5LVLA

Human pdk1 kinase domain in complex with compound ps653 bound to the atp-binding site
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
285
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 285
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvlA01
3UE4A 5CEQA 1OL1A 2J6MA 3PXZA 5D9HA 3O51A 4RLKA 2PVFA 3JVSA 1HOWA 1UKHA 3I0OA 5JFSA 3VUMA 4D5KA 2X39A 4QP9A 3BELA 1VR2A 4ZY6A 1WCCA 1RJBA 5LWNA 3PWYA 1BYGA 4ZMFA 3PPZA 1OKYA 2V55A 5CS6A 4FSQA 5KKRB 2HYYA 4KS7A 3E7OA 4U80A 3KULA 3COMA 2QU6A 2YM4A 3GU7A 3TV4A 4HPUE 3A60A 4ZK5A 1Q97A 4EOJA 3E8EA 2X9FA 1W8CA 1H1RA 4F7NA 3NUAA 3MPTA 5L8LA 4IC8A 4MAOA 2UVZA 3PZEA 3VBWA 4S33A 2EU9A 3FQHA 4RJ6A 4FTAA 3EQIA 1WVYA 4S34A 4X2NA 2FSOX 3AC4A 4JDKA 3QQHA 5EHYA 4A7CA 4OUCA 2QLQA 4FBXA 2V0DA 3DDPA 4D55A 3LIJA 3TG1A 5A4QA 3WYYA 3KRRA 2XEYA 3LQ8A 5ETIA 1XQZA 3UP2A 4JG6A 1Y57A 1XH8A 4I6HA 4ZTQA 2CNUA 4ZEGA 4FZFB 3WZEA 3FZPA 3U6IA 4NJDA 4FNZA 4QP2A 3R1QA 4J8NA 5JT2A 2I0YA 2X2MA 4YJNA 4KBAA 3UQCA 2BUJA 5AP1A 3W2RA 3H30A 3AD4A 4Q9ZA 4FV9A 5HLWA 4IAAA 2Z02A 3PWDA 1JKTA 3MA3A 5HNBA 2Y8OA 2PE2A 2PVHA 2ITOA 5ANEA 3VHEA 3Q53A 3RPRA 1UA2A 2OICA 3BHUA 4ANLA 1P4FA 1OKVA 2XEZA 3GFWA 3R30A 2E9NA 4J8MA 4XHKB 1M2QA 3MA6A 2J51A 2C30A 1JKKA 4NKAA 2ITQA 4O82A 1YWRA 3E3PA 3PIXA 3GI3A 5FDXA 4BWXA 2WGJA 2VTLA 4N6ZA 5HG5A 3DB8A 4XV3A 3N4UA 2O0UA 3FZTA 5IUGA 4P7EA 2LGCA 4FV7A 2WNTA 1Z9XA 5LVNA 3LLTA 4GW8A 3W8QA 3KY2A 3IO7A 5IA2A 4DG2E 1GJOA 2X6DA 4X2FA 5DRBA 2XMYA 4EJ7A 2CKQA 5AJQA 2YZAA 3TT0A 4CTCA 3A4PA 3R8VA 5B2KA 5E8UA 5DPVA 5I9YA 5J9LA 4U40A 2HZIA 4FSNA 3LM5A 4G17A 3RHXA 2R3GA 4PMSA 4ANQA 4TN6A 3V8TA 4RX5A 4BCFA 5KMIA 4DFNA 4GFOA 3HZTA 4PDYA 3DBQA 4NJ3A 1JVPP 1YI3A 3K3IA 2WIHA 3I4BA 3TACA 4M68A 3NUYA 3B8RA 2PVRA 5CSPA 3F5GA 1WMKA 4USEA 4WOVA 4CFXA 2GNLA 3COIA 3EH9A 1URWA 3O8TA 3ODZX 1JSUA 4KAOA 3WILA 1IAHA 3AC8A 3SDJA 3WI6A 3TI1A 3QQKA 1E1XA 4ZTLA 3MI9A 5CAOA 3TUCA 4BDDA 2HY0A 3O23A 3OXTA 4AN9A 4EKKA 4EOOA 2HENA 2CCIA 3QTZA 3RZFA 4CYJA 1ZARA 4EUUA 4AE9A 1YI6A 3AD5A 3E63A 3L1SA 4C02A 3MIYA 3TZ8A 3PA3A 4P2KA 3GP0A 3DBEA 2OXYA 4QMPA 3FZRA 4FKLA 1P14A 2P55A 1R78A 2F2UA 1KE5A 3OBJA 2JGZA 4IX5A 4JX7A 5AX3A 4EOQA 4ACDA 3DAKA 3QXOA 1OL5A 4F7LA 5KMNA 4RA4A 4YNEA 3E8CA 4XLIA 3HDNA 3BV3A 4QNAA 2EB3A 4DC2A 2UZVA 5ANJA 2YIWA 3D0EA 3QXPA 5JZJA 4ZS0A 4XS2A 1JKSA 2O3PA 5I9UA 4JI9A 1KE9A 3QALE 4AUAA 4F6SA 1CKPA 3LFSA 3UG2A 5AAEA 4EBVA 3MFTA 5E8SA 4I6FA 4CGAA 3QTIA 4FYOA 2NNWB 5DIAA 5HE3A 3PXQA 3T9IA 3G5DA 3IKAA 2OG8A 2OI4X 3M42A 5DEYA 4AN3A 2GQGA 5AEPA 2VTTA 2ETMA 5AV3A 1PJKA 2Z7SA 3I81A 2R3PA 3Q60A 3ZUUA 4W8DA 3FKNA 2QR8A 4V0GA 1NVSA 3EB0A 3QX2A 4FMQA 3PIYA 5M57A 2QODA 3ZUTA 3A8WA 4TNBA 5JFWA 4QPAA 4GMYA 2IJMA 4O0UA 4V01A 4UMQA 4GT4A 4QPMA 3FYJX 4CEGA 4LL0A 3BZ3A 2W1CA 4F9WA 4WNMA 5FP5A 4IZ5A 4BIBA 4DEDA 2VWUA 4I5HA 4U6RA 1ZOGA 5CENA 3TUDA 4G9CA 1GAGA 2YJRA 4ZZMA 1B38A 1H00A 3SX9A 4GFMA 4AA5A 4EQMA 5BUIA 5HE2A 5LVPA 3ZSGA 3U87A 4O27B 3EQRA 2UW0A 2XVDA 2GS2A 3HAMA 5AUXA 4GK4A 3UJGA 2H8HA 4RQVA 3U6HA 2J0LA 1FQ1B 3CBLA 3WBLA 2ZVAA 1PXKA 1WBWA 3R9RA 5IQBA 4S30A 3LCTA 4L68A 4JG7A 2YA9A 4ZP5A 5EHOA 2ITVA 5AMNA 3ZOSA 2BAQA 3F3VA 3HV5A 3I0QA 3UNZA 2YDKA 3OY1A 3O96A 4IQ6A 3F69A 2C6TA 1ZYSA 2O5KA 4FV8A 4U41A 3RI1A 3EMGA 3AC3A 5ETAA 5CWZA 5FBOA 3NNVA 4CSVA 3MW1A 3GU6A 2C5VA 4IZAA 3NYNA 4L9IA 4R8QA 4X0MA 3RP9A 2WD1A 4AFEA 3OG7A 1RDQE 2JIIA 2R3RA 4IJPA 2YHVA 4G3GA 4RWJA 5AV1A 4R77A 4YJTA 1OVEA 3P23A 4MF1A 2UZWE 3E92A 3RBWA 4ERWA 4KIPA 3KF4A 3PA5A 5EKNA 2QOLA 3OWLA 3ALOA 4QNYA 1H25A 4DTAA 3NW7A 4K9YA 5KZIA 5BQ0A 3C1XA 3ROYA 1DS5A 4CV8A 1TKIA 2QO9A 4GS6A 4WNKA 3N4VA 1PMEA 2CNVA 4PPCA 2W1IA 3EKKA 4FGRA 4MBJA 4EH8A 4YHJA 4BC6A 5CU4A 4DFBA 1U59A 2HXLA 2JFMA 1UNGA 4ZMEA 2YCRA 3PXRA 4UWYA 2ZDTA 1NXKA 1YWNA 4P4CA 5CAPA 3PDTA 2E9UA 3OCGA 4BZNA 4EWHA 4W4YA 1R3CA 3PFQA 3E5AA 5AM6A 3CR0A 4IHPA 4DCAA 4O0XA 4HCVA 3LFCA 4IX6A 4AN2A 4XG4A 3ZRMA 1CSNA 3FWQA 3R7EA 3QTXA 4E5BA 4Z55A 3P9JA 5M4FA 4ITJA 5CY3A 4HCTA 1IAJA 4C34A 4OBQA 1JPAA 4DEBA 3L9PA 4PWNA 4XP0A 3F88A 1BI8A 3ZRLA 4LGDA 2IWIA 4LOPA 4FZ7A 3NAYA 3R9HA 2YN8A 4U79A 4BY9E 3WZDA 3R8UA 2OIQA 2XP2A 4NM0A 4RVMA 3P1AA 4JL9A 3QKMA 4BKJA 4ZY5A 3KRLA 3LCSA 2CGUA 3NMUF 4WBBB 3AC1A 1V1KA 3GU8A 4BGQA 4NM7A 2BIKB 4PDOA 2IN6A 4UMPA 3VUKA 4M12A 1ZZLA 4JNWA 4NFNA 4F9AA 3NDMA 5H9BA 3KXMA 3NS9A 4R3PA 5H8GA 3SA0A 1GZNA 2VWYA 3L9LA 5FXQA 2PZIA 4FSYA 4GCJA 4IB1A 1OI9A 3I60A 4TPTA 4CKIA 2H6DA 3G6GA 2B55A 2C6KA 3R28A 3QF9A 5HEZA 4CLJA 1KV2A 2W5AA 4GT3A 4AZSA 4ANMA 1PXIA 1SZMA 2BALA 4I0TA 5IH4A 5JEBA 2BAKA 2IVTA 2YFXA 1H0WA 3OUNB 2XKDA 3BU5A 5FGKA 4D0WA 1U4DA 4J7BA 4C3PA 1JNKA 3ORPA 1OKWA 5FM3A 3AC5A 3AT3A 4OAUC 2ZYBA 4DA5A 4JVGA 5TOZA 2OK1A 3IW7A 2IO6A 1M52A 1CKJA 1MQ4A 3DY7A 4FT5A 3Q6UA 4GV1A 4O7ZA 1ZYLA 3FMEA 4II5A 5HU9A 2H96A 3WZJA 2R3IA 4AW5A 5T3QA 4YJOA 1OPJA 2G9XA 3FI2A 3R9DA 4BIDA 2WTWA 2X8DA 2EUFB 2RSVA 5L2QA 4CXAA 5IEXA 4MK0A 2J2IB 2WU7A 2UVXA 3H9FA 4N57A 4AACA 4H05A 5EQYA 3OD6X 3EQHA 3PIZA 5F20A 4FZ6A 3SOAA 3ZLYA 4FG9A 2P33A 2VWVA 4JQ8A 4KKGA 3VQHA 4QTAA 4HVHA 4I1ZA 