4PPCA

Itk kinase domain with compound 27 (n-{1-[(1r)-3-(dimethylamino)-1-phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3-carboxamide)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
264
structure length
233
Chain Sequence
SVIDPSELTFVQEIGSGGLVHLGYWLNKDKVAIKTIIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and optimization of indazoles as potent and selective interleukin-2 inducible T cell kinase (ITK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 66
structure length 233
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ppcA00
1CKIA 2WXVA 2QKRA 2R3GA 2YM4A 4BHZA 3R8ZA 3ENMA 3BQRA 4X2GA 4QTAA 4F1TA 4M66A 3QTXA 3LXNA 2BFYA 1KE5A 5LVMA 1LPUA 1YHVA 4OTGA 4FOCA 4RJ3A 2JIUA 4TXCA 4F4PA 3O96A 4FSUA 1JOWB 4IADA 2R2PA 4F09A 3QTZA 1XH6A 2IVTA 4ARKA 4KS7A 4CFFA 2ZJWA 3CJGA 4IIRA 4MNEA 5CVHA 2YDJA 5CT0A 2ONLA 3FUPA 3I0OA 4C0TA 1CMKE 5HU9A 3C7QA 4XG2A 5KCVA 2BUJA 5L2SA 3L8XA 3R1NA 5CALA 3BGQA 3C4CA 3CQWA 1ZYDA 5ITAA 2B9IA 4KINA 1OI9A 4FV3A 2XK6A 2GHLA 1IRKA 3MH2A 2VWVA 2B9HA 4I21A 2UZVA 4IAYA 3UQFA 3ZRKA 1YKRA 2F9GA 2BFXA 3KF7A 3FPMA 3GP0A 3RPRA 3UIBA 2IVVA 3HVCA 5CASA 3CY2A 4D1SA 2FSMX 5IH5A 4LL0A 3U9CA 3GU8A 2JDTA 4S30A 1CM8A 3UNKA 1GIIA 5AUWA 4YTFA 4FNWA 4LRMA 2OKRA 4UZHA 5LCJA 1H26A 3UODA 3EKNA 4YTIA 2R3FA 4M7IA 4BN1A 4BKZA 1XH9A 4MCVA 5DPVA 3OWPA 3EFWA 2Y0AA 3ACJA 5JH6A 4IWQA 1AD5A 4AUAA 4E5AX 4CCBA 5BX0A 1JQHA 3NW6A 4PMMA 5AMNA 2C0TA 1BI7A 4PL3A 2Y7JA 4GG7A 5BUJA 2XYNA 2PE2A 3FLZA 4QT1A 4D2SA 3ORTA 3K54A 3OXZA 4QP9A 3RPYA 3FQSA 3ZUTA 1OIRA 2WQEA 4BGHA 1IASA 4G5PA 3HZTA 5AP1A 3BPRA 4G9RA 4J52A 4LOQA 5AUTA 4NUSA 5LMAA 1AQ1A 2VTTA 3QRTA 4ALVA 5EK7A 5HG7A 4U79A 4EH3A 3KEXA 5E92A 4FK6A 3OTUA 4JAIA 4FSYA 5CAPA 4QPMA 3TTJA 3F3TA 4EHVA 2FYSA 3RKBA 4XEYA 3G0FA 5LMKC 2QODA 4XJ0A 3THBA 4AU8A 4BGGA 2WOUA 2JD5A 5HVYA 4D9TA 3BLHA 4XG4A 3CKWA 5FM3A 4XG9A 3DU8A 4FG8A 3NGAA 4CFWA 1UNHA 3FQHA 2HCKA 1PMEA 1V0PA 3CPBA 4R7IA 3CC6A 5E7RA 2CMWA 2WO6A 4BCNA 3RK7A 5HOAA 1H28A 1U4DA 4EZ7A 2WELA 3QZFA 5IEYA 3KVXA 2V7AA 5ACBC 3NYOA 4HVIA 5CEKA 1Q62A 2PUUA 2PVMA 3GT8A 3NNXA 4JQ8A 4CYJA 3QBNA 2QC6A 1VEBA 1OL1A 4FA2A 5CAUA 1OL5A 4J95A 3SC1A 3K5UA 4L67A 3DK6A 4WD5A 4RGJA 2IWIA 4XH6A 3B2TA 5G6VA 2GQGA 4EH5A 5HX6A 4YHJA 3GC7A 3ORZA 1YW2A 5AM7A 5KMNA 2XYUA 4RIWB 3BHVA 2RF9A 4C3FA 3TACA 3DB8A 3Q9XA 4X6QC 4DG3E 4K9YA 1XR1A 4AZVA 4ZZOA 5I5ZA 4RX7A 1WMKA 2W9ZB 4NJDA 2P0CA 3WF9A 4UXLA 4BIEA 4RIXA 4OGRA 3VRZA 1FVTA 3P7CA 2FUMA 3T9IA 3TL8A 3PPKA 2EB2A 3A8WA 3IW7A 3HMMA 2XEYA 1BUHA 3KFAA 5FP5A 1XO2B 2QQ7A 2QOOA 2FVDA 2G9XA 2XNMA 4WRSA 4E4MA 2HK5A 2DQ7X 5AR3A 4JR7A 3BQCA 2QOCA 5CXZA 3E93A 2IN6A 3IW5A 2BILB 5BQ0A 4C37A 4DH7A 4N6YA 3BYOA 4IW0A 2ZV2A 3O8TA 5HCYA 3ODZX 5JEBA 4PNIA 3HMPA 4IAFA 3W8QA 2FSLX 4M68A 3AD6A 2HENA 3JY0A 1Z57A 2E9NA 2ZM3A 3U6JA 1VR2A 3ZC6A 1FOTA 5IMEA 5AV1A 4QYFA 4IFGA 2PMIA 4OT6A 4PV0A 5ANDA 3HMNA 5T3QA 4RFMA 3HV3A 1UKIA 3P7AA 4I5PA 2B52A 3FLQA 4U40A 4W9XA 4YR8A 2BKZA 4B99A 5IDPA 5LMKA 5ETAA 4IVAA 3ZEWA 5EYMA 5C27A 2XNBA 5H8EA 3BYSA 5KKRB 3HA6A 2WZJA 3HNGA 3E8CA 1RJBA 4LGDA 2C3IB 5KNJA 2VNYA 3TZ9A 4ACHA 3L9PA 3KF4A 3V6SA 3E3BX 4YC8A 4DLIA 3NYXA 3C0GA 4YGAA 4BWXA 4V01A 4EK6A 5L8KA 2QO7A 3RCDA 5BVNA 2YITA 5J9LA 3LFDA 3R7YA 3ORMA 3KMMA 4C57A 1WFCA 4W8DA 5HBEA 3R8PA 3TNIA 3UPXA 3GI3A 3Q9WA 2WTIA 2QHNA 3O50A 3CTJA 4FL1A 5CVFA 3TIZA 1YI4A 3NRMA 2O63A 1FVVA 1XBAA 2EWAA 3AT2A 4LRKA 2PK9A 1DAYA 3DLZA 3QZGA 3QZIA 2OF4A 2RKUA 3OEFX 4FT3A 4I0SA 4M13A 3UQGA 4BFMA 2QD9A 4PTCA 5IA3A 5LVNA 1OKZA 5HGIA 3VN9A 3GXLA 4L7SA 2PZRA 2W1CA 5BUEA 3QXOA 3TZ7A 3OMVA 3N51A 5HE0A 3GCPA 1BLXA 5DT0A 3FKOA 3O2MA 4JBPA 4ANBA 1PXPA 2A2AA 2PTKA 3QTWA 3UO5A 3ZS5A 3LOKA 3CD3A 2BRMA 4U7ZA 5TO8A 5LMBA 5IUIA 1A9UA 3C5UA 4XBRA 4J8NA 5EHLA 2ITNA 4WBOA 2B55A 2YA9A 4YJPA 3W32A 4TL0A 3IK3A 2BZKB 4Z9LA 2IO6A 4G16A 2PMOX 3ZLWA 5BPYA 4U3YA 1DI9A 2VUWA 4YSMA 1LEZA 1QPCA 4GMYA 3PJ3A 4HNIA 4R1VA 3MFUA 3VS6A 1PMNA 5E8SA 1OGUA 1I09A 5K9IA 3S0OA 5AV0A 4L43A 3E7OA 5LVOA 1UVRA 4IAAA 4MXAA 5JQ8A 4QMSA 2PVHA 1FPUA 4A4OA 4IHPA 5HX8A 3FLNC 4YLLA 2X8IA 3B8QA 4K11A 5KMLA 4I6BA 3JY9A 1GIJA 4IZ5A 2XJ0A 3WYYA 5I9YA 1YOMA 2JAVA 2OI4X 4FKLA 3UOJA 4WO5A 2C0IA 5HIEA 4NTTA 3DGKA 3LW0A 4MNEB 4XV9A 1STCE 2VN9A 3P78A 3QTSA 5EDRA 4CV8A 4FT5A 4HGEA 4ZLOA 2ACXA 3LPBA 3WZDA 2ZVAA 3LVPA 4BBMA 5EDPA 3EL8A 2V62A 3DPKA 5BVOA 1OL7A 4HVDA 4RJ8A 4J96A 5BVKA 3L1SA 4HNFA 2QI8A 3VHKA 1J1CA 4LUEA 5DR2A 3QFVA 2JDRA 4ID7A 5BUIA 4M15A 5I3RA 3ULZA 2QURA 3VJOA 3A7IA 5G1XA 3C9WA 4B4LA 4DEHA 3UG1A 2R3LA 4NSTA 1FVRA 3D14A 3MN3A 4QOXA 2O3PA 3CGOA 2PVJA 3Q96A 3R83A 5DG5A 3PTGA 4ZIMA 4YP8A 4O0RA 3MFSA 5ICPA 3IG7A 3MTLA 4O0VA 2HXLA 3ZDIA 4H1JA 2HZNA 2WMWA 1XKKA 3HGKA 3OC1A 5JRQA 5EI6A 3ELJA 2UZBA 3BV2A 3PZEA 5CEOA 1UWJA 4G3CA 3O71A 4DTKA 2BPMA 4AT5A 2HZ0A 3FMHA 5EKNA 4RJ4A 1H0VA 3NIEA 4J99A 3RK5A 5ANIA 4DH8A 3NUNA 3R01A 5AP0A 1YI6A 4PPAA 2VWWA 2ZDTA 3Q4UA 3NLBA 3VS0A 4OAVB 4JBVA 3QRKA 4L8MA 2IZSA 4YPSA 4EUTA 4NFMA 4GCJA 4IVDA 5ANKA 3OCTA 3PWYA 3QHWA 4R3PA 3QTUA 3FE3A 2BALA 2QO9A 3FL4A 4G6OA 4A9SA 1MQ4A 3C50A 4K18A 2OZOA 1QL6A 3AC3A 4YLKA 