4PPCA

Itk kinase domain with compound 27 (n-{1-[(1r)-3-(dimethylamino)-1-phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3-carboxamide)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
264
structure length
233
Chain Sequence
SVIDPSELTFVQEIGSGGLVHLGYWLNKDKVAIKTIIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and optimization of indazoles as potent and selective interleukin-2 inducible T cell kinase (ITK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 233
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ppcA00
4NIFB 3Q3BA 2J90A 2VTHA 3R7EA 4C0TA 3R7GA 1WBNA 3Q04A 5EYMA 3ZHPC 4AT4A 1R78A 3PJ8A 5E8WA 2QOIA 3KRRA 4W4VA 2WMUA 1MQ4A 3FL5A 4L53A 2X4ZA 3A60A 4QPAA 2GDOA 4O21A 2OSCA 1YHVA 4I93A 4WSQA 1A9UA 4U40A 3WF8A 3MVMA 3VUMA 4JRNA 5HICA 5HEZA 3KK8A 3R9NA 4F7SA 4ZJVA 4IC7A 4AWIA 3EN7A 4D0XA 3ZO1A 5EW8A 2ERKA 2ITZA 2QR8A 3GC8A 1XR1A 3KN5A 3PXZA 4HNIA 5L2SA 3AD6A 1URWA 4QQCA 3QKMA 3VJOA 4WO5A 4TYHA 4FV0A 4JR7A 3ZMMA 4UY9A 4HVHA 3POZA 2C3IB 4TNBA 5C8KA 2WMXA 2GTNA 3TJDA 3S95A 2NRUA 4AZEA 2HW7A 2XK7A 2RFEA 3QA0A 4QP2A 4CD0A 1WBTA 4FKWA 4MQ2A 3P7CA 4ZIMA 3ZO4A 3ZLSA 4BCGA 1Q24A 4A7CA 2EXMA 1YVJA 2UW3A 3DJ6A 2P3GX 3A61A 5K9IA 4BGHA 4E4MA 1BMKA 3EN5A 4JIKA 2BPMA 3EN6A 2GNLA 1AQ1A 2CLQA 1YWNA 4B7TA 1H08A 3MH3A 4N4SA 3C4EA 3W32A 3QQLA 2J6MA 2YM5A 4UX9A 3G6GA 3RWQA 2JIUA 3S2PA 4OTQA 3R1YA 2WU7A 3QAME 4XG9A 5CQUA 2V0DA 5HLNA 3R28A 3WILA 2F49A 1KE9A 3R71A 5CYIA 4YSMA 5J1VA 5HE0A 3L1SA 5TKDA 3ZC5A 2NP8A 4IANA 3KKVA 3AMBA 5CVFA 5BVKA 2J0LA 4ASDA 4AW5A 3KXXA 5LVOA 4EHEA 1H1SA 1GAGA 3SW7A 3AD4A 2R3QA 3GQLA 1MRYA 2OBJA 1PXMA 5J87A 4A07A 5LCJA 3TTJA 2VGPA 4YZBA 4OTHA 5HG5A 4DN5A 3KRJA 2GSFA 5AIRA 4OT6A 4B99A 2OH0E 5FBNC 1U5QA 3CQUA 3FMMA 1WVYA 1OKVA 5DT0A 3MB7A 3QZHA 4U3ZA 3WZUA 1XO2B 2X2KA 2X6EA 4TWOA 2XYNA 1H28A 4IJ9A 5CZIA 1XHAA 4NJ3A 4TN6A 3U51A 1PKGA 2F2UA 2IVTA 2Y0AA 2CGWA 4AA5A 4JDJA 3NUUA 4C4IA 3SAYA 2XIKA 2X7GA 4M8TA 3TV6A 2QODA 4FSWA 1I09A 3D5UA 1OZ1A 3OD6X 4I6HA 2GHMA 3Q9YA 2JDOA 3I0QA 1J1CA 4TRLA 4CVAA 2XKFA 4XYFA 4JG6A 3RM6A 1GZOA 1H00A 3E7OA 3LFDA 3FXWA 3UNZA 2C3LA 2W1CA 4I6FA 4QT1A 5TR6A 1Q3DA 1JKTA 4FSTA 3EH9A 4Y46A 4MXXA 4FYNA 3TV4A 5HCXA 5EM5A 1JSVA 2XNPA 1XQZA 3DAJA 3ACKA 4QTAA 4YURA 4U43A 4FBXA 5EOLA 3KY2A 4XOZA 4ALVA 3QTIA 4YUQA 4QMVA 4IFCA 4U44A 3DU8A 4QO9A 3V5WA 4D2PA 5D41A 4QYFA 2QHNA 3H9OA 3PSCA 1P4OA 5DEWA 4L46A 4ACHA 3FZPA 3KC3A 4UWYA 3W10A 3LMGA 3PZEA 2GTMA 3AT3A 3F2AA 3O8PA 3VC4A 4FIJA 4IM2A 1XH5A 4B4LA 3CQEA 3EQPA 3LCDA 4IH8A 3T3UA 1PXOA 4AOIA 3MGYA 3VS4A 3E62A 3DBFA 1PXLA 1NY3A 3BV2A 3MJ1A 5LVLA 1FPUA 4AACA 1CMKE 3ODZX 2BZIB 3R0TA 2YDIA 4NZWB 5A3XA 4LGHA 5FEEA 4EC9A 5ETAA 5J7HA 5F95A 1GNGA 1F5QA 3L8VA 4ALWA 2YA9A 3KB7A 3R1SA 2FB8A 3GC9A 3H10A 4Q5HA 1XJDA 2I40A 2OI4X 2UZOA 3DBCA 3RINA 4FYOA 3UE4A 3HYHA 3MV5A 4MNEB 4R1YA 4JBPA 5EYCA 3SKCA 4YTFA 3GI3A 4OLIA 3HP5A 4O22A 4KIQA 3DQXA 4DFXE 3SVVA 3PXYA 5HNGA 1TQIA 5AADA 3PE1A 4RIXA 3MBLA 4XV3A 4AW2A 3R7IA 4IAFA 4K6ZA 1LEWA 3QUEA 5A6NA 5HTIA 3A7FA 4HJOA 4RJ3A 4MXYA 3ZM4A 2WAJA 4BCNA 3QQJA 4LMUA 2XEZA 2ZM3A 3DA6A 3R1QA 2R3OA 5CSHA 2UW6A 4J95A 4F9AA 4R1VA 2PHKA 3CS9A 3E64A 3R21A 5D9HA 2CDZA 3C4CA 4AS0A 3NLBA 2BRGA 4RVTA 4LI5A 3CCNA 5AJQA 3E8DA 3LFNA 4L3JA 3DK3A 2W9FB 3UC4A 4QMMA 3BV3A 3SRVB 4BHZA 1CDKA 2B53A 3IO7A 3TI1A 4C59A 2H9VA 5LWMA 3UOKA 3POOA 4USEA 1JAMA 4D2RA 3QRIA 4M67A 2FUMA 3VS2A 5KKRB 3M42A 3RK5A 3K3IA 5CU0A 2PVFA 4NEUA 2ITTA 4D4YA 4I4EA 4W8EA 2V7AA 1P14A 4ZJJA 3ZSHA 5AUXA 4FICA 4QP7A 4ANOA 3DBQA 2Y6OA 3NAXA 4GU6A 3ZONA 4DEDA 4F9BA 3I6UA 2GHGA 3VO3A 2VWUA 3NCGA 4FOBA 3ZZWA 1M2PA 2PVJA 2YAKA 4AF3A 4E4NA 4IZ7A 2PVMA 2XK3A 3OBJA 4ASEA 5B2LA 4CYIA 2Y7JA 5I9VA 4RSSA 2XNOA 5J79A 2H34A 3OWJA 2OJGA 4JR3A 4EKLA 3AT4A 4D9UA 4AE9A 5JFWA 2HENA 4NK9A 3FXXA 1YW2A 4XLIA 4RIWB 3WZJA 4X2JA 3OY1A 1J1BA 2QO7A 3H3CA 4M97A 4TWNA 4L42A 3ROYA 4O0YA 2ITUA 4CFWA 4GL9A 3DB6A 3IOPA 4HPTE 1Q8WA 5LCKA 2R0IA 3HV6A 4UZHA 5ANDA 3CTHA 4B8MA 5GNKA 1ZYCA 4YNOA 3UQGA 4XG2A 4EKKA 4RQKA 1B38A 2BHEA 2RG6A 2OWBA 1MP8A 4GIHA 5M44A 5DR2A 4JDKA 1OPJA 4FIEA 5JK3A 4RVLA 4EOKA 2UUEA 3VNTA 3MDYA 1UU7A 2C6DA 4YO6A 3F3ZA 3OC1A 3QZFA 5CU3A 1IR3A 4J53A 1IEPA 4DLJA 3U9CA 4IM3A 1B39A 2A2AA 4A9TA 2PVHA 5HG8A 1SYKA 4XP2A 4A4OA 3QCSA 4IQ6A 3EYGA 4MCVA 4QD6A 2HXQA 5ACKA 4EH5A 2GS7A 4J97A 4PPAA 3GCVA 1VYWA 2OF4A 2PVNA 3G33A 5EM6A 1OIUA 3C7QA 4UMTA 1YXTA 2PUUA 3OMVA 4FTRA 4YC8A 1CSNA 3RJCA 3QKLA 2JKMA 2QU5A 2WTDA 3P4KA 3PWYA 1Y91A 1OKZA 2XIRA 2P33A 4YJOA 2QLUA 3GC7A 2P55A 4WRGA 5CALA 4E6QA 1K9AA 2FGIA 5D10A 4EORA 2PL0A 3OOMA 5FGKA 3DLSA 5DG5A 1BUHA 3IOKA 4Y85A 3RHKA 4JT3A 5CEQA 3V8SA 3BYUA 2QCSA 4WG5A 2I0EA 4FIGA 4QMLA 4DEHA 2EWAA 2J0IA 3VRYA 4LUDA 1RJBA 5HE1A 4LRKA 3AT2A 2XKEA 3MY0A 5EDRA 3RP9A 2AC5A 2Z7SA 1Q8YA 3KXMA 4H36A 4U79A 5AP3A 2GQGA 5L6OA 4Z16A 5JGAA 4CQEA 2BRNA 3ZRMA 5EW3A 2C69A 4TXCA 1O6KA 4OTGA 4BWXA 3FLWA 3Q6WA 3GGFA 2LGCA 2B7AA 3R7YA 4B0GA 3OW4A 4GYIA 1UNGA 4JL9A 4RIOA 4U80A 5AP1A 2VX0A 5J5TA 3O51A 2UV2A 4FODA 2B55A 4TWCA 3BGPA 3OWPA 4BCHA 1SVEA 2O8YA 4CZUA 4JOAA 3QFVA 4WIHA 5LARA 3W55A 3ZFMA 