3W2OA 3NCZA 3LE6A 2X8EA 4MNEB 3NUSA 4C61A 3FQEA 2VTRA 4U3ZA 5AADA 4E20A 4CMUA 4N0SA 4W4XA 5A9UA 5CF6A 3F7WA 3Q9ZA 5ITAA 4FL3A 5D1JA 4RPVA 4H58A 2W4KA 1WBSA 2OJIA 2V5QA 3FDNA 2WTKB 1O6YA 2ZB1A 2OIBA 2WXVA 3C0IA 4HYHA 3RM7A 4BBFA 5BVNA 3WYXA 5CF5A 2X8IA 5K3YA 2IVUA 4YHTA 3A7FA 4R3RA 4TNDA 4B0GA 3NNUA 3NZ0A 3FY0A 5DMZA 3UGCA 2PVJA 4FZDB 3C9WA 1E9HA 4LYNA 4QD6A 2Z7RA 2C6MA 3SXRA 3IS5A 2BZJA 4WUAA 1KE6A 5EW3A 5H2UA 3TTJA 3O7LD 3ZH8A 3EQFA 2DS1A 4ALWA 2OJGA 4EONA 2VGPA 5AA8A 4OTHA 4TYJA 4QYYA 2WMXA 5AR2A 5M4UA 5ANIA 2CKEA 3NNWA 3HNGA 3U4WA 5JFVA 1OBDA 4UY9A 3VN9A 4DN5A 4PL4A 3GUBA 5E92A 4O91A 4QTDA 4J97A 2C3LA 2R3JA 3GC7A 2YITA 4KSPA 5ICPA 5K4IA 4AWIA 3FC1X 4Z16A 5EHLA 5A4TA 3O0GA 4D28A 3ACJA 3QYZA 3EN9A 5J1VA 3C7QA 3KXGA 2VX1A 5HQ0A 3PP0A 3RPYA 3F5PA 3TNWA 3HDMA 1PXMA 4D1XA 4AA0A 3FXXA 5CI7A 2NPQA 1H01A 3SGCA 5D11A 5M44A 4EZ5A 3EZRA 1OUYA 2W4OA 3CGFA 4C4HA 4LUEA 2J50A 3MPAA 5I9VA 3HMPA 4YTCA 2WTJA 3FMKA 3HUCA 3UVQA 1WAKA 3H10A 1ZOHA 4TYIA 1DI9A 3QQFA 5KNJA 3ORLA 1YHVA 1JLUE 4R78A 2PVMA 3RM6A 1PYEA 1SVHA 3IGGA 3RTPA 4JQEA 4C0TA 5A4EA 2XK3A 4K1BA 1J7IA 1MP8A 4WG4A 2YCFA 2AC5A 1Y6AA 1H24A 3LFQA 2PZRA 4EOSA 3RMFA 2VTNA 3DBDA 3SRVA 3NW6A 5HZNA 4RJ8A 3UOHA 4FR4A 4ZSJA 4K77A 2RFSA 2ZM3A 3GC0A 2JDRA 3VNTA 4HPTE 1FGKA 1W98A 2XK4A 3C4CA 3ANRA 3EN4A 3UOLA 5IUHA 1YQJA 4MXAA 2PZ5A 3EN6A 5CAVA 5E8VA 1DAWA 1OIQA 2PMLX 5TKDA 3VUGA 5HTBA 1WVXA 3C51A 4R1VA 4IFCA 5CT7A 4C4FA 4RC3A 5D10A 4RA5A 3H4JA 2JDVA 5J7BA 3EHAA 3A2CA 1H27A 4YC8A 3ZO3A 4LOQA 1PMUA 3FMLA 5M09A 5GZAA 3SKCA 3VS7A 3QQUA 5D7VA 2NRYA 3TIYA 4DG0E 4E8AA 4MBIA 4RIXA 2W9ZB 4BVUA 4EQUA 3D2IA 5JZNA 3BRBA 3ZO2A 1FVRA 2V7OA 3C4WA 5EYCA 1TQIA 4YZNA 2QHNA 2VTMA 3D15A 3JXWA 3L8SA 1H1QA 3GCVA 4FTIA 4X21A 2OO8X 4U81A 2X4ZA 1L8TA 4XMOA 5I3OA 3FUPA 4BDGA 1FOTA 3A62A 3JUHA 2UZEA 2QOCA 4W4VA 2OF2A 2BFYA 3A7JA 3Q9WA 5B2LA 2YZLA 3GENA 3G9LX 5BYLA 4NSTA 3R83A 2UV2A 3RGFA 4R7HA 4AT5A 3DXNA 3D5WA 3F3WA 4M14A 5DWRA 4I5CA 4AW2A 3AC2A 3BKBA 4JS8A 4B7TA 2Z7QA 3O2MA 1DI8A 3GT8A 2PMIA 5GJGA 2VO0A 3CQEA 2DQ7X 2OFVA 3GC9A 4OR5A 4BIEA 4ZZOA 1ZXEA 1ND4A 2R7IA 3QHWA 4J71A 4LMNA 3PJ1A 5I0BA 3HKOA 1BMKA 3GCPA 4F7JA 2YIRA 3GCQA 5HG9A 2A19B 4IB0A 3D7TA 3R01A 4KS8A 3U4UA 4O83A 3NSZA 1YOJA 3AG9A 4GG7A 4AFJA 3MN3A 4A06A 4NFMA 4D4VA 2VWIA 3MY5A 1REJA 2PU8A 3L9NA 4IBMA 4RWIA 1KE8A 1Q24A 4ASXA 2WMAA 5HI2A 4GEOA 1FMKA 2R3MA 2RGPA 2F7XE 4NIFA 4GK3A 3UVPA 3I1AA 1Q99A 3K2LA 4OTFA 4WNOA 5CSHA 4KA3A 3VS6A 3WF8A 3QZFA 5CALA 3PRIA 2B9IA 1TQPA 3QWKA 4MXOA 3UC4A 3RJCA 1OBGA 4TYHB 5F1ZA 4FF8A 3NUNA 4Y8DA 1VEBA 2HW6A 4BICA 4E73A 1MUOA 4FTJA 3MPMA 2Z8CA 2HWOA 3HMNA 4HYSA 2CGVA 4HW7A 2JAMA 3MH0A 4JRNA 3V01A 3TM0A 2OXDA 3F2AA 4FKVA 5CSXA 4YTHA 2XNEA 4FV6A 3R0TA 3DFCB 4UBAA 5AR4A 2XM9A 3GCSA 4R5YA 2XJ0A 4IEBA 4BFMA 3DAJA 4PMPA 2PVYA 5GIOE 4HYUA 4IM2A 4N4SA 4EHGA 5KBRA 3NYVA 4G1WA 5EOLA 4LGGA 4NTTA 4Y95A 3RPVA 4FV2A 1FPUA 3ULIA 3UO5A 3QQLA 2W1ZA 3E3BX 1M17A 2ESMA 4LRMA 2BR1A 3QYWA 4U43A 4XG7A 3BE2A 5BVEA 4B8LA 5HGIA 4XX9A 4WKQA 2CKOA 3NIEA 3PSCA 2OJJA 4FTUA 2WMVA 4M15A 2C5YA 2PUUA 3MWUA 3QUPA 3TJDA 3TZ9A 3V8SA 3QAME 4PL5A 1WBNA 3T3VA 3UOKA 2PWLA 4YBJA 4G3DA 2C5XA 5FEEA 4EORA 5JRSA 5AUWA 2RL5A 2W4JA 4FUXA 3V6SA 4O0RA 4M0YA 3QKLA 1QL6A 2C47A 4GJ2A 5EI6A 5DBXA 3RNIA 4YR8A 1Q61A 4ZTRA 3DZQA 4DGMA 5BUJA 5ANOA 3W8LA 3KK8A 4QQCA 2BKZA 3LFFA 2UZUE 4AZWA 5B7VA 2W96B 3S4QA 3WZUA 3FPQA 4A4OA 4YJSA 5AUYA 3V5PA 4CRLA 5TR6A 2WMSA 5DHJA 4PF4A 4FI1A 5HIEA 4FEWA 4CQGA 1XKKA 2YM6A 3O71A 4FK6A 1NA7A 4YJRA 2WAJA 4U3YA 2GNFA 3ULZA 3WE8A 4D2TA 1NT2A 4JAIA 2VO6A 2VTIA 3Q5ZA 3M1SA 3MTLA 3FEGA 1WVWA 5AX9A 5A14A 4ZLZA 2X7OA 1XH6A 4NT4A 2VGOA 4HNFA 1IASA 2VTPA 3BYSA 3S00A 1AQ1A 1PXNA 3CC6A 4RLLA 3RINA 3DK6A 3GB2A 2C6IA 5JFXA 3BGPA 3DS6A 3P7CA 5KHWA 4EK5A 3C0HA 5FTQA 3JYAA 3PY0A 1VYWA 3ANQA 3R00A 4QMWA 4EYMA 3BHTA 4G2FA 2I0HA 4YJQA 5FWKK 3D83A 5CXHA 5IQEA 3OEZA 3FYKX 3DKOA 3FMJA 3S95A 3DOGA 4R7BA 5J7HA 5LQFA 1Q8YA 3VW8A 4CYIA 4CG8A 1F3MC 2J5FA 3HEGA 4MXYA 5E1EA 3WF9A 2QLUA 1YOMA 2BDJA 2NP8A 4HVSA 2BFXA 2WTIA 3DJ6A 4BWKA 3KC3A 4YZMA 3TDVA 4E6CA 3F5UA 3PXYA 1UNHA 4YP8A 4QP8A 4Q5EA 4QMNA 1H1PA 2WMUA 4MQ2A 2BZKB 4L45A 4NW6A 4WHZA 4BDKA 4F6UA 3HAVA 3QFVA 3RKBA 2BZHB 4O84A 2QVSE 1GIJA 3FPMA 3VBYA 4EH9A 4F9BA 3BQRA 4HNIA 4E6QA 3PP1A 3R9OA 5JN2A 4PDPA 4G9RA 4FEXA 5ANKA 4CZYB 4IW0A 1IA8A 5IA1A 1LP4A 2F57A 5CYIA 3FI8A 4U7ZA 5M56A 5IH5A 1ZZ2A 3TN8A 4D4YA 3ORTA 3BPRA 4ZJVA 3GGFA 3SXSA 5AV4A 4ANNA 1NVQA 4LFIA 4QMQA 3COHA 3RAIA 5E90A 3DJ7A 2J0IA 3R22A 3KXXA 3QUEA 3ZLXA 4EC8A 3UVRA 3MJ1A 4AGUA 4O7RA 3JY9A 4RRVA 4TYEA 3T3UA 3VBQA 1OPKA 4L7SA 3CY2A 3ZEPA 1ZMWA 4D2SA 1U46A 3GXLA 5AP7A 4EI4A 5GZ8A 5DE2A 4DT8A 4O86A 2P2IA 2OLCA 1PKGA 5L8KA 3QTSA 4HGEA 3KXZA 4R6VA 1MRYA 4J52A 4LV5A 4I22A 2X4FA 4R1YA 4X3FC 3UG1A 4RMZA 1Z5MA 1ZOEA 4FKGA 3JS2A 3PSBA 4FE2A 3QD4A 2WFYA 3D5XA 3R02A 5C9CA 3OWJA 5IZFA 2GNHA 3JVRA 4OTRA 2JKQA 3EWHA 2XNNA 3AQVA 4YHFA 5C27A 4DLJA 5HG8A 4QP3A 4O2ZA 3MB7A 2R3KA 3TNQB 4I0RA 2JBPA 3G33A 1OKZA 4EH3A 2ITXA 3O8PA 5DA3A 2WMBA 4GU6A 4O0TA 4QQ5A 