4CTBA 3OCSA 2UW3A 4F9CA 4DEBA 1YXTA 3ZM4A 2W96B 3I7CA 3HV4A 2W5AA 4DLJA 3LJ1A 4FT9A 4IX3A 5CF5A 4QP3A 3S4QA 3KRXA 5KZ0A 2HY81 3E88A 4C02A 5IA5A 4BWPA 4H3QA 4DGOA 1OKWA 5HHWA 3V8WA 5A4EA 4M3QA 4F9YA 4YU2A 2GFCA 3O8UA 3VBQA 1BMKA 2C30A 1ZAOA 5KBQA 2YM6A 3R71A 3UBDA 3UPZA 5AIRA 3R9OA 4WSQA 3QZHA 5LXMA 2YHVA 3RTPA 2ZV8A 2EVAA 5DHJA 4UV0A 3A99A 5IISA 3F69A 3GC8A 3RBWA 4EK8A 4EJNA 4K6ZA 4FZFB 5GZ8A 4L44A 3HRFA 5H3QA 3ORIA 4E26A 4FV7A 1H01A 1LUFA 4FSRA 1Q97A 5LOHA 4LM5A 5JK3A 4HZRA 3VW8A 1WBTA 2A19B 2VWBA 2G1TA 4NIFA 3NUSA 1ZMWA 3GFEA 2XA4A 4RBLA 5M51A 1PXLA 3G0EA 5CSHA 4JG7A 1T45A 4NU1A 3I4BA 2WU7A 4YHTA 3F9NA 1RDQE 3DQWA 5L6PA 2EXMA 3LXPA 5CSXA 4IB0A 4RIXB 5AUXA 4JBQA 1U59A 4FK3A 4I24A 2BRBA 2VGOA 1YHWA 3MVMA 3VS2A 4R6VA 4X3FA 2BVAA 3I1AA 2PVFA 3OEZA 4TNDA 4XV3A 3TUBA 4UYNA 3BBTB 3QQKA 3TNWA 5DN3A 4FTQA 4DG2E 5H8GA 2XIZA 4IEBA 3KXHA 4WNOA 3WZEA 1DM2A 2ETRA 3ORLA 2R7IA 3BE9A 4BDEA 4L46A 3ZFYA 4OLIA 4RSSA 2OXYA 3EQHA 3AC1A 2I0EA 2B53A 4R3RA 4HOKA 1KSWA 1F0QA 1JKLA 3G6HA 3IDPA 3S2PA 3IW6A 4CT1A 4EBVA 2GHGA 2P33A 5BVDA 3VC4A 4AW1A 5CAQA 3DV3A 1KOBA 4O27B 2QONA 4PY1A 4EYMA 4IZAA 3LHJA 4QYYA 5B2KA 3RGFA 5KBRA 4FIGA 4FEQA 2HIWA 2J9MA 2VWUA 3PSCA 1H25A 4RRVA 3ZSIA 4A9RA 4TRLA 3RWPA 2C6KA 3CKXA 5D9HA 1B38A 2QOLA 1U5RA 4CRSA 4Z7GA 1UV5A 3EFLA 4LOPA 1JKSA 3BU5A 3PA5A 2AYPA 4FZAB 4F9WA 2I0HA 4E8AA 2A0CX 5HICA 2J90A 5ANJA 1UKHA 4UEUA 5GNKA 4BCIA 4A07A 1Z9XA 3QQFA 5KE0A 2YISA 3KU2A 3BLRA 5IH4A 3LM5A 2QOBA 3R0TA 3MSSA 4BKYA 3JS2A 5CEQA 1CKPA 5JSMA 4MBLA 5AUYA 1H0WA 3C4WA 4CV9A 4ERWA 3TG1A 1Q3DA 3MTFA 4MXZA 3KKVA 4BDBA 3P86A 2X1NA 1JSVA 3W2CA 4M69A 3AOXA 5KMMA 4L3PA 4HPUE 4RWIA 5HG9A 3D83A 3R9HA 3ZOSA 4EH4A 1PXOA 4RWLA 3WI6A 2X7OA 4MXOA 2JKQA 3F6XA 4KD1A 4I92A 5AAGA 4FT7A 1OZ1A 1PXNA 3CQUA 3EN7A 2YLEA 3QQLA 4HCUA 4IE9A 3W2QA 4CT2A 3L9LA 4TYGA 4D1XA 3R9NA 1ZZLA 2X9FA 3QUEA 2XCKA 2QCSA 4AP7A 2BRHA 4DH1A 4E5WA 2HOGA 1PY5A 4C4FA 4ZSAA 3EMGA 3JPVA 3KL8A 4XP0A 4C59A 4JQ7A 1YDSE 3QKLA 2HW7A 5HG5A 3MFRA 5HORA 5DNRA 5E8YA 5L8JA 3SHEA 2W1DA 3QLGA 1H00A 5DLSA 4BCJA 2JKKA 2ZB0A 3RJCA 1IA8A 4YUQA 3CCNA 5CENA 4CZTA 2WMRA 4JRNA 5CT7A 3PXZA 2BDWA 4GEOA 4J1RA 4UWBA 2YN8A 2YWPA 4RQKA 4YC3A 5AX9A 2C68A 5CVGA 1GY3A 5EI2A 5JGAA 3N9XA 3V5WA 1OKVA 3L8VA 4AE9A 3EQIA 4MVFA 3DLSA 4PDOA 1UWHA 5HVJA 3V8SA 4A06A 1XH8A 2GNLA 4LYNA 4X2KA 5D10A 4EL9A 2VTRA 3A4OX 4DEAA 4EOLA 4QNYA 3MIAA 5EI8A 4O1OA 5AP6A 3D7ZA 3II5A 2H6DA 1NVSA 4NFNA 4LGHA 5J1VA 2HZIA 3SKCA 3MH3A 1G5SA 2NRUA 4AAAA 3FL5A 4RPVA 1SNUA 2J0JA 4DFLA 1ZY4A 3QXPA 3DFAA 3H9OA 3WIKA 3MB6A 5IMXA 4M12A 2PZYA 3DZOA 3QAME 1P4FA 4R5YA 2O5KA 4RVKA 4RQVA 5E8ZA 3SXRA 1NVQA 2P2IA 3H9RA 4OR5A 3WIGA 2XIRA 1REJA 3WZKA 4MWIA 4Z7HA 4WG5A 1GZOA 3KCFA 2GHMA 4ENYA 5TKDA 4I3ZA 3CP9A 4NM5A 2QVSE 2B9JA 3PY1A 3Q52A 5AP4A 4K1BA 5FDXA 4I5MA 4QQCA 3FZPA 3JVRA 3COIA 3LFAA 1KOAA 1H1QA 2FGIA 4KS8A 4HYUA 1XHAA 4QMTA 4I6HA 1WBSA 4DH3A 1URCA 4I93A 4JI9A 4MTAA 2XK3A 4FL2A 1YWVA 2EUFB 4M67A 5D7VA 4AN3A 4EONA 4X7QA 4O38A 3PJ2A 4EH2A 3MDYA 3F5UA 3MJ1A 5AP7A 5DE2A 5A46A 1OIQA 2JITA 4LFIA 3EQPA 5CEPA 2FSTX 5AP3A 1H07A 3OXTA 3UNZA 5DRBA 4O2ZA 4XRJA 5GZ9A 3RK9A 4HVGA 3FZSA 3NYNA 3FC2A 2J2IB 3G6GA 1OPLA 4FSWA 4FICA 2F49A 4MK0A 3OW3A 4EQMA 1GAGA 4CQEA 4EHZA 4AA4A 2HY0A 1YOLA 3PZHA 5C8MA 3R9DA 5IZFA 4FMQA 4JT3A 3ZZEA 4QMYA 5CF8A 3DKOA 4U41A 5DMZA 5KMKA 4UYAA 3A7GA 3DJ6A 5AV3A 5TT7A 4D0XA 3GU4A 4FKOA 4EOJA 4NH1A 2WTDA 1OIYA 5CXHA 4EH7A 5IG1A 4JDHA 4UBAA 2R3IA 4D2VA 4G6NA 3MA3A 5J9ZA 3FMJA 4YZCA 2BTSA 1JSUA 4HCVA 2UW7A 5E8TA 1R39A 1R0PA 2OH4A 3MPAA 5D1JA 3MB7A 3UVPA 2C6EA 3KK9A 5FRIA 5CSPA 1O6KA 3BEGA 3PXKA 5A6NA 2B7AA 2C69A 2XIYA 3CD8A 5A3XA 3FY2A 5JFSA 2RFNA 2VD5A 3PSDA 4L7FA 3RNYA 1PXJA 4FV4A 3I7BA 3JVSA 5EG3A 3QX4A 4K2RA 4KB8A 4IX4A 4NIFB 3AD5A 3EIDA 4C8BA 5ANGA 4EOQA 1CDKA 3ERKA 1JVPP 4ZZMA 3HLLA 2W7XA 3ZO3A 4CLJA 2CN5A 4QYHA 4IB3A 3R00A 4C4HA 1M7QA 3OWKA 3FMLA 5DT4A 4IB5A 2AUHA 1XBCA 3R7OA 4ASDA 4B8MA 4C4JA 4BYIA 3GBZA 3NNVA 4UMQA 4X3FB 5KUPA 4RA5A 3BU6A 2XH5A 2CN8A 3ALNA 4QTBA 3OD6X 1W82A 2VTIA 1GOLA 3HYHA 4XX9A 5HE1A 4DEEA 3PWDA 1YWNA 1ZYJA 4WUNA 2XNPA 3UVQA 2OJIA 1FGKA 2RFSA 2I6LA 3EFKA 2OIBA 3A7HA 5IA2A 5AAEA 4LV5A 2YM8A 4TWOA 4ZTNA 2IZTA 4IANA 3DCVA 2PVYA 2RL5A 1OKYA 3C51A 4JL9A 5D7AA 4AGWA 4YBJA 3IOKA 2J51A 4ASZA 1UNLA 3ZFXA 1KE7A 3GC9A 2WMBA 3W55A 4FTLA 1YXXA 2GU8A 3L8SA 3BLQA 4YJVA 5IKWA 1YRPA 4XCUA 4BC6A 3IGGA 4F64A 5HO7A 4KAOA 3R22A 2DUVA 4BTFA 3KXGA 3ENHA 4H3PA 2XP2A 4YBKA 2GS7A 3D2IA 3R8LA 4BB4A 4EH9A 5A9UA 4DCEA 2R3KA 2C5NA 2O0UA 3LQ5A 1B6CB 4MD7E 1P2AA 4RVLA 4AZEA 4E6QA 4EZ3A 2O64A 3OTVA 3ZXZA 3G33A 3I6WA 2ITWA 5HLNA 2JDOA 3PG1A 4EHGA 3PIXA 4C7TA 3KRWA 4AN9A 4XBUA 1PXMA 3OROA 3VF9A 1WVXA 5T68A 2B9FA 3KN6A 3ZLSA 1ZXEA 3IW4A 3QTRA 4FNXA 2OJJA 3UOHA 4X2FA 4FL3A 3VBTA 2IZRA 2BRNA 2J50A 2VU3A 2UVXA 3BE2A 4ZJJA 3HRBA 5C1QB 2OIDA 4MXYA 3O17A 2W5HA 2CLQA 2YIQA 3OXIA 4I1ZA 4M69B 4ZP5A 2XB7A 4AWIA 2UW6A 2OXXA 2H8HA 4MH7A 4HZSA 4L68A 4AW2A 4H36A 4EC9A 2UZWE 3C0HA 1QPEA 4LV8A 3ZH8A 3LFFA 3V8TA 4U45A 2X2MA 2ZMDA 2YCFA 3A4PA 3OFMA 2F2CB 2F57A 3R7UA 4E6CA 2ZDUA 5CSVA 4M14A 