4DBNA 4PMMA 3R7UA 4IX3A 5JGBA 2JDRA 5GHVA 4JNWA 1OB3A 3RPOA 4JG7A 3LJ2A 2QURA 4GT4A 3UPZA 2IW9A 1ZYLA 5FQDC 3LFCA 2DS1A 5LMBA 3VQUA 2G9XA 1O6LA 2YITA 5LXMA 3F3TA 4RA5A 5D7VA 4YTCA 3TNQB 1Z57A 3HDMA 4D58A 4P90A 2VNYA 4HCTA 4I24A 2VWIA 2XK4A 3DDPA 3VWAA 5DGZA 2UZBA 2UVZA 1UKIA 4PTGA 4IC8A 3C50A 4MWHA 2HY0A 4G3EA 4PMSA 4YJVA 3MIYA 3HV3A 2QOHA 4YJPA 2ZMCA 4ZSAA 4EBVA 3LAUA 2R3JA 2HOGA 2I0HA 2J51A 3I81A 4KWPA 3TT0A 2CCIA 3PIZA 5F4NA 5HORA 1PF8A 1PKDA 4PTEA 2G2HA 3V5PA 5DR9A 4O6LA 4C3PA 2W05A 3NYVA 5CSXA 2WD1A 3E8NA 2RKUA 1NVRA 2C5OA 5I9ZA 2RGPA 4FNYA 4ZP5A 2WEIA 2PMLX 5CI7A 2XZSA 1JBPE 4AOTA 3GU4A 2BUJA 4XNEA 4M13A 4ZTMA 3ENMA 1UWJA 3QQUA 4OT5A 4QMOA 4O0XA 3COKA 1KSWA 3HMPA 3KGAA 3OROA 4IMYA 2R9SA 4NUSA 2ZOQA 5BVFA 4JQ8A 1UU9A 2XJ1A 5CY3A 4KIKA 2R0UA 3MTFA 3ZSIA 4DTKA 5IG1A 2UZUE 3I7CA 1PW2A 3QQKA 3R83A 4CMOA 4D5HA 2WXVA 3BHHA 2REIA 2VTTA 3W2CA 4RC2A 4GSBA 3LQ8A 3NUXA 4F7LA 2BZJA 3MY1A 3ZRKA 4CFUA 5AV3A 4IVDA 4G31A 3AOXA 3IECA 1PMEA 4Q5EA 4YHTA 3ZOSA 1M7QA 1VEBA 4D9TA 2OU7A 4JJRA 1OIRA 1FINA 2W4JA 4K0YA 3OOGA 5DHJA 3ULIA 2CKEA 3QTWA 2VD5A 5DI1A 5HD7A 3UIXA 4I94A 2YM4A 3KXNA 2RF9A 2XRWA 4RT7A 1MUOA 3TV7A 5IA1A 1SVHA 1W8CA 2OXDA 3UO4A 3IW6A 5AUYA 3RGFA 4L68A 2GNJA 3ALOA 3I6WA 4IFGA 1UV5A 4Q9SA 2H8HA 2C6IA 4BKZA 3LXNA 3NIEA 4KB8A 4DH1A 3E8EA 3NUNA 4AN2A 4D4SA 2VTIA 4EOJA 1LUFA 3AC3A 4DG3E 2A19B 5CU4A 4NFNA 4GVAA 1P2AA 2XIYA 3Q60A 2GNGA 5E8VA 4FV1A 4C33A 5AUZA 3UG1A 1OUKA 4NM7A 4I5MA 3BU6A 3T9TA 5M4UA 1R3CA 4IJPA 3QGWA 4XG6A 3OEFX 3I79A 3EIDA 5B7VA 5JKGA 3AC8A 1QCFA 3NW6A 4FTIA 4F09A 3GOPA 2PMOX 3BE2A 2HZNA 4FV6A 1DAWA 1H4LA 2XRUA 4XH6A 5AP4A 1H0VA 4GJ3A 4X3FC 4XV1A 4KAOA 4EK4A 3PG3A 4JBQA 3TEIA 1PXNA 1XH8A 2WEVA 3DY7A 2W9ZB 3NW7A 1W82A 4AZFA 2R3FA 4BDDA 2ZJWA 3PLSA 3DAKA 1W7HA 3VS7A 4G1WA 1NXKA 2C5NA 4L52A 3QL8A 4RX8A 4BWPA 5DRDA 3ORXA 3MH2A 5AR2A 3SX9A 3VBXA 3K2LA 1H25A 4BDFA 3FC1X 3UNKA 3LOKA 3MB6A 4C4HA 4GRBA 3E8CA 2UW8A 2CSNA 2JGZA 3IGGA 5IA4A 3R6XA 3A62A 4IW0A 2BROA 3AGLA 2VTRA 3D2IA 3WYXA 5ACBC 3U6IA 4I0TA 2X0GA 4S30A 2YN8A 3B2TA 5EHYA 3MPTA 1YHWA 4M0ZA 2WQMA 4KINA 3P08A 4EZ3A 2VWZA 2PZPA 3F7WA 5CNOA 5L6WL 4UWBA 5E1EA 3BBWA 3GFEA 5HQ0A 3GP0A 3ZFXA 5BUJA 5CF8A 1BI8A 2QR7A 3E63A 3FI4A 4MXZA 4X2FA 5BVWA 4BKJA 5M56A 2ESMA 4AG8A 2ERZE 2W1DA 3LCSA 3ORPA 4FVQA 4L44A 4C8BA 2BFXA 3FMKA 4FSRA 1OL1A 4QPSA 3G9LX 3ORZA 2QO2A 1G3NA 3C0GA 4J71A 4QMNA 3H9RA 3ZO3A 2UW5A 3CKWA 1H1QA 4CMUA 4CNHA 3DTCA 1OVEA 3IW5A 1OKWA 3ZZEA 3U6HA 3T9IA 2C5XA 2DWBA 5AV1A 2Z7QA 4GT3A 3BU3A 4UMQA 1OIYA 1YWVA 4U81A 2QKWB 4WNPA 4UMPA 5L6PA 5AWMA 3OW3A 4I6QA 3KULB 2XK6A 3F9NA 3QRJA 3QU0A 2PMIA 4BCIA 3FI3A 3Q32A 4HGSA 2BKZA 5ANGA 3CTJA 2C0OA 4FTTA 5CEPA 1ZYDA 2F9GA 5IA5A 4HPUE 3FLZA 3UYTA 3RKBA 4BFMA 4HCUA 3UJGA 2YEXA 3KCKA 3AMAA 3MVHA 3O0GA 5L8JA 2VO3A 4DFYA 3L9MA 3GXLA 4BCKA 4YZCA 3HNGA 1FGKA 2ITVA 2JDVA 3ZFYA 3BX5A 4HYIA 3QZGA 2QOKA 3AC4A 4IAIA 2IW8A 3UVRA 4CQGA 3RALA 2XNNA 2H96A 1UNHA 3F5XA 4D1ZA 3BLRA 2YJRA 4YMJA 3NNUA 2OFVA 3PVGA 4M69B 5HCYA 5DMZA 2B1PA 4XG3A 3ORLA 5AV0A 2IN6A 1KE7A 2P2HA 4YHJA 3DBEA 3ETAA 4CMTA 4F1TA 4FX3A 4IB3A 2WMAA 5BYYA 1KE5A 4FGBA 3TKUA 4KS7A 1XWSA 2E9VA 4E5WA 5E8UA 4J52A 4CCBA 5I0BA 3D5XA 2BRMA 4O2ZA 3VW8A 1MRVA 4RC4A 1PXIA 5M55A 3ZXZA 4F64A 3VUKA 2OJ9A 4RPVA 3LE6A 2PE0A 4K1BA 4AE6A 1ATPE 4WNMA 3RAWA 3AXWA 2F4JA 4IBMA 2QOLA 4RJ7A 5I4NA 5CEMA 2RFDA 4BZDA 3VBVA 1IRKA 4E26A 3R9OA 4FK6A 3PTGA 5HVKA 1NVQA 1PHKA 1LP4A 1GY3A 3IDCA 2GCDA 2PTKA 3Q9WA 3BPRA 5JSMA 4RX5A 1H8FA 4YSJA 3JYAA 4PQNA 4GVJA 4I3ZA 4TKSA 4RLLA 2ZDTA 5DNRA 3HVCA 2IWIA 4MAOA 2WQNA 3GEQA 3VUDA 3ZBFA 4BDIA 5JZJA 4GK2A 2EXEA 2HK5A 5B2KA 5IA3A 4QMZA 4JIAA 5I9UA 3U9NA 4EH9A 1OL5A 4D2WA 1DM2A 3B8RA 4ZSEA 1Q62A 2XJ0A 1PMNA 4C57A 3LFFA 2CGVA 4EH3A 4F65A 5IA2A 4EQMA 3QTUA 3L8XA 3P86A 4BKYA 2YIYA 5ANKA 3F5UA 2GS2A 3FMEA 3MFRA 4MX9A 4L3PA 4AA0A 4JS8A 2EB3A 3A7GA 5AP7A 3NX8A 3EFKA 5I5ZA 2ZB0A 2YZAA 2JIVA 3ODYX 5CTPA 3FZRA 3WIGA 2VTJA 3PPZA 4CFMA 4FT9A 4PX6A 4QYHA 5KX8A 3EQHA 5ANIA 3F3UA 4BCOA 5BMSA 3O8UA 5B0XA 3LIJA 5KE0A 1ZOHA 3LXKA 4YZDA 5CF4A 5K5NA 3ZH8A 1U54B 3ZEWA 1VYZA 3NNWA 3HDNA 4RVMA 3JVRA 5EH0A 3UIUA 4DFNA 3HKOA 3QD3A 2QC6A 4L7FA 4USFA 2YIWA 2ETKA 3WIKA 3ZS5A 3A4OX 3D5VA 3OT8A 4UYNA 4EEVA 3S3IA 3D2KA 2JIIA 4NKSA 1EH4A 4E5BA 4LV5A 2PWLA 4DFLA 4FSQA 1UA2A 3WARA 4RWIA 4M66A 4EYMA 1ZARA 1Q41A 3SXFA 3LLTA 4CLJA 2BALA 4MF0A 4MD7E 4E73A 3UOHA 5AP2A 2YIQA 1H01A 3VJNA 2QLQA 4HOKA 3EN9A 4YLJA 3MIAA 4F08A 5JN2A 1PYEA 3EWHA 2YAAA 4DHFA 2XA4A 3V5QA 2FSMX 4BYIA 3HUBA 4EUTA 4ZSLA 1GZKA 4GUEA 3JPVA 5HGIA 4F0IA 3VHEA 5ANEA 4FTUA 2JITA 2VN9A 4KBKA 4O0UA 4O96A 3ULZA 2GNIA 4W4YA 4ANBA 4C4JA 4FV4A 4O0WA 3CY2A 4MQ1A 5FP6A 3BHTA 2WU6A 3LCOA 4EH4A 1FGIA 2OIDA 4RQVA 5CU2A 5KBRA 2PZRA 5M4IA 2B9FA 4PWNA 1H0WA 4HW7A 1IASA 4D2VA 4EJNA 1OIQA 5D1JA 4XHKB 4BCJA 4EI4A 3SV0A 1WBOA 3WBLA 4EBWA 1A06A 4ARKA 3FKNA 3BCEA 3MA6A 3MI9A 3MPAA 2XBAA 3ZLXA 3PXRA 1WMKA 4KS8A 4CT1A 4BIBA 4XS2A 3C13A 3TNWA 4LGDA 2VX3A 5CAPA 4II5A 4ANNA 4CKJA 2PZYA 2JEDA 3MA3A 5HBJA 2CGUA 2YLEA 2J2IB 5E91A 3I7BA 3TCPA 3EL7A 3PY1A 4FL3A 4X21A 4FV5A 4RRVA 