1CM8A

Phosphorylated map kinase p38-gamma
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
346
structure length
327
Chain Sequence
RSGFYRQEVTKTAWEVRAVYRDLQPVAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMGVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHQVQKYDDSRTLDEWKRVTYKEVLSFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHORYLATED MAP KINASE P38-GAMMA
publication title The structure of phosphorylated p38gamma is monomeric and reveals a conserved activation-loop conformation.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 327
sequence length 346
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1999-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1cm8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1cm8A01
1UNLA 3UDBA 4F70A 2B55A 4HVSA 2PMOX 4Y85A 4AFJA 2HW6A 2XRWA 1G8AA 3U4UA 3BWJA 1Q24A 4LM5A 5IQDA 4CFNA 1PKGA 2B9JA 5FXSA 2XEZA 4BDCA 1UU7A 4C3FA 4OTDA 3JR1A 3R73A 3QZIA 3BGPA 2ITXA 4IMYA 2E9VA 4LUEA 2C69A 3OCBA 1MUOA 5JN2A 4QYGA 4MX9A 4IM2A 1YI4A 4YC8A 3A60A 2C5XA 3WZKA 1F5QA 4GEOA 3AT2A 4F7LA 2W4KA 2R7BA 5IZFA 4HPTE 4MK0A 4UMUA 2X8IA 3GBZA 4WG3A 2VWIA 3GUBA 3D83A 4MCVA 5L8KA 3PIYA 5L3AA 3GU7A 1FVVA 4C38A 2JKQA 2YCFA 2B4SB 5CZHA 2UZBA 3VQHA 3UMWA 3WYYA 4D2VA 4W8DA 4BGQA 3FMMA 4J53A 3UC3A 3PXQA 5HE0A 3OT3A 3TZ8A 2XRUA 3V5TA 1UKIA 3TZ9A 3U6HA 2AC5A 3COHA 2PZPA 2AYPA 2V62A 4RQVA 1DM2A 1XH5A 3E93A 4G3DA 3V01A 4LGDA 2OH4A 3MY5A 3HMOA 3L8PA 3PPKA 4UWBA 5AR4A 2PUUA 3ZEPA 3MS9A 3EH9A 3OUKA 3FYKX 3KA0A 5BX0A 4YJOA 3HZTA 4EWHA 1U5RA 4GT5A 3VBQA 3NCZA 3BWFA 3UIMA 5D7VA 4FVQA 5IKWA 2XNGA 4Q5HA 3VHEA 2BAQA 4ITIA 5IEVA 2X7FA 2OSCA 4FK3A 4GG7A 4O0WA 4E3CA 5JQ8A 5D9HA 2JDTA 2PL0A 4IDVA 5DPVA 3TNPC 4AA0A 2JDRA 5KMLA 4ZLYA 3IGGA 4KRCA 2GQSA 1ATPE 4D1XA 3LVPA 4NM7A 3C9WA 4JDIA 3HMNA 3LZBA 2I0VA 4AN3A 4YTFA 4KUJA 4ZEGA 3Q2JA 1DI9A 3IKAA 4FTLA 3RAIA 2ITNA 3GOKA 2GNIA 4F6WA 3NVMB 1G3NA 3P7BA 5D41A 4XX9A 4EHVA 3NZ0A 2HY0A 4AT3A 3GCVA 4Y95A 4FV9A 2P0CA 4AQCA 3NRMA 4AW5A 3B8RA 5EW8A 3TKHA 5HLNA 3WARA 3WBLA 1J91A 3O2MA 2EB2A 5E90A 2X7OA 2WMWA 3K3IA 3P5KA 3ZSGA 5A4EA 4G31A 4FKGA 4FEWA 4I5CA 3B8QA 3GXLA 4I20A 4IWDA 3G15A 1KE5A 3HV5A 3F2RA 4MBLA 5AV3A 2FO0A 2YZAA 4I1ZA 5E8UA 2GPHA 2IZTA 4MWHA 4BCJA 4EOPA 3CJFA 5FBOA 3VRZA 5E8YA 3UZTA 4CLJA 4A07A 4HCTA 1OKWA 1PXMA 1ZLTA 4YPDA 4QMUA 3KMMA 2R9SA 5CEMA 2VWZA 2QC6A 5HQ0A 2X81A 1OB3A 3BRBA 3G2FA 3QZHA 4DCEA 2A1AB 5CF8A 3VS7A 3ANQA 5GHVA 4PMMA 4ZSAA 1HCLA 3BLQA 3OHTA 2SRCA 3ZM4A 5E8SA 4PP9A 4ZTMA 2OF2A 4OAUC 3IGOA 2BZIB 3FZTA 4RG0A 2UV2A 4G3EA 3WZEA 4N70A 3RZFA 2UVYA 3ZHPC 4MAOA 5D12A 2ZMCA 4IW0A 2G2IA 2GNFA 1E1VA 4U80A 3RK7A 3OOMA 3MH3A 2G1TA 2JGZA 4ANLA 2Q83A 2XBJA 3RHKA 3ZXZA 1JSVA 4XEYA 2QG7A 1ZY5A 2RL5A 1V1KA 4DFNA 5M4IA 3MSSA 1ZYLA 3VF8A 2A19B 2QQ7A 3H0YA 3W2PA 1Z57A 4DEDA 4CYIA 5I9VA 1JKSA 1YVJA 3EB0A 3KULA 4I4FA 2QU6A 3LOKA 2G15A 2JDOA 4FNWA 4G5PA 4H3QA 4HGLA 3WE8A 2PWLA 4FV1A 2ZM4A 4WUNA 1H1RA 2UZEA 4LMUA 4BCNA 5HD4A 3BGQA 3R1YA 3R7GA 5AR8A 4KKHA 5ETAA 3Q9ZA 5DI1A 5LARA 3DZQA 2VX1A 5A14A 3KREA 4XRJA 1JVPP 4CT1A 3Q52A 3N51A 2PE2A 2VTRA 3F2AA 2PVKA 3P7CA 3COKA 4IHPA 1Q99A 2LAVA 4D4SA 2ITVA 1OL7A 3D94A 5EH0A 2E9PA 4JBPA 2BRBA 3DNEA 3DA6A 1WFCA 4TZRA 2ZB0A 2C3IB 2XNNA 3D5VA 3DBDA 1ERKA 2XYUA 3RP9A 3RVGA 3GU6A 2ERZE 1OI9A 3PP1A 4RT7A 5HNGA 4C4FA 2QO9A 5AV0A 2GSFA 3IK3A 4RJ3A 4NFMA 3R8ZA 4IDTA 4EQMA 5EKNA 3QL8A 3FWQA 3I6UA 4RWKA 4DINA 3PFQA 2JIIA 4M69A 5I4NA 2VU3A 4XRLA 3ZSIA 1XJDA 3FL4A 3LQ3A 3TUCA 3OUNB 2O3PA 3VUGA 3OXTA 3GT8A 5J9ZA 5BMSA 3R7UA 5D7AA 3FUPA 1OIQA 3EYGA 2F7ZE 3JY9A 3M11A 1R3CA 2R3JA 2RIOA 5TKDA 3CP9A 2ZDUA 4YHJA 3K5VA 3OC1A 3DZOA 3Q9WA 4KINA 4X3FC 5M06A 5JGBA 4ITJA 3ORPA 4WNOA 4DH3A 5DRBA 1OL1A 1PXKA 2R3KA 4J7BA 1REJA 3H9FA 3A7IA 3LCTA 3W55A 4XLVA 2P2HA 3ID6C 4QPAA 4RIXA 2RFDA 4OW8A 4PTGA 4MBJA 3ZO1A 2WELA 3KXMA 3DDQA 4E6CA 4RIYB 2OH0E 3VRYA 4R7BA 4I92A 4ANQA 3I6WA 5T6KA 5J5TA 5H8GA 3RCDA 4CCUA 3LXKA 3AXWA 1KOAA 3EN4A 4YZCA 3QRUA 2YM5A 4UN0C 2VZ6A 3V8SA 3Q9YA 3ZRLA 4LOQA 5AIRA 5A4CA 3KVWA 4FIEA 3MGYA 5AM7A 1ZYCA 2UZTA 3KXXA 4J98A 1E1XA 1O6YA 3DKOA 5DT4A 3U6IA 4FGRA 4KBKA 4G3CA 4Y83A 3RMFA 5IF1A 4G6OA 3N9XA 4OTRA 2XK8A 4A06A 3P78A 4IJPA 4QMOA 4KRDA 3P9JA 4I24A 3P4KA 4USEA 2YAKA 3R63A 4FSWA 3QXPA 4CMUA 3W2OA 3AC2A 4RFMA 4CFFA 3EQGA 4J8MA 3RZBA 3OF0A 3BHTA 4WNPA 4EKLA 4CGAA 4UXQA 4NCTA 2WEVA 5JMSA 5HEZA 2X0GA 4PY1A 2ZYBA 4ANMA 3DDPA 4E93A 4QMTA 3CIKA 4MQ2A 3CQEA 2C6OA 4JQEA 4M13A 3DK6A 3TI1A 4BDKA 3FQSA 3BYOA 3HX4A 4DE4A 3C0HA 1JSUA 5M4FA 3FY0A 5DEYA 3CTJA 2Y9QA 1T46A 5AV1A 4IANA 3SG9A 4KIKB 3QKKA 5HLPA 3TDWA 3FQEA 4X2GA 2F7EE 1B38A 1VJYA 2WMRA 4C8BA 4S30A 3ZRMA 4WRGA 3MFUA 3TNIA 4FG8A 5C4KA 2QOCA 4BZOA 4IEBA 4O22A 3ZLSA 1M2QA 1WMKA 5DYJA 4C59A 5AA9A 2WTKC 2XIRA 4FKQA 2HOGA 4FUYA 3DBFA 4TXCA 4CKJA 4KKEA 1QPJA 1UU8A 2PE1A 5BVKA 3HRFA 4RJ6A 3QTQA 1UU9A 4QNYA 4BVUA 3ZFYA 4BY9E 2IW9A 3PIZA 2X1NA 4F7NA 5EQPA 4AZSA 1GNGA 2B54A 3K2LA 2XEYA 1FVRA 3TKUA 3Q04A 4B6LA 5AP4A 1PXNA 3PSBA 4WNKA 3PJ8A 3ORXA 2Y8OA 1KV2A 4FODA 3EQHA 4K18A 4K77A 4ZLOA 3GU4A 2XKCA 3SDJA 4C4JA 1LP4A 1J3HA 1UA2A 