2DYLA 3LLAA 3DQXA 3W10A 4W8EA 4O38A 4QYGA 4LG4A 4BF2A 2C69A 3MJ2A 3CGOA 2HAKA 4W9WA 4H3PA 4IAZA 4CZTA 3D9VA 3R9NA 3QUDA 4C57A 4J96A 2QURA 2C5OA 2F4JA 5H3QA 5E8TA 4XV9A 3NUPA 4DTBA 1MRUA 2XZSA 3VS5A 4HZRA 2PMNX 1A48A 2O65A 5EM5A 1KE7A 2HZ0A 4TT7A 2GHMA 5HHWA 5ETFA 4EUTA 1WBPA 3R8MA 4AT4A 1M2PA 2OSCA 4MD7E 2OU7A 3Q52A 3VF8A 1UNLA 4MD9E 4XG3A 3MDYA 3BU6A 5JQ8A 3ROCA 3S1HA 2XH5A 4KKEA 2XKEA 4FSRA 2PVKA 3UZTA 2Q0BA 1PXLA 4RJ4A 2WHBA 1G5SA 3FMNA 1BI7A 4A9TA 4BYIA 4EH5A 1H0VA 2CLXA 2WEIA 4NCTC 3H9RA 4GYIA 2ITNA 1W0XC 4QOXA 2C6OA 1YXTA 4G3FA 3I7BA 5TT7A 4BCGA 4CNHA 5EDRA 2BZIB 3QA0A 4IX4A 1Q41A 4O6LA 3IOKA 5CI6A 5AP0A 4F0FA 3K3JA 4H3QA 4EZ7A 2KULA 5CVFA 2VTQA 2OJFE 1XHAA 1YWVA 2JEDA 3DFAA 3LJ1A 4FYNA 5CVHA 4MEDA 4A4XA 4F64A 2GQRA 1S9IA 2EB2A 3QZIA 4AOIA 2VUWA 2WEVA 3ZHPC 5L2IA 4TTHB 2HELA 2B7AA 4BCPA 2PULA 2XRWA 2Q83A 4FT3A 4FEVA 3POZA 4HOKA 5HNGA 4UN0C 4YPDA 5AV2A 1K9AA 2IW6A 3R7GA 4TWCA 5J8IA 3EN5A 4E3CA 2C1AA 3BCEA 5CAUA 2UZLA 2WKMA 3CJGA 5A3XA 2PUPA 2R4BA 4IWDA 3HA8A 4CCUA 3NCGA 4IAIA 4FOBA 2A0CX 3KMUA 5BX0A 4RVTA 2PUNA 1Q8WA 3II5A 3QTRA 4C36A 4RIWA 4TWPA 4QYFA 4H36A 3KQ7A 4HVDA 2W7XA 5AUUA 3AGLA 3UYTA 3VUDA 5ACBC 2C0OA 4WRSA 4M67A 3LMIA 5TE0A 5AUVA 4BHNA 3FC2A 3FMDA 5K4JA 4QMZA 4AX8A 2WOUA 4WRGA 5CNOA 4L3JA 3WE4A 4MTAA 2ITUA 3VRZA 2VV9A 4ZTSA 1JSVA 1NW1A 4QMTA 4FT0A 3V5WA 3P0MA 4Y46A 1BKXA 5L6WL 3OHTA 3CTQA 3FZ1A 4QP6A 3KREA 5HX6A 3OOMA 5HLPA 5FTGA 4MYGA 4YZBA 3SD0A 4I23A 3HMMA 5DVRA 1OPLA 2BILB 4WNPA 4C4EA 4V04A 2GDOA 2Y4IC 4HGSA 5AR3A 5BVOA 5KKRC 4DBXA 3SW4A 1FVVA 2O8YA 4A9RA 3FZSA 3QRTA 2PHKA 4I4EA 1ZRZA 4NW5A 4YJVA 5HU3A 3E8DA 4UYNA 4TW9A 4MNFA 5HVKA 3S3IA 3UZRA 4G5JA 3Q04A 3MGYA 2X2KA 4JR7A 3QL8A 2YDIA 3TKIA 4YTFA 2FSTX 2XIKA 3R73A 4FSMA 2OH4A 2HWPA 2YIXA 5C4LA 4F0IA 5HCZA 4OTQA 2R64A 4QMUA 4L6QA 1FINA 4I4FA 2CNQA 5M4IA 1O6KA 2VTAA 1P4OA 3KU2A 3QBNA 4XG6A 4FTNA 2JITA 1GZOA 3CIKA 4QYHA 3PJ3A 4IACA 4MF0A 3BWJA 3UOJA 2BCJA 5EQPA 4BBMA 3O17A 3NEWA 3DB6A 4JLCA 5AWMA 3VBVA 1H08A 2XNGA 3IGOA 4IM0A 4RIWB 2A27A 4X7QA 5C03A 5L2WA 4D5HA 1PYXA 5L6OA 3A8XA 4O0YA 5F94A 5FG8A 4H39A 4RVLA 2IW9A 4S2ZA 4JXFA 5H8EA 4DEIA 4FEUA 4ZS4A 2QG5A 3HMOA 4FIFA 4PQNA 2O63A 5F95A 4NL0A 3PG3A 4ZSLA 3T9TA 3AXWA 3E64A 3SHEA 4U0IA 5H8BA 4FTMA 3DT1A 3F2NA 3Q9XA 2CSNA 3HL7A 3QLFA 4DEGA 2FO0A 1ZLTA 2WZJA 2BTRA 4UXQA 2PY3A 5JQ5A 4KD1A 2CGXA 2YLEA 3HRCA 1PXJA 4CFVA 4O0VA 3TDWA 3R1SA 3FL4A 4M8TA 3OW3A 3TJCA 4Y5QA 4KBCA 1SNUA 2YM8A 2ITTA 4FL1A 4GL9A 4DH1A 4EKLA 1STCE 5KX8A 2QD9A 3RK7A 3BHVA 3EFLA 3PJCA 3QZGA 1YRPA 3ZC6A 4EYJA 1G8SA 5E91A 4L44A 4BTFA 5B0XA 4I92A 4UMRA 4NTSA 2FA2A 4RJ7A 4KUJA 5HVJA 1Y8GA 5C8KA 3NYOA 2ERZE 4BL1A 2B1PA 4YBKA 4D2VA 5HICA 3OCSA 2YM5A 1JQHA 1CDKA 1S9JA 2ONLA 4JDIA 4MQ1A 3OT3A 5AP5A 5M53A 2IPXA 4EJNA 5I9WA 4FTQA 4I20A 2QU5A 1UWJA 2GS6A 4MNEA 4D9TA 4KRCA 4G16A 4D4SA 4L7FA 2UZOA 4FKQA 4IB5A 4FIHA 3F3UA 4AXAA 2E9OA 2LAVA 4I41A 3ENMA 4W4WA 3EYHA 2XUUA 5FBNC 4AP7A 3ORMA 4R5SA 5E8XA 4CCBA 3BEGA 2GSFA 1AD5A 3O7LB 4I0SA 4IAYA 3VS0A 3MVHA 4IE9A 4AG8A 2OF4A 3LXPA 4TKSA 4WG3A 4K33A 4LI5A 2W1EA 4IH8A 3DLZA 5HE1A 4AW1A 2GHLA 1H28A 3FV8A 1Q62A 5CQUA 2I6LA 5G1XA 4C8BA 4IDVA 2R7BA 4QMYA 4GKHA 5IISA 5DI1A 3KCKA 4GIHA 3QCSA 1UU8A 3PXFA 1GOLA 4IVBA 4XYFA 3LFDA 5HVYA 4GYGA 5J87A 4ZXTA 4K18A 2FYSA 4XJ0A 4O21A 4XBUA 5CU3A 2YCSA 1IRKA 2YM3A 4RX8A 2VU3A 4F9YA 5IDPA 4RGJA 2UZDA 2EWAA 5HIBA 4DGNA 4RVKA 5CT0A 5AIKA 5IA0A 2C3JA 5CEPA 4GUBA 4ALVA 2BKKA 4U42A 1CTPE 1U5QA 1WBVA 3FXZA 2P4IA 4FT9A 4W9XA 3ZDUA 5L2SA 4PX6A 2JIVA 3E7VA 2VTSA 3HVCA 3R8PA 5AAGA 4GVAA 3Q4ZA 3KVWA 4K0YA 3KRXA 4FV1A 2UW3A 1JKLA 1GIIA 2FH9A 2ZM1A 3QD2B 4GH2A 4YZDA 4CMOA 5J9YA 3PG1A 5KZ0A 3OFMA 2IZRA 3ZEWA 4B99A 4FTOA 1J7UA 3ZFXA 3R04A 1LEZA 3SOCA 4F09A 5FQDC 5HBJA 3RALA 3MFRA 4AZTA 3QTUA 4Q5HA 3LFBA 4DG3E 4F4PA 3TUBA 3Q9YA 2F7ZE 4F6WA 4F1OA 3OUKA 4JDHA 2B0QA 2BAJA 2NO3A 1I44A 4O7NA 3HP5A 4FTLA 4O7TA 4ACGA 1SNXA 1PW2A 1JOWB 4YURA 4CVAA 4X6QC 5DR6A 1XWSA 3H0YA 3U55A 2P0CA 3W33A 3R7OA 3UODA 4FOCA 1G8AA 3R8ZA 3NVMB 4ITIA 5KUPA 3ZXTA 3C5UA 1MRVA 2FB8A 3R7VA 4YJUA 4CV9A 2R0IA 4IMYA 5AA9A 1OIYA 2X2LA 5LVLA 3E62A 4NH1A 4UWCA 5BMSA 1OM1A 4IWQA 5LWMA 3W2SA 5M07A 3ZFMA 1REKA 2GTMA 2VWWA 4KSQA 4B9DA 4OGRA 4BTKA 2REIA 4KWPA 2QONA 5FP6A 3UIMA 4DGGA 4GKIA 5HTIA 1UWHA 2RF9A 3VUIA 1EH4A 2W0JA 5HKMA 3ORXA 3I6UA 4QQTA 3RCDA 3HLLA 3G9NA 4XRJA 2JBOA 3U9CA 1OB3A 2UW5A 4K8AA 1PMVA 3VJOA 4BBEA 4NWMA 3O50A 1KV1A 4QP4A 2PZYA 3FLZA 4U44A 4YZ9A 3DNEA 4FIEA 1GY3A 4G6LA 4GT5A 3T8OA 5IG1A 3H9OA 3RWPA 4NM3A 1GZ8A 3W2CA 3OBGA 4B4LA 1JBPE 2QOFA 2GHGA 2XNBA 4CFUA 2EXEA 4AZFA 2QHMA 3QGWA 1FMOE 2G2HA 2PZPA 3PE2A 4FX3A 4GG5A 1V0OA 4A9SA 4DE4A 3EQPA 1KOAA 3ZBFA 2JDOA 5DRDA 2BDFA 3VBXA 4CFFA 3TNPC 3DGKA 2WMWA 2XYUA 4IFGA 3TNHA 1UU9A 4WUNA 5K9IA 3G51A 3UO6A 4J99A 3P4KA 4EHZA 5A4LA 5KMMA 2VTJA 3BU3A 3UPXA 2R3LA 4UEUA 3SLSA 3HECA 2WOTA 2B53A 5KO1A 4HVGA 1XH4A 5EH0A 4FNXA 2QG7A 2BHHA 4NEUA 4PTEA 4RFYA 4JRVA 5CTPA 3EFKA 4X2GA 1ZYCA 2QOOA 5IH6A 4XH6A 5EM6A 5CEOA 4UXLA 4USDA 4HGLA 2W5BA 3PRFA 2YACA 2OBJA 4LQMA 