5HG9A 3ROCA 3CBLA 4EHVA 4EH2A 5E90A 3N9XA 2WTKC 4WT6A 5A4CA 1GIJA 5KMNA 3UPXA 4DCEA 5L2QA 2O63A 4FTJA 3UBDA 4M84A 3R8MA 4MHAA 3EQFA 2R64A 1Y57A 4IVBA 3F66A 3QWJA 4QQ5A 4XG4A 1Y6AA 4KNBA 3RHXA 3KU2A 1PXJA 2C4GA 1OMWA 1S9IA 3QTQA 3QXPA 4QMSA 1LR4A 4BDAA 2GHLA 3QYWA 3G6HA 4C7TA 4TZRA 2G2IA 1JSTA 4PL5A 2BAKA 4APCA 3C4ZA 5DR6A 4AGDA 4HYUA 4E6CA 1WBVA 4FG9A 4FTOA 4DC2A 3W2PA 4BDBA 2ETMA 4MXAA 5JMSA 2R4BA 4BDKA 1ZY5A 4MXCA 4PDSA 5KMLA 1R39A 5FM2A 2KTYA 3VHKA 3WOWA 2C6OA 1M52A 5CAQA 1Q97A 2XNBA 3MFSA 3BI6A 4U97A 3U4UA 3NYXA 3VF9A 1Y8YA 3Q2MA 3C0IA 4IAYA 1URCA 1UKHA 4P4CA 4WHZA 5HESA 4PDPA 1ZYJA 5EM8A 5BVEA 1CKIA 3A99A 3DGKA 4XV2A 2LAVA 4F1OA 4UBAA 4L8MA 5AP0A 4AGWA 5HO6A 4CFXA 3EQBA 2OZAA 5CF5A 1YXXA 3F5GA 2BDWA 2OK1A 4FOCA 3D94A 1M14A 4FSMA 4PF4A 3TACA 4DEIA 5C26A 2YLFA 1REJA 1PXKA 4USDA 5KBQA 5DVRA 1AGWA 2J4ZA 3UO6A 5HIDA 4E7WA 2B9IA 4I5PA 3SC1A 2WHBA 3NUPA 4HVSA 2SRCA 2W5HA 1ZOGA 4FTMA 2W1FA 1YOMA 3R63A 3F7ZA 4RC3A 4YZ9A 4YC3A 1WAKA 4EQCA 2C1BA 4YJSA 1LEZA 5BUEA 5EKNA 5H2UA 4TYJA 4AT5A 4FTQA 4ZEGA 3R8VA 5AV4A 2O64A 3HMOA 3UVPA 3NSZA 4AX8A 4Y5HA 4TYHB 1NVSA 1P4FA 4QP1A 1SZMA 4JAJA 2XVDA 4TYEA 2X39A 3JUHA 4GT5A 4Z3VA 4FTNA 5E1SA 3TUDA 2ITYA 2ZMDA 1CM8A 3IG7A 4DEBA 4K77A 5J95A 4TL0A 5LMAA 3FY2A 4LRJA 4R8QA 4C4FA 3HRCA 3PSDA 4RX9A 4BI2A 1JKKA 3RK7A 4ASZA 2O3PA 1U46A 3FSFA 3H4JA 2XM9A 5CANA 3M2WA 5J8IA 2WNTA 3QLFA 4FG8A 3B2WA 3LHJA 3MH1A 3PRIA 2WQBA 3R30A 4UALA 4AGCA 4AZWA 3FMDA 4EQUA 3OCGA 3E88A 3ORIA 5CAOA 2VWVA 4XOYA 4Y73A 2UZNA 4AT3A 3CXWA 4W4WA 4EZ5A 5LQFA 3IW7A 3DQWA 4RWKA 1ZLTA 5C1QB 3DKFA 5FRIA 2NO3A 1OI9A 3HUCA 4MVFA 3O17A 3QXOA 4C3FA 4F63A 3EB0A 1YXVA 2CN5A 4O2PA 5FP5A 4MEDA 5F94A 4L67A 1OUYA 5IUGA 3ORNA 4YU2A 5T3QA 4D2SA 3NPCA 3GCQA 1KE8A 4I5CA 3ZU7A 5A54A 4RIYA 4ZTNA 2UZDA 3OCTA 2ZV8A 3MSSA 1AD5A 3QWKA 5JGDA 3UQFA 5DA3A 1VR2A 4CCUA 3IDBA 3RAKA 2XNEA 4KKEA 3EHAA 4BHNA 5CNNA 3PXFA 4CTBA 3F5PA 3OY3A 4FKRA 5HO8A 2ITNA 3U87A 3PIXA 5AA9A 2DYLA 4BBFA 3D5WA 4CZYB 3CPBA 2ITPA 2R2PA 3NNVA 4H1MA 2VTMA 3KQ7A 2PE1A 3TZMA 4EUUA 2ZV9A 2KULA 2PY3A 3BEAA 4ZTSA 4EK8A 4BDJA 3DS6A 4F0FA 3LCKA 2IZUA 3ZTXA 4N0SA 4FEQA 4NH1A 3D83A 4Y95A 1BKXA 3EKKA 3FYKX 1ZXEA 3OZ6A 4KIOA 2G15A 4QTDA 3BU5A 4RG0A 4AA4A 4A9RA 1BLXA 4C3RA 4F9WA 4PUZA 3HRBA 3SXRA 2XUUA 2ZDUA 3OP5A 1Z5MA 4FKIA 4IZAA 3UO5A 4XP3A 4W9XA 4LQMA 2VTLA 2YDKA 3BYVA 1J3HA 1JPAA 5GJGA 4GCJA 4NSTA 3MTLA 4MNFA 3PJ2A 1XBBA 3CJFA 4FKUA 3CGFA 4L01A 4O27B 5FEQA 2WTJA 2YHVA 3KK9A 1OITA 4AW0A 4V0GB 5EI8A 3P5KA 5CLPA 1XH9A 2BIYA 2E9NA 5FBOA 1DI8A 3D9VA 4ZSJA 3TN8A 4FA2A 1UVRA 2BHHA 1BI7A 3FL4A 4L9IA 3RPYA 4HGLA 4B6LA 4EHGA 2QONA 3ACJA 3WF7A 2J5FA 4LG4A 3WF5A 3EQRA 2ZV2A 5TOZA 3D15A 3UGCA 4FSUA 2FYSA 2RIOA 4O6EA 5AUVA 3LFBA 3RMFA 4DG2E 1KOBA 3QUPA 5HD4A 3BZ3A 2RSVA 4RZWA 4GFGA 3W2SA 4TYGA 2WMVA 2X2MA 3CJGA 3PVBA 5HU3A 2OZOA 2UW7A 2WMWA 1K2PA 4RZVA 1W98A 3KA0A 4JQEA 3BWFA 3GBZA 2AUHA 4V01A 3DKCA 4IX4A 1H1WA 5ETCA 2G2FA 4TWPA 2VTNA 4YPDA 4QQTA 2QOBA 3LM0A 4BDEA 3DK7A 4X2NA 3R7VA 3ZCLA 4UWCA 1FQ1B 4S34A 3R2YA 3OXTA 3FXZA 4IWQA 1H26A 3MFTA 4QP3A 4M7IA 1M7NA 4EK6A 2YIRA 1ZMUA 3GC0A 5CU6A 5CVHA 5F9EA 3FV8A 3CP9A 3AGMA 4CKIA 2ITWA 5LVMA 3FHIA 4Z7GA 4NT4A 1DAYA 4RIXB 3L9PA 5JT2A 3O2MA 4FT3A 4JRVA 5FEDA 4EH6A 2XIXA 5KMJA 4AQCA 3R01A 2X9FA 5HLWA 5IKWA 4JI9A 2CN8A 3LXPA 3QALE 4ANQA 5CXHA 3V8WA 4BI1A 4R3CA 3VUIA 5HLPA 2XBJA 1REKA 4MXOA 1KE6A 3VBQA 3P1AA 3R2BA 2YIXA 4FT0A 4J1RA 2VX1A 3P78A 4S31A 5AEPA 2FA2A 4FKGA 4K8AA 4RVKA 4U5JA 5DBXA 5E8XA 4UMRA 1OL7A 4GV1A 4AN9A 5IH4A 4Y5QA 2C6LA 4UB7A 3WE4A 4BYJA 1V0PA 3G51A 1QPCA 3U4WA 5JH6A 3R02A 2O2UA 4U41A 4N6ZA 4QNYA 3D7TA 4FR4A 2WZJA 4I22A 1BX6A 5BVOA 4JBVA 3AMYA 3QCXA 4BGQA 3LPBA 3FAAA 5A4QA 2EVAA 4FZFB 5IU2A 4FF8A 2QG5A 1HCKA 2XIZA 5DH3A 1Q3WA 2V55A 4G2FA 3FUPA 1G5SA 3EQCA 4DGNA 4FV3A 3C5UA 4RJ6A 4CFNA 3SA0A 4IADA 4NJDA 4FK3A 5HTCA 2QKRA 4FZ7A 5HVJA 2C0TA 4F7NA 3BLQA 1BL6A 2I0VA 3FLQA 4FTAA 4LFIA 3FZSA 3TKIA 5JEBA 2EUFB 5ANOA 3R9DA 3E5AA 4PL4A 4ONAA 3R7OA 3ZDIA 4YJUA 4OAVB 1HCLA 4FTKA 4R6VA 1XH6A 3EOCA 4F0GA 4IB5A 5HO7A 4NFMA 4U42A 4Q2AA 5EG3A 4DGMA 4IWPA 4TYIA 2UZLA 1T46A 5A4EA 3OXZA 4DGLC 3E3BX 4ENYA 5IDNA 4AU8A 5J9YA 3BHUA 2W7XA 1RE8A 4MBIA 4QP9A 4D0WA 3LVPA 1B6CB 5BVDA 3EKNA 3LW0A 3R1NA 3DTWA 4QMWA 4GIIA 5AAFA 3R8ZA 4C62A 1YRPA 3E87A 4FG7A 3VS6A 2Z7RA 1U5RA 2W1GA 3ANRA 2W1ZA 2Z2WA 1Z9XA 3QLGA 3QQGA 5BYZA 4ZZNA 3W8LA 1RDQE 3IONA 3VBTA 3KRWA 4WNKA 3OFMA 3HRFA 2ZAZA 3ZUTA 3V51A 4WUNA 3AD5A 3DT1A 3GU5A 3GOKA 4MYGA 4O0SA 3PVUA 1T45A 4M69A 5E8TA 3QYZA 3PUPA 2IVSA 3MJ2A 4IHPA 2WIHA 3QC4A 3VS0A 4XRJA 2C30A 4PTCA 4BIEA 3RAIA 2BMCA 4G16A 2JDSA 2OGVA 3ORTA 5FG8A 3DV3A 2E9UA 2X7FA 2XMYA 2UW4A 4KKHA 3R9HA 4BRXA 1TQPA 3OWLA 4JVGA 5BX0A 3C4XA 4X3FB 3MN3A 2QVSE 2FSLX 3VS5A 5F1ZA 5M51A 4MWIA 3PY0A 1Q5KA 3FI2A 4L7SA 3ZRLA 4OUCA 4GYGA 4WBBB 1ZMWA 4MD8E 4J7BA 5C03A 4GG5A 4HYHA 2VO7A 2YM7A 4K9YA 4X2GA 2WMQA 3TUBA 3PRFA 4L43A 1IG1A 4FT5A 5KMKA 3DKGA 1Q8TA 3R73A 2ACXA 4UXLA 3RM7A 3RNIA 1OL2A 3QQHA 2UW9A 4DH7A 5GZAA 3T8OA 2R3NA 4EC8A 3Q5IA 3BGZA 3HL7A 4QMXA 3COIA 4FUYA 3BLHA 4BC6A 1LPUA 2VV9A 4DEEA 