3PJ2A 3QCSA 5EI2A 2P4IA 2Y0AA 4FBXA 4Y5HA 5ETFA 3UIBA 4U40A 3LW0A 4R1YA 5F4NA 3UYSA 4AGWA 4MVFA 3S1HA 4XS2A 4E8AA 1UWJA 4FZDB 5IA3A 4RGJA 2YZLA 3FLSA 4XCUA 5BQ0A 3UOLA 1YOMA 4CCBA 3RALA 5GNKA 3ZMMA 4O1OA 2XKDA 4FT5A 2OK1A 3VF9A 5KMMA 4FV3A 5HCXA 2BIKB 2ITOA 4RIWA 5CNNA 3SW4A 2YCRA 4JBQA 3CKWA 1X8BA 2X2KA 5IA1A 2VTTA 2OXYA 3BLRA 4O7NA 2XK6A 4X21A 2GTMA 4GT4A 4IFGA 2X7GA 5DWRA 2CDZA 5ANOA 3FSKA 3ODZX 5HI2A 4F9CA 2OO8X 1IR3A 3OY1A 4C7TA 4FNYA 4MXOA 5KMJA 4ZJJA 2B9HA 1GAGA 1RE8A 4M0YA 2WTIA 2WMQA 4JS8A 4YJTA 3D2KA 2UVXA 4IFCA 4W8EA 5ETCA 2XIZA 3NYVA 4UY9A 4X3FA 5T3QA 2Z7RA 3WZJA 4ALVA 1JNKA 2W1FA 3VS6A 2WU6A 5C27A 3C4EA 4L8MA 3UJGA 5IQHA 4G9RA 3W33A 3ET7A 3PLSA 4H05A 3MH0A 4UV0A 5JH6A 2JDVA 2R3PA 2QOIA 2WOUA 2WTWA 3CXWA 3HV7A 5EI6A 3TZMA 3KK9A 4DAWA 5CF6A 2UVZA 5HTBA 4O7LA 5CY3A 3BHUA 4UB7A 2VTPA 3LJ1A 4D5KA 4N6ZA 4U45A 3F3TA 3EYHA 3Q4CA 3R71A 4AP7A 1WBVA 4DEEA 3RM7A 4XG9A 2IVSA 2O5KA 2X4FA 3WIGA 2RKUA 4KB8A 4ARKA 4PP7A 4XBRA 1PXOA 3VHKA 5BUEA 5CI6A 2QURA 1PF8A 3I79A 2W1EA 2C6MA 3KMWA 2OG8A 3EZRA 3G9NA 3NLBA 3OEZA 1GIIA 5AUVA 1CTPE 3P08A 4LOPA 4JQ7A 3UBDA 3QA8A 4KWPA 5HHWA 4ZY6A 4EL9A 4HVHA 3S4QA 1MP8A 1T45A 3VBYA 4FTJA 2UZNA 4KKGA 4YJVA 1PXJA 4EKKA 5J5SA 3PY0A 3VUTA 2CGUA 4AZVA 2JKMA 1IEPA 3ORKA 5IH6A 4NM3A 4U41A 4BDHA 1WVYA 3QC9A 4BCQA 2J51A 1CKJA 4FYNA 2X39A 4AA4A 3V51A 2R3RA 4FUXA 4MHAA 3FZOA 3GU8A 5BUJA 1SVHA 4FVPA 1YXXA 3E3PA 4KIPA 4XG4A 4MEDA 3CGOA 3UO4A 4FKOA 3MA6A 4NZWB 4MWIA 3RM6A 2E9OA 4IAFA 4FEVA 5IQBA 3PXZA 5BVOA 2BCJA 3F7WA 5KHWA 2RGPA 2JIVA 4AZEA 4I3ZA 4UMQA 4NSTA 3BYUA 4TWNA 2HK5A 3PVBA 5F94A 5CAQA 5L6PA 1MRUA 1ZZLA 4C4IA 4OBQA 4F4PA 4DA5A 4XLIA 4QTEA 3V8WA 2JFMA 3F3ZA 4FTRA 3MVMA 4QP7A 4FT9A 5DG5A 2JDSA 3RAWA 5GZAA 2WTCA 3SC1A 2XH5A 4RJ8A 4TYEA 3UIUA 4DH1A 5L2IA 5EW3A 4IVDA 5JEBA 1M7NA 4DEGA 3TN8A 2BAJA 4NJDA 3MN3A 3MPTA 3QQUA 1Y8GA 2R3QA 3A62A 4Y46A 5EI8A 4EHGA 4QNAA 2X2LA 2GS7A 1NVQA 5GJGA 1H07A 1NY3A 1BL6A 2DUVA 4YC3A 2IWIA 2PTKA 4E4LA 4ANSA 4CKRA 2YM4A 5FEDA 4IAYA 4TL0A 5CU2A 3A61A 2Z8CA 3CPBA 1H01A 3DY7A 3OZ6A 2H96A 4XMOA 4AWIA 4OBOA 3L8XA 2PU8A 3BEGA 5JFSA 2ZVAA 1ZMUA 1BX6A 1XR1A 2LGCA 4X3JA 4EOLA 2R2PA 2BFYA 3KGAA 5J95A 3PY1A 5EK7A 1ZMVA 2DYLA 3CQUA 2NP8A 1P14A 3QQLA 3L8SA 3CY2A 4O1PA 1YDRE 5K5XA 3E3BX 4H36A 1XWSA 3QWJA 4L9IA 1JQHA 4FMQA 4C37A 2W06A 3MIAA 3DBEA 2RFSA 2ZM3A 4OTGA 5EDQA 3ZFXA 5KE0A 2BR1A 4BCMA 4AF3A 2ZV9A 4FEXA 5BVNA 3PPJA 3Q5ZA 3KB7A 4G3GA 4BDGA 3VJOA 3ITZA 3FLZA 4C33A 4F64A 4UWCA 4ONAA 3K54A 3R8VA 4E4XA 5CASA 2PZRA 2F4JA 3SW7A 4M14A 3QA0A 4HYSA 3G6GA 4LGHA 4D2RA 1J7LA 5AUWA 4MKCA 4A9TA 4IVAA 4PRJA 4RFYA 3FXWA 4JT3A 5EYMA 3ZSHA 2YJSA 3HMPA 5LXMA 1JKTA 4M15A 4BDJA 3S0OA 5HCYA 4ZZMA 5AR5A 3VULA 2QOHA 1Y8YA 4KS8A 4F63A 1U46A 5FXRA 3WOWA 2VGOA 3LCOA 4ASDA 2I0HA 3EZVA 5HO8A 3KKVA 4LV5A 5A6OA 2GNLA 2OF4A 1GZOA 1YHSA 1PMEA 4BCOA 3Q3BA 4X6RA 3GB2A 1PMVA 2HZNA 4WT6A 2BILB 5C8NA 4IC7A 3OBJA 4NUSA 3W2SA 4NM5A 3JVRA 3FMDA 3K5UA 2XJ0A 5HOAA 4EUTA 5LOHA 4WKQA 3L9NA 5C4LA 1J1CA 4HCVA 5JRQA 1W98A 2PVYA 3A4PA 4U97A 3W1FA 1YHWA 5EOBA 4I0RA 4F9BA 3N4VA 4E6QA 1ZOHA 1SYKA 2W17A 3PVGA 2XUUA 4QYEA 4A9UA 4P2KA 3R8UA 4D4VA 3DBCA 1TQMA 3MIYA 3GENA 4XV2A 4BF2A 3PE1A 2OKRA 4A4OA 5BPYA 4I21A 4O82A 1V0PA 4HNIA 3LCSA 1XO2B 4JLCA 3UNZA 4E26A 3ANRA 3QUEA 4RX7A 1WCCA 1IG1A 4UZHA 4BI1A 5M57A 3NVKI 5ANIA 1JAMA 3HAMA 5HIDA 4FL3A 4IZ5A 3FHRA 5IISA 3A8XA 5E8ZA 5JGAA 3O8PA 2C5YA 3DJ6A 3P7AA 5CEIA 4O7SA 1YWRA 4BDDA 5HNIX 3VS4A 3U6JA 3FLWA 1Z9XA 1LEWA 3HEGA 4FICA 5AP3A 4O7VA 3MH1A 2XJ2A 1XH7A 4MD8E 4U8ZA 1STCE 2B53A 4GUBA 1IAJA 3GQLA 3ORLA 4L52A 3GCUA 3R7YA 4JAIA 3F2NA 5AP2A 4BKZA 2O65A 1OGUA 3EQFA 5DT0A 4BIDA 1VR2A 4G34A 1QPDA 2XK4A 3POOA 4GFOA 2OXDA 3CS9A 4FIGA 4X3FB 4E6AA 5IA0A 2UZOA 4BCIA 4F09A 4QQTA 3VUMA 3UYTA 3R9DA 4AOTA 4CNHA 3S2PA 3PA4A 4ALWA 4WOVA 5ANGA 4DLIA 3EFWA 3OD6X 4IAAA 3F5PA 3IW6A 3PRIA 4J1RA 2J5FA 1P2AA 4C36A 3R00A 3ORNA 4L00A 2WTJA 4EK5A 5HX6A 3TACA 4BWKA 5M4UA 2XCHA 3RK5A 2CKPA 4RIYA 3ZYAA 3NW6A 3QLGA 3QWKA 3O0GA 1PW2A 4HYHA 4L3LA 3TCPA 4EONA 4S33A 3Q6WA 4JIAA 4HVDA 1GOLA 3HDNA 2YCSA 3CQWA 1WBOA 1YXTA 2CN5A 3BKBA 3KU2A 4GRBA 4M97A 3MFSA 3KK8A 4OBPA 1O6KA 3E7OA 1R0PA 4YURA 5AUUA 5LJJA 3OVVA 3Q5IA 4KNBA 4RFZA 2YHVA 3HYHA 4O38A 4YLJA 2BALA 4HW7A 2R3NA 3EQIA 3MPMA 3ULIA 4PDPA 4XV3A 4O7YA 2F9GA 3QQFA 4O7ZA 4TT7A 1XH9A 3BI6A 4BL1A 4QQCA 3WF6A 2W1ZA 4KIOA 5CSVA 2UW8A 2BZKB 2XJ1A 1O6LA 2XNBA 5HE2A 2CCIA 3RNIA 3U8WA 5AA8A 4C2VA 2X9FA 4KD1A 5EOLA 2VWUA 3KRXA 4B9DA 3MVJA 5KMNA 2XIYA 4I6FA 3VO3A 3R28A 1SVGA 4ZTHA 2R3GA 4UYNA 4GSBA 3V5QA 2W96B 5HD7A 3Q4TA 2WQNA 4I0TA 3EHAA 4K8AA 4P90A 3DGKA 3KRRA 4U42A 4YSMA 3VS5A 4AE9A 5AEPA 3RWPA 2VTLA 3A7FA 3ZOSA 2O8YA 3GCQA 1LUFA 3K3JA 2FA2A 5G6VA 4BRXA 4FK6A 4TPTA 5K3YA 4UMPA 3WYXA 3QCQA 4P5QA 3MDYA 3TL8A 5FUTA 4R5YA 3C4FA 4LRJA 4AW2A 4I93A 3S95A 4KIKA 3O7LB 4G17A 3PVWA 3GCSA 4BI0A 1ZXEA 2YIYA 3LCKA 3QUDA 3PXYA 3AGMA 3C0IA 3LFNA 1BMKA 2ZV8A 5EM7A 5LWMA 5FWKK 2WTKB 4YLKA 4FC0A 4LOOA 4XJ0A 2XS0A 1H08A 3NUPA 2AUHA 4QP4A 4RRVA 4WSQA 3NYXA 3R0TA 4RX5A 3LPBA 2R7IA 2C5VA 4RSSA 4TWCA 5L2TA 2XM9A 3PJ1A 4ZSEA 4BGGA 