1A9UA 5M55A 3OROA 4XNEA 1YXXA 3OEFX 1ZAOA 2BRHA 1P2AA 2Z7LA 4D1SA 2YIQA 1O9UA 2VTOA 1WBTA 4MBLA 1YXVA 2P3GX 5CU6A 3VC4A 1VJYA 4TYHA 5C1QB 4D1ZA 2VWBA 4C4IA 4F1MA 3DTCA 3BBTB 3WARA 3V3VA 2PPQA 3AT4A 3ODYX 3V5LA 3V8WA 4FG7A 4FL2A 5LMAA 3Q2JA 1BL7A 3QA8A 1U54B 4TWNA 3OTVA 3KEXA 3R7IA 4Y72A 2XF0A 1IG1A 4ASZA 4C7TA 2JC6A 4BCMA 4Z7HA 3TCPA 4I21A 4ACHA 3ZXZA 3G0EA 4XG8A 4TL0A 1YI4A 4OTDA 2QOKA 1YOLA 3D5VA 3OWKA 4ZJJA 4BCNA 4EOKA 1M2RA 2GNJA 5BVFA 3S0OA 4O7WA 2IVVA 3BYMA 4LV8A 5HD4A 4ASDA 4AZVA 2C5NA 4NYEA 2YWPA 5LVMA 2Y9QA 1KSWA 1Q5KA 2XNPA 4USFA 4A9YA 3IDBA 5FUTA 4M97A 4NU1A 4IX3A 4Z3VA 4EOMA 4Y5HA 2PE0A 4CKRA 4CT1A 2YCQA 4XBRA 3PUPA 5AIRA 2PYWA 2VWZA 3EL7A 5CX9A 2QCSA 3DZOA 1GNGA 2I0VA 2C0IA 2YAKA 4LOOA 5AM7A 4LUDA 2G2IA 3ORNA 3MS9A 3ZFYA 2W1GA 2FGIA 2QOQA 4XOYA 5AR7A 3SG8A 3JPVA 5BYYA 4I94A 4B6LA 5HCXA 3RAWA 4O22A 1R0EA 2YEXA 2OKRA 4K2RA 3GOPA 5E7RA 3VW6A 2F9GA 3NGAA 3R8LA 5IQAA 1A06A 2WMTA 2VWXA 3IW8A 2HXQA 5L4QA 4CMTA 4O0WA 4DH5A 4PNKA 5AP2A 5BVDA 2C68A 1YDSE 2J0KA 4IC7A 2IW8A 1SM2A 3ZCLA 4KABA 3KXNA 2ITYA 4NKSA 3OY3A 4ZTMA 4AOJA 4ANSA 3PJ8A 4I5MA 5B2MA 4PP9A 5AP6A 5IA4A 3ZS5A 5IA3A 3F6XA 2VX0A 5EM7A 3TKHA 2HCKA 5HNIX 2CDZA 4RZWA 2ZV2A 3QHRA 2C3IB 4ANBA 4C2WA 2XIYA 4ZZNA 3HV4A 2F7EE 3R71A 3RCJA 3SQQA 4D4RA 2VAGA 1T46A 4YSJA 3QTQA 2QR7A 5E8WA 4C4JA 3MH1A 2YAAA 5HO8A 3NR9A 5K0XA 3V5JA 4DTKA 4X3FB 1BLXA 3ZSHA 4KIQA 1UU3A 2OZOA 2CJMA 5FEQA 3UIUA 3CP9A 3BGZA 5KMOA 3DTWA 3VRYA 4E93A 4UB7A 1ZWSA 3EQBA 3MB6A 3W16A 4BTJA 3HX4A 2V7AA 4QTEA 4G6NA 3EYGA 2QQ7A 1JSTA 4WD5A 5F9EA 3ZO4A 5EI8A 3DBCA 3PZHA 4ZJIA 2ZOQA 4MKCA 5IEYA 4RIYB 2QOIA 4O1PA 3EIDA 2OFUA 3BHHA 3NW5A 3ZZWA 3HGKA 2X81A 5HO6A 2RKUA 3VS4A 4EWQA 3UIXA 4DFUA 3D7ZA 3OMVA 3KF7A 4EH2A 5J95A 2OZAB 1F5QA 3NAXA 3ZO1A 2WMRA 3ITZA 4JIAA 4L42A 3DXQA 3R63A 4EH4A 3CJFA 3QU0A 4BDCA 4CKJA 1LPUA 3KGAA 4OW8A 3CCNA 3F7ZA 3CPCA 3QX4A 4OT6A 3M2WA 4QYEA 5GJDA 4AA4A 5DNRA 4IVCA 4TZRA 4DHFA 5D41A 5DFPA 4BZOA 4FKSA 4KINA 4D2WA 4ZSEA 4BR3A 2ZV8A 3HV3A 1UVRA 2CPKE 3LXLA 4B8MA 4RC2A 4BDEA 4AGDA 2XK8A 5CAQA 2PTKA 3KFAA 4O2PA 2BMCA 4DYMA 2Y4PA 3Q5IA 3I7CA 4PV0A 4UMUA 4IDTA 4MXZA 3DK3A 5HOAA 3OOGA 4GU9A 3TZ7A 4I5PA 4YNOA 2R3QA 4JBOA 4ACMA 1ZMVA 2B54A 3OC1A 4YLKA 2HZNA 5CXZA 4YUQA 4E6DA 4RFMA 4XG2A 2YM7A 3OCTA 4BCIA 3GQIA 2JLDA 3F2RA 4HZSA 5IQIA 2R0UA 4A07A 4DINA 3ZU7A 1WBOA 1QPJA 3DU8A 4BRXA 3UTOA 3NWWA 2I7QA 5BVKA 2HZ4A 1Y8YA 4Y85A 4TRLA 3K54A 4G6OA 4DFZE 5IQFA 4MHAA 3V5TA 4APPA 5LOHA 2X6EA 3FQSA 5IMEA 3ZLSA 1LEWA 5HD7A 4YPSA 2AYPA 4WBOA 2R3OA 4JDJA 5BPYA 3PPJA 2BDWA 5AP3A 3R7YA 3MH3A 3CQWA 1IR3A 2WMQA 3Q96A 4OTIA 3TNIA 1E1VA 2E2BA 5AR5A 3DPKA 1Q8TA 3GBZA 3W32A 4R7IA 4KIKB 4EH6A 4YJPA 4BHZA 2PE1A 4E5AX 4ZOGA 5I3RA 3LAUA 5J1WA 3WF5A 2WU6A 2GNGA 1IEPA 4DEAA 5KCVA 3FKOA 3NNXA 4DEEA 4ASEA 3LW0A 4XP3A 4GFGA 4CLIA 4C3FA 3I6WA 3M11A 3HV6A 2PL0A 3BQCA 4QTCA 5E8YA 3V5QA 3TKUA 4LMUA 2YWVA 3RNYA 4I24A 3NIZA 4E4MA 1JAMA 2XKFA 1ZY5A 3F82A 3BLQA 2PK9A 1OIUA 4EK4A 1Q3DA 1H1WA 2OXXA 1L3RE 2ETKA 4U8ZA 2IG7A 5EYDA 1BX6A 3KK9A 3TIZA 2UZNA 4IAKA 2FSLX 3NX8A 4P5QA 4PUZA 3QRJA 3QGYA 4FTCA 2YIYA 4L3PA 5AUZA 2Z2WA 3Q4CA 4M13A 4TY1A 3N4TA 4OBPA 2R3FA 3NUXA 4FKPA 4KNBA 4OLIA 1SYKA 1H1SA 1OL6A 3FI4A 4KB8A 4UYAA 2BRNA 4FSZA 4LRKA 3KXHA 2G2FA 4AU8A 3Q6WA 3PJ2A 3CQUA 4GVJA 4APCA 2Y4IB 2XIRA 3R1NA 4BDJA 3UIBA 3ZLWA 5IMXA 1R0PA 3P7AA 4FGBA 4GSBA 5CZHA 3OWPA 5IA5A 5DG5A 5CSWA 3DDQA 3P78A 4BZDA 4EL9A 1YKRA 5CEKA 4AQCA 1J1CA 4RC4A 4QO9A 5EK7A 2CN8A 5F4NA 2E9PA 4RX7A 5FDPA 4OTWA 3TEIA 2BROA 1U5RA 1OMWA 3DA6A 4M69B 3Q32A 4J95A 3QRIA 3BBWA 4ZLYA 4U97A 1XBCA 3DAEA 5EW9A 4KKHA 3PVWA 3LKMA 2B4SB 5G6VA 3SXFA 5JGDA 1Z57A 3FMHA 3L8PA 4MVFA 4YO6A 5HO7A 1M7QA 2G01A 3KN5A 3QC9A 4LM5A 2JIUA 4FTKA 3PVBA 5CU0A 4FNWA 5AUTA 2J0MB 3AD6A 3L8VA 3LOKA 5HCYA 3FY2A 5A6NA 5LMKA 3IONA 2IZTA 4H1MA 3HUBA 5FRIA 4BKZA 3WZKA 1LR4A 4E4XA 3KVXA 3KRJA 1BL6A 4IWOA 4MXXA 3A7GA 2BPMA 4UZDA 3EOCA 4ZTHA 3KL8A 2GTNA 2W5HA 3LHJA 5DOSA 3ZM9A 4FV4A 3THBA 1WZYA 3C13A 4O96A 3EKNA 4J98A 3ZTXA 4AZEA 1CKIA 5K5NA 1GZKA 2YDJA 5DYJA 3OVVA 1Q8ZA 4FT7A 3QRKA 2XYNA 1YXSA 2WELA 2VX3A 4FC0A 4IADA 4DITA 2XCKA 4LRJA 4TXCA 5M51A 3WOWA 3V04A 2XNOA 5JH6A 5IF1A 2CGWA 3VS2A 3GOKA 2I0EA 2SRCA 3KULB 3SG9A 2VTHA 5DH3A 3C4FA 2W99B 3D14A 4XCUA 2I40A 5TF9A 2W06A 2AUHA 3QQGA 4M0ZA 3RK5A 3R21A 4F1TA 5DR2A 4RWLA 3PSDA 2ZMDA 1O6LA 2B9JA 4G3CA 2EXCX 3JY0A 5EI2A 5C8MA 3R2YA 4PY1A 3IDPA 4MD8E 3AOXA 5JGBA 3IW4A 3KMMA 2UUEA 3G0FA 5C01A 3WIKA 1RW8A 4EH7A 3H3CA 3IG7A 3NRMA 3MYGA 4NM5A 3UQFA 3UDBA 2V62A 5AV0A 4WSQA 3U51A 3Q4UA 4MWIA 3FAAA 5T68A 1CM8A 2C1BA 2UW9A 4FKWA 3N9XA 2G1TA 2W1FA 1HCKA 4L8MA 4ZTNA 5JK3A 5C4KA 2YERA 3ENHA 3GCUA 4PTCA 4EBWA 2J4ZA 2HW7A 3VVHA 4X2KA 2BRGA 4C3RA 3DCVA 3FLNC 3GU4A 4RT7A 4C59A 3CY3A 5CQWA 3TZMA 4XV1A 4O7LA 2ERKA 2XK6A 4FODA 2AC3A 4K6ZA 4YZCA 3IW5A 3Q2MA 1ZYJA 4H1JA 5M08A 2XB7A 2QNJA 4CD0A 3OCBA 1QMZA 4ANOA 2ACXA 2XK7A 4JOAA 2Y7JA 3SW7A 4C37A 3HV7A 3FHRA 4FIGA 2Y0AA 3AMBA 4FNYA 4WIHA 4D58A 4PNIA 3VHKA 4G31A 4FVPA 4M7IA 4BTMA 5IU2A 1DAYA 3FI3A 1XH5A 