2GPHA 3FDNA 4J96A 4FTLA 3NDMA 1K3AA 1OPKA 4EHZA 4NIFA 2XM8A 2C5VA 3BQRA 3MVJA 3PJCA 3FLNC 4ID7A 3VQHA 5BUIA 5KO1A 3H0YA 2RFSA 2P4IA 3BBTB 3OXIA 5TF9A 1TKIA 1Q99A 2NPQA 2J7TA 3G90X 3KXHA 3CD8A 3UODA 3W2RA 5ETIA 3IK3A 5EI2A 3S1HA 2W17A 4K11A 2W4OA 4LOPA 4YJTA 3JY9A 4RBLA 2YCRA 3NW5A 4E3CA 3Q4UA 1KV2A 4RFZA 4QYGA 5CT0A 4AGUA 4QMTA 4LV8A 2C6MA 4HNFA 2R5TA 2XK8A 3QTRA 1O6YA 3AC2A 4F70A 5CEIA 2FSOX 3HX4A 2X1NA 1QPEA 1R0PA 3IDPA 4P7EA 4XEYA 1YXUA 3FY0A 5HNBA 4C4GA 5DLSA 4ZJIA 2Y6MA 5EDQA 4NTTA 4K2RA 4AXAA 4NCTA 4LOQA 3THBA 3COMA 3DDQA 5IA0A 1JKLA 4LMNA 4O1OA 2WMSA 4NM3A 3RPVA 1OGUA 2CMWA 3NUYA 2VUWA 3Q96A 5DPVA 5EM7A 1U54A 4ZTLA 5CS6A 2WQOA 3CLYA 4ZXTA 3TNIA 4ENXA 1OL6A 3DFAA 5ICPA 4WBOA 2OO8X 1YI3A 2YCSA 4FNWA 2B9JA 2Y4IC 4I1ZA 2PSQA 4OR5A 4UV0A 3CD3A 4F6WA 3HECA 5TT7A 4YHFA 4O0VA 3HV5A 3EMGA 4TW9A 5DT4A 3ET7A 5IMXA 4XMOA 3E93A 2C1AA 3QGYA 3WZKA 2R3KA 2VU3A 4UYAA 4C34A 3I5NA 2DUVA 2E2BA 3O50A 5FM3A 2Y4PA 5AIKA 2GFCA 2XCHA 3Q53A 5HTBA 3QC9A 3R22A 3FLSA 3ZDUA 2XYUA 1U59A 3TZ7A 2IW6A 3BWJA 4IZYA 4H3BA 2HZIA 3BGQA 2E9PA 4XJ0A 4EL9A 4EONA 3GUBA 2BIKB 3DBDA 4G5JA 4GJ2A 4C2VA 4I0SA 3EL8A 1SNXA 3GENA 2WTIA 2OH4A 1S9JA 2WTWA 3ITZA 4FIIA 5AP6A 4D55A 3PJ3A 3BELA 5LOHA 2UZTA 5KHWA 3R8PA 5CSPA 1V1KA 3VS3A 3Q5ZA 4WG4A 5E8SA 2WTVA 2JD5A 4WRSA 5ITAA 3PWDA 4KIKB 3UOLA 3WI6A 3REPA 4AOJA 1FMOE 3FMLA 5FTQA 4FZ6A 3QBNA 3QUDA 2WFYA 3KRXA 3R8UA 2OJJA 3SW4A 1ZYSA 2IZRA 4FKSA 2VNWA 3P9JA 4Y8DA 5JRSA 4D5KA 3PY3A 3O7LB 4R3RA 4TTHB 2UZWE 1OECA 4YNEA 4X3JA 5AUWA 2VWWA 4G3CA 3UZTA 3SD0A 3DCVA 3RZFA 4IEBA 4XG8A 3FMNA 4UN0C 2WOUA 5DT3A 4JDHA 2XNGA 3EZVA 4R3PA 3BHVA 2OFUA 4GK3A 4IDVA 4D28A 4I4FA 5CAVA 3DKOA 2F7EE 3L9LA 3PJ1A 5J1WA 3QF9A 2GNFA 3FPMA 3QKKA 4OTPA 5AM6A 5EI6A 4ZTQA 2BRBA 3IKAA 4DYMA 2RG5A 2GMXA 5HKMA 4C36A 4ZY4A 3FKOA 3KVXA 2VTQA 5J7BA 2EB2A 2PZ5A 3RVGA 3B8QA 4IDTA 3C51A 4KSQA 2O5KA 4PNIA 3MYGA 5DOSA 5DWRA 4WUAA 1R0EA 5KMMA 4PNKA 3DZOA 4G34A 4FMQA 3HEGA 3A4PA 3UDBA 4FKOA 5CEOA 5EK7A 3UP7A 3CE3A 3OVVA 2C5YA 4GFMA 4NWMA 3TXOA 4JXFA 3WF6A 4H1JA 4CT2A 3P0MA 4AZVA 5J5SA 2C0IA 1YI4A 3OUNB 4DFZE 5FDPA 2FVDA 4ACDA 4O91A 4CZTA 3K54A 4X6QC 4JLCA 3LFEA 2X7OA 3IS5A 4QNAA 4E4XA 1FOTA 4IVCA 5EDPA 5DRBA 3IGOA 3RBWA 2ONLA 1E9HA 2JDTA 3P79A 4HYSA 3AQVA 4ZTHA 4E6AA 2A27A 4KA3A 3COHA 2OIBA 4B9DA 2AYPA 4FKPA 3PZHA 3AC5A 3HLLA 4GS6A 3H9FA 4NTSA 4IB0A 3DAEA 4J99A 4QMQA 3DB8A 3FZOA 4JDIA 2Y8OA 1PJKA 1WZYA 5LVNA 2YCQA 3TIYA 2OJIA 4X0MA 4BDGA 4AZTA 1QPJA 3E7VA 4ASXA 2ZM1A 4EWQA 5AR4A 5C01A 2HY81 3V5LA 4XG7A 3MY5A 2F57A 3FHRA 1VJYA 3UIMA 4C35A 4MNEA 4QQJA 4CV8A 2JKQA 3PP1A 1GZNA 3FWQA 4PP9A 3SOCA 2QU6A 1FVVA 2R7BA 3L9NA 2IVVA 4MK0A 5D11A 3RI1A 2PVLA 3A8XA 4E93A 4KBAA 3G5DA 4PV0A 4IZ5A 4XRLA 5CAUA 3QRTA 4BZOA 4A9YA 1DI9A 2B9HA 3EQIA 3I4BA 3DJ5A 3Q4TA 5CEKA 1HOWA 2ITOA 5IZFA 4HVIA 4JBOA 5I3RA 3LCTA 5H8GA 2UVYA 3QCYA 4OTIA 4ZK5A 5AX9A 3QX2A 2R3RA 2RL5A 1GIHA 2QNJA 1PMUA 2C47A 2YERA 1PYXA 3NCZA 4A4XA 4Z9LA 2WIPA 4YJRA 4A4LA 3PSBA 1F0QA 4FUXA 5H9BA 3KXGA 5IUHA 4KBCA 3SRVA 3S0OA 3GQIA 4PP7A 3G0EA 5K4JA 4CSVA 2UVXA 4NCTC 4CV9A 3FQSA 3P23A 1BL7A 1W0XC 4R7IA 2XEYA 2Z60A 1NA7A 4XV9A 3VS1A 3VRZA 5L2TA 1QL6A 3V04A 2JKOA 2HIWA 3NGAA 4RWJA 5AUUA 4X7QA 4KRDA 2HZ4A 4RJ5A 5HG7A 4QP6A 3OUKA 2JBPA 4U8ZA 4ZS0A 4IE9A 2W5BA 3IW8A 4L6QA 3M11A 5C8NA 1WBSA 2XP2A 5T68A 2WTKB 4NM5A 5FTOA 1MQBA 4ZTRA 2IZTA 5LJJA 4PMPA 5E8ZA 2HELA 2R7IA 3D14A 4ZY6A 4DINA 3ELJA 2PE2A 3RPRA 3ZYAA 3RCJA 2GFSA 3VULA 4FSNA 4FV8A 2BILB 2BR1A 2W99B 1GZ8A 4E1ZA 4BL1A 4HZSA 2WPAA 2OW3A 2X81A 2X4FA 2JAVA 4D4VA 3NAYA 2B52A 4NW5A 3FMJA 4YZMA 3NNXA 4U9AA 5A9UA 4L00A 3VIDA 4QTEA 5JRQA 5G6VA 4EOMA 2HYYA 4RIWA 3PIYA 4IAZA 2QOOA 5AX3A 1CKJA 2PMNX 2VRXA 3F88A 3TJCA 4AAAA 4BTMA 2JC6A 3KEXA 1TQMA 5HU9A 2HW6A 4FSYA 5IEYA 3KF4A 4ACCA 2EXCX 2F2CB 3E3PA 3GT8A 4F9YA 1E1XA 4WNOA 4XBRA 5AM7A 3LM5A 4UEUA 3GU8A 3VAPA 3VBWA 3GCSA 4A9SA 5IISA 2XJ2A 4Z7HA 1ZZLA 1OKYA 4G6OA 2R3LA 2PZIA 4R5SA 3PVWA 5HZNA 2B4SB 4I0RA 3UVQA 4BI0A 1E1VA 1YDRE 4TNDA 2JKKA 5CI6A 3KVWA 4QMUA 5L8LA 4M15A 4R5YA 3UQCA 2O0UA 4QP4A 4BWKA 3I5ZA 3FLYA 4BICA 4CFFA 4E5AX 5AUTA 3II5A 3F2NA 4IB1A 4BN1A 3NYOA 2ZB1A 5KZIA 3M1SA 5HBHA 3TNHA 1H07A 4U45A 1KV1A 4FVPA 5K4IA 4C38A 5CSVA 3CTQA 1YOLA 5A6OA 4RJ4A 4V0GA 4FC0A 3KF7A 1YI6A 2G1TA 2W06A 4DITA 4YLLA 1OM1A 4QRCA 3IQ7A 4PRJA 4IX5A 5D12A 3RZBA 4PPCA 4BF2A 5M57A 2ETRA 2IO6A 1YOJA 2V62A 4GMYA 1SMHA 3G2FA 1FVRA 1Q8ZA 2AC3A 2QQ7A 5IH5A 1APME 1YQJA 2WKMA 2J50A 2X9EA 3Q6UA 4JAIA 3S4QA 3VBYA 4ZLOA 1O9UA 3T3VA 1KWPA 3TNPC 4F99A 3RPSA 2YM3A 4U0IA 2WMRA 4U6RA 5AAGA 1W84A 5EYKA 4GH2A 4GK4A 4IWOA 4NM0A 2FSTX 3ALNA 5HI2A 4CRSA 4DEGA 2HWOA 4E20A 2JBOA 4E8AA 5KNJA 3F3WA 4ZSGA 1WFCA 3UP2A 5AR3A 3QD2B 4W4XA 3L8PA 4F6UA 4YR8A 2ONLC 3BYMA 3R00A 4HZRA 4L3LA 4AFEA 4R7HA 3HP2A 1GJOA 4ITHA 2GS6A 3TZ8A 4C61A 4S2ZA 3D4QA 4AP7A 4E4LA 2WMBA 2WMTA 3DXNA 4QOXA 3WF9A 3V01A 4JX7A 3S00A 1JSUA 5C27A 4NU1A 5IMEA 4GFOA 5LMKA 3NZ0A 1JLUE 2YCFA 2VTPA 3MWUA 1JQHA 4BBMA 4FKJA 2HCKA 2HWPA 5B2MA 3Q52A 2ZM4A 3BQCA 3LJ0A 3BRBA 2BZHB 3ZBXA 1M2QA 4FIHA 5JFXA 2CGXA 3C4WA 1ZZ2A 3P7AA 5L4QA 5FXQA 