2Y4IB 4IB1A 4G6NA 1PXPA 1F3MC 4DH8A 4EOSA 1ZYSA 4JDKA 5HE3A 2QKRA 2WO6A 2V7OA 4FSRA 3FLNC 4PF4A 4NIFB 3KQ7A 4N0SA 4ACHA 2F7XE 3I7CA 4YMJA 3GFEA 4I5HA 2WAJA 3BU5A 3H0ZA 3LFFA 3P0MA 3DXNA 4L43A 3ZEWA 3I4BA 4MNEB 2F49A 3R01A 2E9UA 3TTJA 4ANNA 4ZTNA 4D4YA 3FHIA 3P1AA 4EK6A 2XYNA 4KSQA 4YBKA 1OUKA 2W1HA 3DPKA 3VIDA 4C4GA 4DN5A 4WO5A 2R4BA 2C6DA 3HV4A 4BDIA 3G33A 3LFDA 4U0IA 3UO6A 5IU2A 2Y7JA 4ITHA 2IZUA 3NIEA 4M66A 4EH5A 2VGPA 5DMZA 3BBTB 4EC8A 4XP3A 5HVJA 5LMAA 4BICA 1Q3WA 3QLFA 3UGCA 4U43A 4J71A 2VWYA 1KE6A 3EQBA 4M8TA 2ZAZA 3OT8A 4XG2A 3GEQA 3OXIA 4Q9SA 4FZFB 4O7WA 3C13A 3CY3A 3W32A 5K0XA 3KF7A 4PPAA 4FA2A 4ZIMA 2QOOA 5CX9A 3EFJA 3I7BA 2E2BA 4II5A 4JX7A 2V0DA 1BI7A 2G2HA 2C1AA 5L6OA 2XBAA 3O50A 3C5IA 5F1ZA 5GINE 4F6SA 1OIRA 2CKEA 2QG5A 4CZTA 5JT2A 5JSMA 2ITQA 3DQWA 3FE3A 3GU5A 3JYAA 3FY2A 4HJOA 4O6LA 2IZRA 4A7CA 4CG8A 4Y73A 3KVXA 3BBWA 1H27A 4W4VA 2VO6A 4UALA 5C01A 5A9UA 5CF4A 2J50A 3PA3A 3QHWA 2ITWA 5FP6A 4Q2AA 3ZONA 4QTBA 3DXQA 3MFRA 4FIIA 1M2RA 2HZIA 5A46A 5I5ZA 3EN9A 4JIKA 4EEVA 4QP1A 3ELJA 4X2FA 1E9HA 3QQJA 3QZGA 4QPSA 2PYWA 5GIPE 3RBWA 3E64A 2Z7QA 2YM3A 3LMGA 4CD0A 2J2IB 2OWBA 3FZPA 3O17A 3O7LD 4DG3E 1PRYA 2R3IA 3V8TA 4EZ3A 2OJJA 4NTTA 2GDOA 2WXVA 3HA8A 1MRVA 2WB8A 2WIPA 5HX8A 2CNUA 2R3LA 1OKVA 4JJRA 3MJ2A 5FQDC 5LVMA 3W2CA 4AG8A 4MD7E 5CVFA 3OWKA 4LV8A 4K33A 4S2ZA 4YTIA 3UOKA 4UMTA 3WF5A 5ACKA 2HZ0A 2GQGA 4LQMA 3A8WA 2JITA 1PMUA 3DJ7A 4JL9A 5J87A 3ZFMA 3IOPA 1BKXA 1U54B 5IEXA 2O0UA 1ZYJA 3KMUA 3U51A 4IB0A 4RZVA 4O7RA 4YZ9A 4JRNA 5HLWA 4QP8A 3ZZEA 1Y6AA 5B0XA 4EORA 5AUTA 2IPXA 4ZMEA 4CRLA 2PK9A 4D2WA 3PIXA 4OR5A 3QFVA 4IWPA 4IX6A 2WNTA 3GI3A 1UU3A 3D7ZA 3NUNA 3Q60A 4J96A 4ZZNA 4O6EA 3DAJA 4M7IA 4F0GA 3OWJA 4ID7A 4MXXA 1OUYA 2ETKA 4QP9A 4QD6A 4ENXA 5IMXA 4YHTA 4GIIA 5BVEA 3GVUA 3TNQB 1WBPA 2VX0A 4YZDA 3UP2A 4GL9A 4EI4A 2YM7A 3A99A 5DRDA 2V22A 3QTSA 1XKKA 3IW7A 2YDJA 4DF3A 4NFNA 5EDPA 4RC4A 2GHGA 5GJFA 5AP7A 5F95A 3SGCA 3QGYA 5DA3A 2X6EA 4YJSA 3ORIA 4R3RA 4JDJA 4L3PA 2W9ZB 2GFSA 4GJ2A 5E8VA 4FTIA 3KXZA 3F69A 4O91A 4L46A 3OP5A 5DE2A 5AR7A 3DK3A 4GVAA 3GC8A 5M56A 5KBQA 4O2PA 2V55A 3ULZA 2GCDA 4DBXA 1SMHA 1FINA 4TYHB 3F61A 3DQXA 1W0XC 3LE6A 4FIJA 4BDAA 3DOGA 4K6ZA 3AGLA 1PHKA 3ALOA 2BRNA 3VC4A 3NNUA 2VV9A 3BHVA 2IW8A 4EOKA 4QYFA 3R9HA 1UNHA 2O2UA 4FKSA 5HZNA 5J1VA 1XBAA 5JK3A 3F7ZA 3SAYA 1SZMA 2GTNA 4ACDA 3OCGA 3HNGA 4E5AX 4LRMA 4FKUA 5IG1A 3MTLA 2BUJA 4CYJA 5AWMA 1JLUE 1XH8A 3FZSA 3D7TA 3R22A 5AP5A 5JZNA 3ZLWA 1OZ1A 1W84A 4X7QA 3FC2A 4FVRA 4V05A 5EHLA 4O7TA 4FSUA 3HAVA 2OZAB 2I0EA 3FMEA 2VTQA 1CKPA 2QO2A 3L9PA 3UVRA 4CFMA 1PXIA 2UZVA 3UPXA 4ANOA 3ROYA 4MXAA 1BLXA 2RSVA 3MY1A 2BIYA 4GG5A 3ATSA 4QMLA 2QCSA 4FE2A 4NT4A 5KBRA 3H10A 4BIEA 5AX9A 4FSYA 5EM6A 4FKVA 4HYUA 4Q5EA 1AGWA 4GK3A 2DQ7X 3CLYA 5LMBA 4XP0A 3TKIA 5AIKA 5IQIA 2XVDA 5I9UA 4BWPA 3MESA 3DFCB 3KN6A 2R0IA 4G1WA 5KNJA 1GZKA 2RG5A 4HGTA 1B39A 2C1BA 4TWOA 3T9TA 1CSNA 5IDPA 2B7AA 3V5WA 1KWPA 1KE7A 2CKQA 3FEGA 1JKKA 5CF5A 2PVMA 3DLSA 1FOTA 2IO6A 2QO7A 1BYGA 1ZMWA 3DV3A 3FMKA 4IWQA 4D0XA 3IDPA 3WF7A 1Q8WA 1H0VA 3IQ7A 5HESA 3VN9A 3FMHA 4I5MA 4KABA 2PZYA 2Y4IC 1PMNA 5CU6A 1OL6A 3R21A 4DEAA 1ZRZA 4FT0A 3U9CA 4YO6A 4RJ7A 3QF9A 3ZXTA 4AX8A 3ZLYA 2HYYA 2H9VA 3FMNA 2BKZA 3AC4A 2C5NA 1YQJA 2GU8A 1MQBA 4RBLA 4U7ZA 3C51A 4RWLA 3C1XA 4HPUE 3PZHA 4QT1A 2BHEA 1SM2A 2J0IA 4WG5A 5AUYA 3R7OA 3ZO4A 4IAIA 4MNFA 4DT8A 3PVUA 4ZTQA 2PY3A 4RX9A 3BQRA 4M84A 3LMHA 4NM0A 4PQNA 2VUWA 1REKA 5EW9A 4ZZOA 2QONA 4B7TA 3HRBA 2XNPA 3QALE 4QMQA 5M51A 1UWHA 2WIHA 4FSNA 4EK4A 1WBWA 5AV4A 3NEWA 4O0VA 2ZDTA 3ERKA 4S32A 5M55A 4M0ZA 3CTQA 2PMLX 2F2CB 5IH5A 3AD4A 3PXRA 3QTUA 3HV6A 1A06A 2HAKA 3N4TA 4R3CA 5A54A 3VQUA 2BPMA 1OL2A 4GVJA 4HGSA 4UEUA 4AW0A 4FT3A 4NJ3A 5H3QA 2ZV2A 2WPAA 3PJ3A 2XKEA 5HCZA 4PV0A 4EHEA 4YP8A 3FMLA 3KC3A 3F3VA 1SNUA 3NAXA 4YTHA 3R9OA 4CV8A 4F1MA 3TXOA 4DGOA 1Q8UA 4OT5A 3LAUA 3DT1A 3MTFA 1NXKA 4PMTA 5LCKA 4BDBA 4ZMFA 2H8HA 2P2IA 2R3OA 4QTDA 2EB3A 4A9RA 2OLCA 1M52A 5HNBA 4YO4A 3C4WA 2PVHA 4JR7A 2BTSA 2CJMA 1TQIA 4JXFA 2FSTX 2UUEA 5EDRA 4CMTA 2PUIA 4FSMA 3NUYA 1H0WA 2CLXA 4L7SA 5E92A 1U59A 5LVLA 4OTIA 3RJCA 4O27B 4XHKB 1YWNA 3HRCA 4JQ8A 4M67A 3G6HA 3PE2A 4WUAA 4YGAA 3SOAA 4CTBA 2ITYA 5IQGA 1YI3A 4RA4A 3R6XA 4E5BA 3LFBA 3LCDA 3FMJA 1S9IA 3BV2A 4MD9E 4C58A 5KMKA 2JBOA 4FTNA 4FZ7A 3ALNA 4UXLA 2CLQA 3CGFA 4CQEA 2WQOA 4NKSA 1ZY4A 1QPCA 4K1BA 1OBGA 4OTPA 4UYAA 3JY0A 3QTIA 5HO7A 5AAEA 4IJ9A 4IQ6A 1GZNA 1OIUA 5TO8A 4DGLC 5EG3A 2ITPA 1Q8TA 2PVJA 3QX4A 2VO7A 1WAKA 5CENA 1Q41A 2B1PA 2C4GA 4RVMA 1PKDA 3E8DA 5K5NA 2J7TA 2YN8A 3C4XA 3ZRKA 2IJMA 2VNWA 4V0GB 2WKMA 4C4HA 4KA3A 5CVGA 4DFUA 2PMNX 5ANKA 5I3RA 4CFXA 3UNKA 4RMZA 3Q4UA 1QMZA 4GKHA 4IE9A 4AZWA 4UMRA 4U6RA 4BBEA 2CNQA 3EFLA 4EH4A 4BI2A 4C35A 5E1SA 3TWJA 4FEQA 3F3UA 3DJ5A 3LLTA 4FTAA 1QCFA 5CT7A 3ETAA 3PDTA 5DNRA 2YDKA 3CJGA 2XF0A 3OEFX 3TJCA 4ALUA 4RJ4A 4BTJA 4DG2E 2OXXA 2PE0A 2QOKA 5ICPA 3UIXA 5B2MA 4RC2A 1W7HA 1XBCA 4I22A 1A9UA 5L8LA 4WBBB 3FI3A 4XG3A 4EH9A 3COIA 4H3BA 4X2KA 4AXAA 4EOOA 3CR0A 3EL7A 4QMZA 3TUDA 5AFVA 5HTCA 1KE8A 4OGRA 5CU4A 5IPJA 1FVTA 5BMMA 2PUNA 3R9RA 3MY0A 