA 2PVMA 4AGUA 3ZUTA 2X2KA 4D1ZA 1R1WA 2G2HA 1Q99A 3KK8A 3AD6A 5BMMA 3T9TA 4EKLA 1ZAOA 3R0TA 5ANJA 3ID6C 4O1PA 4NT4A 2SRCA 3UG2A 4CT2A 1GJOA 4F9WA 3EZVA 4F09A 4XG2A 3O2MA 2YLFA 4WRSA 5CY3A 4D2VA 3GOKA 4G34A 5L8LA 4FKRA 1H1QA 5DH3A 3EB0A 5A3XA 1TFFA 4DBXA 3QX2A 4KSPA 4QYHA 3K54A 1PXJA 3I0QA 3AC2A 2AC3A 2V0DA 5F94A 4RWLA 3DBEA 4R5YA 4AF3A 4MXZA 2J50A 2VWYA 4YO4A 2VX0A 4RBLA 3MIYA 4BIDA 5AM6A 3W2QA 2OGVA 2ITXA 3ZDUA 2KULA 5IQHA 3IGGA 2BIYA 3VS4A 2C3IB 4PMTA 3R8PA 3TDVA 2CPKE 1SM2A 2OF4A 4K11A 3C4XA 4XLVA 1RJBA 5IA0A 4LM5A 3P08A 3PJ2A 3GI3A 3F7ZA 3CJGA 4FNZA 1XBAA 4YU2A 3AT3A 2WXVA 3TL8A 2VRXA 3UVQA 5AV2A 3W0MA 4O27B 1XQZA 3GXLA 5TR6A 2P3GX 4HCVA 5BYZA 4D2SA 4GL9A 4QD6A 3VBXA 4DLIA 5HIEA 4FTCA 1J1BA 4ANOA 3K5UA 4F6WA 5AA9A 3I1AA 5T68A 2OZAB 4XOYA 3R1QA 4IIRA 5KNJA 2VO3A 3N4UA 5EW3A 3F2AA 5GZAA 4OTFA 4GW8A 2Y6OA 4J98A 3TUBA 2C5XA 3F3ZA 2HW6A 1F0QA 2ITPA 4M12A 3QD0A 4HVIA 4I6LA 2GU8A 4K18A 3LHJA 3QGYA 4CFFA 5BVDA 2ZFYA 2X0PA 3UZRA 3G6HA 2EXMA 5E1SA 3LQ8A 2VO7A 4CFMA 3DJ5A 4LMUA 5AP5A 3IPHA 3ZM9A 1YDRE 2R7BA 2Y4PA 3NYXA 4ZOGA 5JKGA 3KY2A 3MB7A 2OSCA 4FTLA 4DAWA 5JGBA 5CEMA 3Q9ZA 2DS1A 4Q2AA 5CU6A 5EG3A 4CT1A 5E8TA 5KO1A 3NCGA 3MH2A 5ETAA 3QQJA 2VO0A 4J95A 3BE2A 2PY3A 5IEYA 2UW0A 3D5UA 4C8BA 4KABA 2G15A 4OTPA 4MF0A 4CLIA 3UE4A 2BZKB 4AZVA 3LM0A 1J7IA 5EM7A 4DFLA 2IO6A 2FO0A 2V22A 2I6LA 2UZDA 3O8TA 4FZ7A 4RIOA 3ALNA 2E9PA 1VR2A 3OWJA 3DLZA 3OCTA 3GQLA 2ETMA 3PP0A 2VZ6A 3QD2B 4XG7A 5KZIA 2QI8A 3FZ1A 3IO7A 3VQHA 3D7ZA 4RJ8A 4QMNA 3ATSA 3OWPA 5B2KA 1KE9A 4XYFA 3IKAA 3OFMA 1XO2B 3LIJA 4ZJJA 4FT7A 4GUBA 5M51A 3NFFB 4DF3A 1MP8A 3PXFA 3EJ1A 4RX8A 5C26A 4C2VA 5CWZA 4V05A 4FKLA 3FKOA 2GTNA 1YKRA 1P4OA 4QYYA 3OCSA 4BTJA 3BV3A 4C4FA 2ETRA 2VNWA 5AAGA 3SHEA 2YN8A 1XJDA 3E5AA 3KC3A 4PX6A 2GQRA 3FE3A 3F3WA 3HYHA 4Y8DA 2WTCA 3AKLA 1JNKA 