5JMSA 3OZ6A 4FKGA 4H39A 5IU2A 4GU6A 4B6LA 4XOYA 3FMMA 5H8BA 2IW8A 5CU6A 4DFXE 4U6RA 5EH0A 2R0UA 5KHXA 2UZTA 2WIHA 5J79A 3D0EA 4P5QA 2Y4IB 3V5QA 4E4XA 4PMSA 2C6DA 5AR4A 3DY7A 3TN8A 3DDQA 4FTCA 4OTRA 4GFOA 5I3OA 4I23A 4GK2A 4Q5EA 2RGPA 4HGTA 4RLKA 4EK4A 4AT3A 1PXIA 4FZDB 2C1AA 3QHRA 2VTMA 3NR9A 3GU6A 4JAJA 4ALUA 4U44A 3PRIA 4QQJA 2QR7A 4BICA 1L3RE 4DHFA 1E1VA 2R3PA 4U81A 4N70A 1W84A 1PYEA 4QPAA 3IW8A 2Y4PA 3MY1A 2R5TA 4U9AA 4EQCA 3BKBA 2C6TA 1W83A 4XG6A 3F2AA 4IWDA 4QQ5A 4QP4A 5C8NA 4XV1A 2ZB1A 4YJSA 2YAKA 3ANQA 4RC4A 3FZRA 4KRCA 3COHA 3GUBA 4Y95A 2C3LA 2ITPA 3C4ZA 4PDPA 5E8XA 5HCXA 3TT0A 5JN2A 4AACA 4DGNA 1MRUA 3QC9A 3R7GA 5JZNA 5EW8A 2QOQA 2XBAA 3E5AA 3HMIA 2XK7A 4S2ZA 1JKKA 3VRYA 1OECA 2OG8A 4E7WA 3PLSA 1KWPA 1TKIA 3TKHA 2A27A 4TT7A 5HU3A 5F9EA 4FUXA 4BYJA 3NS9A 4QRCA 1I44A 1OUKA 4QMNA 5CANA 4FTOA 4UY9A 3R2YA 3ZXTA 4F1OA 4U43A 1PKDA 4GSBA 3UZPA 3UTOA 4CFVA 2YABA 5K0XA 3QD2B 4U80A 1Q8YA 3LCOA 5CTPA 5BMMA 3VUDA 2PL0A 3QYWA 2RFDA 3BYVA 2ZYBA 3QQGA 4E1ZA 4C58A 4EC8A 5H9BA 2YM7A 4X3FC 3IONA 3TV6A 4M97A 4CKIA 4F0FA 2ETKA 5KMIA 2CGXA 3RM6A 3DBDA 2BROA 2HYYA 3P1AA 2C5XA 3P79A 3R04A 4Y5HA 4YJQA 5CAVA 2UZUE 4FG9A 5AEPA 5IA0A 4QMUA 3SDJA 4DEGA 5CZHA 2X6DA 5F1ZA 5HE2A 4F65A 4V0GA 2YCQA 2H34A 2OFVA 4FKJA 3VUGA 4BZOA 3PY0A 1JPAA 2E9UA 3RZBA 2R7BA 1PHKA 4LMNA 4BDFA 1ZMUA 4B9DA 4E4NA 2OGVA 3H0YA 3AQVA 1OPJA 2WAJA 4IJPA 3PXQA 1ZYLA 3AC8A 5DI1A 4Y8DA 2VV9A 3AGMA 4OTPA 3P08A 3HUBA 3QC4A 5CYIA 3VQUA 4BWKA 4RVTA 5CS6A 3PPZA 3AC2A 4W4XA 5D12A 3E8NA 4GT4A 3GC0A 4TYJA 2W1EA 4HYSA 2ETMA 2PZ5A 4F6WA 5KZIA 2VO6A 3E3PA 2XK4A 3EYGA 4QMVA 4MXCA 3PIYA 2VO3A 5CQWA 3R1QA 4D0WA 2OSCA 4NKAA 3G51A 3TI1A 4O2PA 3EKKA 2WTKC 3KRRA 3H3CA 2I0YA 2UZLA 3B8RA 1LEWA 2UW0A 3NUXA 3Q3BA 4QMZA 4IAZA 5HTCA 2QG5A 3L9MA 4GT3A 4L9IA 3E63A 2W4JA 4OW8A 3F61A 3KC3A 5F20A 5FXSA 4RJ5A 3UVRA 4DG0E 3D7TA 3CBLA 2ZOQA 3I5ZA 5LWNA 2Z7RA 3F5XA 2JDVA 4Q9SA 5KHWA 3ZZWA 4RMZA 5J7HA 2WMXA 4L6QA 5A54A 3HP2A 3TWJA 1F3MC 1GIHA 3KVWA 4JG6A 4RWKA 1O6LA 2KULA 5K3YA 3QCSA 5FBNC 4C35A 2SRCA 3QF9A 4PX6A 1U54A 2FB8A 4NCTC 4D2TA 5M4FA 3OY1A 2Y4IC 3PRFA 2QHMA 4IC7A 5K5NA 4BTKA 2JDSA 1KV1A 2XIKA 3EB0A 3U8WA 1YOJA 2C4GA 3FHRA 3MPMA 5D41A 4QQTA 4CVAA 5IH6A 1APME 1NVRA 3PYYA 4UXQA 3A61A 2HAKA 3D2KA 1ZOGA 4X21A 1JAMA 3FBVA 4S34A 4F7LA 4YO4A 1M2RA 2HZ4A 5CQUA 2OH0E 5L2WA 5IPJA 4JBOA 4L00A 4O96A 3FQEA 3CS9A 3IQ7A 1Q8UA 4ACGA 1H24A 2O8YA 4KKGA 2Y6OA 1M14A 4RC3A 3PXYA 3TNPC 2OF2A 2CGVA 3OBJA 2WMSA 5DGZA 2PMLX 4CFXA 5FTOA 3LCTA 4DFZE 3ZCLA 4S33A 2XNOA 2Z7SA 3QKMA 4FYOA 3U4UA 5M44A 5C01A 1Y91A 3M11A 3UMXA 2OICA 4CEGA 3F3VA 1TQPA 1YXUA 4UMUA 1YQJA 3RI1A 3NW5A 4F63A 5F95A 2UZEA 2YCRA 5EFQA 1WCCA 3QCQA 3Q2MA 4O0TA 3HUCA 3VUKA 4B8LA 3GQIA 2OW3A 3FWQA 1WVWA 3FKNA 3HV6A 4FV9A 2WIPA 4A9YA 4F7JA 1WBWA 2BIYA 3UMWA 3H9FA 3NYVA 3EFJA 3KN5A 1MRYA 2J0LA 3PY3A 2CCHA 5FLFA 4MF1A 4FV5A 2YIWA 5A4CA 1YVJA 4U3ZA 4D2PA 4TN6A 2PVLA 3RALA 3ZRMA 2PWLA 1RW8A 4YO6A 4RFYA 1YDTE 4USFA 3RHKA 2XM9A 3KXNA 3UDBA 3WF6A 4A7CA 2YLFA 3OHTA 2WGJA 2LAVA 3EZVA 1RQQA 3F88A 1UA2A 5KMOA 2WFYA 3LFNA 4IM2A 4OBOA 3EN9A 4TKSA 4WOVA 4Q2AA 3VAPA 3DK3A 3DK7A 4MQ2A 1SMHA 4WHZA 4MHAA 1SNXA 2QLQA 4ANOA 2J4ZA 2J6MA 4OTHA 4U8ZA 5FM2A 5FQDC 3BU3A 4I4FA 4TZRA 2VX3A 1QPJA 4FODA 5A4LA 4J97A 4I6FA 3W16A 3UYTA 4EOIA 4Y83A 2W4OA 4NZWB 3G9NA 3GCQA 3IS5A 5M4UA 2I40A 3DDPA 3PP0A 4BI1A 1OIUA 2PVRA 4JIKA 4YNOA 3UGCA 2GCDA 2IW9A 3UP7A 4BDAA 4V05A 3RHXA 1EH4A 3LFBA 4OBQA 2CPKE 2OZAA 3MY5A 3NAYA 4K8AA 4M0ZA 2PE1A 4IACA 4G5JA 4D4SA 5AUVA 2GMXA 4BCHA 1J1BA 2OBJA 5DA3A 3KQ7A 1XH7A 3SD0A 2VGPA 1OM1A 2X7GA 1LR4A 4NM7A 5FEEA 3VS7A 4BKJA 1ZWSA 5L3AA 3A7JA 4RIOA 1Q3WA 1XH5A 3R6XA 1SM2A 2J0KA 3OCBA 2W5BA 4EOMA 5A14A 3CJFA 3F7WA 1FGIA 3F3ZA 2V5QA 3Q5ZA 4JS8A 2HWPA 2ITUA 3BI6A 5DT3A 4USEA 2J0IA 2EU9A 4QMOA 2JBPA 5E8WA 5M4IA 4NTSA 3ZSGA 4JNWA 3EHAA 2VTPA 4LUDA 4DEDA 1OL2A 3P7BA 2QNJA 4FIEA 4I6QA 4ZTLA 1W0XC 3NCGA 1BI8A 2B54A 3OW4A 2GNJA 3PUPA 5EM5A 4IWOA 1QCFA 2HWOA 3LFSA 2W9FB 1W98A 4NWMA 4W8EA 3DXNA 3TCPA 4I0TA 4UN0C 4IVBA 3MFTA 3IGOA 3KMWA 5TOZA 1MRVA 3T3VA 3OG7A 3GENA 4QYEA 5AJQA 1U46A 4LMUA 3BHTA 3SQQA 1Q8ZA 4IBMA 3HDMA 3PA3A 3QA8A 5HNGA 3G5DA 4KKHA 5FXRA 2OWBA 1BL7A 3LIJA 4KKEA 4TNBA 2Y8OA 4PMPA 4ZZNA 2BZJA 5LWMA 1J91A 2YDIA 4UWYA 3ROCA 2ITXA 4EZ5A 3NX8A 2UW8A 4RX8A 2UZNA 3AT4A 3BHUA 3DNDA 3GEQA 1SVGA 4V0GB 3VW6A 4C4GA 3FKLA 2QOHA 3VS3A 4D2WA 1QPDA 4CFMA 3UIXA 4C2VA 5E90A 4EKKA 4BL1A 4USDA 3TJCA 4F7NA 3GOPA 4KIOA 5HIBA 5HO8A 3BV3A 2YM3A 1M52A 2OO8X 4UB7A 5EW9A 5F94A 3O7LD 5CEMA 5EHOA 1H08A 5I9UA 4BBFA 2Z7LA 5IUHA 4D9UA 5ETIA 3KCKA 4MBIA 4QMPA 4IB1A 4XHKB 4ACMA 4BZNA 4EOPA 1JBPE 1VZOA 3F66A 3HP5A 3VBXA 4ZSJA 4AZWA 2XIXA 4GH2A 4EOOA 2BDFA 3M1SA 4GIIA 5GZAA 3UIMA 1GZKA 4MYGA 1K2PA 3ZFMA 4AZSA 4OUCA 4UZDA 1OPKA 5CSWA 2E2BA 3F3WA 1ZYSA 4FV2A 2WD1A 3SW4A 1XJDA 3VUHA 1H1SA 2YEXA 3GGFA 5DH3A 4C34A 4DEIA 3QTIA 4YNEA 2WTJA 3KMUA 3D94A 3MJ2A 1YWRA 2J5FA 3BX5A 3KB7A 4FTJA 2G15A 4O0UA 1M2PA 4ITIA 3PA4A 5M56A 3FSKA 5HTIA 3GFWA 3FC1X 2VO0A 3DT1A 3FI2A 4FGBA 5AR8A 4ZLZA 4NCTA 5KMJA 1S9JA 3EN6A 4R5SA 5AR2A 4GYIA 