3VBVA 5HG8A 2QOLA 3KXHA 1W83A 3D0EA 4FKPA 4XYFA 2OU7A 3CD8A 4I94A 1K2PA 3LKMA 2OJGA 3MWUA 3PPZA 4HYIA 2DWBA 5JFXA 1TQPA 2WQBA 3ENMA 1GIJA 2W9FB 4OTWA 4AU8A 3DB6A 2R3HA 3AMBA 3GOPA 3CTHA 4L42A 5ANEA 4MXYA 1HCKA 2BDWA 3DXPA 3VS2A 3V5PA 4QMWA 1JPAA 4IVCA 2J0MB 1MQ4A 3UC4A 3UQGA 4LI5A 4FSZA 4Z9LA 4C62A 3ODYX 2XB7A 4AT4A 4YSJA 1GJOA 2UW6A 4E20A 4E5WA 4G5JA 3C5UA 2A27A 4GFGA 1JWHA 4GUEA 4NIFA 3FPQA 4XG7A 4J95A 4JAJA 3O8TA 4HOKA 4ZXTA 3KY2A 3UVQA 4D9UA 3GGFA 4FV6A 5HKMA 4F6UA 2ZJWA 3EFKA 2BHHA 4MNEA 1H1SA 2HWOA 4GU9A 2WMTA 4YJRA 4FYOA 2OW3A 2UW4A 2ZB1A 3KL8A 4IH8A 4O21A 5L8JA 3VWAA 3F6XA 2VO0A 3PG1A 4JI9A 3VUDA 3HGKA 5IA2A 2Y6MA 4D2PA 3EN7A 3IPHA 3ORZA 4TNBA 3D7TB 5DHJA 1HOWA 4XP2A 3DBQA 3OMVA 1H24A 5FTQA 3AT3A 1ND4A 4AZTA 3QAME 2BRGA 4ZK5A 5B2LA 4MYGA 4ASEA 5C26A 5AX3A 3KRJA 1URWA 4FV2A 4F9AA 4X6QC 2VTHA 3I1AA 2WQMA 3F66A 3DK7A 4I4EA 4NK9A 4ERWA 1M14A 3QCYA 4QP6A 1M7QA 3G9LX 1NW1A 3DS6A 3BU6A 1PYEA 3U54A 2XA4A 4AUAA 4DITA 2PPQA 2R3FA 5IA5A 4AN9A 4DG0E 3PRFA 4IAZA 4EOIA 3DKFA 3II5A 4XOZA 3MW1A 4EOJA 4TRLA 5JQ5A 4BZDA 1YHVA 3TJDA 1FMOE 2WZJA 4KAOA 4NL0A 2Z60A 1UKHA 4TKSA 3GC7A 5L6WL 5IUGA 5J9YA 4MXCA 2IN6A 4F0IA 3GC0A 1SVEA 4LFIA 4JDHA 4E73A 3RINA 2XNEA 2HWPA 1LPUA 3DNDA 3LXPA 1NVRA 2ONLC 2XK3A 2I0YA 4E7WA 3VVHA 4R1VA 4ZS0A 4AGUA 4YR8A 3W8QA 2JKOA 4YJQA 1H26A 3NSZA 3G90X 4DFLA 3O96A 2I40A 3KXGA 3FQHA 3Q96A 3SRVB 3LM0A 5KUPA 4EH7A 4KSPA 5T68A 3FXXA 1V0BA 3H3CA 1L3RE 3WI6A 1OL5A 2C6EA 4C4EA 4R78A 3NUUA 3NCGA 4EWQA 4Y5QA 4A9YA 3HUCA 4OAVB 4M12A 1MRYA 3VW8A 1U4DA 4AS0A 5KKRC 2X6DA 5JGDA 1H1PA 2FGIA 4N6YA 4D4RA 3R9NA 4PTEA 4U3ZA 4QQJA 1FQ1B 3FKLA 3QTZA 3ZH8A 4IADA 1VYZA 2OIQA 3VUKA 4YJUA 2GNGA 3C7QA 4I5PA 4IAKA 1FMKA 3HP5A 4C2WA 4X2JA 2X9EA 1OPKA 3NYNA 5CU3A 2FYSA 5HE1A 4JBVA 3SXSA 2QVSE 4BTKA 4CEGA 1U54A 2YABA 2I6LA 3E5AA 5DVRA 4L3JA 2DS1A 3LHJA 4GIHA 3D5UA 1PY5A 4EH6A 4WA9A 2C0TA 4E6DA 2J0LA 4O0SA 3HLLA 4FZAB 4I6BA 4DTAA 4X0MA 4FF8A 5HG5A 2R3MA 3QD2B 5GIOE 3QRTA 3ZTXA 1JKLA 4JVGA 2OIDA 5E8TA 2A2AA 2G01A 4HVIA 1GIHA 3F5UA 5EYDA 4F99A 3W10A 3AOXA 4MF0A 1VYWA 4G3FA 4EH2A 1J7IA 3PSCA 3WZUA 3G51A 3UG1A 2WMXA 2IZSA 4I0SA 3MFTA 1Y91A 4L01A 3HA6A 2F57A 4Q9ZA 2IVUA 3OXZA 4PL5A 5FD2A 5EM5A 3R7IA 3FXZA 2C47A 3ZDIA 3LQ8A 3SHEA 3OWPA 5AP6A 4JR3A 3T8OA 4CTCA 4GFMA 5DR2A 2WEIA 4IB5A 1I44A 1R0EA 3G5DA 4FV7A 1Q3DA 4GV1A 4QMXA 4I23A 5FRIA 3FLYA 3TEIA 4EHZA 2Y6OA 4YZMA 3NUAA 2UZDA 3E7VA 4P4CA 5AMNA 3HL7A 4UBAA 2JC6A 2C3KA 1RJBA 2H34A 3L9LA 4TY1A 4AZFA 4AGCA 1YOJA 2UZWE 3MB6A 4TYHA 4BBFA 1YXUA 4PNKA 4ZS4A 3NGAA 3ORTA 2UZLA 4RWIA 4X2NA 3V6SA 2EWAA 2OJIA 3IW5A 5HG9A 4F1TA 2UW0A 3OOGA 5CSHA 2YERA 3NIZA 3PWYA 4C3RA 4GS6A 3E8NA 2GHLA 4DFZE 4LG4A 3QQKA 2YJRA 3LXLA 2ZOQA 4F0FA 2VX3A 3BHYA 3FSFA 3AD5A 3EKKA 2PMIA 3O8UA 3M1SA 3Q53A 5DLSA 4B8LA 4D2TA 4EC9A 2KULA 3FBVA 5J7BA 4P5ZA 1AD5A 4WBOA 3DTWA 5DR9A 4C3PA 4YTCA 1CM8A 2W5BA 2OZAA 3BPRA 4FV4A 3R83A 4DEBA 4O84A 3BQCA 4BWXA 3R1SA 2VWWA 2QOBA 2HELA 4O0YA 2Y4PA 4YLLA 4DCAA 2J0JA 4V04A 3HDMA 4CFVA 3R02A 3GFWA 2JAVA 2PZIA 2ZMDA 2FUMA 4AFEA 3NNXA 2BFXA 1H8FA 4O0TA 2EVAA 4JG6A 3FI2A 2R0UA 3AC1A 5DFPA 2X4ZA 5CZIA 2E9NA 2J9MA 4ZSLA 4EQCA 2ONLA 3UZPA 3RPOA 1M17A 3D2IA 2I7QA 3QRJA 5K9IA 1OVEA 2NNWB 5LQFA 2OICA 4FL1A 5FDPA 2HZ4A 3R7EA 4J99A 4D55A 5JZJA 3QYWA 3PXKA 2BZHB 5B7VA 2QR8A 4XNEA 1V0OA 2C6IA 3JS2A 4HNFA 2WMBA 3V5LA 4EYMA 1OPJA 3MV5A 4ERKA 3R2BA 4J8NA 5EFQA 1DI8A 1PYXA 3F5GA 4O2ZA 5GJDA 2P3GX 2RFNA 5J7HA 1OIYA 1Y6BA 2Z7SA 1LEZA 3KXNA 3NX8A 5DBXA 1UV5A 3CC6A 3VNTA 3FI8A 1VZOA 3NUXA 2EUFB 2WOTA 4GYGA 4PPCA 5HIEA 1OECA 3KF4A 4ZTRA 5FM2A 1Q4LA 3FPMA 2UW5A 2GNJA 3ZS5A 1NT2A 4CMOA 5AJQA 5ACBC 3A2CA 1SNXA 3H9RA 3F88A 3R1QA 5FG8A 5H2UA 4DGMA 2A4LA 3ACKA 1YWVA 4G9CA 5AV2A 2YITA 3MVLA 3CPCA 4ENYA 3E62A 3LXNA 3I5NA 2VTIA 3FYJX 3GC9A 3V6RA 2CPKE 3H4JA 3R8PA 3DCVA 4BIBA 2VRXA 4L45A 5FGKA 3ZDUA 3VS1A 2VTOA 3OCSA 5AP1A 1L8TA 5HO6A 3QX2A 1P4OA 3F9NA 4FEUA 3BYSA 3ZM9A 2XK9A 3MB7A 2CGWA 2IVTA 3H30A 4FOBA 4RPVA 4DFYA 2BVAA 2VTNA 3C4ZA 5A6NA 1IRKA 2A0CX 3V3VA 2GS6A 4NEUA 2OFUA 2BTRA 3VS3A 2YM6A 3BE9A 5IUIA 2VTMA 4EJ7A 3DU8A 4HGEA 3BIZA 2QODA 4GW8A 5TT7A 1RW8A 5D10A 4XBUA 5AUZA 4UZDA 4LGGA 4RJ5A 5CNOA 3A7GA 3IOKA 2OI4X 4AACA 3UVPA 5TE0A 2WGJA 2P33A 4BC6A 4B8MA 4AAAA 5DOSA 3OY3A 4HZRA 5K4JA 2WTDA 2YAAA 4MH7A 3R8MA 4NCTC 3EN5A 2C68A 2J5EA 3JPVA 3FDNA 3PLAE 2QD9A 4CQGA 3U4WA 4ORKA 4M3QA 4AW1A 2BROA 3MPAA 3UQFA 4FKIA 2W5HA 3RTPA 3EN6A 3T9IA 3VBTA 5AAGA 3AD6A 2ACXA 3IW4A 3OW3A 4D5HA 3PY3A 1OKZA 4BKYA 4F65A 3ZUVA 2QHNA 5M4CA 1XH6A 4IZAA 5I9ZA 3BHHA 3RNYA 2YWPA 5GZ8A 4I6QA 3UPZA 3QQHA 4IBMA 4FKJA 1VEBA 4RA5A 3VUHA 2B0QA 5G1XA 1CDKA 1W82A 5EYKA 4QP2A 2FSMX 5J9LA 4BDEA 4BHZA 3BZ3A 4PWNA 3BU3A 3L9MA 3KRLA 3F3WA 4H3PA 3F5XA 4F1OA 5FXQA 3T3UA 5L2QA 4FTQA 2BDFA 4V0GA 2YCQA 2J6MA 4L6QA 2YA9A 4FNXA 5I3OA 2XK7A 3E87A 3KCFA 4Z3VA 3NDMA 3OBGA 4C0TA 3FLQA 4H58A 1K9AA 3RPSA 4AT5A 2CMWA 4NWMA 3TZ7A 3UP7A 3BYVA 2WFYA 5L2WA 4FSQA 4FNZA 1BUHA 3P79A 3QC4A 3H9OA 3SXRA 2I1MA 4EJNA 2XMYA 4EYJA 3CBLA 4GCJA 2WMAA 4QMYA 3UNJA 3EKNA 3PJCA 3DFAA 5E91A 5HICA 3NWWA 4MBIA 5AM6A 4CZYB 4ZTSA 3FC1X 3UQCA 