4JJRA 3RPSA 1OPJA 3EQBA 3OCGA 4U44A 3SXFA 5LWMA 4FK6A 2XNPA 4ZS4A 5I5ZA 4TWOA 4DN5A 4UMUA 1TQPA 4HVSA 1Q8ZA 4PDSA 1G8JA 5CQWA 3EN4A 1JPAA 4K77A 3L8PA 1GOLA 1M7QA 5FGKA 2XIRA 3RM7A 3SOAA 3OEFX 4I6HA 5I3RA 4J71A 4I24A 5KE0A 3R8ZA 5I9ZA 3ZLWA 2W1GA 3ORZA 4CRSA 5DR9A 5KBRA 1NA7A 5IMEA 1OB3A 5JRQA 4BRXA 4OBQA 5TF9A 1XH5A 4FSWA 4EYJA 3P78A 3NDMA 4CCUA 4W4XA 1B38A 2YWPA 4NKAA 3OMVA 4RMZA 4GEOA 5CZIA 4QMWA 2ZOQA 2UZTA 2QU6A 2XS0A 4ZLYA 4UWYA 4MXOA 4TZRA 4AG8A 3IDPA 3LFQA 2XIKA 1KV1A 4KIQA 2O3PA 2O64A 4MH7A 3VN9A 4KRDA 5DT0A 4G5PA 5CX9A 5IKWA 3CC6A 4AW2A 2WZJA 3OT8A 1U46A 3QA8A 1Y91A 4IQ6A 4MXYA 4W4VA 1Y8GA 2ITNA 3ZFYA 4E4XA 1JLUE 2YM3A 1W0XC 3LKMA 4K2RA 2IW6A 2CLXA 5IA2A 3FC1X 5H9BA 4ZEGA 4ITIA 4BCNA 2C5YA 1XH4A 4FG9A 4GYGA 4IFGA 5I9YA 1OL7A 3JS2A 4QPSA 5DYJA 4BKZA 2X39A 4EK6A 1LP4A 2C1BA 3JUHA 3HNGA 4UXQA 4BJJA 4RPVA 3NUYA 4EQCA 2VTRA 4L53A 4MBJA 1W82A 4YJTA 4H3BA 2WMRA 4TPTA 5EYMA 3G0FA 3N9XA 4TRLA 3UO6A 3DBCA 4WSQA 4BGHA 1G5SA 3GU7A 3PY3A 3B8RA 3EKKA 5TE0A 2YCSA 5IISA 1QL6A 1XH9A 3LPBA 3MVHA 3P9JA 5HBEA 2XKFA 2EXEA 4QEBA 2IZSA 3F2RA 2A0CX 2GFSA 5FP5A 4O81A 3H9RA 2C6OA 4GFMA 3TZ8A 4BBFA 4CFNA 4BDHA 2GNGA 3I0OA 3O7LD 1OUYA 3MN3A 4KIOA 4MTAA 1A48A 3QGWA 4RVMA 3W2OA 3HEGA 3ZO4A 2Y4IC 3NYVA 4NFMA 4X21A 1NY3A 5GHVA 4QMVA 2YM5A 1PHKA 3GBZA 3RAKA 4EK8A 3DTCA 3PSBA 3N4TA 3W55A 3V51A 1CTPE 3AT2A 1TQMA 5HIBA 4P5ZA 4CMOA 1PKDA 3GC7A 5KMMA 3AC4A 1PMNA 2B9JA 3FHIA 4HGLA 4IWPA 4HGTA 3DNDA 3HZTA 3Q32A 3BPRA 3O50A 2ZV2A 4ZTMA 4BDJA 4E5WA 3QU0A 4O7LA 4DFXE 5AUTA 3HKOA 2BTSA 1QPDA 4B8LA 5DVRA 5H2UA 4LGGA 3NLBA 2R9SA 4QTBA 3VHEA 4FTIA 3F3UA 3A7FA 4QP8A 1A06A 5EI2A 3E93A 3VUTA 3W2RA 4O84A 3ELJA 4G1WA 3SX9A 3COIA 4BDGA 4YR8A 4UWBA 1ZYLA 2ITQA 4ONAA 3FHRA 1BYGA 1OBDA 3CPBA 3OHTA 5AP7A 1OECA 3SW7A 3U6JA 2VAGA 2JITA 3D83A 3EQCA 2R3HA 3FY0A 2I1MA 