4FSTA 3VS1A 5K5XA 2JIVA 2CLXA 3LFQA 4YTCA 2CGWA 4RG0A 1Y8YA 3D7TB 4BHNA 5J1WA 3POOA 4PTGA 2XRWA 4ZTSA 2DWBA 3FLYA 4CYIA 2C6LA 2J7TA 2XKCA 5E8VA 3PP1A 4X2NA 2VWIA 4E6DA 4A9UA 5ETFA 4II5A 1YDRE 3EN4A 3SXFA 4JXFA 5EDQA 2A1AB 4PF4A 2JFMA 2F2UA 1ZLTA 4QPSA 1U54B 2W4KA 4GL9A 4UMTA 4FKVA 3ZBXA 2OK1A 3ZSHA 4DGLC 3KRJA 3V6RA 2X8EA 3BBWA 4X2JA 3Q6WA 3P23A 1BYGA 5JGBA 3VQHA 3ZU7A 2EXEA 4YURA 2W1FA 3NPCA 3T3UA 3L8PA 4NW5A 2V55A 4DH5A 3QRJA 4RC2A 4E20A 2QOFA 3EH9A 1FINA 2VX1A 3HV7A 4PPBA 4E4LA 2OU7A 3PVWA 3V04A 4CZUA 3BYUA 3FMNA 2W17A 3TNQB 1R1WA 3UNJA 4BCOA 2CHLA 3TKUA 2X39A 3COMA 3UJGA 3FJQE 4S31A 4FBXA 3LJ0A 2EB3A 4O6EA 1IR3A 3MVHA 1ZOEA 1UU7A 5AV2A 1FQ1B 1PMUA 5FWKK 3E8EA 2GPHA 1V0OA 3DBQA 4FKSA 2UUEA 4LRJA 5LJJA 3SRVA 1W7HA 2NP8A 2UW9A 2JC6A 3MVLA 4IX6A 5AAFA 3F7ZA 4XOZA 4IZYA 4CXAA 4FNZA 4EH6A 3GVUA 2XKEA 3I6UA 5E91A 3K2LA 4KA3A 4M0YA 5DVRA 3PFQA 2JIIA 1ERKA 5IA4A 3PE2A 2UW4A 4FYNA 4YZDA 4AW5A 3AGLA 2XJ1A 2GS2A 2JLDA 5FGKA 3EZRA 4JX7A 4ZEGA 4ALWA 2GS6A 1YI3A 3VBYA 3GCUA 5JGDA 3SLSA 3K3IA 3QUDA 4XS2A 3JYAA 4XNEA 4OTDA 4AFEA 3EQBA 2OJ9A 2XVDA 5BYYA 2WOTA 2XS0A 3LLTA 5JFXA 3QD0A 2VZ6A 4XG3A 5HKMA 3R1YA 4EH8A 5JQ5A 1PYXA 2Z60A 2ZM1A 3KGAA 2PZIA 3BHHA 5M57A 4BCQA 4OTFA 3ZUVA 1P5EA 3B2WA 2W1IA 5HLPA 3A8XA 4GJ2A 4PNKA 3P4KA 3QQJA 2ZMCA 3C0IA 5J5TA 5CI7A 5JFVA 3DKGA 4CRLA 3CTHA 4FX3A 4JIAA 4GK4A 5J87A 2YIYA 3FI4A 4E5BA 4F6SA 4FZ7A 4RVMA 5IUGA 2JKOA 3E64A 3QD4A 4NEUA 3R21A 4CZYB 5AA9A 5E1EA 5KO1A 4FTMA 3HRCA 5ACKA 4QMWA 3DJ7A 4QTEA 4MD9E 5B2LA 4QTCA 5CNOA 3W10A 2ITTA 3EQDA 3BZ3A 1B39A 4FVQA 5AUZA 3V5TA 4D5HA 2XF0A 3QU0A 2UVYA 3UC4A 1BX6A 4F0GA 4H3BA 2WTWA 4F1MA 2CCIA 4ZTQA 4D1ZA 4AZTA 4ZXTA 3U87A 5I9XA 2OZAB 3VO3A 2C1BA 2PY3A 3LM0A 2JEDA 3FAAA 3RAIA 4BVUA 2OFUA 4RJ6A 3ZLXA 4X6RA 4NM0A 4BDJA 3DAEA 3MIYA 4YJOA 3M2WA 1Q41A 1Q8TA 2HW6A 4YC6A 5AP5A 4NJ3A 5HD4A 3QCYA 4AGDA 4N4SA 1UNGA 4C3RA 4RX5A 3OT8A 3TZMA 2OJFE 5HNBA 3WYXA 4C36A 4IC8A 3RMFA 1YXVA 3V01A 2UVZA 3AMBA 4AA5A 3QX2A 3W2OA 1HCLA 4R1YA 4Z16A 5J9YA 5HQ0A 4F9AA 3FHIA 3DBFA 4O91A 2UV2A 5KKRC 1KE9A 4FKUA 2WPAA 4ITHA 4MNFA 3W8LA 3MA6A 2C5OA 5T6KA 4G3DA 4EWQA 5BMSA 4FTIA 3QRIA 5KX8A 1QMZA 2C6MA 2PZPA 4BI2A 5CU4A 5HLWA 4GT5A 3WILA 4F08A 2ITOA 4IXPA 1OITA 4KBKA 5ANOA 4QYGA 2VTOA 5CY3A 3Q5IA 4C4IA 4FKTA 2EXCX 3OT3A 3A2CA 4NT4A 3UOLA 4AN2A 3AXWA 4TPTA 4KIQA 3D15A 4CQGA 2XEZA 4H58A 4U0IA 4FVRA 4JJRA 3F5PA 3QA0A 4YPDA 1MQBA 1H8FA 2GTNA 1WBNA 2Z7QA 2R3JA 3KA0A 4IZ7A 4GRBA 4F0IA 3U9NA 2RG5A 3DAKA 4G9CA 4GK3A 4PP9A 2G01A 1JWHA 2YFXA 3QRUA 4ANLA 4BCMA 3FZ1A 5HEZA 2F7XE 1YHSA 2UZDA 3KULA 2ZV7A 5CU2A 4IMYA 3K3JA 3OY3A 3PG3A 4D4RA 5HTBA 2YM5A 1OB3A 2WTKB 1R78A 4KBCA 3OWLA 4G6LA 4WBBB 4XG8A 5CU3A 4CD0A 1DI8A 5HVKA 1NY3A 2CJMA 3A62A 4CFUA 2C3JA 4YJTA 3VHEA 3W18A 4TYEA 5CEIA 4FTKA 3SA0A 5BVEA 1ZMVA 4L53A 3UG2A 4D28A 4D55A 2ERKA 5JRSA 3VUIA 4XP3A 3PVGA 1Y8GA 4CFNA 1URWA 3R8VA 2FO0A 3ULIA 3DA6A 4FI1A 4MEDA 2R3OA 4QMMA 1Y6AA 4X3JA 4ZS0A 5L2TA 1Z5MA 1PF8A 3EQCA 3NEWA 3CGFA 4ZJIA 5HE3A 2WQBA 4QTDA 5F4NA 5HBHA 3LCKA 1H1PA 1X8BA 2IZUA 5FTQA 3FXXA 2BRGA 5DEYA 3GCVA 3IECA 3CPCA 4L01A 3MGYA 5DRDA 1BL6A 1FMKA 3ZDUA 1OUYA 4DITA 4AXAA 2VTHA 2BAQA 3GQLA 3GU5A 1YXSA 2BTRA 5JFWA 4O21A 4YLJA 3F82A 2R4BA 3RAHA 3VNTA 4AG8A 4EOKA 2UW5A 2CKEA 4O0XA 3RCJA 4Y5QA 3EL7A 4IJ9A 4ENXA 3MS9A 1OVEA 3WBLA 2F7EE 2XUUA 1P14A 4TTHB 3RP9A 5B2MA 2X7FA 1FMOE 1V1KA 3Q6UA 2QU6A 4B0GA 4DFNA 4RX9A 3ACKA 4FC0A 4ZSLA 2VTLA 4TWCA 2YACA 4IQ6A 4JLCA 5FEQA 4OBPA 3RM7A 2GDOA 4RJ7A 3OP5A 4BGQA 2VTJA 4CMOA 3TV7A 4OAUC 4FKIA 4MXXA 1PMVA 3COKA 3ZBFA 4GUEA 1Y57A 4YMJA 2XNNA 3TZ8A 3AC4A 3PJ1A 3H10A 3ROYA 3FMEA 4P4CA 3QQHA 4AGCA 5L2QA 3QALE 3I81A 4Z3VA 3C13A 4DN5A 3NIZA 1R0EA 2X4ZA 3V5LA 3D4QA 1XBBA 5H2UA 3VUTA 5I9VA 4FKRA 4W4WA 2X81A 3I60A 2WMUA 4KIKA 4EQUA 2YZAA 4BCGA 5HNIX 4MKCA 1WBPA 4HYIA 3MBLA 2I0VA 5CU0A 4QD6A 4JOAA 4I22A 3PE1A 2VWZA 2B4SB 3FZOA 5FBOA 3V5PA 3ZONA 5A4TA 5HBJA 3QL8A 2JBOA 3TUDA 4D58A 4QO9A 3TUCA 3SOCA 3KK8A 2JFLA 5AM6A 1Q5KA 1LP4A 2DS1A 3GU7A 3ZUUA 3SRVB 2WMVA 3NW7A 4UALA 4XUFA 4PL5A 2XK8A 2WTCA 1ATPE 4TWNA 5CWZA 5M55A 1WZYA 3S00A 2NPQA 3DTCA 5L6WL 4YSJA 2GSFA 2BCJA 3OCGA 4LG4A 3RPVA 2XRUA 4FV1A 2P4IA 4ASXA 1WBOA 3ZLYA 2WEIA 1O9UA 3E7VA 4WNKA 4YZNA 4X0MA 4BCFA 2WU6A 3PJCA 4APPA 2VAGA 3R63A 2WMTA 3E92A 2WMQA 3SVVA 2YERA 3DKCA 4K77A 2PE0A 3AC5A 5AP2A 2W1HA 4R3CA 3C4FA 3FI3A 4FIJA 4CTCA 3NZ0A 3PJ8A 3CR0A 3D5WA 3LMGA 3ZTXA 5AX3A 3HA8A 4K33A 4BZDA 5HCZA 2J0MB 3BELA 3OWJA 4I0RA 4RWJA 5L8LA 2FA2A 3HDNA 1W8CA 2R3HA 3HV5A 3ZO2A 3SW7A 3WF5A 1WBVA 4KABA 3P5KA 4P5ZA 3O8PA 3LCSA 3DZQA 2W05A 1E1XA 4WA9A 4W4YA 2OXDA 4JRVA 2XK9A 3RAWA 4P7EA 4OTQA 3ALOA 5DEWA 2AC5A 2CDZA 3E62A 4BCPA 1Q24A 2VTAA 5EM7A 4DYMA 3FYJX 3IDCA 4RA4A 2IVSA 2BZHB 2PHKA 2X4FA 3IO7A 2GNFA 1K3AA 4O0SA 4WNMA 4IM3A 4IDVA 2X8DA 3UOKA 1HOWA 3CXWA 3FLWA 4C2WA 4EK5A 3DAJA 4BIDA 3VUMA 2ITZA 4K0YA 2I1MA 4ERKA 2C6OA 4YZBA 5IDNA 3AMAA 4IWPA 3RWQA 3Q4TA 4DBNA 5JKGA 4GJ3A 1O6YA 5AA8A 3NCZA 4EI4A 2GNHA 1CTPE 4FSQA 4FUYA 3CTQA 4MBJA 3S95A 2X2KA 3V51A 3EYHA 3NSZA 5DOSA 3TKIA 3W33A 3QWJA 4DFYA 3H0ZA 4Q5HA 4JVGA 4MF0A 