4QO9A 5FM3A 5I9WA 4YBJA 4A9SA 4CZUA 4D58A 4ZY4A 4NYEA 1UNGA 2OFVA 1IASA 5L2SA 3KEXA 3QD3A 4U44A 5GZ9A 4BN1A 3CSVA 5EHYA 2XCKA 5CSWA 5CAVA 2ZM1A 1YKRA 4IX3A 5FP5A 3MYGA 3QCXA 3C4CA 4W4YA 3QGWA 3ZO3A 4O86A 4IXPA 4RC3A 4GKIA 5IUHA 3RPVA 5DGZA 4UX9A 3KCKA 3EWHA 3R8LA 3Q4ZA 5IQCA 3COMA 3PZEA 4CFUA 4TWPA 3R1NA 1IA8A 3B2WA 4WD5A 4XV9A 4IM3A 1H28A 5EYCA 2CHLA 3FKOA 5IA4A 5JKGA 4U79A 2CNVA 4I41A 4TYJA 4WG4A 2ETMA 5D1JA 3BLHA 4FT7A 5LVPA 3BELA 4MQ1A 2NO3A 4JOAA 3TTIA 5E1EA 2JBPA 4DFBA 2QR7A 4PNIA 4DLJA 2EU9A 3I81A 3U55A 4FOCA 4N4SA 4FZ6A 4CSVA 3R04A 2PSQA 2VWBA 3PUPA 4BHNA 1TVOA 2B9FA 3E88A 4CG9A 2HCKA 4BTFA 4R77A 3U87A 5FLFA 4D28A 1H1WA 4FKRA 3O71A 4F7SA 2UZUE 4BKJA 3OCTA 3IW8A 4IWOA 3BYMA 5H9BA 3QU0A 3PP0A 5FEQA 5C8KA 4TTHB 5J8IA 5M08A 3TIZA 2XP2A 1XH4A 2YACA 2ESMA 1KSWA 4R6VA 5CSPA 4W4WA 3MA3A 3A4OX 3CCNA 3N4UA 5EQEA 4KBCA 5BYLA 4K11A 5CYIA 1YXVA 1JSTA 3OROA 5CQUA 2Q0BA 3AQVA 4GYIA 4IACA 4YU2A 1Q5KA 4LL0A 5A3XA 1J1BA 2NRYA 4DH5A 2REIA 5KHXA 3RWQA 2V7AA 4XOYA 1YRPA 3MH2A 5I0BA 4MTAA 4O81A 4USFA 1ZOGA 3AMAA 4R5SA 1OPLA 3AT4A 4EH3A 3EMGA 3QZFA 5I9XA 3B2TA 1Q8YA 2EXMA 1KE9A 3LFQA 4IC8A 1B6CB 3OTUA 3FZ1A 3T3VA 4WNMA 3ZLXA 3QXOA 2YLEA 1TKIA 2VD5A 3SQQA 1OITA 5C9CA 2PHKA 4S31A 2ERKA 1YDTE 4BYIA 4PX6A 3DAKA 4H39A 4IM0A 4TYIA 5HBHA 2QNJA 2RF9A 4ZSGA 3SOCA 2YIWA 4I6HA 4IVBA 5HIBA 5CS6A 4APPA 4ZY5A 5BVFA 5IQEA 2W05A 3DB8A 1JBPE 2QOQA 2QOFA 3NS9A 1FGIA 4OTHA 5A4TA 4NKAA 3GCPA 3UZRA 4PL3A 4FR4A 5HG7A 3LLAA 2WD1A 4QPMA 2IVVA 3SRVA 4BFMA 3POZA 4IIRA 5EM8A 3DKGA 4BCPA 5I9YA 4FGBA 3FJQE 1PXLA 3DTCA 3TIYA 5KKRB 2X8EA 5E9EA 1IA9A 3QD0A 3IG7A 1P4FA 3PA5A 1R39A 3PXFA 2C6TA 3FV8A 4MXZA 3UMXA 4DC2A 5BVDA 4RVTA 3RAHA 4FSTA 4RLKA 4D1ZA 1BI8A 4UWYA 3TG1A 1WBNA 2BZJA 4EK8A 5J79A 3LFSA 1W8CA 3UODA 1GY3A 4L7FA 2YLFA 3SLSA 2HIWA 5KMOA 4JG7A 2HY81 2W4OA 3HP2A 2YWVA 5FTGA 4ZOGA 4LRKA 2CKOA 4ACMA 4NU1A 3L8VA 3TV6A 5JFVA 3D15A 2ITUA 2IG7A 3QKLA 2C30A 4HZSA 2HW7A 3AG9A 4FX3A 4F9WA 5IEYA 2YDIA 3ZUTA 1Z5MA 5KMIA 3FZRA 1KV1A 5HU9A 5ITAA 5LVNA 2UW7A 1Q61A 5CTPA 4B4LA 3QBNA 2FSLX 2YISA 4RIOA 3S3IA 3UOJA 3PYYA 3VAPA 1DS5A 4O83A 3BV3A 3G0FA 4U81A 1DAWA 3NNVA 3NR9A 3VJNA 3Q6UA 5HBJA 5M09A 2O64A 4E4MA 4GK2A 4FI1A 3GP0A 4XUFA 5IH4A 2GS2A 3S00A 4KS7A 3MJ1A 3R30A 3SG8A 2G2FA 4IX5A 3RK9A 4F7JA 1ZWSA 4TNDA 3W2RA 2CSNA 2NRUA 2YIXA 3NNWA 2VAGA 3BCEA 3W18A 1Y57A 3GNIB 4YPSA 2VN9A 4C57A 5IMEA 2JAMA 3P86A 3RKBA 2WMVA 4QMSA 4ZP5A 4W4XA 2HXLA 5J1WA 3AC8A 2J4ZA 4K2RA 4B0GA 2C3JA 3WF8A 3QYZA 3ZC5A 4GU6A 4ACGA 3TUBA 5C1QB 4L53A 1A48A 5HTIA 3NUSA 3OS3A 1ZYDA 4KIQA 2BKKA 2C0IA 5LCJA 3V04A 4APCA 4DTBA 1ZARA 2PVNA 2JLDA 4RVLA 3WZDA 1GZ8A 4U5JA 4C34A 3UTOA 5HORA 5K4IA 1ZAOA 1H4LA 3F82A 4F08A 2YFXA 3TV7A 4A4LA 2UW9A 4FTCA 1K3AA 4FTKA 5CU0A 5IDNA 2QHMA 4TYGA 1NVSA 1UVRA 5E8WA 1Q97A 4M68A 5E8XA 4PTCA 3OW4A 3ZU7A 4JX3A 3EQCA 4YJPA 4CRSA 4FTUA 1URCA 2XKFA 3Q32A 4L67A 3SXFA 3VW6A 1FGKA 3EQDA 4QP3A 4S34A 3NW5A 1JOWB 3ORMA 4BCKA 5K0KA 4NTSA 3SVVA 4FG7A 2JEDA 4IX4A 3D9VA 2PZ5A 5CXHA 1OMWA 2PVFA 5CAUA 3QRKA 2AC3A 2QU5A 2RFEA 3EQPA 4J97A 4D2SA 5ANDA 5F20A 3RPRA 2W0JA 4USDA 2WMSA 4R8QA 4BGHA 4H1MA 3E63A 2OJFE 1OM1A 3JUHA 4BB4A 5H8EA 3I0OA 5KX8A 3KULB 5CAOA 3TV4A 5CAPA 4FL2A 4PPBA 3O23A 4R7IA 1YW2A 4O96A 4O0UA 4RVKA 5HGIA 4O0RA 3IO7A 2W4JA 4ACCA 2PVLA 4FV5A 4OT6A 3TDVA 3M42A 4EOMA 2FH9A 4HCUA 4WIHA 5C8MA 4Z55A 4OTFA 4G2FA 3E92A 4CV9A 3SA0A 2W99B 3FKNA 4FTMA 4G16A 3FI4A 5EKOA 3MI9A 4ZLZA 3JXWA 3W16A 2VWXA 4FKLA 5C03A 4EBWA 2XZSA 4IZYA 3NPCA 4E4NA 3W8LA 4AN2A 4ZJIA 1IAHA 3P23A 4OLIA 4PMPA 4EZ5A 2Z02A 2CGVA 3I5ZA 5FTOA 5JRSA 3GQIA 2Z7LA 4QYHA 1YXSA 4YJNA 3ZBXA 1FBNA 2PUPA 3D14A 4LL5A 4BDFA 3IS5A 2Z2WA 3NAYA 3R2YA 5HVYA 1O9UA 5TOZA 3PG3A 4BCHA 5HU3A 1XBBA 4DH7A 3EOCA 3R7VA 2UW3A 4QMVA 4AE6A 4XG6A 4E1ZA 5CXZA 2VNYA 4M69B 3AC3A 4D9TA 2C0OA 4AA5A 4BZNA 4LMNA 4YHFA 2VTSA 4P7EA 4LUDA 3E8EA 4WRSA 3ROCA 2PVRA 3HVCA 2HENA 3WIKA 1I09A 3SD0A 3RHXA 5KZ0A 4DBNA 4PDYA 4QOXA 2JKKA 4QMPA 5M44A 2XIKA 4LYNA 1G5SA 4B99A 3VBXA 3ZUUA 5LMKC 2B52A 2FVDA 4YC6A 5CVHA 4R7HA 5L4QA 2FSOX 2V5QA 4N57A 3UOHA 5BVWA 4CVAA 3DKCA 1WBSA 4RIXB 2OGVA 2W7XA 3CEKA 1H1QA 4ZAUA 3MBLA 2W1CA 5CEOA 5AAFA 3TNHA 4Z7HA 3BX5A 4JBOA 3RAKA 3IDCA 4K0YA 4RZWA 3LQ5A 1WVXA 4U9AA 3Q2MA 5LWNA 1R1WA 2W1IA 4W9XA 3LM5A 2C3LA 2WU7A 1BL7A 5AUXA 3A7HA 2YIRA 4C02A 3I60A 2XNOA 4D1SA 1H00A 2IW6A 4XV1A 4BR3A 1OBDA 3QTXA 4BCGA 4HVGA 3M2WA 1XHAA 3BGZA 4NW6A 2HXQA 3OWLA 4FKTA 1M2PA 2B9IA 3C0GA 5DIAA 4RQKA 3BE2A 5F9EA 2EXEA 4DGGA 4ZTLA 2BMCA 3NW7A 4BYJA 1G8SA 4FIFA 4IZ7A 3LJ0A 3QKMA 2EXCX 2H6DA 2OIBA 2WQEA 4PUZA 5BYZA 1J7UA 4YZNA 4DYMA 4F9YA 5CSXA 4QTAA 4PDSA 1XQZA 4W9WA 4WSYA 3UG2A 3O51A 4H1JA 5BUIA 3HV3A 3IECA 3LJ2A 3WE4A 2QLUA 4CT2A 2WMUA 2YEXA 4JG8A 4BTMA 5H8BA 1RDQE 3CE3A 2VTAA 3LIJA 3PSDA 2F2UA 1LR4A 5CEKA 2P55A 4L68A 5KZIA 5AADA 4EQUA 2C5OA 2VTJA 1NA7A 4CXAA 2YM8A 4YZBA 4DT9A 3SKCA 5CANA 2W5AA 3UO5A 5LVOA 5IQAA 4AOIA 4QTCA 3EIDA 3G0EA 4DHFA 1YI6A 3ACJA 3ATTA 4V01A 4RLLA 3FAAA 4J52A 2O63A 3PWDA 5DEWA 4FG9A 1Q8ZA 3NYOA 4FTTA 4EUUA 5M53A 1RQQA 3VBWA 3WF9A 1PJKA 2ITTA 2FB8A 4EOQA 4ANBA 1CMKE 4PL4A 4EH8A 