4KS7A 2YM8A 1Y8YA 4CKRA 3SC1A 3Q53A 3IW7A 3KCKA 5CXHA 2YIYA 4M14A 2W4OA 1DI8A 2OJFE 4W4YA 5HCZA 1OBGA 3UNJA 2XALA 2PUUA 4HZSA 3ZFMA 5BMSA 3TKUA 3ZSIA 4BCIA 2VTJA 4I41A 4GMYA 2W0JA 3R73A 3VF9A 3TNQB 4X3FA 4HVDA 3D2KA 4MYGA 3TTIA 2OJIA 3NEWA 3TDWA 4FVQA 1W2FA 4TNDA 3EQRA 5GZ8A 2XRUA 3MJ1A 4C7TA 2HIWA 3QC4A 2XIYA 2IVSA 2WKMA 4NW5A 1F5QA 4HPTE 4JBPA 2HK5A 4HYUA 1YOLA 2O63A 3SQQA 4C4IA 3DLSA 3C5UA 3WF6A 2WIPA 5C8MA 5BVKA 4PNKA 1IEPA 3BX5A 3LFDA 2PU8A 3QTZA 3NFGB 5LXMA 3I79A 3EH9A 4DGMA 3U6IA 2R3JA 1PW2A 4RX9A 3R9HA 4BGQA 3A62A 1PF8A 3LCKA 2QC6A 3BHHA 1RQQA 5L4QA 4BCHA 5JGDA 3VS2A 5C01A 4BFMA 3NWWA 1IAJA 2PUIA 5J79A 3WZJA 4CCBA 4MQ1A 3RNYA 3FL5A 3QRUA 5L3AA 5M4IA 4NIFA 5JRSA 2PVRA 4WA9A 4XG4A 3PUPA 2ZV9A 3D0EA 4M84A 2XIXA 3F3TA 2CLQA 2VWWA 4OUCA 2LGCA 4O0RA 4DH8A 4AAYA 4ZJIA 4X6RA 4RX5A 1XBBA 2XUUA 1KUTA 2UZWE 3W18A 1UU7A 4IACA 5CF4A 3EFJA 2HENA 3ANQA 4RFMA 3O17A 3ZH8A 4ANBA 5CSPA 3JR1A 3QZHA 2GHMA 4FTNA 4O7ZA 3DFAA 3LFEA 4RA4A 4UB7A 3U54A 2IF8A 1WBSA 3O8UA 5IH6A 4QPMA 2GMXA 4O0SA 2BAJA 1H07A 3D5WA 3ZXZA 1MQ4A 3NYNA 1YVJA 3R7EA 3PFYA 1OIYA 3GCSA 4FUYA 4RWKA 4ASDA 2GNFA 4IZYA 4ASXA 3KU2A 2VTLA 4NEUA 3M42A 5JH6A 3ORXA 4PRJA 3RM6A 3VAPA 5JFVA 2ZM3A 1ST0A 2BZHB 4U0IA 4XCUA 1BLXA 4E6AA 1ZYDA 5IA5A 1KWPA 3P5JC 4WD5A 3R00A 2YDJA 4F9YA 2WTWA 1JWHA 2JKKA 3BHYA 2W5HA 3HV3A 2PK9A 4KIKA 2WMUA 4Y85A 3RCDA 3T3VA 1Y57A 3UIUA 5E1EA 3ODZX 4EOIA 4ZZNA 5LCJA 2VTNA 4YBKA 5CYIA 4FKTA 1Q8UA 4QYFA 3L9NA 5EDPA 5H3QA 4AN9A 1YXUA 3P23A 3OVVA 3QKMA 4XRLA 1STCE 1YXTA 1J3HA 4BI1A 2X81A 1H27A 3Q2JA 1H1WA 2IEWA 2J0IA 2WQEA 3EKNA 4FSMA 2B0QA 3W0SA 1IR3A 3FZOA 4AZTA 4A9UA 4EH3A 4DT8A 3MPAA 2ZV8A 3HX4A 4A4XA 4QTAA 5FLFA 2WMBA 5KMNA 3ACKA 5I9UA 5FEQA 4I0RA 2PVJA 4H05A 2UW8A 4WG4A 3EN5A 1OIRA 3E3BX 4C3PA 2FB8A 3CJFA 4RWIA 2ITVA 4FNWA 5JK3A 3T8OA 4GJ2A 