2YDKA 3D5XA 2G2HA 3KXXA 4C61A 3UZTA 4W4VA 2W1ZA 5CF6A 3FZTA 1V0BA 1GZ8A 3DJ5A 4RIYA 4DGMA 4PRJA 1REKA 4GVAA 4O0YA 3T9TA 4BDKA 4EEVA 2O2UA 3R7VA 1GJOA 3E87A 1ZOHA 2R64A 3HMOA 3Q04A 4F99A 3ZO4A 2VWXA 3ZYAA 4ANMA 3S3IA 2YIRA 3R73A 3HX4A 3ZC5A 3FSFA 4MD8E 4JQEA 3VBVA 3MWUA 4HVSA 5EW3A 3R1SA 3WE8A 2REIA 4UX9A 2BHEA 4R7HA 4FV0A 1ZRZA 4GYGA 4QP2A 2YIXA 1SZMA 4D4VA 2ERZE 2BAKA 4PP7A 2R3NA 1CKJA 3TEIA 5GJGA 2Z2WA 5DWRA 4YZMA 4CKJA 3QTQA 4LOOA 4IFCA 5DBXA 1PXKA 5AWMA 4EWHA 5LCKA 5FD2A 5FP6A 2HELA 4P90A 4CCUA 5ANEA 3RNIA 3D9VA 3HL7A 3I0QA 4MAOA 3O23A 5IEVA 5AR5A 3O0GA 4C62A 2BMCA 3K5VA 3NUPA 4ANSA 3UQCA 2W1GA 3NAXA 4UMRA 3MI9A 1Y6BA 4G3FA 3QUPA 4IM0A 4NW6A 3WZUA 4KIPA 4GU9A 3NNUA 3KULB 5AADA 4HGLA 4KRDA 2A4LA 3FMKA 3LFCA 2CGUA 3Q4CA 4FKQA 4FSNA 4GS6A 4YZ9A 4L52A 3FYKX 5K0KA 5C26A 4U5JA 4C3PA 5L6OA 3W2RA 4G3EA 1NA7A 1GNGA 3A60A 1Q99A 1Q4LA 3DQXA 4CNHA 4G31A 4FSMA 3G9LX 4J98A 3MPTA 5K4IA 4WT6A 3EOCA 4G2FA 4D4YA 2ZM4A 3TIYA 4EOSA 2DYLA 4L42A 4EORA 4AFJA 4NM3A 5CI6A 4PUZA 4QMLA 4U97A 2PVNA 4ONAA 3HECA 3CLYA 4FIHA 4FTAA 5LVLA 5TE0A 3R8MA 4AS0A 4BTMA 3EWHA 4MWHA 4RT7A 5CZIA 1PW2A 4EK3A 2WTVA 1ZYCA 3ITZA 4YJNA 4PPCA 1HCKA 2OJGA 4HPTE 4IDTA 1Q61A 3WE4A 4ZTMA 4UMPA 2VTSA 4B7TA 3IOPA 4WRGA 5AIKA 3QQUA 4QP8A 2QU5A 3AG9A 5DIAA 3PPJA 3MW1A 4KNBA 2E9VA 4FTRA 3FXZA 4M84A 2Q0BA 2QO2A 4BRXA 2Y6MA 5M4CA 2IJMA 4AOJA 3VF8A 5HI2A 4PDSA 5C9CA 1ZY5A 1DS5A 4EYJA 4WKQA 3RZFA 3R28A 4QP6A 1XQZA 2QOKA 2ZAZA 1OMWA 3BHYA 3ORKA 3R30A 2XMYA 2XNGA 4ZTRA 2ITQA 2F4JA 5LARA 4HVHA 1JKTA 4O6LA 4ZSEA 3WOWA 4I4EA 1R3CA 4ZY5A 4GIHA 2E9PA 3ODYX 5A6OA 1CSNA 2RG6A 2WHBA 4D5KA 1WAKA 2G2IA 3OUKA 3PXFA 4L3LA 5DR9A 3V5JA 2HXQA 3PXRA 3Q60A 4YHFA 3JXWA 3POZA 4G17A 5DR6A 4BI0A 4BDGA 4AX8A 3F2NA 4XV2A 4U42A 1NXKA 4E73A 5EHYA 3UE4A 3OS3A 5EM6A 5FDPA 4GV1A 3HKOA 4AQCA 4AW0A 2O65A 4E3CA 2WEVA 3W1FA 4EUUA 5A4QA 3T8OA 5J5SA 3U4WA 2IW6A 5GJFA 2W06A 4FV6A 4HYHA 4W9WA 2BIKB 2PSQA 2XKFA 3R2BA 3RINA 3RVGA 3VS5A 3ZHPC 3CY3A 2VO7A 2C6IA 5HIDA 2V22A 3SAYA 4HW7A 4BIBA 4KIKB 4ZAUA 4ZY4A 4XYFA 4I20A 3I79A 3QGYA 2BR1A 4S32A 4TYHA 4C33A 1K9AA 1IG1A 2YCSA 4FSZA 4KSQA 5J7BA 3KXMA 2QR8A 1Q8WA 3IDBA 4FTTA 2C5VA 4TYIA 3UC3A 1XWSA 1TVOA 2R9SA 3MY0A 2VTQA 3R02A 4PWNA 4I5CA 4WIHA 4Y85A 3W2SA 3AD4A 4ZOGA 3TNHA 2KTYA 2XM8A 3KY2A 3WARA 5ETCA 2F7ZE 4A4LA 2ESMA 4BDCA 4RLLA 4XMOA 3V3VA 5IEXA 5BVWA 4QP7A 4AGUA 2XCHA 4NK9A 2XZSA 5EM8A 1OL6A 3BGZA 3SV0A 3SXSA 4DINA 3MH0A 2WB8A 4IVCA 1H1WA 4F7SA 1MUOA 5C03A 3FPQA 1SVHA 1MP8A 3Q53A 1WVYA 2R3MA 2XNEA 3WF7A 1U5QA 4GFMA 2Y9QA 5DFPA 3FXWA 3UIUA 4XLIA 5BVFA 3FMDA 4AA0A 3TJDA 2FH9A 1VJYA 2Z8CA 4QMXA 3FDNA 2R0IA 4GUBA 2RSVA 3BYMA 2BDJA 4NKSA 4OT5A 2P2HA 3DNEA 5J8IA 2YJRA 1PJKA 4A4XA 5IF1A 4ZLYA 3QD3A 3CEKA 4RFZA 3UO6A 5JZJA 3GCSA 2NO3A 2XBJA 3JUHA 4DGGA 3LQ8A 5LVPA 3BRBA 5CLPA 5GHVA 1KE8A 2GTMA 2J5EA 3MV5A 4N6ZA 4QNAA 4XRLA 5EOBA 3DB6A 3O51A 4ZTHA 4ITJA 1M2QA 3P9JA 4HCTA 5BYZA 4FNYA 4ANQA 1E9HA 4GG5A 4BDHA 4BDDA 5CX9A 3F3UA 2ONLC 1KE6A 2Q0NA 3C4XA 3NUUA 5AUUA 4IAKA 3BWFA 4DC2A 2E9OA 4ZSGA 3U6IA 3REPA 4MX9A 4FKWA 5JT2A 2PMNX 3BGPA 3FY0A 2YAAA 4FZ6A 2NRYA 5E8UA 4G1WA 4LL5A 5AV4A 1XH4A 3EQGA 5CNNA 3QCXA 4L3JA 4I5HA 1J3HA 2P3GX 3DTWA 5TF9A 2AC3A 5FEDA 3RAKA 4ACDA 5B7VA 3ZO1A 5K4JA 3IKAA 3A7FA 5L4QA 5L2IA 2G2FA 2V0DA 3LFEA 3NUYA 3UYSA 4CLIA 1T46A 2C0OA 2W0JA 2X6EA 4JG8A 3DBCA 2ITYA 3ETAA 5E1SA 3VULA 4LI5A 1UU8A 5TR6A 5CAOA 2R3QA 2ZV9A 4CSVA 3VIDA 3ZEPA 4EBWA 3W2PA 4CMTA 3AT3A 4AOIA 4AOTA 3EN5A 4RZWA 5HZNA 3NDMA 4FKPA 4PTEA 3PVUA 3R7IA 2X2LA 4FOBA 4APCA 1P4OA 4IH8A 4PQNA 4HJOA 4TY1A 1SYKA 2BHHA 3CE3A 3M42A 3LJ2A 4HGSA 3Q9YA 4FG7A 2W99B 4ZK5A 5HG8A 4JDJA 5B0XA 2JGZA 3BEAA 2VRXA 3ORNA 3R7EA 4RIYB 1DAWA 2QKWB 1UU9A 4V04A 3VS4A 2C3KA 2R3RA 1G3NA 2IVUA 3UP2A 2PVKA 4FF8A 4CKRA 4ZY6A 4M8TA 4JR3A 3QGWA 2WQOA 3UO4A 3OBGA 2C5YA 3MYGA 5GJDA 4CMUA 2VX0A 4FVPA 4FIFA 4WG4A 4P2KA 3HEGA 3VBWA 3C4EA 3VVHA 5EYDA 5LQFA 3CQEA 3D5VA 1TQMA 2XKDA 3Q4ZA 2CSNA 5BNJA 4J71A 2YJSA 3OUNB 5HESA 5EYKA 3KRLA 3OOGA 2WQNA 4GW8A 5IA1A 3LAUA 4BBEA 4RIWA 3I5NA 4Y72A 1VYWA 3VJNA 2VTNA 4GFGA 4AF3A 5M53A 4FV8A 2FSOX 5FXQA 3PIZA 5J95A 1RE8A 3S1HA 4JX3A 3ANRA 3CIKA 2B1PA 3AMYA 4J53A 3ZRLA 4Z55A 3RPOA 3ORPA 4C38A 4WNPA 4F9BA 1H4LA 4JDIA 3G2FA 5I4NA 4TW9A 3BIZA 3DFCB 3NNWA 3ORXA 4DAWA 4A9TA 3KXZA 4YJRA 4RZVA 3WF8A 2QLUA 4ASEA 4C4EA 4AT4A 3GNIB 3LZBA 3WZJA 3LCDA 3GB2A 3Q32A 1AGWA 5D11A 3C1XA 4ZJVA 5EOLA 4PMTA 1VYZA 2GNIA 2V7OA 4O22A 4MQ1A 3DKFA 3PSBA 4O1PA 4Y46A 3R8UA 4BDIA 3QLFA 2WNTA 4XG7A 4YJUA 4R8QA 3F5GA 4PL4A 3SX9A 2LGCA 2P55A 1UU3A 3E8DA 2VNWA 4EKLA 4E6AA 4KBAA 5EKOA 4Q9ZA 3MVJA 2X0GA 4I94A 5AR7A 3SOAA 4AZFA 4O0WA 3TTIA 4BCKA 5I9ZA 3ET7A 2RIOA 1ZARA 2VWYA 3L9NA 3FV8A 4QMQA 3U51A 4BTJA 3G90X 3QWKA 3ZMMA 5C8KA 1S9IA 2WKMA 3LE6A 4L45A 3PVBA 3BWJA 4ACCA 3RPSA 2GFSA 2C47A 3MH1A 3D5UA 3TV4A 1JLUE 4EHEA 1BKXA 1M7NA 5HD7A 3TXOA 2RFEA 2WQMA 4TWPA 3P0MA 4Y73A 4OTWA 5I0BA 3O7LB 1H27A 2GNGA 2JAMA 4IAIA 3QYZA 1A06A 5HO6A 4XP2A 1ZZ2A 3U6HA 2XJ2A 3OVVA 1GZNA 3DBEA 3EJ1A 1JNKA 3EQFA 2BZIB 4GVJA 3VWAA 1F5QA 3EQRA 1TQIA 3H4JA 3DS6A 3QKKA 4YTHA 3LXLA 4KSPA 4F6UA 1PKGA 3DOGA 3Q9ZA 2BAJA 4ANNA 4IX5A 2H9VA 3BCEA 4KWPA 3LXKA 3NWWA 4JDKA 2QOIA 1JSTA 3GOKA 4FIIA 3IPHA 4OTIA 5EYCA 4FTUA 4AE6A 2UZOA 3H30A 4F70A 1IEPA 4H1MA 3FLSA 2X9EA 3OOMA 1H1RA 2H96A 4UWCA 4WUAA 4D2RA 4XLVA 4J7BA 2OIQA 5I9WA 4LQMA 5CF4A 2ITVA 4LGGA 2WMAA 4G34A 4N0SA 1KV2A 4BF2A 4FR4A 4G3GA 4FTNA 2JKMA 1SVEA 4J8MA 4FT0A 1M17A 5FG8A 4TYHB 4WG3A 4E93A 4QP1A 4WSYA 3OF0A 4I41A