5DT3A 1KUTA 4QMNA 4PMSA 3LMIA 3ZZWA 3I0QA 4NH1A 5E4HA 4JNWA 3QD4A 3RPYA 3W2QA 5CWZA 3LFAA 2G9XA 1OKYA 4YNOA 2VWVA 5AR2A 5AP0A 5CEQA 3VS0A 4U3YA 3KN5A 3WILA 2NPQA 4Z7GA 1H25A 3HMIA 2W1GA 2C6LA 3PTGA 4KBAA 3OTVA 3RI1A 4L44A 2X8DA 4QRCA 5AR3A 4EZ7A 2XNMA 5CI7A 1WVWA 2GFCA 3IONA 3MVHA 4TN6A 2ITZA 5ANJA 1R78A 5CT0A 5IQFA 1QL6A 2Q0NA 3HUBA 5BYYA 4C61A 1ZOEA 3SX9A 2XIXA 3QTWA 4QYYA 4ASXA 5M07A 2GHMA 2ZV7A 3OFMA 4BBMA 5D11A 4DEHA 3OG7A 5HVKA 4OUCA 2R64A 3CKXA 4ZJVA 2BDJA 3CD3A 3UE4A 1KOBA 5CALA 5CEPA 1ZZ2A 4GH2A 4RIWB 2BAKA 5B2KA 3LFEA 3TM0A 4Y72A 4FTOA 4Z16A 3L1SA 3C50A 4XH6A 3D4QA 4DGNA 4R3PA 3EJ1A 4FV8A 3VUIA 3QQGA 5FEEA 4YUQA 3QUPA 5EHOA 4XG8A 4FKWA 2CCHA 3FL5A 4IB3A 4DTKA 4AOJA 3NMUF 3TT0A 4NW5A 4PDOA 5KCVA 3THBA 2WTVA 3E8CA 2GQRA 1EH4A 3A7JA 2KTYA 3AMYA 2XM8A 3Q9XA 1Q62A 4GT3A 4OTQA 3HKOA 4TW9A 5DH3A 2CN8A 4JRVA 2J0KA 3EQRA 5KO1A 2VO3A 3SV0A 3LFCA 3TNWA 4O0XA 2R5TA 5LMKA 4GMYA 3ENHA 4YNEA 4CKIA 1APME 3V5JA 2QKWB 4FV0A 2JFLA 1F0QA 3HECA 4RX8A 4Y8DA 4CFWA 2BRHA 1WBTA 3DAEA 4FIHA 4RWJA 5HBEA 3RGFA 2QLQA 1FPUA 4DEIA 5BNJA 2OJ9A 3KFAA 3ZBFA 2PULA 4QQ5A 4ZSJA 4D0WA 2RG6A 3KRWA 4MF1A 5TF9A 4DFXE 3QRIA 3JVSA 4QMMA 2X2MA 3D5WA 5TR6A 3U9NA 4CLIA 2GNHA 4ASZA 5CLPA 3QHRA 2CGXA 2ETRA 3ZO2A 3BEAA 2W1DA 4EBVA 2C6KA 2QI8A 4BCFA 2WHBA 5ETIA 5E7RA 3EL8A 4G6LA 5EQYA 3QTRA 1CKIA 2OBJA 5JFWA 2J90A 3DLZA 5FDXA 4GJ3A 3RCJA 1WZYA 2JIUA 2BRMA 3IDBA 4GK4A 2OZOA 5A4LA 1QPEA 4EK3A 3ZCLA 1U5QA 3D5XA 5DR6A 4K9YA 2GMXA 5A4QA 4A4XA 5CQWA 2JD5A 1AQ1A 3HMMA 5FBNC 3REPA 1YDSE 1P5EA 4WHZA 5DN3A 3ZC6A 4AGDA 1YOLA 3AC5A 2YIQA 1S9JA 1DAYA
chains in the Genus database with same CATH superfamily
1UNLA 3UDBA 4F70A 2B55A 4HVSA 2PMOX 4Y85A 4AFJA 2HW6A 2XRWA 1G8AA 3U4UA 3BWJA 1Q24A 4LM5A 5IQDA 4CFNA 1PKGA 2B9JA 5FXSA 2XEZA 4BDCA 1UU7A 4C3FA 4OTDA 3JR1A 3R73A 3QZIA 3BGPA 2ITXA 4IMYA 2E9VA 4LUEA 2C69A 3OCBA 1MUOA 5JN2A 4QYGA 4MX9A 4IM2A 1YI4A 4YC8A 3A60A 2C5XA 3WZKA 1F5QA 4GEOA 3AT2A 4F7LA 2W4KA 2R7BA 5IZFA 4HPTE 4MK0A 4UMUA 2X8IA 3GBZA 4WG3A 2VWIA 3GUBA 3D83A 4MCVA 5L8KA 3PIYA 5L3AA 3GU7A 1FVVA 4C38A 2JKQA 2YCFA 2B4SB 5CZHA 2UZBA 3VQHA 3UMWA 3WYYA 4D2VA 4W8DA 4BGQA 3FMMA 4J53A 3UC3A 3PXQA 5HE0A 3OT3A 3TZ8A 2XRUA 3V5TA 1UKIA 3TZ9A 3U6HA 2AC5A 3COHA 2PZPA 2AYPA 2V62A 4RQVA 1DM2A 1XH5A 3E93A 4G3DA 3V01A 4LGDA 2OH4A 3MY5A 3HMOA 3L8PA 3PPKA 4UWBA 5AR4A 2PUUA 3ZEPA 3MS9A 3EH9A 3OUKA 3FYKX 3KA0A 5BX0A 4YJOA 3HZTA 4EWHA 1U5RA 4GT5A 3VBQA 3NCZA 3BWFA 3UIMA 5D7VA 4FVQA 5IKWA 3W0RA 2XNGA 4Q5HA 3VHEA 2BAQA 4ITIA 5IEVA 2X7FA 2OSCA 4FK3A 4GG7A 4O0WA 4E3CA 5JQ8A 4O4EA 5D9HA 2JDTA 2PL0A 2X0PA 4IDVA 5DPVA 3TNPC 2XAMA 4AA0A 2JDRA 5KMLA 4ZLYA 3IGGA 4KRCA 2GQSA 1ATPE 4D1XA 3LVPA 4NM7A 3C9WA 4JDIA 3HMNA 3LZBA 2I0VA 4AN3A 4YTFA 4KUJA 4ZEGA 3Q2JA 1DI9A 3IKAA 4LV7A 4FTLA 3RAIA 2ITNA 3GOKA 2GNIA 4F6WA 3NVMB 1G3NA 3P7BA 5D41A 4XX9A 4EHVA 3NZ0A 2HY0A 4AT3A 3GCVA 4Y95A 4FV9A 2P0CA 4AQCA 3NRMA 4AW5A 3B8RA 5EW8A 3TKHA 5HLNA 3WARA 3WBLA 1J91A 3O2MA 2EB2A 5E90A 2X7OA 2WMWA 3K3IA 3P5KA 3ZSGA 5A4EA 4G31A 4FKGA 4FEWA 4I5CA 3B8QA 3GXLA 4I20A 4IWDA 3TMOA 3G15A 1KE5A 3HV5A 3F2RA 4MBLA 5AV3A 2FO0A 2YZAA 4I1ZA 3UDSA 5E8UA 2GPHA 2IZTA 4MWHA 4BCJA 4EOPA 3CJFA 5FBOA 3VRZA 5E8YA 3UZTA 1G8JA 4CLJA 4A07A 4HCTA 1OKWA 1PXMA 1ZLTA 4YPDA 4QMUA 3KMMA 2R9SA 5CEMA 2VWZA 2QC6A 5HQ0A 2X81A 1OB3A 3BRBA 3G2FA 3QZHA 4DCEA 2A1AB 5CF8A 3VS7A 3ANQA 5GHVA 4PMMA 4ZSAA 1HCLA 3BLQA 3OHTA 2SRCA 3ZM4A 5E8SA 4PP9A 4ZTMA 2OF2A 4OAUC 3IGOA 2BZIB 3FZTA 4RG0A 2UV2A 4G3EA 3WZEA 4N70A 3RZFA 2UVYA 3ZHPC 4MAOA 5D12A 2ZMCA 4IW0A 2G2IA 2GNFA 1E1VA 4U80A 3RK7A 3OOMA 3MH3A 2G1TA 2JGZA 4ANLA 2Q83A 2XBJA 1W2CA 3RHKA 3ZXZA 1JSVA 4XEYA 2QG7A 1ZY5A 2RL5A 1V1KA 4AXDA 4DFNA 5M4IA 3MSSA 1ZYLA 3VF8A 2A19B 2QQ7A 3H0YA 3W2PA 1Z57A 4DEDA 4CYIA 5I9VA 1JKSA 1YVJA 3EB0A 3KULA 4I4FA 2QU6A 3LOKA 2G15A 2JDOA 4FNWA 4G5PA 4H3QA 4HGLA 3WE8A 2PWLA 4FV1A 2ZM4A 4WUNA 4DDGA 1H1RA 2UZEA 4LMUA 4BCNA 5HD4A 3BGQA 3R1YA 3R7GA 5AR8A 4KKHA 5ETAA 3Q9ZA 5DI1A 5LARA 3DZQA 2VX1A 5A14A 3KREA 4XRJA 4DDIA 1JVPP 4CT1A 3Q52A 3N51A 2PE2A 2VTRA 3F2AA 2PVKA 3P7CA 3COKA 4IHPA 1Q99A 2LAVA 4D4SA 2ITVA 1OL7A 3D94A 5EH0A 2E9PA 4JBPA 2BRBA 3DNEA 3DA6A 1WFCA 4TZRA 2ZB0A 2C3IB 2XNNA 3D5VA 3DBDA 1ERKA 2XYUA 3RP9A 3RVGA 3GU6A 2ERZE 1OI9A 3PP1A 4RT7A 5HNGA 4C4FA 2QO9A 5AV0A 2GSFA 3IK3A 4RJ3A 4NFMA 3R8ZA 4IDTA 4EQMA 5EKNA 3QL8A 3FWQA 3I6UA 4RWKA 4DINA 3PFQA 2JIIA 4M69A 5I4NA 2VU3A 4XRLA 3ZSIA 1XJDA 3FL4A 3LQ3A 3TUCA 3OUNB 2O3PA 3VUGA 3OXTA 3GT8A 5J9ZA 5BMSA 3R7UA 5D7AA 3FUPA 1OIQA 3EYGA 2F7ZE 3JY9A 3M11A 1R3CA 2R3JA 2RIOA 5TKDA 3CP9A 2ZDUA 4YHJA 3K5VA 3OC1A 3DZOA 3Q9WA 4KINA 4X3FC 5M06A 5JGBA 4ITJA 3ORPA 4WNOA 4DH3A 5DRBA 1OL1A 1PXKA 2R3KA 4J7BA 1REJA 3H9FA 3A7IA 3LCTA 3W55A 4XLVA 2P2HA 3ID6C 4QPAA 4RIXA 2RFDA 4OW8A 4PTGA 4MBJA 3ZO1A 2WELA 3KXMA 3DDQA 4E6CA 4RIYB 2OH0E 3VRYA 4R7BA 4I92A 4ANQA 3I6WA 5T6KA 5J5TA 5H8GA 3RCDA 4CCUA 3LXKA 3AXWA 1KOAA 3EN4A 4YZCA 3QRUA 2YM5A 4UN0C 2VZ6A 3V8SA 3Q9YA 3ZRLA 4LOQA 5AIRA 5A4CA 3KVWA 4FIEA 3MGYA 5AM7A 1ZYCA 2UZTA 3KXXA 4J98A 1E1XA 1O6YA 3DKOA 5DT4A 3U6IA 4FGRA 4KBKA 4G3CA 4Y83A 3RMFA 5IF1A 