2DWBA 5BUEA 3JR1A 5JSMA 3LMHA 4HVIA 3VULA 2BRBA 3EQDA 4IZYA 3MY0A 2XJ2A 1SVEA 2RIOA 2EXMA 3OW4A 1W83A 3UO4A 2OJ9A 3FLWA 4ALUA 3U54A 1B6CB 4PMTA 4YTIA 4AE6A 3BE9A 3LCDA 4O7SA 3REPA 4BCOA 4IIRA 5HIDA 5J5TA 4YC6A 5EW8A 3ALNA 3ZUVA 5I9ZA 2YISA 4C38A 3N51A 4PPAA 4DBNA 4MX9A 2BTSA 3U9NA 4AOTA 4E7WA 5ANDA 3KN6A 3R6XA 4PDSA 4QMXA 5DN3A 4CG9A 3PTGA 3V51A 2QOBA 4UZHA 1OZ1A 1F0QA 1K3AA 3AT2A 4ZLOA 3C4EA 4KRDA 5J5SA 5JKGA 3ETAA 3NLBA 2JFLA 4BYJA 5FXSA 4HGTA 2W1DA 4DGLC 4EK8A 5GINE 1H4LA 4RWKA 2J0JA 4X6RA 5GNKA 2BHEA 3FLYA 3EJ1A 4BI2A 2WQEA 3BLHA 4WG5A 1P5EA 3EFJA 5EYMA 2W1HA 3EL8A 5IKWA 1XBAA 4YU2A 4QT1A 2A4LA 2CMWA 2V22A 4L00A 1UU7A 4I6BA 2UW4A 2WO6A 1Q4LA 2R2PA 5CSVA 4EK3A 1QPDA 2XS0A 3QQJA 4IVDA 2J5EA 4QMOA 1PY5A 2A2AA 2WTVA 5IPJA 5A46A 5KMLA 2PMOX 5DT0A 1FVTA 3ORKA 1UKIA 2C4GA 2E9VA 3BWFA 5FM2A 4H3BA 3UC3A 3LXKA 4E5WA 4M84A 5IUIA 4IZ7A 5IQGA 3UP7A 3A61A 4FSTA 3WF6A 4FVRA 3FBVA 3VWAA 5HLNA 5J79A 2UW7A 2BIYA 3TTIA 3WF7A 2FSMX 4J53A 2CLQA 2UZTA 1PMNA 5C26A 2WQBA 4G5PA 2VRXA 4GJ3A 1R1WA 4XUFA 3PVGA 2B52A 4MXCA 4ACCA 4FKRA 2BVAA 2QO7A 3W1FA 4DCEA 5KBQA 2WQOA 5CEIA 3OZ6A 4BDAA 4E4NA 3ACKA 3MVMA 3ZC5A 4L46A 2F49A 2J9MA 2QO2A 3BV2A 3MV5A 3R7UA 3OXZA 4YC3A 4RQKA 4E6AA 4PL3A 2ZMCA 2A1AB 2C3KA 1XH9A 3HA6A 5JGAA 5GIPE 3PYYA 4QRCA 3FSKA 3UZPA 4BN1A 4AGCA 3CEKA 4BGHA 4D9UA 1ATPE 2RG5A 5KE0A 4V0GB 3WIGA 3PE1A 5E9EA 3IECA 4CZUA 2RFNA 2G15A 4D2RA 3CTJA 4XV2A 2CKPA 1QPCA 4WA9A 3PXKA 5LCJA 3CKWA 3ORIA 2CCHA 3KKVA 3QCQA 1RE8A 4OBOA 3TV7A 4EEVA 4F7SA 3F3ZA 2VNYA 3PLSA 1XBBA 2P2HA 3P86A 1YXUA 3D2KA 3QC4A 2FVDA 3BIZA 4QP7A 3ZMMA 4ZAUA 5L3AA 1YDRE 3DQWA 5CF8A 2B9FA 3HMIA 2JKMA 2GQSA 3VQUA 4RBLA 3PLAE 4YMJA 5CF4A 4HCUA 4F70A 1XJDA 4XLVA 3IK3A 5HX8A 5E8ZA 5DLSA 2FUMA 5CZIA 2JAVA 4EZ3A 5HESA 5A54A 4G3EA 4RSSA 4EQCA 4AAAA 3V6RA 5LMKC 4IJ9A 4V05A 4GRBA 4C58A 5LARA 3KCFA 2PVLA 5FLFA 1PRYA 2YLFA 2Y6MA 3QWJA 3RVGA 1ZYDA 4KBKA 5HBHA 2PUIA 4OTPA 2R5TA 4UWBA 3G6HA 2HY81 1TQMA 4WO5A 5IEVA 4C4GA 3HP2A 4C35A 3G15A 3UYSA 2ZJWA 1X8BA 3CD3A 4RJ3A 5J9ZA 2W17A 2WTDA 3LM0A 4D2PA 3A99A 3HRBA 1SMHA 3K5UA 4X3JA 4A9UA 3P08A 5T6KA 4I93A 5EDQA 3I5NA 2OH0E 4PPBA 5DT3A 3DLSA 3QZHA 4Y73A 3B2TA 3VO3A 4EHVA 2H34A 4BGGA 3RZBA 3ZSIA 4YO4A 4DH7A 4OAVB 1OITA 3U8WA 4CFNA 4U45A 1M14A 4OT5A 5HE0A 2RFDA 3MY1A 3NPCA 3LFAA 5KMKA 3BGQA 3LFNA 3W2QA 3L9MA 1OECA 3F3TA 3OT8A 2C0TA 1I09A 2WB8A 2XIXA 3R2BA 3DK7A 5IQCA 4CT2A 5L8JA 4DFLA 5AFVA 4PMMA 5CNNA 2C6EA 2UW6A 4WT6A 3QCXA 5HBEA 1JWHA 4AW0A 3OF0A 2ITPA 3VBTA 4ERKA 3GC8A 4JBVA 1GIHA 3UPZA 3ATTA 3DXPA 3UMXA 3VIDA 5M06A 5I9XA 3FL5A 4L01A 4EK6A 3E8NA 2CHLA 3CE3A 4FTRA 4QMSA 3A4OX 2W9FB 1V0BA 1UV5A 3BEAA 3DKFA 4IB3A 4N70A 4TYGA 3F66A 3FLQA 1K2PA 2YJSA 3LZBA 4BI0A 2HIWA 2JD5A 2X1NA 4DFXE 3P5KA 3C50A 4CQEA 4WSYA 3OS3A 3KB7A 4F99A 3DKGA 4FA2A 4O81A 4AGWA 1NVRA 3CSVA 1FGIA 4QPSA 1PKDA 3ZYAA 1U54A 2IVSA 4O0SA 3TV6A 3LVPA 2ZAZA 3MIAA 5JMSA 3K5VA 3MH2A 4ITHA 4XRLA 3S2PA 3TWJA 1IA9A 3ID6C 4YLLA 1J1BA 4LL5A 3POOA 4G34A 5EFQA 4R3CA 4FIIA 2YABA 2VO7A 2WQNA 4M66A 4XP2A 2R3NA 2VZ6A 5LJJA 3F9NA 3GEQA 5TO8A 1W82A 4GUEA 5DEWA 4IVAA 5CASA 1PF8A 2HOGA 5D12A 4CFWA 4NK9A 3FJQE 5A4CA 4QMMA 5A6OA 2UZBA 5I4NA 2VD5A 4YSMA 3W18A 3QCYA 4AT3A 3LJ2A 3E93A 2GS7A 2BRMA 5IQDA 5HTCA 4E1ZA 3LCKA 5CVGA 3MVLA 2CN5A 2X0GA 1XH7A 3ZBXA 4C2VA 3CTHA 3MFSA 4RFZA 3FLSA 4BDFA 3FHIA 4EOPA 3H0ZA 5HG7A 3BHYA 2PSQA 3GFEA 3R1YA 4FK3A 4S31A 4XG9A 4BWPA 3LPBA 2ITWA 2IZSA 4ORKA 2ETRA 4MWHA 4BDIA 4O7VA 3ORZA 3CKXA 3AGMA 3DKCA 2XRUA 5C8NA 4Y83A 4I3ZA 4C33A 4IXPA 2XK9A 2HK5A 2XNMA 3DV3A 3RK9A 4BCKA 2J7TA 2GCDA 4HJOA 4GK2A 4TWOA 2R9SA 3RAKA 2IZUA 2I1MA 3NVKI 3AMAA 4QMVA 4CTBA 4JBQA 1PXOA 2J90A 3OP5A 4J1RA 3CS9A 1URCA 3VUHA 1YVJA 4FKUA 5EKOA 1H26A 4O7YA 2WIPA 4FV0A 3GU5A 3HYHA 5IQHA 2XBAA 1CMKE 3PY3A 3IQ7A 4ZSGA 1KWPA 4L53A 1FBNA 5E1SA 4L3LA 4L43A 4RZVA 4IM3A 3SV0A 5L2TA 1VZOA 1R39A 1Y91A 2GNIA 3U6JA 5LXMA 1WFCA 4X3FA 3PY1A 4UMTA 4GIIA 4QMLA 3CLYA 1RQQA 2W05A 4IANA 2RFEA 3Q4TA 4X2JA 3VUTA 4BDHA 2Q0NA 3MSSA 1OL7A 1KUTA 3MTFA 3SVVA 5K0KA 4E4LA 1W7HA 1Q3WA 5LCKA 3BYOA 4EHEA 4QTBA 1LUFA 2JDSA 3FXWA 3LCOA 3FMMA 3NYXA 3ET7A 3LQ5A 3CD8A 3QD3A 4RIYA 4F63A 4O6EA 4FEQA 4YLJA 1QCFA 4FV5A 5I5ZA 2OIDA 2ZV9A 4OTGA 4RIOA 5EQEA 4FTTA 5D7AA 5LVOA 3GVUA 5EOBA 4DF3A 2OZAA 5K5XA 2OW3A 3IOPA 4RG0A 4HYIA 4JX3A 5BNJA 3RWQA 2RG6A 4ARKA 3B2WA 4LGHA 2VO3A 3F5XA 1G3NA 3MVJA 3LJ0A 3P7BA 5M4CA 1YDTE 5GZ9A 2JDTA 3I5ZA 4FKIA 5ACKA 4BCQA 1Y6BA 2X7FA 3A7HA 5GJFA 2EVAA 2GU8A 5BYZA 3RAHA 2ONLC 1SVGA 3FKLA 3MFUA 2X7GA 3AMYA 4RJ5A 4JT3A 5AR8A 4EOIA 1YW2A 1M7NA 2O2UA 3ELJA 5EG3A 4BB4A 4FKOA 1BUHA 4F9CA 2XIZA 5FEDA 3ATSA 5GHVA 4FG8A 4N6YA 4NCTA 4F0GA 3SRVB 2XBJA 5HORA 4DT9A 3BYUA 4PP7A 3SAYA 4UX9A 5AAFA 2WTKC 2XA4A 4U5JA 2XCHA 1V0PA 1DM2A 2GMXA 3BX5A 3COKA 3E87A 4ZSAA 1T45A 4I6QA 4QP1A 5CEMA 4NUSA 4FV3A 4AF3A 3BI6A 3UNJA 4DGOA 1XO2B 3ZRKA 4DLIA 3ZDIA 1H8FA 1Q8UA 3FZOA 5DGZA 4BDBA 2QKRA 4JJRA 1VYZA 3F61A 3PVUA 4JIKA 3VS3A 3E88A 3C4XA 4BCJA 4E26A 3QD0A 2VNWA 2UW8A 3LXNA 3QKKA 4ZIMA 2GFCA 3QLGA 5FTOA 2C6LA 3EN7A 4RIXB 