chains in the Genus database with same CATH superfamily
1CKIA 2WXVA 2QKRA 2R3GA 2YM4A 4BHZA 3R8ZA 3ENMA 3BQRA 4X2GA 4QTAA 4F1TA 4M66A 3QTXA 3LXNA 2BFYA 1KE5A 5LVMA 1LPUA 1YHVA 4OTGA 4FOCA 4RJ3A 2JIUA 4TXCA 4F4PA 3O96A 4FSUA 1JOWB 4IADA 2R2PA 4F09A 3QTZA 1XH6A 2IVTA 4ARKA 4KS7A 4CFFA 2ZJWA 3CJGA 4IIRA 4MNEA 5CVHA 2YDJA 5CT0A 2ONLA 3FUPA 3I0OA 4C0TA 1CMKE 5HU9A 3C7QA 4XG2A 5KCVA 2BUJA 5L2SA 3L8XA 3R1NA 5CALA 3BGQA 3C4CA 3CQWA 1ZYDA 5ITAA 2B9IA 4KINA 1OI9A 4FV3A 2XK6A 2GHLA 1IRKA 3MH2A 2VWVA 2B9HA 4I21A 2UZVA 4IAYA 3UQFA 3ZRKA 1YKRA 2F9GA 2BFXA 3KF7A 3FPMA 3GP0A 3RPRA 3UIBA 2IVVA 3HVCA 5CASA 3CY2A 4D1SA 2FSMX 5IH5A 4LL0A 3U9CA 3GU8A 2JDTA 4S30A 1CM8A 3UNKA 1GIIA 5AUWA 4YTFA 4FNWA 4LRMA 2OKRA 4UZHA 5LCJA 1H26A 3UODA 3EKNA 4YTIA 2R3FA 4M7IA 4BN1A 4BKZA 1XH9A 4MCVA 5DPVA 3OWPA 3EFWA 2Y0AA 3ACJA 5JH6A 4IWQA 1AD5A 4AUAA 4E5AX 4CCBA 5BX0A 1JQHA 3NW6A 4PMMA 5AMNA 2C0TA 1BI7A 4PL3A 2Y7JA 4GG7A 5BUJA 2XYNA 2PE2A 3FLZA 4QT1A 4D2SA 3ORTA 3K54A 3OXZA 4QP9A 3RPYA 3FQSA 3ZUTA 1OIRA 2WQEA 4BGHA 1IASA 4G5PA 3HZTA 5AP1A 3BPRA 4G9RA 4J52A 4LOQA 5AUTA 4NUSA 5LMAA 1AQ1A 2VTTA 3QRTA 4ALVA 5EK7A 5HG7A 4U79A 4EH3A 3KEXA 5E92A 4FK6A 3OTUA 4JAIA 4FSYA 5CAPA 4QPMA 3TTJA 3F3TA 4EHVA 2FYSA 3RKBA 4XEYA 3G0FA 5LMKC 2QODA 4XJ0A 3THBA 4AU8A 4BGGA 2WOUA 2JD5A 5HVYA 4D9TA 3BLHA 4XG4A 3CKWA 5FM3A 4XG9A 3DU8A 4FG8A 3NGAA 4CFWA 1UNHA 3FQHA 2HCKA 1PMEA 1V0PA 3CPBA 4R7IA 3CC6A 5E7RA 2CMWA 2WO6A 4BCNA 3RK7A 5HOAA 1H28A 1U4DA 4EZ7A 2WELA 3QZFA 5IEYA 3KVXA 2V7AA 5ACBC 3NYOA 4HVIA 5CEKA 1Q62A 2PUUA 2PVMA 3GT8A 3NNXA 4JQ8A 4CYJA 3QBNA 2QC6A 1VEBA 1OL1A 4FA2A 5CAUA 1OL5A 4J95A 3SC1A 3K5UA 4L67A 3DK6A 4WD5A 4RGJA 2IWIA 4XH6A 3B2TA 5G6VA 2GQGA 4EH5A 5HX6A 4YHJA 3GC7A 3ORZA 1YW2A 5AM7A 5KMNA 2XYUA 4RIWB 3BHVA 2RF9A 4C3FA 3TACA 3DB8A 3Q9XA 4X6QC 4DG3E 4K9YA 1TZDA 1XR1A 4AZVA 4ZZOA 5I5ZA 4RX7A 1WMKA 2W9ZB 4NJDA 2P0CA 3WF9A 4UXLA 4BIEA 4RIXA 4OGRA 3VRZA 1FVTA 3P7CA 2FUMA 3T9IA 3TL8A 3PPKA 2EB2A 3A8WA 3IW7A 3HMMA 2XEYA 1BUHA 3KFAA 5FP5A 1XO2B 2QQ7A 2QOOA 2FVDA 2G9XA 2XNMA 4WRSA 4E4MA 2HK5A 2DQ7X 5AR3A 4JR7A 3BQCA 2QOCA 5CXZA 3E93A 2IN6A 3IW5A 2BILB 5BQ0A 4C37A 4DH7A 4N6YA 3BYOA 4IW0A 2ZV2A 3O8TA 5HCYA 3ODZX 5JEBA 4PNIA 3HMPA 4IAFA 3W8QA 2FSLX 4M68A 3AD6A 2HENA 3JY0A 1Z57A 2E9NA 2ZM3A 3U6JA 1VR2A 3ZC6A 1FOTA 5IMEA 5AV1A 4QYFA 4IFGA 2PMIA 4OT6A 4PV0A 5ANDA 3HMNA 5T3QA 4RFMA 3HV3A 1UKIA 3P7AA 4I5PA 2B52A 3FLQA 4U40A 4W9XA 4YR8A 2BKZA 4B99A 5IDPA 5LMKA 5ETAA 4IVAA 3ZEWA 5EYMA 5C27A 2XNBA 5H8EA 3BYSA 5KKRB 3HA6A 2WZJA 3HNGA 3E8CA 1RJBA 4LGDA 2C3IB 5KNJA 2VNYA 3TZ9A 4ACHA 3L9PA 3KF4A 3V6SA 3E3BX 4YC8A 4DLIA 3NYXA 3C0GA 4YGAA 4BWXA 4V01A 4EK6A 5L8KA 2QO7A 3RCDA 5BVNA 2YITA 5J9LA 3LFDA 3R7YA 3ORMA 3KMMA 4C57A 1WFCA 4W8DA 5HBEA 3R8PA 3TNIA 3UPXA 3GI3A 3Q9WA 2WTIA 2QHNA 3O50A 3CTJA 4FL1A 5CVFA 3TIZA 1YI4A 3NRMA 2O63A 1FVVA 1XBAA 2EWAA 3AT2A 4LRKA 2PK9A 1DAYA 3DLZA 3QZGA 3QZIA 2OF4A 2RKUA 3OEFX 4FT3A 4I0SA 4M13A 3UQGA 4BFMA 2QD9A 4PTCA 5IA3A 5LVNA 1OKZA 5HGIA 3VN9A 3GXLA 4L7SA 2PZRA 2W1CA 5BUEA 3QXOA 3TZ7A 3OMVA 3N51A 5HE0A 3GCPA 1BLXA 5DT0A 3FKOA 3O2MA 4JBPA 4ANBA 1PXPA 2A2AA 2PTKA 3QTWA 3UO5A 3ZS5A 3LOKA 3CD3A 2BRMA 4U7ZA 5TO8A 5LMBA 5IUIA 1A9UA 3C5UA 4XBRA 4J8NA 5EHLA 2ITNA 4WBOA 2B55A 2YA9A 4YJPA 3W32A 4TL0A 3IK3A 2BZKB 4Z9LA 2IO6A 4G16A 2PMOX 3ZLWA 5BPYA 4U3YA 1DI9A 2VUWA 4YSMA 1LEZA 1QPCA 4GMYA 3PJ3A 4HNIA 4R1VA 3MFUA 3VS6A 1PMNA 5E8SA 1OGUA 1I09A 5K9IA 3S0OA 5AV0A 4L43A 3E7OA 5LVOA 1UVRA 4IAAA 4MXAA 5JQ8A 4QMSA 2PVHA 1FPUA 4A4OA 4IHPA 5HX8A 3FLNC 4YLLA 2X8IA 3B8QA 4K11A 5KMLA 4I6BA 3JY9A 1GIJA 4IZ5A 2XJ0A 3WYYA 5I9YA 1YOMA 2JAVA 2OI4X 4FKLA 3UOJA 4WO5A 2C0IA 5HIEA 4NTTA 3DGKA 3LW0A 4MNEB 4XV9A 1STCE 2VN9A 3P78A 3QTSA 5EDRA 4CV8A 4FT5A 4HGEA 4ZLOA 2ACXA 3LPBA 3WZDA 2ZVAA 3LVPA 4BBMA 5EDPA 3EL8A 2V62A 3DPKA 5BVOA 1OL7A 4HVDA 4RJ8A 4J96A 5BVKA 3L1SA 4HNFA 2QI8A 3VHKA 1J1CA 4LUEA 5DR2A 3QFVA 2JDRA 4ID7A 5BUIA 4M15A 5I3RA 3ULZA 2QURA 3VJOA 3A7IA 5G1XA 3C9WA 4B4LA 4DEHA 3UG1A 2R3LA 4NSTA 1FVRA 3D14A 3MN3A 4QOXA 2O3PA 3CGOA 2PVJA 3Q96A 3R83A 5DG5A 3PTGA 4ZIMA 4YP8A 4O0RA 3MFSA 5ICPA 3IG7A 3MTLA 4O0VA 2HXLA 3ZDIA 4H1JA 2HZNA 2WMWA 1XKKA 3HGKA 3OC1A 5JRQA 5EI6A 3ELJA 2UZBA 3BV2A 3PZEA 5CEOA 1UWJA 4G3CA 3O71A 4DTKA 2BPMA 4AT5A 2HZ0A 3FMHA 5EKNA 4RJ4A 1H0VA 3NIEA 4J99A 3RK5A 5ANIA 4DH8A 3NUNA 3R01A 5AP0A 1YI6A 4PPAA 2VWWA 2ZDTA 3Q4UA 3NLBA 3VS0A 4OAVB 4JBVA 3QRKA 4L8MA 2IZSA 4YPSA 4EUTA 4NFMA 4GCJA 4IVDA 5ANKA 3OCTA 3PWYA 3QHWA 4R3PA 3QTUA 3FE3A 2BALA 2QO9A 3FL4A 4G6OA 4A9SA 1MQ4A 3C50A 4K18A 2OZOA 1QL6A 3AC3A 4YLKA 4CTBA 3OCSA 2UW3A 4F9CA 4DEBA 1YXTA 3ZM4A 2W96B 3I7CA 3HV4A 2W5AA 4DLJA 3LJ1A 4FT9A 4IX3A 5CF5A 4QP3A 3S4QA 3KRXA 