4G6OA 3N9XA 3KIOC 4OTRA 2XK8A 4A06A 2X0OA 3P78A 4IJPA 4QMOA 4KRDA 3P9JA 4I24A 3P4KA 4USEA 2YAKA 3R63A 4FSWA 3QXPA 4CMUA 3W2OA 3AC2A 4RFMA 4CFFA 3EQGA 4J8MA 3RZBA 3OF0A 3BHTA 4WNPA 4EKLA 4CGAA 4UXQA 4NCTA 2WEVA 5JMSA 5HEZA 2X0GA 4PY1A 2ZYBA 4ANMA 1OGYA 3DDPA 4E93A 4QMTA 3CIKA 4MQ2A 3CQEA 2C6OA 4JQEA 4M13A 3DK6A 3TI1A 4BDKA 3FQSA 3BYOA 3HX4A 4DE4A 3C0HA 1JSUA 5M4FA 3FY0A 5DEYA 3CTJA 2Y9QA 1T46A 5AV1A 4IANA 3SG9A 4KIKB 3QKKA 5HLPA 3TDWA 3FQEA 4X2GA 2F7EE 1B38A 1VJYA 2WMRA 4C8BA 4S30A 3ZRMA 4WRGA 3MFUA 3TNIA 4FG8A 5C4KA 2QOCA 4BZOA 4IEBA 4O22A 3ZLSA 1M2QA 1WMKA 5DYJA 4C59A 5AA9A 2WTKC 2XIRA 4FKQA 2HOGA 4FUYA 3DBFA 4TXCA 4CKJA 4KKEA 1QPJA 1UU8A 2PE1A 5BVKA 3HRFA 4RJ6A 3QTQA 1UU9A 4QNYA 4BVUA 3ZFYA 4BY9E 2IW9A 3PIZA 2X1NA 4F7NA 5EQPA 4AZSA 1GNGA 2B54A 3K2LA 2XEYA 1FVRA 3TKUA 3Q04A 4B6LA 5AP4A 1PXNA 3PSBA 4WNKA 3PJ8A 3ORXA 2Y8OA 1KV2A 4FODA 3EQHA 4K18A 4K77A 4ZLOA 3GU4A 2XKCA 3SDJA 4C4JA 1LP4A 1J3HA 1UA2A 3PJ2A 3QCSA 5EI2A 2P4IA 2Y0AA 4FBXA 4Y5HA 5ETFA 3UIBA 4U40A 3LW0A 4R1YA 5F4NA 3UYSA 4AGWA 4MVFA 3S1HA 4XS2A 4E8AA 1UWJA 4FZDB 5IA3A 4RGJA 2YZLA 3FLSA 4XCUA 5BQ0A 3UOLA 1YOMA 4CCBA 3RALA 5GNKA 3ZMMA 4O1OA 2XKDA 4FT5A 2OK1A 3VF9A 5KMMA 4FV3A 5HCXA 2BIKB 4JMQA 2ITOA 4RIWA 5CNNA 3SW4A 2YCRA 4JBQA 3CKWA 1X8BA 2X2KA 5IA1A 2VTTA 2OXYA 3BLRA 4O7NA 2XK6A 4X21A 2GTMA 4GT4A 4IFGA 2X7GA 5DWRA 2CDZA 5ANOA 3FSKA 3ODZX 5HI2A 4F9CA 2OO8X 1IR3A 3OY1A 4C7TA 4FNYA 4MXOA 5KMJA 4ZJJA 2B9HA 1GAGA 1RE8A 4M0YA 2WTIA 2WMQA 4JS8A 4YJTA 3D2KA 2UVXA 4IFCA 4W8EA 5ETCA 2XIZA 3NYVA 4UY9A 4X3FA 5T3QA 2Z7RA 3WZJA 4ALVA 3P5JC 1JNKA 2W1FA 3VS6A 2WU6A 5C27A 3C4EA 4L8MA 3UJGA 5IQHA 4G9RA 3W33A 2NYAA 3ET7A 3PLSA 4H05A 3MH0A 4QDEA 4UV0A 5JH6A 2JDVA 2R3PA 2QOIA 2WOUA 2WTWA 3CXWA 3HV7A 5EI6A 3TZMA 3KK9A 4DAWA 5CF6A 2UVZA 5HTBA 1TZDA 5CY3A 4O7LA 3BHUA 4UB7A 2VTPA 3LJ1A 4D5KA 4N6ZA 4U45A 3F3TA 3EYHA 3Q4CA 3R71A 4AP7A 1WBVA 4DEEA 3RM7A 4XG9A 2IVSA 2O5KA 2X4FA 3WIGA 2RKUA 4KB8A 4ARKA 4PP7A 4XBRA 1PXOA 3VHKA 5BUEA 5CI6A 2QURA 1PF8A 3I79A 2W1EA 2C6MA 3KMWA 4O4CA 2OG8A 3EZRA 3G9NA 3NLBA 2XAOA 3AKLA 3OEZA 1GIIA 5AUVA 1CTPE 3P08A 4LOPA 4JQ7A 3UBDA 3QA8A 4KWPA 5HHWA 4ZY6A 4EL9A 4HVHA 3S4QA 1MP8A 1T45A 3VBYA 4FTJA 5BV3A 2UZNA 4KKGA 4YJVA 1PXJA 4EKKA 5J5SA 3PY0A 3VUTA 2CGUA 4AZVA 2JKMA 1IEPA 3ORKA 5IH6A 4NM3A 4U41A 4BDHA 1WVYA 3QC9A 4BCQA 2J51A 1CKJA 4FYNA 2X39A 4AA4A 3V51A 2R3RA 4FUXA 4MHAA 3FZOA 3GU8A 5BUJA 1SVHA 4FVPA 1YXXA 3E3PA 4KIPA 4XG4A 4MEDA 3CGOA 3UO4A 4FKOA 3MA6A 4NZWB 4MWIA 3RM6A 2E9OA 4IAFA 4FEVA 5IQBA 3PXZA 5BVOA 2BCJA 3F7WA 5KHWA 2RGPA 2JIVA 4AZEA 4I3ZA 4UMQA 4NSTA 3BYUA 4TWNA 2HK5A 3PVBA 5F94A 5CAQA 5L6PA 1MRUA 1ZZLA 4C4IA 4OBQA 4F4PA 4DA5A 4XLIA 4QTEA 3V8WA 2JFMA 3F3ZA 4FTRA 3MVMA 4QP7A 4FT9A 5DG5A 2JDSA 3RAWA 5GZAA 2WTCA 3SC1A 2XH5A 4RJ8A 4TYEA 3UIUA 4DH1A 5L2IA 5EW3A 4IVDA 5JEBA 1M7NA 4DEGA 3TN8A 2BAJA 4NJDA 3MN3A 3MPTA 3QQUA 1Y8GA 2R3QA 3A62A 4Y46A 5EI8A 4EHGA 4QNAA 2X2LA 2GS7A 1NVQA 5GJGA 1H07A 1NY3A 1BL6A 2DUVA 4YC3A 2IWIA 2PTKA 4E4LA 4ANSA 4CKRA 2YM4A 5FEDA 4IAYA 4TL0A 5CU2A 3A61A 2Z8CA 3CPBA 1H01A 3DY7A 3OZ6A 2H96A 4XMOA 4AWIA 4OBOA 3L8XA 2PU8A 3BEGA 5JFSA 2ZVAA 1ZMUA 1BX6A 1XR1A 2LGCA 4X3JA 4EOLA 2R2PA 2BFYA 3KGAA 5J95A 3PY1A 5EK7A 1ZMVA 2DYLA 3CQUA 2NP8A 1P14A 3QQLA 3L8SA 3CY2A 4O1PA 1YDRE 5K5XA 3W0PA 3E3BX 4H36A 1XWSA 3QWJA 4L9IA 1JQHA 4FMQA 4C37A 2W06A 3MIAA 3DBEA 2RFSA 2ZM3A 4OTGA 5EDQA 3ZFXA 5KE0A 2BR1A 4BCMA 4AF3A 2ZV9A 4FEXA 5BVNA 3PPJA 3Q5ZA 3KB7A 4G3GA 4BDGA 3VJOA 3ITZA 3FLZA 4C33A 4F64A 4UWCA 4ONAA 3K54A 3R8VA 4E4XA 5CASA 2PZRA 2F4JA 3SW7A 4M14A 3QA0A 4HYSA 3G6GA 4LGHA 4D2RA 1J7LA 5AUWA 4MKCA 4A9TA 4IVAA 4PRJA 4RFYA 3FXWA 4JT3A 5EYMA 3ZSHA 2YJSA 3HMPA 5LXMA 1JKTA 4M15A 4BDJA 3S0OA 5HCYA 4ZZMA 5AR5A 3VULA 2QOHA 1Y8YA 4KS8A 4F63A 1U46A 5FXRA 3WOWA 2VGOA 3LCOA 4ASDA 2I0HA 3EZVA 5HO8A 3KKVA 4LV5A 5A6OA 2GNLA 2OF4A 1GZOA 4AXEA 1YHSA 1PMEA 4BCOA 3Q3BA 4X6RA 3GB2A 1PMVA 2HZNA 4WT6A 4FJVA 2BILB 5C8NA 4IC7A 3OBJA 4NUSA 3W2SA 4NM5A 3JVRA 3FMDA 3K5UA 2XJ0A 5HOAA 4EUTA 5LOHA 4WKQA 3L9NA 5C4LA 1J1CA 4HCVA 5JRQA 1W98A 2PVYA 3A4PA 4U97A 3W1FA 1YHWA 5EOBA 4I0RA 4F9BA 4F78A 3N4VA 4E6QA 1ZOHA 1SYKA 2W17A 3PVGA 2XUUA 4QYEA 4A9UA 4P2KA 3R8UA 4D4VA 3DBCA 1TQMA 3MIYA 3GENA 4XV2A 4BF2A 3PE1A 2OKRA 4A4OA 5BPYA 4I21A 4O82A 1V0PA 4HNIA 3LCSA 1XO2B 4JLCA 3UNZA 4E26A 3ANRA 3QUEA 4RX7A 1WCCA 1IG1A 4UZHA 4BI1A 5M57A 3NVKI 5ANIA 1JAMA 3HAMA 5HIDA 4FL3A 4IZ5A 3FHRA 5IISA 3A8XA 5E8ZA 5JGAA 3O8PA 2C5YA 3DJ6A 3P7AA 5CEIA 4O7SA 1YWRA 4BDDA 5HNIX 3VS4A 3U6JA 3FLWA 1Z9XA 1LEWA 3HEGA 4FICA 5AP3A 4O7VA 3MH1A 2XJ2A 1XH7A 4MD8E 4U8ZA 1STCE 1XMLA 2B53A 4GUBA 1IAJA 3GQLA 3ORLA 4L52A 3GCUA 3R7YA 4JAIA 3F2NA 5AP2A 4BKZA 2O65A 1OGUA 3EQFA 5DT0A 4BIDA 1VR2A 4G34A 1QPDA 2XK4A 3POOA 4GFOA 2OXDA 3CS9A 4FIGA 4X3FB 4E6AA 5IA0A 2UZOA 4BCIA 4F09A 4QQTA 3VUMA 3UYTA 3R9DA 4AOTA 4CNHA 3S2PA 3PA4A 4ALWA 4WOVA 5ANGA 4DLIA 3EFWA 3OD6X 4IAAA 3F5PA 3IW6A 3PRIA 4J1RA 2J5FA 1P2AA 4C36A 3R00A 3ORNA 4L00A 2WTJA 4EK5A 5HX6A 3TACA 4BWKA 5M4UA 2XCHA 3RK5A 2CKPA 4RIYA 3ZYAA 3NW6A 3QLGA 3QWKA 3O0GA 1PW2A 4HYHA 4L3LA 3TCPA 4EONA 4S33A 3Q6WA 4JIAA 