3W55A 4DFYA 2F2CB 3KA0A 1J7LA 3D4QA 3PA4A 3EQCA 4KIKA 4F08A 3OTUA 4U9AA 2ZDUA 5EDPA 5L6PA 1OIRA 3L8XA 3GNIB 4FUYA 4DH3A 4P90A 1AGWA 3TL8A 4FSUA 4K11A 3BLRA 3O8UA 5JRQA 2PVNA 2Z60A 3NUUA 2XKCA 1B39A 4ENYA 4QQJA 1KOBA 3PPKA 5E4HA 1YHSA 1QPEA 3FE3A 2QOHA 2GPHA 3FSFA 4XEYA 4C62A 5CANA 3A7IA 5LMBA 4JQ7A 1APME 3G90X 4PTGA 3UNKA 4ZY4A 1OL2A 5EM8A 4MH7A 2ITZA 2QI8A 3LMGA 4FKJA 4UALA 4IWPA 3VS1A 4BKYA 1PXPA 5DR9A 4FZAB 4JBPA 5IDNA 4Z7GA 3DNDA 3I79A 3SC1A 3ZM4A 4FVQA 1J3HA 5KHXA 1W84A 2XJ1A 4Q2AA 4JR3A 4ONAA 2H9VA 1TVOA 2X9EA 3IW6A 3KMWA 4P5ZA 5ETCA 4F65A 4RX9A 3D7TB 4XOZA 3HRFA 3OXIA 3CPBA 2JKKA 4UV0A 4FIJA 2VN9A 1OUKA 4D0XA 2WPAA 4BCHA 3LFEA 1H07A 4A4LA 2C6DA 4MCVA 3C4ZA 3LQ3A 2KTYA 3P79A 2ZV7A 3D94A 4FSWA 4NIFB 3RPSA 3VAPA 2B9HA 4ID7A 4ENXA 4L67A 3ERKA 3MESA 5CU2A 3DJ5A 3Q3BA 3UQGA 4AS0A 1YHWA 3W2PA 2ZB0A 2JKOA 4M69A 1OGUA 3GQLA 1ZMUA 3EFWA 5KMJA 3D5UA 1MQBA 3B8QA 2NRUA 3IPHA 3KRWA 4NZWB 3QTWA 4JAJA 3QRUA 1XR1A 2DUVA 3IDCA 5AP4A 4O1OA 1ZY4A 1NY3A 2Y6OA 2XM8A 3G2FA 4PRJA 2QKWB 3BYVA 3CXWA 5BMMA 4L52A 1HCLA 3DBFA 4IAFA 2O64A 2WTCA 4DH8A 4S32A 4EC9A 3TXOA 4Z9LA 5EYKA 3ZZEA 4BI1A 2OWBA 3C5IA 3RHKA 1PHKA 5BVWA 2WQMA 5DT4A 5ANGA 3UMWA 2UVYA 4FKTA 3VJNA 4CRSA 2GFSA 3EZVA 2ZM4A 4FICA 5FD2A 4DEHA 1J91A 3EQGA 4KIOA 4YGAA 3ZONA 2R3HA 4JG8A 4M3QA 4CFMA 5CLPA 5FXRA 2OGVA 4DAWA 3UBDA 2QC6A 3VF9A 3MBLA 4Q9SA 4EOLA 3C0GA 1ERKA 3RPOA
chains in the Genus database with same CATH superfamily
3UE4A 5CEQA 1OL1A 2J6MA 3PXZA 5D9HA 3O51A 4RLKA 2PVFA 3JVSA 1HOWA 1UKHA 3I0OA 5JFSA 3VUMA 4D5KA 2X39A 4QP9A 3BELA 1VR2A 4ZY6A 1WCCA 1RJBA 5LWNA 3PWYA 1BYGA 4ZMFA 3PPZA 1OKYA 2V55A 5CS6A 4FSQA 5KKRB 2HYYA 4KS7A 3E7OA 4U80A 3KULA 3COMA 2QU6A 2YM4A 3GU7A 3TV4A 4HPUE 3A60A 4ZK5A 1Q97A 4EOJA 3E8EA 1ST0A 2X9FA 1W8CA 1H1RA 4F7NA 3NUAA 3MPTA 5L8LA 4IC8A 4MAOA 2UVZA 4DHIB 3PZEA 3VBWA 4S33A 2EU9A 3FQHA 4RJ6A 4FTAA 3EQIA 1WVYA 4S34A 4X2NA 2FSOX 3AC4A 4JDKA 3QQHA 5EHYA 4A7CA 4OUCA 2QLQA 4FBXA 2V0DA 3DDPA 4D55A 3LIJA 3TG1A 5A4QA 3WYYA 3KRRA 2XEYA 3LQ8A 4DDIA 5ETIA 1XQZA 3UP2A 4JG6A 1Y57A 1XH8A 4I6HA 4ZTQA 2CNUA 4ZEGA 4FZFB 3WZEA 3FZPA 3U6IA 4NJDA 4FNZA 4QP2A 3R1QA 4J8NA 5JT2A 3W0MA 2I0YA 2X2MA 4YJNA 4KBAA 3UQCA 2BUJA 5AP1A 3W2RA 3H30A 3AD4A 4Q9ZA 4FV9A 5HLWA 4IAAA 2Z02A 3PWDA 1JKTA 3MA3A 5HNBA 2Y8OA 2PE2A 2PVHA 2ITOA 5ANEA 3VHEA 3Q53A 3RPRA 1UA2A 2OICA 3BHUA 4ANLA 1P4FA 1OKVA 2XEZA 3GFWA 3R30A 2E9NA 4J8MA 4XHKB 1M2QA 3MA6A 2J51A 2C30A 2XALA 1JKKA 4NKAA 2ITQA 4O82A 1YWRA 3E3PA 3PIXA 3GI3A 5FDXA 2XAOA 4BWXA 2WGJA 2VTLA 4N6ZA 5HG5A 3DB8A 4XV3A 3N4UA 2O0UA 3FZTA 5IUGA 4P7EA 2LGCA 4FV7A 2WNTA 1Z9XA 5LVNA 3LLTA 4GW8A 3W8QA 3KY2A 3IO7A 5IA2A 4DG2E 1GJOA 2X6DA 4X2FA 5DRBA 2XMYA 4EJ7A 2CKQA 5AJQA 2YZAA 3TT0A 4CTCA 3A4PA 3R8VA 5B2KA 5E8UA 5DPVA 5I9YA 5J9LA 4U40A 2HZIA 4FSNA 3LM5A 4G17A 3RHXA 2R3GA 4PMSA 4ANQA 4TN6A 3V8TA 4RX5A 4BCFA 5KMIA 4DFNA 4GFOA 3HZTA 4PDYA 3DBQA 4NJ3A 1JVPP 1YI3A 3K3IA 2WIHA 3I4BA 3TACA 4M68A 3NUYA 3B8RA 2PVRA 5CSPA 3F5GA 1WMKA 4USEA 4WOVA 4CFXA 2GNLA 3COIA 3EH9A 1URWA 3O8TA 3ODZX 1JSUA 4KAOA 3WILA 1IAHA 3AC8A 3SDJA 3WI6A 3TI1A 3QQKA 1E1XA 4ZTLA 3MI9A 5CAOA 3TUCA 4BDDA 2HY0A 3O23A 3OXTA 4AN9A 4EKKA 4EOOA 2HENA 4FRFA 2CCIA 3QTZA 3RZFA 4CYJA 1ZARA 4EUUA 4AE9A 1YI6A 3AD5A 3E63A 3L1SA 4C02A 3MIYA 3TZ8A 3PA3A 4P2KA 3GP0A 3DBEA 2OXYA 4QMPA 3FZRA 4FKLA 1P14A 2P55A 1R78A 2F2UA 1KE5A 3OBJA 2JGZA 4IX5A 4JX7A 5AX3A 4EOQA 4ACDA 3DAKA 3QXOA 1OL5A 4F7LA 5KMNA 4RA4A 4YNEA 3E8CA 4XLIA 4AXCA 3HDNA 3BV3A 4QNAA 2EB3A 4DC2A 2UZVA 5ANJA 2YIWA 3D0EA 3QXPA 5JZJA 4ZS0A 4XS2A 4F78A 1JKSA 2O3PA 5I9UA 4JI9A 1KE9A 3QALE 4AUAA 4F6SA 1CKPA 3LFSA 3UG2A 5AAEA 4EBVA 3MFTA 5E8SA 4I6FA 4CGAA 3QTIA 4FYOA 2NNWB 2XARA 5DIAA 5HE3A 3PXQA 3T9IA 3G5DA 3IKAA 2OG8A 2OI4X 3M42A 5DEYA 4AN3A 2GQGA 5AEPA 2VTTA 2ETMA 5AV3A 1PJKA 2Z7SA 3I81A 2R3PA 3Q60A 3ZUUA 4W8DA 3FKNA 2QR8A 4V0GA 1NVSA 3EB0A 3QX2A 4FMQA 3PIYA 5M57A 2QODA 3ZUTA 3A8WA 4TNBA 5JFWA 4QPAA 4GMYA 2IJMA 4O0UA 4V01A 4UMQA 1OGYA 4GT4A 4QPMA 3FYJX 4CEGA 4LL0A 3BZ3A 2W1CA 4F9WA 4WNMA 5FP5A 4IZ5A 4BIBA 4DEDA 2VWUA 4I5HA 4U6RA 1ZOGA 5CENA 3TUDA 4G9CA 1GAGA 2YJRA 4ZZMA 1B38A 1H00A 3SX9A 4GFMA 4AA5A 4EQMA 5BUIA 5HE2A 5LVPA 3ZSGA 3U87A 4O27B 3EQRA 2UW0A 2XVDA 2GS2A 3HAMA 5AUXA 4GK4A 3UJGA 2H8HA 4RQVA 3U6HA 2J0LA 1FQ1B 3CBLA 3WBLA 2ZVAA 1PXKA 1WBWA 3R9RA 5IQBA 4S30A 3LCTA 4L68A 4JG7A 2YA9A 4ZP5A 5EHOA 2ITVA 5AMNA 3ZOSA 2BAQA 3F3VA 3HV5A 3I0QA 3UNZA 2YDKA 3OY1A 3O96A 4IQ6A 3F69A 2C6TA 1ZYSA 2O5KA 4FV8A 4U41A 3RI1A 3EMGA 3AC3A 5ETAA 5CWZA 5FBOA 3NNVA 4CSVA 3MW1A 3GU6A 2C5VA 4IZAA 3NYNA 4L9IA 4R8QA 4X0MA 3RP9A 2WD1A 4AFEA 3OG7A 1RDQE 2JIIA 2R3RA 4IJPA 2YHVA 4G3GA 4RWJA 5AV1A 4R77A 4YJTA 1OVEA 3P23A 4MF1A 2UZWE 3E92A 3RBWA 4ERWA 4KIPA 3KF4A 3PA5A 5EKNA 2QOLA 3OWLA 3ALOA 4QNYA 1H25A 4DTAA 3NW7A 4K9YA 5KZIA 5BQ0A 3C1XA 3ROYA 1DS5A 4CV8A 1TKIA 2QO9A 4GS6A 4WNKA 3N4VA 1PMEA 2CNVA 4PPCA 2W1IA 3EKKA 4FGRA 4MBJA 4EH8A 4YHJA 4BC6A 5CU4A 4DFBA 1U59A 2HXLA 2JFMA 1UNGA 4ZMEA 2YCRA 3PXRA 4UWYA 2ZDTA 1NXKA 1YWNA 4P4CA 5CAPA 3PDTA 2E9UA 3OCGA 4BZNA 