2X0PA 5KZ0A 2HY81 3E88A 4C02A 5IA5A 4BWPA 4H3QA 4DGOA 1OKWA 5HHWA 3V8WA 5A4EA 4M3QA 4F9YA 4YU2A 2GFCA 3O8UA 3VBQA 1BMKA 2C30A 1ZAOA 5KBQA 2YM6A 3R71A 3UBDA 3UPZA 5AIRA 3R9OA 4WSQA 3QZHA 5LXMA 2YHVA 3RTPA 2ZV8A 2EVAA 5DHJA 4UV0A 3A99A 5IISA 3F69A 3GC8A 3RBWA 4EK8A 4EJNA 4K6ZA 4FZFB 5GZ8A 4L44A 3HRFA 5H3QA 3ORIA 4E26A 4FV7A 1H01A 1LUFA 2X0QA 1Q97A 4FSRA 5LOHA 4LM5A 5JK3A 4HZRA 3VW8A 1WBTA 2A19B 2VWBA 2G1TA 4NIFA 3NUSA 1ZMWA 3GFEA 2XA4A 4RBLA 5M51A 1PXLA 3G0EA 5CSHA 4JG7A 1T45A 4NU1A 3I4BA 2WU7A 4YHTA 3F9NA 1RDQE 3DQWA 5L6PA 2EXMA 3LXPA 5CSXA 4IB0A 4RIXB 5AUXA 4JBQA 1U59A 4FK3A 4I24A 2BRBA 2VGOA 1YHWA 3MVMA 3VS2A 4R6VA 4X3FA 2BVAA 3I1AA 2PVFA 3OEZA 4TNDA 4XV3A 3TUBA 4UYNA 3BBTB 3QQKA 3TNWA 5DN3A 4FTQA 4DG2E 5H8GA 2XIZA 4IEBA 3KXHA 4WNOA 1W2DA 3WZEA 1DM2A 2ETRA 3ORLA 2R7IA 3BE9A 4BDEA 4L46A 3ZFYA 4OLIA 4RSSA 2OXYA 3EQHA 3AC1A 2I0EA 2B53A 4R3RA 4HOKA 1KSWA 1F0QA 1JKLA 3G6HA 3IDPA 3S2PA 3IW6A 4CT1A 4EBVA 2GHGA 2P33A 5BVDA 3VC4A 4AW1A 5CAQA 3DV3A 1KOBA 4O27B 2QONA 4PY1A 4EYMA 4IZAA 3LHJA 4QYYA 5B2KA 3RGFA 5KBRA 4FIGA 4FEQA 2HIWA 2J9MA 2VWUA 3PSCA 1H25A 4RRVA 3ZSIA 4A9RA 4TRLA 3RWPA 2C6KA 3CKXA 5D9HA 1B38A 2QOLA 1U5RA 4CRSA 4Z7GA 1UV5A 3EFLA 4LOPA 1JKSA 3BU5A 3PA5A 2AYPA 4FZAB 4F9WA 2I0HA 4E8AA 2A0CX 5HICA 2J90A 5ANJA 1UKHA 4UEUA 5GNKA 4BCIA 4A07A 1Z9XA 3QQFA 5KE0A 2YISA 3KU2A 3BLRA 5IH4A 3LM5A 2QOBA 3R0TA 3MSSA 4BKYA 3JS2A 5CEQA 1CKPA 5JSMA 4MBLA 5AUYA 1H0WA 3C4WA 4CV9A 4ERWA 3TG1A 1Q3DA 3MTFA 4MXZA 3KKVA 4BDBA 3P86A 2X1NA 1JSVA 3W2CA 4M69A 3AOXA 5KMMA 4L3PA 4HPUE 4RWIA 5HG9A 3D83A 3R9HA 3ZOSA 4EH4A 1PXOA 4RWLA 3WI6A 2X7OA 4MXOA 2JKQA 3F6XA 4KD1A 4I92A 5AAGA 4FT7A 1OZ1A 1PXNA 3CQUA 3EN7A 2YLEA 3QQLA 4HCUA 4IE9A 3W2QA 4CT2A 3L9LA 4TYGA 4D1XA 3R9NA 1ZZLA 2X9FA 3QUEA 2XCKA 2QCSA 4AP7A 2BRHA 4DH1A 4E5WA 2HOGA 1PY5A 4C4FA 4ZSAA 3EMGA 3JPVA 3KL8A 4XP0A 4C59A 4JQ7A 1YDSE 3QKLA 2HW7A 5HG5A 3MFRA 5HORA 5DNRA 5E8YA 5L8JA 3SHEA 2W1DA 3QLGA 1H00A 5DLSA 4BCJA 2JKKA 2ZB0A 3RJCA 1IA8A 4YUQA 3CCNA 5CENA 4CZTA 2WMRA 4JRNA 5CT7A 3PXZA 2BDWA 4GEOA 4J1RA 4UWBA 2YN8A 2YWPA 4RQKA 4YC3A 5AX9A 2C68A 5CVGA 1GY3A 5EI2A 5JGAA 3N9XA 3V5WA 1OKVA 3L8VA 4AE9A 3EQIA 4MVFA 3DLSA 4PDOA 1UWHA 5HVJA 3V8SA 4A06A 1XH8A 2GNLA 4LYNA 4X2KA 5D10A 4EL9A 2VTRA 3A4OX 4DEAA 4EOLA 4QNYA 3MIAA 5EI8A 4O1OA 5AP6A 3D7ZA 3II5A 2H6DA 1NVSA 4NFNA 4LGHA 5J1VA 2HZIA 3SKCA 3MH3A 1G5SA 2NRUA 4AAAA 3FL5A 4RPVA 1SNUA 2J0JA 4DFLA 1ZY4A 3QXPA 3DFAA 3H9OA 3WIKA 4O4BB 3MB6A 5IMXA 4M12A 2PZYA 3DZOA 3QAME 1P4FA 4R5YA 2O5KA 4RVKA 4RQVA 5E8ZA 3SXRA 1NVQA 2P2IA 3H9RA 4OR5A 3WIGA 2XIRA 1REJA 3WZKA 4MWIA 4Z7HA 4WG5A 1GZOA 3KCFA 2GHMA 4ENYA 5TKDA 4I3ZA 3CP9A 4NM5A 2QVSE 2B9JA 3PY1A 3Q52A 5AP4A 4K1BA 5FDXA 4I5MA 4QQCA 3FZPA 3JVRA 3COIA 3LFAA 1KOAA 1H1QA 2FGIA 4KS8A 4HYUA 1XHAA 4QMTA 4I6HA 1WBSA 4DH3A 1URCA 4I93A 4JI9A 4MTAA 2XK3A 4FL2A 1YWVA 2EUFB 4M67A 5D7VA 4AN3A 4EONA 4X7QA 4O38A 3PJ2A 4EH2A 3MDYA 3F5UA 3MJ1A 5AP7A 5DE2A 5A46A 1OIQA 2JITA 4LFIA 3EQPA 5CEPA 2FSTX 5AP3A 1H07A 3OXTA 3UNZA 5DRBA 4O2ZA 4XRJA 1W2CA 5GZ9A 3RK9A 4HVGA 3FZSA 3NYNA 3FC2A 2J2IB 3G6GA 1OPLA 4FSWA 4FICA 2F49A 4MK0A 3OW3A 4EQMA 1GAGA 4CQEA 4EHZA 4AA4A 2HY0A 1YOLA 3PZHA 5C8MA 3R9DA 5IZFA 4FMQA 4JT3A 3ZZEA 4QMYA 5CF8A 3DKOA 4U41A 5DMZA 5KMKA 4UYAA 3A7GA 3DJ6A 5AV3A 5TT7A 4D0XA 3GU4A 4FKOA 4EOJA 4NH1A 2WTDA 1OIYA 5CXHA 4EH7A 5IG1A 4JDHA 4UBAA 2R3IA 4D2VA 4G6NA 3MA3A 5J9ZA 3FMJA 4YZCA 2BTSA 1JSUA 4HCVA 2UW7A 5E8TA 1R39A 1R0PA 2OH4A 3MPAA 5D1JA 3MB7A 3UVPA 2C6EA 3KK9A 5FRIA 5CSPA 1O6KA 3BEGA 3PXKA 5A6NA 2B7AA 2C69A 2XIYA 3CD8A 5A3XA 3FY2A 5JFSA 2RFNA 2VD5A 3PSDA 4L7FA 3RNYA 1PXJA 4FV4A 3I7BA 3JVSA 5EG3A 3QX4A 4K2RA 4KB8A 4IX4A 4NIFB 3AD5A 3EIDA 4C8BA 5ANGA 4EOQA 1CDKA 3ERKA 1JVPP 4ZZMA 3HLLA 2W7XA 3ZO3A 4CLJA 2CN5A 4QYHA 4IB3A 3R00A 4C4HA 1M7QA 3OWKA 3FMLA 5DT4A 4IB5A 2AUHA 1XBCA 3R7OA 4ASDA 4B8MA 4C4JA 4BYIA 3GBZA 3NNVA 4UMQA 4X3FB 5KUPA 4RA5A 3BU6A 2XH5A 2CN8A 3ALNA 4QTBA 3OD6X 1W82A 2VTIA 1GOLA 3HYHA 4XX9A 5HE1A 4DEEA 3PWDA 1YWNA 1ZYJA 4WUNA 2XNPA 3UVQA 2OJIA 1FGKA 2RFSA 2I6LA 3EFKA 2OIBA 3A7HA 5IA2A 5AAEA 4LV5A 2YM8A 4TWOA 4ZTNA 2IZTA 4IANA 4FRFA 3DCVA 2PVYA 2RL5A 1OKYA 3C51A 4JL9A 5D7AA 4AGWA 4YBJA 3IOKA 2J51A 4ASZA 1UNLA 3ZFXA 1KE7A 3GC9A 2WMBA 3W55A 4FTLA 1YXXA 2GU8A 3L8SA 3BLQA 4YJVA 5IKWA 1YRPA 4XCUA 4BC6A 3IGGA 4F64A 5HO7A 4KAOA 3R22A 2DUVA 4BTFA 3KXGA 3ENHA 4H3PA 2XP2A 4YBKA 2GS7A 3D2IA 3R8LA 4BB4A 4EH9A 5A9UA 4DCEA 2R3KA 2C5NA 2O0UA 3LQ5A 1B6CB 4MD7E 1P2AA 4RVLA 4AZEA 4E6QA 4EZ3A 2O64A 3OTVA 3ZXZA 3G33A 3I6WA 2ITWA 5HLNA 2JDOA 3PG1A 4EHGA 3PIXA 4C7TA 3KRWA 4AN9A 4XBUA 1PXMA 3OROA 3VF9A 1WVXA 5T68A 2B9FA 3KN6A 3ZLSA 1ZXEA 3IW4A 3QTRA 4FNXA 2OJJA 3UOHA 4X2FA 4FL3A 3VBTA 2IZRA 2BRNA 2J50A 2VU3A 2UVXA 3BE2A 4ZJJA 3HRBA 5C1QB 2OIDA 4MXYA 3O17A 2W5HA 2CLQA 2YIQA 3OXIA 4I1ZA 4M69B 4ZP5A 2XB7A 4AWIA 2UW6A 2OXXA 2H8HA 4MH7A 4HZSA 4L68A 4AW2A 4H36A 4EC9A 2UZWE 3C0HA 1QPEA 4LV8A 3ZH8A 3LFFA 3V8TA 4U45A 2X2MA 2ZMDA 2YCFA 3A4PA 3OFMA 2F2CB 2F57A 3R7UA 4E6CA 2ZDUA 5CSVA 4M14A 5JMSA 3OZ6A 4FKGA 4H39A 5IU2A 4GU6A 4B6LA 4XOYA 3FMMA 5H8BA 2IW8A 5CU6A 