4HVDA 1GOLA 3HDNA 2YCSA 3CQWA 1WBOA 1YXTA 2CN5A 3BKBA 3KU2A 4GRBA 4M97A 3MFSA 3KK8A 4OBPA 1O6KA 3E7OA 1R0PA 4YURA 5AUUA 5LJJA 3OVVA 3Q5IA 4KNBA 4RFZA 2YHVA 3HYHA 4O38A 4YLJA 2BALA 4HW7A 2R3NA 3EQIA 3MPMA 3ULIA 4PDPA 4XV3A 4O7YA 2F9GA 3QQFA 4O7ZA 4TT7A 1XH9A 3BI6A 4BL1A 4QQCA 3WF6A 2W1ZA 4KIOA 5CSVA 2UW8A 2BZKB 2XJ1A 1O6LA 2XNBA 5HE2A 2CCIA 3RNIA 3U8WA 5AA8A 4C2VA 2X9FA 4KD1A 5EOLA 2VWUA 3KRXA 4B9DA 3MVJA 5KMNA 2XIYA 4I6FA 3VO3A 3R28A 1SVGA 4ZTHA 2R3GA 4UYNA 4GSBA 3V5QA 2W96B 5HD7A 3Q4TA 2WQNA 4I0TA 3EHAA 4K8AA 4P90A 3DGKA 3KRRA 4U42A 4YSMA 3VS5A 4AE9A 5AEPA 4MUQA 4DHJA 3RWPA 2VTLA 3A7FA 3ZOSA 2O8YA 3GCQA 1LUFA 3K3JA 2FA2A 5G6VA 4BRXA 4FK6A 4TPTA 5K3YA 4UMPA 3WYXA 3QCQA 4P5QA 3MDYA 3TL8A 5FUTA 4R5YA 3C4FA 4LRJA 4AW2A 4I93A 3S95A 4KIKA 3O7LB 4G17A 3PVWA 3GCSA 4BI0A 1ZXEA 2YIYA 3LCKA 3QUDA 3PXYA 3AGMA 3C0IA 3LFNA 1BMKA 2ZV8A 5EM7A 5LWMA 5FWKK 2WTKB 4YLKA 4FC0A 4LOOA 4XJ0A 2XS0A 1H08A 3NUPA 2AUHA 4QP4A 4RRVA 4WSQA 3NYXA 3R0TA 4RX5A 3LPBA 2R7IA 2C5VA 4RSSA 4TWCA 5L2TA 2XM9A 3PJ1A 4ZSEA 4BGGA 2Y4IB 4IB1A 4G6NA 1PXPA 1F3MC 4DH8A 4EOSA 1ZYSA 4JDKA 5HE3A 2QKRA 2WO6A 2V7OA 4FSRA 3FLNC 4PF4A 4NIFB 3KQ7A 4N0SA 4ACHA 2F7XE 3I7CA 4YMJA 3GFEA 4I5HA 2WAJA 3BU5A 3H0ZA 3LFFA 3P0MA 3DXNA 4L43A 3ZEWA 3I4BA 4MNEB 2F49A 3R01A 2E9UA 3TTJA 4ANNA 4ZTNA 4D4YA 3FHIA 3P1AA 4EK6A 2XYNA 4KSQA 4YBKA 1OUKA 2W1HA 3DPKA 3VIDA 4C4GA 4DN5A 4WO5A 2R4BA 2C6DA 3HV4A 4BDIA 3G33A 3LFDA 4U0IA 3UO6A 5IU2A 2Y7JA 4ITHA 2IZUA 3NIEA 4M66A 4EH5A 4AQKA 2VGPA 5DMZA 3BBTB 4EC8A 4XP3A 5HVJA 5LMAA 4BICA 1Q3WA 3QLFA 3UGCA 4U43A 4J71A 2VWYA 1KE6A 3EQBA 4M8TA 2ZAZA 3OT8A 4XG2A 3GEQA 3OXIA 4Q9SA 4FZFB 4O7WA 3C13A 3CY3A 3W32A 5K0XA 3KF7A 4PPAA 4FA2A 4ZIMA 2QOOA 5CX9A 3EFJA 3I7BA 2E2BA 4II5A 4JX7A 2V0DA 1BI7A 2G2HA 2C1AA 5L6OA 2XBAA 3O50A 3C5IA 5F1ZA 5GINE 4F6SA 1OIRA 2CKEA 2QG5A 4CZTA 5JT2A 5JSMA 2ITQA 3DQWA 3FE3A 3GU5A 3JYAA 3FY2A 4HJOA 4O6LA 2IZRA 4A7CA 4CG8A 4Y73A 3KVXA 3BBWA 1H27A 4W4VA 2VO6A 4UALA 5C01A 5A9UA 5CF4A 2J50A 3PA3A 3QHWA 2ITWA 5FP6A 4Q2AA 3ZONA 4QTBA 3DXQA 3MFRA 4FIIA 1M2RA 2HZIA 5A46A 5I5ZA 3EN9A 4JIKA 4EEVA 4QP1A 3ELJA 4X2FA 1E9HA 3QQJA 3QZGA 4QPSA 2PYWA 5GIPE 3RBWA 3E64A 2Z7QA 2YM3A 3LMGA 4CD0A 2J2IB 2OWBA 3FZPA 3O17A 3O7LD 4DG3E 1PRYA 2R3IA 3V8TA 4EZ3A 2OJJA 4NTTA 2GDOA 2WXVA 3HA8A 1MRVA 2WB8A 2WIPA 5HX8A 2CNUA 2R3LA 1OKVA 4JJRA 3MJ2A 5FQDC 5LVMA 3W2CA 4AG8A 4MD7E 5CVFA 3OWKA 4LV8A 4K33A 4S2ZA 4YTIA 3UOKA 4UMTA 3WF5A 5ACKA 2HZ0A 2GQGA 4LQMA 3A8WA 2JITA 1PMUA 3DJ7A 4JL9A 5J87A 3ZFMA 3IOPA 1BKXA 1U54B 5IEXA 2O0UA 1ZYJA 3KMUA 3U51A 4IB0A 4RZVA 4O7RA 4YZ9A 4JRNA 5HLWA 4QP8A 3ZZEA 1Y6AA 5B0XA 4EORA 5AUTA 2IPXA 4ZMEA 4CRLA 2PK9A 4D2WA 3PIXA 4OR5A 3QFVA 4IWPA 4IX6A 2WNTA 3GI3A 1UU3A 3D7ZA 3NUNA 3Q60A 4J96A 4ZZNA 4O6EA 3DAJA 4O4BB 4M7IA 4F0GA 3OWJA 4ID7A 4MXXA 1OUYA 2ETKA 4QP9A 4QD6A 4ENXA 5IMXA 4YHTA 4GIIA 5BVEA 3GVUA 3TNQB 1WBPA 2VX0A 4YZDA 3UP2A 4GL9A 4EI4A 2YM7A 3A99A 5DRDA 2V22A 3QTSA 1XKKA 3IW7A 2YDJA 4DF3A 4NFNA 5EDPA 4RC4A 2GHGA 5GJFA 5AP7A 5F95A 3SGCA 3QGYA 5DA3A 2X6EA 3VONA 4YJSA 3ORIA 4R3RA 4JDJA 4L3PA 2W9ZB 2GFSA 4GJ2A 5E8VA 4FTIA 3KXZA 3F69A 4O91A 4L46A 3OP5A 5DE2A 5AR7A 3DK3A 4GVAA 3GC8A 5M56A 5KBQA 4O2PA 2V55A 3ULZA 2GCDA 4DBXA 1SMHA 1FINA 4TYHB 3F61A 3DQXA 1W0XC 3LE6A 4FIJA 4BDAA 3DOGA 3O5AA 4K6ZA 3AGLA 1PHKA 3ALOA 2BRNA 3VC4A 3AKJA 3NNUA 2VV9A 3BHVA 2IW8A 4EOKA 4QYFA 3R9HA 1UNHA 2O2UA 4FKSA 5HZNA 5J1VA 1XBAA 5JK3A 3F7ZA 3SAYA 3W0NA 1SZMA 2GTNA 4ACDA 3OCGA 3HNGA 4E5AX 4LRMA 4FKUA 3PUFC 5IG1A 3MTLA 2BUJA 4CYJA 5AWMA 1JLUE 1XH8A 3FZSA 3D7TA 3R22A 5AP5A 5JZNA 3ZLWA 1OZ1A 1W84A 4X7QA 3FC2A 4FVRA 4V05A 2A98A 5EHLA 4O7TA 4FSUA 3HAVA 2OZAB 2I0EA 3FMEA 2VTQA 1CKPA 2QO2A 3L9PA 3UVRA 4CFMA 1PXIA 2UZVA 3UPXA 4ANOA 3BLAA 3ROYA 4MXAA 1BLXA 4FRFA 2RSVA 3MY1A 2BIYA 4GG5A 3ATSA 4QMLA 2QCSA 4FE2A 4NT4A 5KBRA 3H10A 4BIEA 5AX9A 4FSYA 5EM6A 4FKVA 4HYUA 4Q5EA 1AGWA 4GK3A 2DQ7X 3CLYA 5LMBA 4XP0A 3TKIA 5AIKA 5IQIA 2XVDA 5I9UA 4BWPA 3MESA 3DFCB 3KN6A 2R0IA 4G1WA 5KNJA 1GZKA 2RG5A 4HGTA 1B39A 2C1BA 4TWOA 3T9TA 1CSNA 5IDPA 2B7AA 3V5WA 1KWPA 1KE7A 2CKQA 3FEGA 1JKKA 5CF5A 2PVMA 3DLSA 1FOTA 2IO6A 2QO7A 4AAYA 1BYGA 1ZMWA 3DV3A 3FMKA 4IWQA 4D0XA 3IDPA 3WF7A 1Q8WA 1H0VA 3IQ7A 5HESA 3VN9A 3FMHA 4I5MA 4KABA 2PZYA 2Y4IC 1PMNA 5CU6A 1OL6A 3R21A 4DEAA 1ZRZA 4FT0A 3U9CA 4YO6A 4RJ7A 3QF9A 3ZXTA 4AX8A 3ZLYA 2HYYA 2H9VA 3FMNA 1VLRA 2BKZA 3AC4A 2C5NA 1YQJA 2GU8A 1MQBA 4RBLA 4U7ZA 3C51A 4RWLA 3NFFB 3C1XA 4HPUE 3PZHA 4QT1A 2BHEA 1SM2A 2J0IA 4WG5A 5AUYA 3R7OA 3ZO4A 4IAIA 1TFFA 4MNFA 4DT8A 3PVUA 4ZTQA 2PY3A 3PFYA 4RX9A 3BQRA 4M84A 3LMHA 4NM0A 4PQNA 2VUWA 1REKA 5EW9A 4ZZOA 2QONA 4B7TA 3HRBA 2XNPA 3QALE 4QMQA 5M51A 1UWHA 2WIHA 4FSNA 4EK4A 1WBWA 5AV4A 3NEWA 4O0VA 2ZDTA 3ERKA 4S32A 5M55A 4M0ZA 3CTQA 2PMLX 2F2CB 5IH5A 3AD4A 3PXRA 3QTUA 3HV6A 1A06A 2HAKA 3N4TA 4R3CA 5A54A 3VQUA 2BPMA 1OL2A 4GVJA 4HGSA 4UEUA 4AW0A 4FT3A 4NJ3A 5H3QA 2ZV2A 2WPAA 3PJ3A 2XKEA 5HCZA 4PV0A 4EHEA 4YP8A 1G8KA 3FMLA 3KC3A 3F3VA 1SNUA 3NAXA 4YTHA 3R9OA 4CV8A 4F1MA 3W0MA 3TXOA 4DGOA 1Q8UA 4OT5A 3LAUA 3DT1A 3MTFA 1NXKA 4PMTA 5LCKA 4BDBA 4ZMFA 2H8HA 2P2IA 2R3