4EWHA 4W4YA 1R3CA 3PFQA 3E5AA 5AM6A 3CR0A 4IHPA 4DCAA 4O0XA 4HCVA 3LFCA 4IX6A 4AN2A 4XG4A 3ZRMA 1CSNA 3FWQA 3R7EA 3QTXA 4E5BA 4Z55A 3P9JA 5M4FA 4ITJA 5CY3A 4HCTA 1IAJA 4C34A 4OBQA 1JPAA 4DEBA 3L9PA 4PWNA 4XP0A 3F88A 1BI8A 3ZRLA 4LGDA 2IWIA 4LOPA 3ML1A 4FZ7A 3NAYA 3R9HA 2YN8A 4U79A 4BY9E 3WZDA 3R8UA 2OIQA 2XP2A 4NM0A 4RVMA 3P1AA 4JL9A 3QKMA 4BKJA 4ZY5A 3KRLA 3LCSA 2CGUA 3NMUF 4WBBB 3AC1A 1V1KA 3GU8A 4BGQA 4NM7A 2BIKB 4PDOA 2IN6A 4UMPA 3VUKA 4M12A 1ZZLA 4JNWA 4NFNA 4F9AA 3NDMA 5H9BA 3KXMA 3NS9A 4R3PA 5H8GA 3SA0A 1GZNA 2VWYA 3L9LA 5FXQA 2PZIA 4FSYA 4GCJA 4IB1A 1OI9A 3I60A 4TPTA 4CKIA 2H6DA 3G6GA 2B55A 2C6KA 3R28A 3QF9A 5HEZA 4CLJA 1KV2A 2W5AA 4GT3A 4AZSA 4ANMA 1PXIA 1SZMA 2BALA 4I0TA 5IH4A 5JEBA 2BAKA 2IVTA 2YFXA 1H0WA 3OUNB 2XKDA 4O4EA 3BU5A 5FGKA 4D0WA 1U4DA 4J7BA 4C3PA 1JNKA 3ORPA 1OKWA 5FM3A 3AC5A 3AT3A 4OAUC 2ZYBA 4DA5A 4JVGA 5TOZA 2OK1A 3IW7A 2IO6A 1M52A 1CKJA 1MQ4A 3DY7A 4FT5A 3Q6UA 4GV1A 4O7ZA 3UDTA 1ZYLA 3FMEA 4II5A 5HU9A 2H96A 3WZJA 2R3IA 4AW5A 5T3QA 4YJOA 1OPJA 2G9XA 3FI2A 3R9DA 4BIDA 2WTWA 2X8DA 2EUFB 2RSVA 5L2QA 4CXAA 5IEXA 4MK0A 2J2IB 2WU7A 2UVXA 3H9FA 4N57A 4AACA 4H05A 5EQYA 3OD6X 3EQHA 3PIZA 5F20A 4FZ6A 3SOAA 3ZLYA 4FG9A 2P33A 2VWVA 4JQ8A 4KKGA 3VQHA 4QTAA 4HVHA 4I1ZA 3W2OA 3NCZA 3LE6A 2X8EA 4MNEB 3NUSA 4C61A 3FQEA 2VTRA 4U3ZA 5AADA 4E20A 4CMUA 4N0SA 4W4XA 1W2FA 5A9UA 3F7WA 3Q9ZA 5CF6A 5ITAA 4FL3A 5D1JA 4RPVA 4H58A 2W4KA 1WBSA 2OJIA 2V5QA 3FDNA 2WTKB 1O6YA 2ZB1A 2OIBA 2WXVA 3C0IA 4HYHA 3RM7A 4BBFA 5BVNA 3WYXA 5CF5A 2X8IA 5K3YA 2IVUA 4YHTA 3A7FA 4R3RA 4TNDA 4B0GA 3NNUA 3NZ0A 3FY0A 5DMZA 4DHJA 3UGCA 2PVJA 4FZDB 3C9WA 1E9HA 4LYNA 4QD6A 2Z7RA 2C6MA 3SXRA 3IS5A 2BZJA 4WUAA 1KE6A 5EW3A 5H2UA 3TTJA 3O7LD 3ZH8A 3EQFA 2DS1A 4ALWA 2OJGA 4EONA 2VGPA 5AA8A 4OTHA 4TYJA 4QYYA 2WMXA 5AR2A 5M4UA 5ANIA 2CKEA 3NNWA 3HNGA 3U4WA 5JFVA 1OBDA 4UY9A 3VN9A 4DN5A 4PL4A 3GUBA 5E92A 4O91A 4QTDA 4J97A 2C3LA 2R3JA 3GC7A 2YITA 4KSPA 5ICPA 5K4IA 4AWIA 3FC1X 4Z16A 5EHLA 5A4TA 3O0GA 4D28A 3ACJA 3QYZA 3EN9A 5J1VA 3C7QA 3KXGA 2VX1A 5HQ0A 3PP0A 3RPYA 3F5PA 3TNWA 3HDMA 1PXMA 4D1XA 4AA0A 3FXXA 5CI7A 2NPQA 1H01A 3SGCA 5D11A 5M44A 4EZ5A 3EZRA 1OUYA 2W4OA 3CGFA 4C4HA 4LUEA 2J50A 3MPAA 5I9VA 3HMPA 4YTCA 2WTJA 3FMKA 3HUCA 2XAMA 3UVQA 1WAKA 3H10A 1ZOHA 4TYIA 1DI9A 3QQFA 5KNJA 3ORLA 1YHVA 1JLUE 4R78A 2PVMA 3RM6A 1PYEA 1SVHA 3IGGA 3RTPA 4JQEA 4C0TA 5A4EA 2XK3A 4K1BA 1J7IA 1MP8A 4WG4A 2YCFA 2AC5A 1Y6AA 1H24A 3LFQA 2PZRA 4EOSA 3RMFA 2VTNA 3DBDA 3SRVA 3NW6A 5HZNA 4RJ8A 3UOHA 4FR4A 4ZSJA 4K77A 2RFSA 2ZM3A 3GC0A 2JDRA 3VNTA 4HPTE 1FGKA 1W98A 2XK4A 3C4CA 3ANRA 3EN4A 3UOLA 5IUHA 1YQJA 4MXAA 2PZ5A 3EN6A 5CAVA 5E8VA 1DAWA 1OIQA 2PMLX 5TKDA 3VUGA 5HTBA 1WVXA 3C51A 4R1VA 4IFCA 5CT7A 4C4FA 4RC3A 5D10A 4RA5A 3H4JA 2JDVA 5J7BA 3EHAA 3A2CA 1H27A 4YC8A 3ZO3A 4LOQA 1PMUA 3FMLA 5M09A 5GZAA 3SKCA 3VS7A 3QQUA 5D7VA 2NRYA 3TIYA 4DG0E 4E8AA 4MBIA 4RIXA 2W9ZB 4BVUA 4EQUA 3D2IA 4O4CA 5JZNA 3BRBA 3ZO2A 1FVRA 3C4WA 2V7OA 5EYCA 1TQIA 4YZNA 2QHNA 2VTMA 3D15A 3JXWA 3L8SA 4BJJA 1H1QA 3GCVA 4FTIA 4X21A 2OO8X 4U81A 2X4ZA 1L8TA 4XMOA 5I3OA 3FUPA 4BDGA 1FOTA 3A62A 3JUHA 2UZEA 2QOCA 4W4VA 2OF2A 2BFYA 3A7JA 3Q9WA 5B2LA 2YZLA 3GENA 4I6LA 3G9LX 5BYLA 4NSTA 3R83A 2UV2A 3RGFA 4R7HA 4AT5A 3DXNA 3D5WA 3F3WA 4M14A 5DWRA 4I5CA 4AW2A 3AC2A 3BKBA 4JS8A 4B7TA 1TFFA 2Z7QA 3O2MA 1DI8A 3GT8A 2PMIA 5GJGA 2VO0A 3CQEA 2DQ7X 2OFVA 3GC9A 4OR5A 4BIEA 4ZZOA 1ZXEA 1ND4A 2R7IA 3QHWA 4J71A 4LMNA 3PJ1A 5I0BA 3HKOA 1BMKA 3GCPA 4F7JA 2YIRA 3GCQA 5HG9A 2A19B 4IB0A 3D7TA 3R01A 4KS8A 3U4UA 4O83A 3NSZA 1YOJA 3AG9A 4GG7A 4AFJA 3MN3A 4A06A 4NFMA 4D4VA 2VWIA 3MY5A 1REJA 2PU8A 3L9NA 4IBMA 4RWIA 1KE8A 1Q24A 4ASXA 2WMAA 5HI2A 4GEOA 1FMKA 2R3MA 2RGPA 2F7XE 4NIFA 4GK3A 3UVPA 3I1AA 1Q99A 3K2LA 4OTFA 4WNOA 5CSHA 4KA3A 3VS6A 3WF8A 3QZFA 5CALA 3PRIA 2B9IA 1TQPA 4QDVA 3QWKA 4MXOA 3UC4A 3RJCA 1OBGA 4TYHB 5F1ZA 4FF8A 3NUNA 4Y8DA 1VEBA 2HW6A 4BICA 4E73A 1MUOA 4FTJA 3MPMA 2Z8CA 2HWOA 3HMNA 4HYSA 2CGVA 4HW7A 2JAMA 3MH0A 4JRNA 3V01A 3TM0A 2OXDA 3F2AA 4FKVA 5CSXA 4YTHA 2XNEA 4FV6A 3R0TA 3DFCB 4UBAA 5AR4A 2XM9A 3GCSA 4R5YA 2XJ0A 4BJJB 4IEBA 4BFMA 3DAJA 4PMPA 2PVYA 5GIOE 1W2DA 4HYUA 4IM2A 4N4SA 4EHGA 5KBRA 3NYVA 4G1WA 5EOLA 4LGGA 4NTTA 4Y95A 3RPVA 4FV2A 1FPUA 3ULIA 3UO5A 3QQLA 2W1ZA 3E3BX 1M17A 2ESMA 4LRMA 2BR1A 3QYWA 4U43A 4XG7A 3BE2A 5BVEA 4B8LA 5HGIA 4XX9A 4WKQA 2CKOA 3NIEA 3PSCA 2OJJA 4FTUA 2WMVA 4M15A 2C5YA 2PUUA 3MWUA 3QUPA 3TJDA 3TZ9A 3V8SA 3QAME 4PL5A 1WBNA 3T3VA 3UOKA 2PWLA 4YBJA 4G3DA 2C5XA 5FEEA 4EORA 5JRSA 5AUWA 2RL5A 2W4JA 4FUXA 3V6SA 4O0RA 4M0YA 3QKLA 1QL6A 2C47A 4GJ2A 5EI6A 5DBXA 3RNIA 4YR8A 1Q61A 4ZTRA 3DZQA 4DGMA 5BUJA 5ANOA 3W8LA 3KK8A 4QQCA 2BKZA 3LFFA 2UZUE 4AZWA 5B7VA 2W96B 3S4QA 3WZUA 3FPQA 4A4OA 4YJSA 5AUYA 3V5PA 4CRLA 5TR6A 2WMSA 5DHJA 4PF4A 4FI1A 5HIEA 4FEWA 4CQGA 1XKKA 2YM6A 3O71A 4FK6A 1NA7A 4YJRA 2WAJA 4U3YA 2GNFA 3ULZA 3WE8A 4D2TA 1NT2A 4JAIA 2VO6A 2VTIA 3Q5ZA 3M1SA 3MTLA 3FEGA 1WVWA 5AX9A 5A14A 4ZLZA 2X7OA 1XH6A 4NT4A 2VGOA 4HNFA 1IASA 2VTPA 3BYSA 3S00A 1AQ1A 1PXNA 3CC6A 4RLLA 