3LFSA 4AFJA 3W33A 3UOJA 3ZO2A 4CFVA 1YKRA 3EFJA 4QPMA 3ZSGA 3VN9A 5KZ0A 3VUGA 2ZYBA 3CR0A 1UWHA 2UZEA 2CCHA 3QHWA 4YJNA 4H3QA 4KRCA 3SQQA 4D1XA 1DS5A 5CX9A 3OWKA 2A0CX 3FC2A 3ZUVA 4I5HA 2GNHA 1H1RA 4C2WA 4G17A 4FVRA 1U4DA 3K5VA 2X2LA 5ANJA 4CKRA 4BDHA 2JFMA 3KL8A 5LWNA 2JLDA 4ERKA 4FNXA 4RX7A 3FZ1A 4X2KA 5AA8A 3ORKA 2QHMA 4FKTA 2IZSA 4C02A 1WCCA 4IIRA 4ZZOA 1JKSA 4FTCA 2GU8A 4OW8A 3SDJA 3QTXA 5AR8A 2OG8A 1CTPE 2J0JA 3FKLA 3UG2A 3KMMA 2CHLA 4FZAB 3NIZA 1WVWA 2R3MA 5M4FA 4FV2A 4YBJA 5FD2A 4CYJA 2JAMA 3CIKA 2UW0A 3E92A 4EOIA 1UU3A 3O71A 3ZXTA 3O23A 1STCE 2H6DA 5GJFA 2YFXA 1QMZA 3IPHA 2Q0NA 3HV4A 3PFQA 4C4EA 3GFWA 3QRKA 4IXPA 4NW6A 4QYYA 3U8WA 2W96B 3CEKA 2I6LA 3QRUA 5JQ5A 5KKRC 4S33A 5HX6A 1YDTE 2PVYA 2J9MA 3BE9A 2IJMA 4IM0A 5TE0A 4A9UA 2BAJA 1H24A 4ANLA 3NEWA 5IF1A 1UNLA 3MVLA 2HZ0A 4EOPA 3MFUA 1J91A 4BTKA 3CY3A 4KSPA 1JOWB 2OF2A 4YO4A 5I3OA 2G01A 4OBQA 3KN6A 3WYYA 4EOOA 4DGGA 2X8DA 5IUIA 5T6KA 1YHSA 2WGJA 3V8TA 4XUFA 3FMHA 3A2CA 5EHOA 5EW9A 1Y6BA 4J98A 4H3PA 4KABA 4EH7A 2VTOA 3W8QA 4XBUA 3I60A 3BIZA 4YJQA 3RTPA 4B8LA 4RWLA 4IVAA 4BB4A 2UZVA 3OG7A 3OS3A 4O0TA 2QO9A 2OJFE 4KKGA 5K3YA 4EOLA 1ZY4A 3DPKA 5A14A 2Z7LA 4I20A 3EFWA 3Q9XA 3GU7A 4YPSA 3CPCA 1X8BA 3FQHA 4C37A 3K3JA 3Q4ZA 3TKHA 3HZTA 2IVUA 1F3MC 2C3JA 4XCUA 4FSZA 3FYJX 4JX3A 5I9XA 5A46A 5M4CA 3NWWA 2HXLA 4OTFA 5E7RA 4WSYA 4ZOGA 1ERKA 4RFMA 5L3AA 4LGGA 3DOGA 2FH9A 2PVKA 2XKCA 3BKBA 3QD0A 2A1AB 3MPMA 2I0YA 5DIAA 3LQ5A 2EU9A 4RA4A 3KMUA 4Y72A 2OZAB 2YACA 4CXAA 4ACGA 5H3QA 4X3FA 2C6EA 3UIBA 4KIPA 2RFNA 4YBKA 4F9CA 4J8NA 3HA6A 3MH0A 3W2QA 4ANMA 4ZAUA 5L2WA 2B54A 4H58A 4OTDA 5F20A 3HMIA 4OBPA 3RAHA 3SXSA 3G9NA 3A7IA 4LL5A 5HIEA 4LUEA 3HA8A 3G0FA 4F6SA 5HIBA 3SHEA 4DH3A 3KXZA 4DLIA 4GU9A 4EWHA 2YJSA 4N70A 5IEVA 3SOAA 3UMXA 3UTOA 4M0YA 2C3KA 4P5QA 3EZRA 4XX9A 5CWZA 4BCQA 3DJ7A 3UYSA 1WBWA 2JFLA 1XH4A 4I23A 1MRUA 5AAEA 3CGOA 2W0JA 4PMTA 3W1FA 3O7LD 3VVHA 5L8KA 3TUCA 4WG3A 1WVXA 3EFLA 4X6RA 4TT7A 2OXXA 5JFVA 3AG9A 4I41A 3GCUA 4BGGA 4RGJA 3FPQA 4AUAA 4FV7A 2C68A 4Q9ZA 5AMNA 3OF0A 5A4TA 5DEYA 5HE3A 4F1MA 4ANSA 5EOBA 4MKCA 3UC3A 1PXPA 4ITIA 3TIZA 2A4LA 3D0EA 3JXWA 5LMKC 2BDJA 1IA8A 2W1HA 3RK9A 4D4RA 4BCMA 3PP0A 3A7HA 2R3HA 3HV7A 3FSKA 3WZDA 4OTRA 5BVNA 4MH7A 4G3DA 4MF1A 1PMVA 1I44A 2CPKE 2O65A 4RIYB 5CQWA 4MBJA 5AR5A 3EN4A 4HVDA 4L45A 1L3RE 4BVUA 4QYEA 3PA3A 3DFCB 1Q4LA 3NYNA 1FMKA 3VUHA 3TTIA 4BDCA 4PDOA 4ERWA 1QPDA 4IX6A 3BEGA 3GU6A 3W16A 3AC1A 3LZBA 2QOFA 3ORMA 3OHTA 4GW8A 4F7JA 4M3QA 2X8EA 3W18A 2V22A 3OCBA 2BTRA 4KD1A 4LRMA 3DNDA 3NS9A 4GUBA 2BAQA 3KULA 1ZMVA 4W9WA 4WD5A 2VWBA 5JQ8A 3IW4A 4H39A 2DQ7X 3QTZA 4LOOA 5D7AA 3FBVA 4YTIA 2ZV7A 4ZZMA 4EOQA 3OBGA 4FKLA 4OBOA 4Y83A 5GJDA 3PA4A 1FVTA 3GVUA 5DE2A 3WZEA 4EYJA 4DGOA 4MD9E 3C4FA 3EQDA 4EK5A 4ZLYA 3DZQA 3ZLWA 4IAAA 2VO6A 2VGOA 2ITQA 3KFAA 3I0OA 4G5PA 5HNIX 5KMOA 5E92A 4EH8A 4M68A 3V5JA 3PA5A 5GZ8A 2WOTA 2XK9A 3OT3A 1UU8A 3F69A 2XCKA 3V6SA 5H8BA 4M12A 2BDFA 3RWPA 4MBLA 5A4LA 4FKQA 2YM6A 3O96A 4EZ7A 3BYOA 3PXKA 5DN3A 4N6YA 5K0XA 4BTJA 5C9CA 3OTUA 2R3IA 4LM5A 4F4PA 2X6DA 1ZAOA 4CRLA 4HCVA 3F6XA 3U6JA 2P0CA 4A06A 4FL1A 2VWXA 2F7ZE 4G3FA 4J8MA 1TVOA 2R3PA 4GEOA 2XB7A 5CASA 4WOVA 2V5QA 5DFPA 3Q4CA 2WQEA 4G3GA 2YISA 2BCJA 3FJQE 3PG1A 4QTBA 3RNYA 5BPYA 1H27A 4U3YA 1VZOA 2VTSA 3GB2A 4V05A 2CJMA 3I1AA 2VZ6A 4BZNA 3OTVA 3FE3A 2VAGA 1JVPP 1SNUA 3PE2A 1XKKA 3JS2A 2BRHA 3PPKA 4P2KA 1SM2A 4YTHA 5M53A 2J0KA 4TY1A 4Z55A 1RQQA 2BZKB 3QQFA 3PPJA 3QD4A 4RFYA 4DG0E 4G6LA 3FZTA 4JG8A 3PYYA 5HE2A 1ZOEA 3CC6A 3DNEA 4YP8A 3C0HA 2VO0A 4HGTA 3TWJA 4BCFA 5KUPA 1W83A 2XH5A 5JFSA 2F7XE 3VW6A 1M2RA 3DK6A 2Z8CA 5K0KA 1V0OA 5H8EA 2WB8A 5KCVA 4APPA 3Q9ZA 2VWYA 2Y4IB 3H0ZA 5IEXA 3C9WA 2P2IA 4XP0A 5FDXA 4CTCA 1BYGA 4IWDA 4D1SA 4I6BA 3NUSA 4YGAA 5GZ9A 3R8LA 4CLIA 3MS9A 4LYNA 5LVPA 3QTSA 3ZEPA 1RW8A 3LFQA 3ZUUA 5HHWA 1YDSE 4FT7A 4OAUC 3SLSA 4C58A 1GOLA 4HVGA 1ZRZA 2BVAA 2WTCA 4PPBA 4DEAA 1SVGA 5CVGA 2PVRA 4E6DA 5EFQA 3DLZA 4FKVA 2OKRA 1KOAA 2QOCA 3P7BA 4G9RA 4MTAA 4M14A 2QD9A 1V0BA 4BCPA 3D7TB 3NR9A 5G1XA 4YLKA 5FWKK 2J5EA 3O8TA 3UZPA 2Q0BA 3EQGA 5CZHA 2YDJA 2YWPA 3HGKA 5ETFA 4PL3A 4BBEA 3H30A 4D2TA 5BQ0A 4QMYA 3QCQA 1R1WA 4DH8A 4JQ7A 2W4KA 5HX8A 4CEGA 2VTAA 1OPLA 3HMMA 5HOAA 2Y9QA 4IAKA 3F3VA 3CQWA 4K18A 3OEZA 5EHLA 5FLFA 3FQEA 3QZIA 5CF6A 1ZWSA 4WA9A 5IH6A 3ZC6A 4OGRA 3VF8A 4ACMA 4I92A 1Q8UA 5HCZA 5CSWA 1WBPA 3WE8A 2CLXA 4YZNA 4G6NA 4ZLZA 4DH5A 4K33A 1GIIA 5EKOA 4I21A 5AV2A 3V3VA 2C6KA 3V5TA 3KMWA 3KCFA 4FNZA 3ENHA 1JNKA 2XKDA 3ERKA 4FZDB 3TL8A 4FIFA 5IDPA 2W1IA 3LFAA 3OCSA 2W1EA 1Q61A 2XNMA 4TPTA 4V04A 4RLKA 3TG1A 3V6RA 4AN3A 3JVSA 2WELA 2YABA 1JWHA 2R3GA 5AR7A 3UNJA 3F61A 2W5AA 4UXQA 2BFYA 3GCPA 2OICA 3QX4A 2OIQA 4BTFA 1PY5A 3UMWA 4IACA 2OXYA 4S32A 4QMPA 2WO6A 4HGEA 4FI1A 5AP5A 4W8DA 3VUTA 4AZSA 4DAWA 4FV9A 5IPJA 2NRYA 5FXSA 2XS0A 5C8MA 3F82A 3BYSA 5HVYA 2XF0A 2ITXA 1CKPA 2FO0A 4EOSA 2ZVAA 5BMMA 5BNJA 3NRMA 5I9WA 2QOQA 1YWRA 4XLVA 2HAKA 3A8WA 4U7ZA 5HBEA 5I9YA 5FXRA 2QI8A 4LL0A 3BHYA 4QTCA 3CKXA 2I1MA 4EK3A 2X8IA 4UZDA 5JZNA 3D7ZA 4G9CA 2PK9A 4ITJA 4ZY5A 5J9LA 1P5EA 4O0RA 3KRLA 5KHXA 3A7JA 3LJ1A 4RMZA 4ALUA 4GG7A 3HMNA 3R04A 3QHRA 3EYHA 5KMIA 3RCDA 5CT7A 4OTWA 4P5ZA 3EJ1A 3LXLA 3MW1A 3ANQA 5L2IA 4NKAA 5EYDA 3PXQA 1XBAA 3QA8A 3N51A 3L8SA 3W2OA 5CXZA 3GNIB 4FL2A 1XBCA 4WKQA 4O38A 3JY0A 5K5XA 1XH7A 4AW1A 4RJ8A 4BIDA 4UMUA 1Y8GA 1H1PA 5J9ZA 1YXSA 5TO8A 5E8YA 3TZ9A 3K5UA 4PY1A 5CENA 3ZLYA 2V7OA 2BTSA 4O1PA 4QP8A 4YC6A 2J0MB 2C6TA 3C1XA 2YM8A 2E9OA 1M17A