4FTUA 4NJ3A 3NSZA 5K0XA 1XH6A 4ZMFA 3ZBFA 1GIJA 2BPMA 2FSTX 4ACMA 3PYYA 3DT1A 1V0OA 4YJRA 3OBGA 1XR1A 5EDRA 2PL0A 1QPEA 2BDWA 4AT4A 4HYHA 3CTHA 2IVVA 2UVXA 3FUPA 4FV0A 5L8KA 4R1YA 1FVVA 3FZRA 5FM3A 4XG8A 4FV5A 5HE1A 4LYNA 1UWJA 4ARKA 5HX6A 4FJVA 4DEHA 4JNWA 4YNEA 4C62A 3AD4A 4G2FA 5TKDA 4ZZMA 5L2SA 3TZ9A 2XKEA 4BHZA 3MFRA 3SOCA 5I4NA 3CPCA 3TV6A 3V01A 2C1AA 2JFLA 2O0UA 3IQ7A 3OXTA 1CKPA 3DB8A 4GT3A 3WARA 4Z7HA 3M2WA 4FYNA 4EWQA 4JX7A 3UMWA 2WTVA 3E92A 4IDVA 4MUQA 5CAQA 3OW3A 2CN8A 3CQWA 4BVUA 4U81A 3S95A 4YTCA 3L8SA 4H1MA 4ZJVA 1OIUA 5FG8A 1FBNA 3PLAE 4F0GA 3CP9A 3V3VA 4C58A 4D1XA 1ZY5A 3F5UA 2OG8A 3NIZA 3PSDA 3BLAA 3G0EA 3AGLA 1PMEA 2R5TA 1BUHA 4U8ZA 2F7ZE 4Q5HA 4NTTA 3KXXA 5C4LA 3CS9A 2XCHA 2PZ5A 1M17A 5H8BA 1PY5A 3SDJA 5DWRA 4Z55A 1SVHA 5IF1A 4FZDB 4WHZA 2Q83A 4I0SA 5AP3A 3GNIB 4M7IA 1UNGA 1W83A 3R9NA 1URWA 4XMOA 5CEPA 5E8YA 2NRUA 3GB2A 1ERKA 3OBJA 3AOXA 4HCTA 1FQ1B 2QCSA 3TI1A 4J99A 4WBBB 3O71A 4P5QA 3P79A 4HPUE 4B6LA 4WSYA 3RINA 3CQUA 3V5WA 1R3CA 3TV4A 4YTHA 5ANGA 5DEYA 4UV0A 3FY2A 3PSCA 4M15A 4O4EA 3TJCA 3GU5A 3TYKA 4PWNA 2PZYA 2RFDA 2JDOA 4O0WA 2R3FA 2XK9A 4V0GA 5C03A 2QOKA 2B52A 3CY3A 3R63A 3LCDA 3QL8A 5A4TA 4WNOA 1OI9A 4A07A 2H9VA 3VC4A 5AX3A 4CV8A 4EOLA 2FSOX 5LMBA 1OVEA 2O65A 4G6LA 4D1SA 2BDFA 5C1QB 4G3EA 1EH4A 4M13A 1LEZA 3VNTA 3ZO3A 4EUTA 5E8ZA 4A9SA 2YAAA 3AQVA 3C4FA 3MYGA 5CLPA 2WEIA 2QHMA 3IW8A 3TV7A 5LVMA 3LVPA 3TNIA 4F7SA 3TMOA 1OITA 2R7IA 4PQNA 2I0VA 4AQCA 2QO7A 4ALVA 4NFNA 3EFKA 4ZMEA 5AR3A 2Y8OA 2J51A 3NW7A 3UC3A 2YLEA 3WYXA 4UY9A 3BEGA 1WBTA 4RQVA 3BU3A 1HCLA 3C13A 3MIAA 4MXCA 4WNMA 3ZBXA 4BZDA 3ULIA 4BCGA 1P2AA 4D4VA 2C6KA 5D7VA 3L9PA 5IPJA 3R04A 4L7FA 2XZSA 3I6WA 3FMJA 4II5A 3F2NA 4ZTQA 2HELA 4AWIA 4C4JA 5HIDA 2J4ZA 3P86A 5A54A 4OBOA 4FKQA 3BKBA 2JDVA 3PA3A 4LV8A 1J7UA 4ZS0A 3MVMA 2CNUA 4GKI