3RINA 3DK6A 3GB2A 2C6IA 5JFXA 3BGPA 3DS6A 3P7CA 5KHWA 4EK5A 3C0HA 5FTQA 3JYAA 3W0NA 3PY0A 1VYWA 3ANQA 3R00A 4QMWA 4EYMA 3BHTA 4G2FA 2I0HA 4YJQA 3W0RA 5FWKK 3D83A 5CXHA 5IQEA 3OEZA 3FYKX 3DKOA 3FMJA 3S95A 3DOGA 4R7BA 5J7HA 5LQFA 1Q8YA 3VW8A 4CYIA 4CG8A 1F3MC 2J5FA 3HEGA 4MXYA 5E1EA 3WF9A 2QLUA 1YOMA 2BDJA 2NP8A 4HVSA 2BFXA 2WTIA 3DJ6A 4BWKA 3KC3A 4YZMA 3TDVA 4E6CA 3F5UA 3PXYA 1UNHA 4YP8A 2X0QA 4QP8A 4Q5EA 4QMNA 1H1PA 2WMUA 4MQ2A 2BZKB 4L45A 4NW6A 4WHZA 4BDKA 4F6UA 5KBQA 3QFVA 3RKBA 2BZHB 3HAVA 4O84A 2QVSE 1GIJA 3FPMA 3VBYA 4EH9A 4F9BA 3BQRA 4HNIA 4E6QA 3PP1A 3R9OA 5JN2A 4PDPA 4G9RA 4FEXA 5ANKA 4CZYB 4IW0A 1IA8A 5IA1A 1LP4A 2F57A 5CYIA 3FI8A 4U7ZA 5M56A 5IH5A 1ZZ2A 3TN8A 4D4YA 3ORTA 3BPRA 4ZJVA 3GGFA 3SXSA 2AQXA 5AV4A 4ANNA 1NVQA 4LFIA 4QMQA 3COHA 3RAIA 5E90A 3DJ7A 2J0IA 3R22A 3KXXA 3QUEA 3ZLXA 4EC8A 3UVRA 3MJ1A 4AGUA 4O7RA 3JY9A 4RRVA 4TYEA 3T3UA 3VBQA 1OPKA 4L7SA 3CY2A 3ZEPA 1ZMWA 4D2SA 1U46A 3GXLA 5AP7A 4EI4A 5GZ8A 5DE2A 4DT8A 4O86A 2P2IA 2OLCA 1PKGA 5L8KA 3QTSA 4HGEA 3KXZA 4R6VA 1MRYA 4J52A 4LV5A 4I22A 2X4FA 4R1YA 4X3FC 3UG1A 4RMZA 1Z5MA 1ZOEA 4FKGA 3JS2A 3PSBA 4FE2A 3QD4A 2WFYA 3D5XA 3R02A 5C9CA 3OWJA 5IZFA 2GNHA 3JVRA 4OTRA 2JKQA 3EWHA 2XNNA 3AQVA 4YHFA 5C27A 4DLJA 5HG8A 4QP3A 4O2ZA 3MB7A 2R3KA 3TNQB 4I0RA 2JBPA 3G33A 1OKZA 4EH3A 2ITXA 3O8PA 5DA3A 2WMBA 4GU6A 2IF8A 4O0TA 4QQ5A 2DYLA 3LLAA 3DQXA 3W10A 4W8EA 4O38A 4QYGA 4LG4A 4BF2A 2C69A 3MJ2A 3CGOA 2HAKA 4W9WA 4H3PA 4IAZA 4CZTA 3D9VA 3R9NA 3QUDA 4C57A 4J96A 2QURA 2C5OA 2F4JA 5H3QA 5E8TA 4XV9A 3NUPA 4DTBA 1MRUA 2XZSA 3VS5A 4HZRA 2PMNX 1A48A 2O65A 5EM5A 1KE7A 2HZ0A 4TT7A 2GHMA 5HHWA 5ETFA 4EUTA 1WBPA 3R8MA 4AT4A 1M2PA 2OSCA 4MD7E 2OU7A 3Q52A 3VF8A 1UNLA 4MD9E 4XG3A 3MDYA 3BU6A 5JQ8A 3ROCA 3S1HA 2XH5A 4KKEA 2XKEA 4FSRA 2PVKA 3UZTA 2Q0BA 1PXLA 4RJ4A 2WHBA 1G5SA 3FMNA 1BI7A 4A9TA 4BYIA 4EH5A 1H0VA 2CLXA 2WEIA 4NCTC 4LDTA 3H9RA 4GYIA 2ITNA 1W0XC 2X0OA 4QOXA 2C6OA 1YXTA 4G3FA 3I7BA 5TT7A 4BCGA 4CNHA 5EDRA 2BZIB 3QA0A 4IX4A 1Q41A 4O6LA 3IOKA 5CI6A 5AP0A 4F0FA 4DDGA 3K3JA 4H3QA 4EZ7A 2KULA 5CVFA 2VTQA 2OJFE 1XHAA 1YWVA 2JEDA 3DFAA 3LJ1A 4FYNA 5CVHA 4MEDA 4A4XA 4F64A 2GQRA 1S9IA 2EB2A 3QZIA 4AOIA 2VUWA 2WEVA 3ZHPC 5L2IA 4TTHB 2HELA 2B7AA 4BCPA 2PULA 2XRWA 2Q83A 4FT3A 4FEVA 3POZA 4HOKA 5HNGA 4UN0C 2ZFYA 4YPDA 5AV2A 1K9AA 2IW6A 3R7GA 4TWCA 5J8IA 3EN5A 4E3CA 2C1AA 3BCEA 5CAUA 2UZLA 2WKMA 3CJGA 5A3XA 2PUPA 2R4BA 4IWDA 3HA8A 4CCUA 3NCGA 4IAIA 4FOBA 2A0CX 3KMUA 5BX0A 4RVTA 2PUNA 1Q8WA 3P5JC 3II5A 3QTRA 4C36A 4RIWA 4TWPA 4QYFA 4H36A 3KQ7A 4HVDA 2W7XA 5AUUA 3AGLA 3UYTA 3VUDA 5ACBC 2C0OA 4WRSA 4M67A 3LMIA 5TE0A 5AUVA 4BHNA 3FC2A 3FMDA 5K4JA 4QMZA 4AX8A 2WOUA 4WRGA 5CNOA 1G8JA 4L3JA 3WE4A 4MTAA 2ITUA 3VRZA 2VV9A 4ZTSA 1JSVA 1NW1A 4QMTA 4FT0A 3V5WA 3P0MA 4Y46A 1BKXA 5L6WL 3OHTA 3CTQA 3FZ1A 4QP6A 3KREA 5HX6A 3OOMA 5HLPA 5FTGA 4MYGA 4YZBA 3SD0A 4I23A 3HMMA 5DVRA 1OPLA 2BILB 4WNPA 4C4EA 4V04A 2GDOA 2Y4IC 4HGSA 5AR3A 5BVOA 5KKRC 3AKJA 4DBXA 3SW4A 1FVVA 2O8YA 4A9RA 3FZSA 3QRTA 2PHKA 4I4EA 1ZRZA 4NW5A 4YJVA 5HU3A 3E8DA 4UYNA 4TW9A 4MNFA 5HVKA 3S3IA 3UZRA 4G5JA 3Q04A 3MGYA 2X2KA 4JR7A 3QL8A 2YDIA 3TKIA 4YTFA 2FSTX 2XIKA 3R73A 4FSMA 2OH4A 2HWPA 2YIXA 5C4LA 4F0IA 5HCZA 4OTQA 2R64A 4QMUA 4L6QA 1FINA 4I4FA 2CNQA 5M4IA 1O6KA 2VTAA 1P4OA 3KU2A 3QBNA 4XG6A 4FTNA 2JITA 1GZOA 3CIKA 4QYHA 3PJ3A 4IACA 4MF0A 3BWJA 3UOJA 2BCJA 5EQPA 4BBMA 3O17A 3NEWA 3DB6A 4JLCA 5AWMA 3VBVA 1H08A 2XNGA 3IGOA 4IM0A 4RIWB 2A27A 4X7QA 5C03A 5L2WA 4D5HA 4AXEA 1PYXA 5L6OA 3A8XA 4O0YA 5F94A 5FG8A 4H39A 4RVLA 2IW9A 4S2ZA 4JXFA 5H8EA 4DEIA 4FEUA 4ZS4A 2QG5A 3HMOA 4FIFA 4PQNA 2O63A 5F95A 4NL0A 3PG3A 4ZSLA 3T9TA 3AXWA 3E64A 3SHEA 4U0IA 5H8BA 4FTMA 3BL7A 3DT1A 3F2NA 3Q9XA 2CSNA 3HL7A 3QLFA 4DEGA 2FO0A 1ZLTA 2WZJA 2BTRA 4UXQA 2PY3A 5JQ5A 4KD1A 2CGXA 2YLEA 3HRCA 1PXJA 4CFVA 4O0VA 3TDWA 3R1SA 3FL4A 4M8TA 3OW3A 3TJCA 4Y5QA 4KBCA 1SNUA 2YM8A 2ITTA 4FL1A 4GL9A 4DH1A 4EKLA 1STCE 5KX8A 2QD9A 3RK7A 3BHVA 3EFLA 3PJCA 3QZGA 1YRPA 3ZC6A 4EYJA 1G8SA 5E91A 4L44A 4BTFA 5B0XA 4I92A 4UMRA 4NTSA 2FA2A 4RJ7A 4KUJA 5HVJA 1Y8GA 5C8KA 3NYOA 2ERZE 4BL1A 2B1PA 4YBKA 4D2VA 5HICA 3OCSA 2YM5A 1JQHA 1CDKA 1S9JA 2ONLA 4JDIA 4MQ1A 3OT3A 5AP5A 5M53A 2IPXA 4EJNA 5I9WA 4FTQA 4I20A 2QU5A 1UWJA 2GS6A 4MNEA 4D9TA 4KRCA 4G16A 4D4SA 4L7FA 2UZOA 4FKQA 4IB5A 4FIHA 3F3UA 4AXAA 2E9OA 2LAVA 4I41A 3ENMA 4W4WA 3EYHA 2XUUA 5FBNC 4AP7A 3ORMA 4R5SA 4O4DA 5E8XA 4CCBA 3BEGA 2GSFA 3NFGB 1AD5A 3O7LB 4I0SA 4IAYA 3VS0A 3MVHA 4IE9A 4AG8A 2OF4A 3LXPA 4TKSA 4WG3A 4K33A 4LI5A 2W1EA 4IH8A 3DLZA 5HE1A 4AW1A 2GHLA 1H28A 3FV8A 1Q62A 5CQUA 2I6LA 5G1XA 4C8BA 4IDVA 2R7BA 4QMYA 4GKHA 5IISA 5DI1A 3KCKA 4GIHA 3QCSA 1UU8A 3PXFA 1GOLA 4IVBA 4XYFA 3LFDA 5HVYA 4GYGA 5J87A 4ZXTA 4K18A 2FYSA 4XJ0A 4O21A 4XBUA 5CU3A 2YCSA 4O4BB 1IRKA 2YM3A 4RX8A 2VU3A 4F9YA 5IDPA 4RGJA 2UZDA 2EWAA 5HIBA 4DGNA 4RVKA 5CT0A 5AIKA 5IA0A 2C3JA 5CEPA 4GUBA 4ALVA 2BKKA 4U42A 1CTPE 1U5QA 1WBVA 3FXZA 2P4IA 4FT9A 4W9XA 3ZDUA 5L2SA 4PX6A 2JIVA 3E7VA 2VTSA 3HVCA 3R8PA 5AAGA 4GVAA 3Q4ZA 3KVWA 4K0YA 3KRXA 4FV1A <