chains in the Genus database with same CATH superfamily
4NIFB 3Q3BA 2J90A 2VTHA 3R7EA 4C0TA 3R7GA 1WBNA 3Q04A 5EYMA 3ZHPC 4AT4A 1R78A 3PJ8A 5E8WA 2QOIA 3KRRA 4W4VA 2WMUA 1MQ4A 3FL5A 4L53A 2X4ZA 3A60A 4QPAA 2GDOA 4O21A 2OSCA 1YHVA 4I93A 4WSQA 1A9UA 4U40A 3WF8A 3MVMA 3VUMA 4JRNA 5HICA 5HEZA 3KK8A 3R9NA 2AQXA 4F7SA 4IC7A 4AWIA 4ZJVA 3EN7A 4D0XA 3ZO1A 5EW8A 2ERKA 2ITZA 2QR8A 3GC8A 1XR1A 3KN5A 3PXZA 4HNIA 5L2SA 3AD6A 1URWA 4QQCA 3QKMA 3VJOA 4WO5A 4TYHA 4FV0A 4JR7A 3ZMMA 4UY9A 4HVHA 3POZA 2C3IB 4TNBA 5C8KA 2WMXA 2GTNA 3TJDA 3S95A 2NRUA 4AZEA 2HW7A 2XK7A 2RFEA 3QA0A 4QP2A 4CD0A 1WBTA 4FKWA 4MQ2A 3P7CA 4ZIMA 3ZO4A 3ZLSA 4BCGA 1Q24A 4A7CA 2EXMA 1YVJA 2UW3A 3DJ6A 2P3GX 3A61A 5K9IA 4BGHA 4E4MA 1BMKA 3EN5A 4JIKA 2BPMA 3EN6A 2GNLA 1AQ1A 2CLQA 1YWNA 4B7TA 1H08A 3MH3A 4N4SA 3C4EA 3W32A 3QQLA 2J6MA 2YM5A 4UX9A 3G6GA 3RWQA 2JIUA 3S2PA 4OTQA 3R1YA 2WU7A 3QAME 4XG9A 5CQUA 2V0DA 5HLNA 3R28A 3WILA 2F49A 1KE9A 3R71A 5CYIA 4YSMA 5J1VA 5HE0A 3L1SA 5TKDA 3ZC5A 2NP8A 4IANA 3KKVA 3AMBA 5CVFA 5BVKA 2J0LA 4ASDA 4AW5A 3KXXA 5LVOA 4EHEA 1H1SA 1GAGA 3SW7A 3AD4A 2R3QA 3GQLA 1MRYA 2OBJA 1PXMA 5J87A 4A07A 5LCJA 3TTJA 2VGPA 4YZBA 4OTHA 5HG5A 4DN5A 3KRJA 2GSFA 5AIRA 4OT6A 4B99A 2OH0E 5FBNC 1U5QA 3CQUA 3FMMA 1WVYA 1OKVA 5DT0A 3MB7A 3QZHA 4U3ZA 3WZUA 1XO2B 2X2KA 2X6EA 4TWOA 2XYNA 1H28A 4IJ9A 5CZIA 1XHAA 4NJ3A 4TN6A 3U51A 1PKGA 2F2UA 2IVTA 2Y0AA 2CGWA 4AA5A 4JDJA 3NUUA 4C4IA 3SAYA 2XIKA 2X7GA 4M8TA 3TV6A 2QODA 4FSWA 1I09A 3D5UA 1OZ1A 3OD6X 4I6HA 2GHMA 3Q9YA 2JDOA 3I0QA 1J1CA 4TRLA 4CVAA 2XKFA 4XYFA 4JG6A 3RM6A 1GZOA 1H00A 3E7OA 3LFDA 4O4FA 3FXWA 3UNZA 2C3LA 2W1CA 4I6FA 4QT1A 5TR6A 1Q3DA 1JKTA 4FSTA 3EH9A 4Y46A 4MXXA 4FYNA 3TV4A 5HCXA 5EM5A 1JSVA 2XNPA 1XQZA 3DAJA 3ACKA 4QTAA 4YURA 4U43A 4FBXA 5EOLA 3KY2A 4XOZA 4ALVA 3QTIA 4YUQA 4QMVA 4IFCA 4U44A 3DU8A 4QO9A 3V5WA 4D2PA 5D41A 4QYFA 2QHNA 3H9OA 3PSCA 1P4OA 5DEWA 4L46A 4ACHA 3FZPA 3KC3A 4UWYA 3W10A 3LMGA 3PZEA 2GTMA 3AT3A 3F2AA 3O8PA 3VC4A 4FIJA 4IM2A 1XH5A 4B4LA 3CQEA 3EQPA 3LCDA 4IH8A 3T3UA 1PXOA 4AOIA 3MGYA 3VS4A 3E62A 3DBFA 1PXLA 1NY3A 3BV2A 3MJ1A 5LVLA 1FPUA 4AACA 1CMKE 3ODZX 2BZIB 3R0TA 2YDIA 4NZWB 5A3XA 4LGHA 5FEEA 4EC9A 5ETAA 5J7HA 5F95A 1GNGA 1F5QA 3L8VA 4ALWA 2YA9A 3KB7A 3R1SA 2FB8A 3GC9A 3H10A 4Q5HA 1XJDA 2I40A 2OI4X 2UZOA 3DBCA 3RINA 4FYOA 3UE4A 3HYHA 3MV5A 4MNEB 4R1YA 4JBPA 5EYCA 3SKCA 4YTFA 3GI3A 4OLIA 3HP5A 4O22A 4KIQA 3DQXA 4DFXE 3SVVA 3PXYA 5HNGA 1TQIA 5AADA 3PE1A 4RIXA 3MBLA 4XV3A 4AW2A 3R7IA 4IAFA 4K6ZA 1LEWA 3QUEA 5A6NA 5HTIA 3A7FA 4HJOA 4RJ3A 4MXYA 3ZM4A 2WAJA 2X0PA 4BCNA 3QQJA 4LMUA 2XEZA 2ZM3A 3DA6A 3R1QA 2R3OA 5CSHA 2UW6A 4J95A 4F9AA 4R1VA 2PHKA 3CS9A 3E64A 3R21A 5D9HA 2CDZA 3C4CA 4AS0A 3NLBA 2BRGA 4RVTA 4LI5A 3CCNA 5AJQA 3E8DA 3LFNA 4L3JA 3DK3A 2W9FB 3UC4A 4QMMA 3BV3A 3SRVB 4BHZA 1CDKA 2B53A 3IO7A 3TI1A 4C59A 2H9VA 5LWMA 3UOKA 3POOA 4USEA 1JAMA 4D2RA 3QRIA 4M67A 2FUMA 3VS2A 5KKRB 3M42A 3RK5A 3K3IA 5CU0A 2PVFA 4NEUA 2ITTA 4D4YA 4I4EA 4W8EA 2V7AA 1P14A 4ZJJA 3ZSHA 5AUXA 4FICA 4QP7A 4ANOA 3DBQA 2Y6OA 3NAXA 4GU6A 3ZONA 4DEDA 4F9BA 3I6UA 2GHGA 3VO3A 2VWUA 3NCGA 4FOBA 3ZZWA 1M2PA 2PVJA 2YAKA 4AF3A 4E4NA 4IZ7A 2PVMA 2XK3A 3OBJA 4ASEA 5B2LA 4CYIA 2Y7JA 5I9VA 4RSSA 2XNOA 5J79A 2H34A 3OWJA 2OJGA 4JR3A 4EKLA 3AT4A 4D9UA 4AE9A 5JFWA 2HENA 4NK9A 3FXXA 1YW2A 4XLIA 4RIWB 3WZJA 4X2JA 3OY1A 1J1BA 2QO7A 3H3CA 4M97A 4TWNA 4L42A 3ROYA 4O0YA 2ITUA 4CFWA 4GL9A 3DB6A 3IOPA 4HPTE 1Q8WA 1W2FA 5LCKA 2R0IA 3HV6A 4UZHA 5ANDA 3CTHA 4B8MA 5GNKA 1ZYCA 4YNOA 3UQGA 4XG2A 4EKKA 4RQKA 1B38A 2BHEA 2RG6A 2OWBA 1MP8A 4GIHA 5M44A 5DR2A 4JDKA 1OPJA 4FIEA 5JK3A 4RVLA 4EOKA 2UUEA 3VNTA 3MDYA 1UU7A 2C6DA 4YO6A 3F3ZA 3OC1A 3QZFA 5CU3A 1IR3A 4J53A 1IEPA 4DLJA 3U9CA 4IM3A 1B39A 2A2AA 4A9TA 2PVHA 5HG8A 1SYKA 4XP2A 4A4OA 3QCSA 4IQ6A 3EYGA 4MCVA 4QD6A 2HXQA 5ACKA 4EH5A 2GS7A 4J97A 4PPAA 3GCVA 1VYWA 2OF4A 2PVNA 3G33A 5EM6A 1OIUA 3C7QA 4UMTA 1YXTA 2PUUA 3OMVA 4FTRA 4YC8A 1CSNA 3RJCA 3QKLA 2JKMA 2QU5A 2WTDA 3P4KA 3PWYA 1Y91A 1OKZA 2XIRA 2P33A 4YJOA 2QLUA 3GC7A 2P55A 4WRGA 5CALA 4E6QA 1K9AA 2FGIA 5D10A 4EORA 2PL0A 3OOMA 5FGKA 3DLSA 5DG5A 1BUHA 3IOKA 4Y85A 3RHKA 4JT3A 5CEQA 3V8SA 3BYUA 2QCSA 4WG5A 2I0EA 4FIGA 4QMLA 4DEHA 2EWAA 2J0IA 3VRYA 4LUDA 1RJBA 5HE1A 4LRKA 3AT2A 2XKEA 3MY0A 5EDRA 3RP9A 2AC5A 2Z7SA 1Q8YA 3KXMA 4H36A 4U79A 5AP3A 2GQGA 5L6OA 4Z16A 5JGAA 4CQEA 2BRNA 3ZRMA 5EW3A 2C69A 4TXCA 1O6KA 4OTGA 4BWXA 3FLWA 3Q6WA 3GGFA 2LGCA 2B7AA 3R7YA 4B0GA 3OW4A 4GYIA 1UNGA 4JL9A 4RIOA 4U80A 5AP1A 2VX0A 5J5TA 3O51A 2UV2A 4FODA 2B55A 4TWCA 3BGPA 3OWPA 4BCHA 1SVEA 2O8YA 4CZUA 4JOAA 3QFVA 4WIHA 5LARA 3W55A 3ZFMA 4DBNA 4PMMA 3R7UA 4IX3A 5JGBA 2JDRA 5GHVA 4JNWA 1OB3A 3RPOA 4JG7A 3LJ2A 2QURA 