4DFXE 4U6RA 5EH0A 2R0UA 5KHXA 2UZTA 2WIHA 5J79A 3D0EA 4P5QA 2Y4IB 3V5QA 4E4XA 4PMSA 2C6DA 5AR4A 3DY7A 3TN8A 3DDQA 4FTCA 4OTRA 4GFOA 5I3OA 4I23A 4GK2A 4Q5EA 2RGPA 4HGTA 4RLKA 4EK4A 4AT3A 1PXIA 4FZDB 2C1AA 3QHRA 2VTMA 3NR9A 3GU6A 4JAJA 4ALUA 4U44A 3PRIA 4QQJA 2QR7A 4BICA 1L3RE 4DHFA 1E1VA 2R3PA 4U81A 4N70A 1W84A 1PYEA 4QPAA 3IW8A 2Y4PA 3MY1A 2R5TA 4U9AA 4EQCA 3BKBA 2C6TA 1W83A 4XG6A 3F2AA 4IWDA 4QQ5A 4QP4A 5C8NA 4XV1A 2ZB1A 4YJSA 2YAKA 3ANQA 4RC4A 3FZRA 4KRCA 3COHA 3GUBA 4Y95A 2C3LA 2ITPA 3C4ZA 4PDPA 5E8XA 5HCXA 3TT0A 5JN2A 4AACA 4DGNA 1MRUA 3QC9A 3R7GA 5JZNA 5EW8A 2QOQA 2XBAA 3E5AA 3HMIA 2XK7A 4S2ZA 1JKKA 3VRYA 1OECA 2OG8A 4E7WA 3PLSA 1KWPA 1TKIA 3TKHA 2A27A 4TT7A 5HU3A 5F9EA 4FUXA 4BYJA 3NS9A 4QRCA 1I44A 1OUKA 4QMNA 5CANA 4FTOA 4UY9A 3R2YA 3ZXTA 4F1OA 4U43A 1PKDA 4GSBA 3UZPA 3UTOA 4CFVA 2YABA 5K0XA 3QD2B 4U80A 1Q8YA 3LCOA 5CTPA 5BMMA 3VUDA 2PL0A 3QYWA 2RFDA 3BYVA 2ZYBA 3QQGA 4E1ZA 4C58A 4EC8A 5H9BA 2YM7A 4X3FC 3IONA 3TV6A 4M97A 4CKIA 4F0FA 2ETKA 5KMIA 2CGXA 3RM6A 3DBDA 2BROA 2HYYA 3P1AA 2C5XA 3P79A 3R04A 4Y5HA 4YJQA 5CAVA 2UZUE 4FG9A 5AEPA 5IA0A 4QMUA 3SDJA 4DEGA 5CZHA 2X6DA 5F1ZA 5HE2A 4F65A 4V0GA 2YCQA 2H34A 2OFVA 4FKJA 3VUGA 4BZOA 3PY0A 1JPAA 2E9UA 3RZBA 2R7BA 1PHKA 4LMNA 4BDFA 1ZMUA 4B9DA 4E4NA 2OGVA 3H0YA 3AQVA 1OPJA 2WAJA 4IJPA 3PXQA 1ZYLA 3AC8A 5DI1A 4Y8DA 2VV9A 3AGMA 4OTPA 3P08A 3HUBA 3QC4A 5CYIA 3VQUA 4BWKA 4RVTA 5CS6A 3PPZA 3AC2A 4W4XA 5D12A 3E8NA 4GT4A 3GC0A 4TYJA 2W1EA 4HYSA 2ETMA 2PZ5A 4F6WA 5KZIA 2VO6A 3E3PA 2XK4A 3EYGA 4QMVA 4MXCA 3PIYA 2VO3A 5CQWA 3R1QA 4D0WA 2OSCA 4NKAA 3G51A 3TI1A 4O2PA 3EKKA 2WTKC 3KRRA 3H3CA 2I0YA 2UZLA 3B8RA 1LEWA 2UW0A 3NUXA 3Q3BA 4QMZA 4IAZA 5HTCA 2QG5A 3L9MA 4GT3A 4L9IA 3E63A 2W4JA 4OW8A 3F61A 3KC3A 5F20A 5FXSA 4RJ5A 3UVRA 4DG0E 3D7TA 3CBLA 2ZOQA 3I5ZA 5LWNA 2Z7RA 3F5XA 2JDVA 4Q9SA 5KHWA 3ZZWA 4RMZA 5J7HA 2WMXA 4L6QA 5A54A 3HP2A 3TWJA 1F3MC 1GIHA 3KVWA 4JG6A 4RWKA 1O6LA 2KULA 5K3YA 3QCSA 5FBNC 4C35A 2SRCA 3QF9A 4PX6A 1U54A 2X0OA 2FB8A 4NCTC 4D2TA 5M4FA 3OY1A 2Y4IC 3PRFA 2QHMA 4IC7A 5K5NA 4BTKA 2JDSA 1KV1A 2XIKA 3EB0A 3U8WA 1YOJA 2C4GA 3FHRA 3MPMA 5D41A 4QQTA 4CVAA 5IH6A 1APME 1NVRA 3PYYA 4UXQA 3A61A 2HAKA 3D2KA 1ZOGA 4X21A 1JAMA 3FBVA 4S34A 4F7LA 4YO4A 1M2RA 2HZ4A 5CQUA 2OH0E 5L2WA 5IPJA 4JBOA 4L00A 4O96A 3FQEA 3CS9A 3IQ7A 1Q8UA 4ACGA 1H24A 2O8YA 4KKGA 2Y6OA 1M14A 4RC3A 3PXYA 3TNPC 2OF2A 2CGVA 3OBJA 2WMSA 5DGZA 2PMLX 4CFXA 5FTOA 3LCTA 4DFZE 3ZCLA 4S33A 2XNOA 2Z7SA 3QKMA 4FYOA 3U4UA 5M44A 5C01A 1Y91A 3M11A 3UMXA 2OICA 4CEGA 3F3VA 1TQPA 1YXUA 4UMUA 1YQJA 3RI1A 3NW5A 4F63A 5F95A 2UZEA 2YCRA 5EFQA 1WCCA 3QCQA 3Q2MA 4O0TA 3HUCA 3VUKA 4B8LA 3GQIA 2OW3A 3FWQA 1WVWA 3FKNA 3HV6A 4FV9A 2WIPA 4A9YA 4F7JA 1WBWA 2BIYA 3UMWA 3H9FA 3NYVA 3EFJA 3KN5A 1MRYA 2J0LA 3PY3A 2CCHA 5FLFA 4MF1A 4FV5A 2YIWA 5A4CA 1YVJA 4U3ZA 4D2PA 4TN6A 2PVLA 3RALA 3ZRMA 2PWLA 1RW8A 4YO6A 4RFYA 1YDTE 4USFA 3RHKA 2XM9A 3KXNA 3UDBA 3WF6A 4A7CA 2YLFA 3OHTA 2WGJA 2LAVA 3EZVA 1RQQA 3F88A 1UA2A 5KMOA 2WFYA 3LFNA 4IM2A 4OBOA 3EN9A 4TKSA 4WOVA 4Q2AA 3VAPA 3DK3A 3DK7A 4MQ2A 1SMHA 4WHZA 4MHAA 1SNXA 2QLQA 4ANOA 2J4ZA 2J6MA 2IEWA 4OTHA 4U8ZA 5FM2A 5FQDC 3BU3A 4I4FA 4TZRA 2VX3A 1QPJA 4FODA 5A4LA 4J97A 4I6FA 3W16A 3UYTA 4EOIA 4Y83A 2W4OA 4NZWB 3G9NA 3GCQA 3IS5A 5M4UA 2I40A 3DDPA 3PP0A 4BI1A 1OIUA 2PVRA 4JIKA 4YNOA 3UGCA 2GCDA 2IW9A 3UP7A 4BDAA 4V05A 3RHXA 1EH4A 3LFBA 4OBQA 2CPKE 2OZAA 3MY5A 3NAYA 4K8AA 4M0ZA 2PE1A 4IACA 4G5JA 4D4SA 5AUVA 2GMXA 4BCHA 1J1BA 2OBJA 5DA3A 3KQ7A 1XH7A 3SD0A 2VGPA 1OM1A 2X7GA 1LR4A 4NM7A 5FEEA 3VS7A 4BKJA 1ZWSA 5L3AA 3A7JA 4RIOA 1Q3WA 1XH5A 3R6XA 1SM2A 2J0KA 3OCBA 2W5BA 4EOMA 5A14A 3CJFA 3F7WA 1FGIA 3F3ZA 2V5QA 3Q5ZA 4JS8A 2HWPA 2ITUA 3BI6A 5DT3A 4USEA 2J0IA 2EU9A 4QMOA 2JBPA 5E8WA 5M4IA 4NTSA 3ZSGA 4JNWA 3EHAA 2VTPA 4LUDA 4DEDA 1OL2A 3P7BA 2QNJA 4FIEA 4I6QA 4ZTLA 1W0XC 3NCGA 1BI8A 2B54A 3OW4A 2GNJA 3PUPA 5EM5A 4IWOA 1QCFA 2HWOA 3LFSA 2W9FB 1W98A 4NWMA 4W8EA 3DXNA 3TCPA 4I0TA 4UN0C 4IVBA 3MFTA 3IGOA 3KMWA 5TOZA 1MRVA 3T3VA 3OG7A 3GENA 4QYEA 5AJQA 1U46A 4LMUA 3BHTA 3SQQA 1Q8ZA 4IBMA 3HDMA 3PA3A 3QA8A 5HNGA 3G5DA 4KKHA 5FXRA 2OWBA 1BL7A 3LIJA 4KKEA 4TNBA 2Y8OA 4PMPA 4ZZNA 2BZJA 5LWMA 1J91A 2YDIA 4UWYA 3ROCA 2ITXA 4EZ5A 3NX8A 2UW8A 4RX8A 2UZNA 3AT4A 3BHUA 3DNDA 3GEQA 1SVGA 4V0GB 3VW6A 4C4GA 3FKLA 2QOHA 3VS3A 4D2WA 1QPDA 4CFMA 3UIXA 4C2VA 5E90A 4EKKA 4BL1A 4USDA 3TJCA 4F7NA 3GOPA 4KIOA 5HIBA 5HO8A 3BV3A 2YM3A 1M52A 2OO8X 4UB7A 5EW9A 5F94A 3O7LD 5CEMA 5EHOA 1H08A 5I9UA 4BBFA 2Z7LA 5IUHA 4D9UA 5ETIA 3KCKA 4MBIA 4QMPA 4IB1A 4XHKB 4ACMA 4BZNA 4EOPA 1JBPE 1VZOA 3F66A 3HP5A 3VBXA 4ZSJA 4AZWA 2XIXA 4GH2A 4EOOA 2BDFA 3M1SA 4GIIA 5GZAA 3UIMA 1GZKA 4MYGA 1K2PA 3ZFMA 4AZSA 4OUCA 4UZDA 1OPKA 5CSWA 2E2BA 3F3WA 1ZYSA 4FV2A 2WD1A 3SW4A 1XJDA 3VUHA 1H1SA 2YEXA 3GGFA 5DH3A 4C34A 4DEIA 3QTIA 4YNEA 2WTJA 3KMUA 3D94A 3MJ2A 1YWRA 2J5FA 3BX5A 3KB7A 4FTJA 2G15A 4O0UA 1M2PA 4ITIA 3PA4A 5M56A 3FSKA 5HTIA 3GFWA 3FC1X 2VO0A 3DT1A 3FI2A 4FGBA 5AR8A 4ZLZA 4NCTA 5KMJA 1S9JA 3EN6A 4R5SA 5AR2A 4GYIA 4FSTA 3VS1A 5K5XA 2JIVA 2CLXA 3LFQA 4YTCA 2CGWA 4RG0A 1Y8YA 3D7TB