4GT4A 3UPZA 2IW9A 1ZYLA 5FQDC 3LFCA 2DS1A 5LMBA 3VQUA 2G9XA 1O6LA 2YITA 5LXMA 3F3TA 4RA5A 5D7VA 4YTCA 3TNQB 1Z57A 3HDMA 4D58A 4P90A 2VNYA 4HCTA 4I24A 2VWIA 2XK4A 3DDPA 3VWAA 5DGZA 2UZBA 2UVZA 1W2CA 1UKIA 4PTGA 4IC8A 3C50A 4MWHA 2HY0A 4G3EA 4PMSA 4YJVA 3MIYA 3HV3A 2QOHA 4YJPA 2ZMCA 4ZSAA 4EBVA 3LAUA 2R3JA 2HOGA 2I0HA 2J51A 3I81A 4KWPA 3TT0A 2CCIA 3PIZA 5F4NA 5HORA 1PF8A 1PKDA 4PTEA 2G2HA 3V5PA 5DR9A 4O6LA 4C3PA 2W05A 3NYVA 5CSXA 2WD1A 3E8NA 2RKUA 1NVRA 2C5OA 5I9ZA 2RGPA 4FNYA 4ZP5A 2WEIA 2PMLX 5CI7A 2XZSA 1JBPE 4AOTA 3GU4A 2BUJA 4XNEA 4M13A 4ZTMA 3ENMA 1UWJA 3QQUA 4OT5A 4QMOA 4O0XA 3COKA 1KSWA 3HMPA 3KGAA 3OROA 4IMYA 2R9SA 4NUSA 2ZOQA 5BVFA 4JQ8A 1UU9A 2XJ1A 5CY3A 4KIKA 2R0UA 3MTFA 3ZSIA 4DTKA 5IG1A 2UZUE 3I7CA 1PW2A 3QQKA 3R83A 4CMOA 4D5HA 2WXVA 3BHHA 2REIA 2VTTA 3W2CA 4RC2A 4GSBA 3LQ8A 3NUXA 4F7LA 2BZJA 3MY1A 3ZRKA 4CFUA 5AV3A 4IVDA 4G31A 3AOXA 3IECA 1PMEA 4Q5EA 4YHTA 3ZOSA 1M7QA 1VEBA 4D9TA 2OU7A 4JJRA 1OIRA 1FINA 2W4JA 4K0YA 3OOGA 5DHJA 3ULIA 2CKEA 3QTWA 2VD5A 5DI1A 5HD7A 3UIXA 4I94A 2YM4A 3KXNA 2RF9A 2XRWA 4RT7A 1MUOA 3TV7A 5IA1A 1SVHA 1W8CA 2OXDA 3UO4A 3IW6A 5AUYA 3RGFA 4O4BB 4L68A 2GNJA 3ALOA 3I6WA 4IFGA 1UV5A 4Q9SA 2H8HA 2C6IA 4BKZA 3LXNA 3NIEA 4KB8A 4DH1A 3E8EA 3NUNA 4AN2A 4D4SA 2VTIA 4EOJA 1LUFA 3AC3A 4DG3E 2A19B 5CU4A 4NFNA 4GVAA 1P2AA 2XIYA 3Q60A 2GNGA 5E8VA 4FV1A 4C33A 5AUZA 3UG1A 1OUKA 4NM7A 4I5MA 3BU6A 3T9TA 5M4UA 1R3CA 4IJPA 3QGWA 4XG6A 3OEFX 3I79A 3EIDA 5B7VA 5JKGA 3AC8A 1QCFA 3NW6A 4FTIA 4F09A 3GOPA 2PMOX 3BE2A 2HZNA 4FV6A 1DAWA 1H4LA 2XRUA 4XH6A 5AP4A 1H0VA 4GJ3A 4X3FC 4XV1A 4KAOA 4EK4A 3PG3A 4JBQA 3TEIA 1PXNA 1XH8A 2WEVA 3DY7A 2W9ZB 3NW7A 1W82A 4AZFA 2R3FA 4BDDA 2ZJWA 3PLSA 3DAKA 1W7HA 3VS7A 4G1WA 1NXKA 2C5NA 4L52A 3QL8A 4RX8A 4BWPA 5DRDA 3ORXA 3MH2A 5AR2A 3SX9A 3VBXA 3K2LA 1H25A 4BDFA 3FC1X 3UNKA 3LOKA 3MB6A 4C4HA 4GRBA 3E8CA 2UW8A 2CSNA 2JGZA 3IGGA 5IA4A 3R6XA 3A62A 4IW0A 2BROA 3AGLA 2VTRA 3D2IA 3WYXA 5ACBC 3U6IA 4I0TA 2X0GA 4S30A 2YN8A 3B2TA 5EHYA 3MPTA 1YHWA 4M0ZA 2WQMA 4KINA 3P08A 4EZ3A 2VWZA 2PZPA 3F7WA 5CNOA 5L6WL 4UWBA 5E1EA 3BBWA 3GFEA 5HQ0A 3GP0A 3ZFXA 5BUJA 5CF8A 1BI8A 2QR7A 3E63A 3FI4A 4MXZA 4X2FA 5BVWA 4BKJA 5M56A 2ESMA 4AG8A 2ERZE 2W1DA 3LCSA 3ORPA 4FVQA 4L44A 4C8BA 2BFXA 3FMKA 4FSRA 1OL1A 4QPSA 3G9LX 3ORZA 2QO2A 1G3NA 3C0GA 4J71A 4QMNA 3H9RA 3ZO3A 2UW5A 3CKWA 4O4EA 1H1QA 4CMUA 4CNHA 3DTCA 1OVEA 3IW5A 1OKWA 3ZZEA 3U6HA 3T9IA 2C5XA 2DWBA 5AV1A 2Z7QA 4GT3A 3BU3A 4UMQA 1OIYA 1YWVA 4U81A 2QKWB 4WNPA 4UMPA 5L6PA 5AWMA 3OW3A 4I6QA 3KULB 2XK6A 3F9NA 3QRJA 3QU0A 2PMIA 4BCIA 3FI3A 3Q32A 4HGSA 2BKZA 4O4DA 5ANGA 3CTJA 2C0OA 4FTTA 5CEPA 1ZYDA 2F9GA 5IA5A 4HPUE 3FLZA 3UYTA 3RKBA 4BFMA 4HCUA 3UJGA 2YEXA 3KCKA 3AMAA 3MVHA 3O0GA 5L8JA 2VO3A 4DFYA 3L9MA 3GXLA 4BCKA 4YZCA 3HNGA 1FGKA 2ITVA 2JDVA 3ZFYA 3BX5A 4HYIA 3QZGA 2QOKA 3AC4A 4IAIA 2IW8A 3UVRA 4CQGA 3RALA 2XNNA 2H96A 1UNHA 3F5XA 4D1ZA 3BLRA 2YJRA 4YMJA 3NNUA 2OFVA 3PVGA 4M69B 5HCYA 5DMZA 2B1PA 4XG3A 3ORLA 5AV0A 2IN6A 1KE7A 2P2HA 4YHJA 3DBEA 3ETAA 4CMTA 4F1TA 4FX3A 4IB3A 2WMAA 5BYYA 1KE5A 4FGBA 3TKUA 4KS7A 1XWSA 2E9VA 4E5WA 5E8UA 4J52A 4CCBA 5I0BA 3D5XA 2BRMA 4O2ZA 3VW8A 1MRVA 4RC4A 1PXIA 5M55A 3ZXZA 4F64A 3VUKA 2OJ9A 4RPVA 3LE6A 2PE0A 4K1BA 4AE6A 1ATPE 4WNMA 3RAWA 3AXWA 2F4JA 4IBMA 2QOLA 4RJ7A 5I4NA 5CEMA 2RFDA 4BZDA 3VBVA 1IRKA 4E26A 3R9OA 4FK6A 3PTGA 5HVKA 1NVQA 1PHKA 1LP4A 1GY3A 3IDCA 2GCDA 2PTKA 2IF8A 3Q9WA 3BPRA 5JSMA 4RX5A 1H8FA 4YSJA 3JYAA 4PQNA 4GVJA 4I3ZA 4TKSA 4RLLA 2ZDTA 5DNRA 3HVCA 2IWIA 4MAOA 2WQNA 3GEQA 3VUDA 3ZBFA 4BDIA 5JZJA 4GK2A 2EXEA 2HK5A 5B2KA 5IA3A 4QMZA 4JIAA 5I9UA 3U9NA 4EH9A 1OL5A 4D2WA 1DM2A 3B8RA 4ZSEA 1Q62A 2XJ0A 1PMNA 4C57A 3LFFA 2CGVA 4EH3A 4F65A 5IA2A 4EQMA 3QTUA 3L8XA 3P86A 4BKYA 2YIYA 5ANKA 3F5UA 2GS2A 3FMEA 3MFRA 4MX9A 4L3PA 4AA0A 4JS8A 2EB3A 3A7GA 5AP7A 3NX8A 3EFKA 5I5ZA 2ZB0A 2YZAA 2JIVA 3ODYX 5CTPA 3FZRA 3WIGA 2VTJA 3PPZA 4CFMA 4FT9A 4PX6A 4QYHA 5KX8A 3EQHA 5ANIA 3F3UA 4BCOA 5BMSA 3O8UA 5B0XA 3LIJA 5KE0A 1ZOHA 3LXKA 4YZDA 5CF4A 5K5NA 3ZH8A 1U54B 3ZEWA 1VYZA 3NNWA 3HDNA 4RVMA 3JVRA 5EH0A 3UIUA 4DFNA 3HKOA 3QD3A 2QC6A 4L7FA 4USFA 2YIWA 2ETKA 3WIKA 3ZS5A 3A4OX 3D5VA 3OT8A 4UYNA 4EEVA 3S3IA 3D2KA 2JIIA 4NKSA 1EH4A 4E5BA 4LV5A 2PWLA 4DFLA 4FSQA 1UA2A 3WARA 4RWIA 4M66A 4EYMA 1ZARA 1Q41A 3SXFA 3LLTA 4CLJA 2BALA 4MF0A 4MD7E 4E73A 3UOHA 5AP2A 2YIQA 1H01A 3VJNA 2QLQA 4HOKA 3EN9A 4YLJA 3MIAA 4F08A 5JN2A 1PYEA 3EWHA 2YAAA 4DHFA 2XA4A 3V5QA 2FSMX 4BYIA 3HUBA 4EUTA 4ZSLA 1GZKA 4GUEA 3JPVA 5HGIA 4F0IA 3VHEA 5ANEA 4FTUA 2JITA 2VN9A 4KBKA 4O0UA 4O96A 3ULZA 2GNIA 4W4YA 4ANBA 4C4JA 4FV4A 4O0WA 3CY2A 4MQ1A 5FP6A 3BHTA 2WU6A 3LCOA 4EH4A 1FGIA 2OIDA 4RQVA 5CU2A 5KBRA 2PZRA 5M4IA 2B9FA 4PWNA 1H0WA 4HW7A 1IASA 4D2VA 4EJNA 1OIQA 5D1JA 4XHKB 4BCJA 4EI4A 3SV0A 1WBOA 3WBLA 4EBWA 1A06A 4ARKA 3FKNA 3BCEA 3MA6A 3MI9A 3MPAA 2XBAA 3ZLXA 3PXRA 1WMKA 4KS8A 4CT1A 4BIBA 4XS2A 3C13A 3TNWA 4LGDA 2VX3A 5CAPA 4II5A 4ANNA 4CKJA 2PZYA 2JEDA 3MA3A 5HBJA 2CGUA 2YLEA 2J2IB 5E91A 3I7BA 3TCPA 3EL7A 3PY1A 4FL3A 4X21A 4FV5A 4RRVA 5HG9A 3ROCA 3CBLA 4EHVA 4EH2A 5E90A 3N9XA 2WTKC 4WT6A 5A4CA 1GIJA 5KMNA 3UPXA 4DCEA 5L2QA 2O63A 4FTJA 3UBDA 4M84A 3R8MA 4MHAA 3EQFA 2R64A 1Y57A 4IVBA 3F66A 3QWJA 4QQ5A 4XG4A 1Y6AA 4KNBA 3RHXA 3KU2A 1PXJA 2C4GA 1OMWA 1S9IA 3QTQA 3QXPA 4QMSA 1LR4A 4BDAA 2GHLA 3QYWA 3G6HA 4C7TA 4TZRA 2G2IA 1JSTA 4PL5A 2BAKA 4APCA 3C4ZA 5DR6A 4AGDA 4HYUA 4E6CA 1WBVA 4FG9A 4FTOA 4DC2A 3W2PA 4BDBA 2ETMA 4MXAA 5JMSA 2R4BA 4BDKA 1ZY5A 4MXCA 4PDSA 5KMLA 1R39A 5FM2A 2KTYA 3VHKA 3WOWA 2C6OA 1M52A 5CAQA 1Q97A 2XNBA 3MFSA 3BI6A 4U97A 3U4UA 3NYXA 3VF9A 1Y8YA 3Q2MA 3C0IA 4IAYA 1URCA 1UKHA 4P4CA 4WHZA 5HESA 4PDPA 1ZYJA 5EM8A 5BVEA 1CKIA 3A99A 3DGKA 4XV2A 2LAVA 4F1OA 4UBAA 4L8MA 5AP0A 4AGWA 5HO6A 4CFXA 3EQBA 2OZAA 5CF5A 1YXXA 3F5GA 2BDWA 2OK1A 4FOCA 3D94A 1M14A 4FSMA 4PF4A 3TACA 4DEIA 5C26A 2YLFA 1REJA 1PXKA 4USDA 5KBQA 5DVRA 1AGWA 2J4ZA 3UO6A 5HIDA 4E7WA 2B9IA 4I5PA 3SC1A 2WHBA 3NUPA 4HVSA 2SRCA 2W5HA 1ZOGA 4FTMA 2W1FA 1YOMA 3R63A 3F7ZA 4RC3A 4YZ9A 4YC3A 1WAKA 4EQCA 2C1BA 4YJSA 1LEZA 5BUEA 5EKNA 5H2UA 4TYJA 4AT5A 4FTQA 4ZEGA 3R8VA 5AV4A 2O64A 3HMOA 3UVPA 3NSZA 4AX8A 4Y5HA 4TYHB 1NVSA 1P4FA 4QP1A 1SZMA 4JAJA 2XVDA 4TYEA 2X39A 3JUHA 4GT5A 4Z3VA 4FTNA 5E1SA 3TUDA 2ITYA 2ZMDA 1CM8A 3IG7A 4DEBA 4K77A 5J95A 4TL0A 5LMAA 3FY2A 4LRJA 4R8QA 4C4FA 3HRCA 3PSDA 4RX9A 4BI2A 1JKKA 3RK7A 4ASZA 2O3PA 1U46A 3FSFA 3H4JA 2XM9A 5CANA 3M2WA 5J8IA 2WNTA 3QLFA 4FG8A 3B2WA 3LHJA 3MH1A 3PRIA 2WQBA 3R30A 4UALA 4AGCA 4AZWA 3FMDA 4EQUA 3OCGA 3E88A 3ORIA 5CAOA 2VWVA 4XOYA 4Y73A 2UZNA 4AT3A 3CXWA 4W4WA 4EZ5A 5LQFA 3IW7A 3DQWA 4RWKA 1ZLTA 5C1QB 3DKFA 5FRIA 2NO3A 1OI9A 3HUCA 4MVFA 3O17A 3QXOA 4C3FA 4F63A 3EB0A 1YXVA 2CN5A 4O2PA 5FP5A 4MEDA 5F94A 4L67A 1OUYA 5IUGA 3ORNA 4YU2A 5T3QA 4D2SA 3NPCA 3GCQA 1KE8A 4I5CA 3ZU7A 5A54A 4RIYA 4ZTNA 2UZDA 3OCTA 2ZV8A 3MSSA 1AD5A 3QWKA 5JGDA 3UQFA 5DA3A 1VR2A 4CCUA 3IDBA 3RAKA 2XNEA 4KKEA 3EHAA 4BHNA 5CNNA 3PXFA 4CTBA 3F5PA 3OY3A 4FKRA 5HO8A 2ITNA 3U87A 3PIXA 5AA9A 2DYLA 4BBFA 3D5WA 4CZYB 3CPBA 2ITPA 2R2PA 3NNVA 4H1MA 2VTMA 3KQ7A 2PE1A 3TZMA 4EUUA 2ZV9A 2KULA 2PY3A 3BEAA 4ZTSA 4EK8A 4BDJA 3DS6A 4F0FA 3LCKA 2IZUA 3ZTXA 4N0SA 4FEQA 4NH1A 3D83A 4Y95A 1BKXA 3EKKA 3FYKX 1ZXEA 3OZ6A 4KIOA 2G15A 4QTDA 3BU5A 4RG0A 4AA4A 4A9RA 1BLXA 4C3RA 4F9WA 4PUZA 3HRBA 3SXRA 2XUUA 2ZDUA 3OP5A 1Z5MA 4FKIA 4IZAA 3UO5A 4XP3A 4W9XA 4LQMA 2VTLA 2YDKA 3BYVA 1J3HA 1JPAA 5GJGA 4GCJA 4NSTA 3MTLA 4MNFA 1W2DA 3PJ2A 1XBBA 3CJFA 4FKUA 3CGFA 4L01A 4O27B 5FEQA 4FRFA 2WTJA 2YHVA 3KK9A 1OITA 4AW0A 4V0GB 5EI8A 3P5KA 5CLPA 1XH9A 2BIYA 2E9NA 5FBOA 1DI8A 3D9VA 4ZSJA 3TN8A 4FA2A 1UVRA 2BHHA 1BI7A 3FL4A 4L9IA 3RPYA 4HGLA 4B6LA 4EHGA 2QONA 3ACJA 3WF7A 2J5FA 4LG4A 3WF5A 3EQRA 2ZV2A 5TOZA 3D15A 3UGCA 4FSUA 2FYSA 2RIOA 4O6EA 5AUVA 3LFBA 3RMFA 4DG2E 1KOBA 3QUPA 5HD4A 3BZ3A 2RSVA 4RZWA 4GFGA 3W2SA 4TYGA 2WMVA 2X2MA 3CJGA 3PVBA 5HU3A 2OZOA 2UW7A 2WMWA 1K2PA 4RZVA 1W98A 3KA0A 4JQEA 3BWFA 3GBZA 2AUHA 4V01A 3DKCA 4IX4A 1H1WA 5ETCA 2G2FA 4TWPA 2VTNA 4YPDA 4QQTA 2QOBA 3LM0A 4BDEA 3DK7A 4X2NA 3R7VA 3ZCLA 4UWCA 1FQ1B 4S34A 3R2YA 3OXTA 3FXZA 4IWQA 1H26A 3MFTA 4QP3A 4M7IA 1M7NA 4EK6A 2YIRA 1ZMUA 3GC0A 5CU6A 5CVHA 5F9EA 3FV8A 3CP9A 3AGMA 4CKIA 2ITWA 5LVMA 3FHIA 4Z7GA 4NT4A 1DAYA 4RIXB 3L9PA 5JT2A 3O2MA 4FT3A 4JRVA 5FEDA 4EH6A 2XIXA 5KMJA 4AQCA 3R01A 2X9FA 5HLWA 5IKWA 4JI9A 2CN8A 3LXPA 3QALE 4ANQA 5CXHA 3V8WA 4BI1A 4R3CA 3VUIA 5HLPA 2XBJA 1REKA 4MXOA 1KE6A 3VBQA 3P1AA 3R2BA 2YIXA 4FT0A 4J1RA 2VX1A 3P78A 4S31A 5AEPA 2FA2A 4FKGA 4K8AA 4RVKA 4U5JA 5DBXA 5E8XA 4UMRA 1OL7A 4GV1A 4AN9A 5IH4A 4Y5QA 2C6LA 4UB7A 3WE4A 4BYJA 1V0PA 3G51A 1QPCA 3U4WA 5JH6A 3R02A 2O2UA 4U41A 4N6ZA 4QNYA 3D7TA 4FR4A 2WZJA 4I22A 1BX6A 5BVOA 4JBVA 3AMYA 3QCXA 4BGQA 3LPBA 3FAAA 5A4QA 2EVAA 4FZFB 5IU2A 4FF8A 2QG5A 1HCKA 2XIZA 5DH3A 1Q3WA 2V55A 4G2FA 3FUPA 1G5SA 3EQCA 4DGNA 4FV3A 3C5UA 4RJ6A 4CFNA 3SA0A 4IADA 4NJDA 4FK3A 5HTCA 2QKRA 4FZ7A 5HVJA 2C0TA 4F7NA 3BLQA 1BL6A 2I0VA 3FLQA 4FTAA 4LFIA 3FZSA 3TKIA 5JEBA 2EUFB 5ANOA 3R9DA 3E5AA 4PL4A 4ONAA 3R7OA 3ZDIA 4YJUA 4OAVB 1HCLA 4FTKA 4R6VA 1XH6A 3EOCA 4F0GA 4IB5A 5HO7A 4NFMA 4U42A 4Q2AA 5EG3A 4DGMA 4IWPA 4TYIA 2UZLA 1T46A 5A4EA 3OXZA 4DGLC 3E3BX 4ENYA 5IDNA 4AU8A 5J9YA 3BHUA 2W7XA 1RE8A 4MBIA 4QP9A 4D0WA 3LVPA 1B6CB 5BVDA 3EKNA 3LW0A 3R1NA 3DTWA 4QMWA 4GIIA 5AAFA 3R8ZA 4C62A 1YRPA 3E87A 4FG7A 3VS6A 2Z7RA 1U5RA 2W1GA 3ANRA 2W1ZA 2Z2WA 1Z9XA 3QLGA 3QQGA 5BYZA 4ZZNA 3W8LA 1RDQE 3IONA 3VBTA 3KRWA 4WNKA 3OFMA 3HRFA 2ZAZA 3ZUTA 3V51A 4WUNA 3AD5A 3DT1A 3GU5A 3GOKA 4MYGA 4O0SA 3PVUA 1T45A 4M69A 5E8TA 3QYZA 3PUPA 2IVSA 3MJ2A 4IHPA 2WIHA 3QC4A 3VS0A 4XRJA 2C30A 4PTCA 4BIEA 3RAIA 2BMCA 4G16A 2JDSA 2OGVA 3ORTA 5FG8A 3DV3A 2E9UA 2X7FA 2XMYA 2UW4A 4KKHA 3R9HA 4BRXA 1TQPA 3OWLA 4JVGA 5BX0A 3C4XA 4X3FB 3MN3A 2QVSE 2FSLX 3VS5A 5F1ZA 5M51A 4MWIA 3PY0A 1Q5KA 3FI2A 4L7SA 3ZRLA 4OUCA 4GYGA 4WBBB 1ZMWA 4MD8E 4J7BA 5C03A 4GG5A 4HYHA 2VO7A 2YM7A 4K9YA 4X2GA 2WMQA 3TUBA 3PRFA 4L43A 1IG1A 4FT5A 5KMKA 3DKGA 1Q8TA 3R73A 2ACXA 4UXLA 3RM7A 3RNIA 1OL2A 3QQHA 2UW9A 4DH7A 5GZAA 3T8OA 2R3NA 4EC8A 3Q5IA 3BGZA 3HL7A 4QMXA 3COIA 4FUYA 3BLHA 4BC6A 1LPUA 2VV9A 4DEEA 2GPHA 3FDNA 4J96A 4FTLA 3NDMA 1K3AA 1OPKA