5LVLA

Human pdk1 kinase domain in complex with compound ps653 bound to the atp-binding site
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
285
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 285
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvlA01
4NTTA 3OP5A 4EBWA 2O0UA 3HRCA 2PVHA 1PJKA 3HV6A 2W5AA 4OW8A 5JN2A 3JPVA 4RJ3A 3EH9A 2G2FA 3VBYA 3UPZA 3BI6A 4I5CA 3KRWA 4FC0A 1CDKA 4NFMA 3D0EA 2VUWA 4O91A 4W4VA 5D7AA 5EKOA 3SRVB 5M56A 1UVRA 2RIOA 4QQ5A 4E5AX 4FV3A 4O96A 4CZTA 2BRGA 3HAVA 4DTAA 4WUAA 3WYYA 1YI4A 2XKDA 4YZCA 4DG3E 3P1AA 1WMKA 4FTAA 3D4QA 4UXQA 4S32A 3ZEWA 2Z02A 5I5ZA 2XB7A 3EQPA 3PFQA 2HCKA 4NSTA 2IPXA 4P90A 3NCZA 3ZOSA 4EH9A 4FUYA 4BDAA 2PVKA 3OG7A 1PRYA 5ANEA 4HNFA 4RWIA 3ZM4A 3UP7A 4D5KA 2XNNA 3RPOA 3JY0A 2EUFB 3LJ2A 5HBHA 5B0XA 5IA5A 2WO6A 4N6ZA 4GYIA 3HYHA 2C5OA 4S31A 2YIYA 4I3ZA 2Y9QA 4AGDA 2W96B 3QQUA 3VHEA 3R0TA 3RAKA 5DRDA 1H00A 4FGRA 2PMIA 4FV6A 2RF9A 3FKLA 2QG5A 4F99A 2GFCA 2QLQA 2W1EA 2XMYA 3OWKA 4KKGA 2UV2A 4TWCA 4C3FA 2XCHA 4Q2AA 2PPQA 4F65A 4HPUE 4EHVA 1FINA 4QMLA 4XEYA 3UJGA 3MA3A 4O84A 5M08A 3NDMA 4TWOA 4MVFA 1YOLA 1ZY5A 3OBGA 5ANDA 5E8UA 3BBTB 5HG5A 3DJ7A 4AF3A 4F1TA 3AXWA 4KKEA 3ENHA 2J0JA 1M52A 3C4XA 3LFFA 4LOOA 1CMKE 4HYUA 3VRYA 4FMQA 4E20A 5CX9A 5C26A 5HNIX 3HUBA 3T9IA 3F6XA 4EH6A 3R7EA 4RSSA 3R8LA 3TN8A 4DAWA 4ZIMA 3QQKA 4BCHA 3HV5A 2WMAA 3RKBA 3AMAA 3ZDIA 4PTCA 4M67A 2YCSA 2W9FB 5DYJA 2QOLA 3GOPA 4DLJA 5GNKA 3ORPA 3TKIA 2A0CX 3M1SA 1IA9A 5HOAA 3ORIA 4R1VA 4I93A 3PY0A 4LMUA 3R7IA 3ORZA 4DEGA 3TACA 3SXFA 2JC6A 4RWJA 3CTHA 4Q9SA 4LOPA 2DS1A 3IS5A 3R1SA 2VZ6A 4WG5A 5AP0A 5LARA 3QHWA 3SVVA 1SM2A 4A9SA 1OKZA 4M12A 4XUFA 5HVJA 5IQHA 3DPKA 3R21A 3FQHA 5HCYA 4M69B 4IX4A 4RC3A 4BDBA 1FVVA 1K9AA 2JFLA 3ZMMA 2FA2A 4XLVA 5JFSA 3CQWA 4I6HA 2XK7A 3ZBXA 2ITVA 2GDOA 4YGAA 1OL1A 3TJCA 4QT1A 3ZU7A 4AT3A 3Q5IA 5D41A 2QD9A 4WOVA 2GTMA 4E6DA 4NM5A 4M15A 4OTHA 4RIOA 4UXLA 5DLSA 5IZFA 1ZYSA 3FMKA 4G6OA 4FK6A 4OUCA 5CXZA 1H1SA 5CI7A 2OICA 2JAMA 3F66A 4B8MA 4IZ5A 4BGHA 3AC4A 3QKMA 3TKUA 3POOA 4JR7A 4HZRA 3O8UA 5AR8A 5G6VA 2C3IB 4CFUA 1V0OA 2VRXA 2B9JA 2IO6A 4FV9A 4HVGA 4YLKA 4R1YA 4P7EA 4XX9A 4AZWA 2VTQA 3LOKA 2C6TA 3MFUA 4YBKA 5CSWA 1PHKA 1FOTA 4BTMA 4FA2A 2I0HA 4FT3A 4BDDA 1YI6A 2BKKA 3PXYA 3Q4UA 4Z3VA 4NEUA 5FXRA 4X3FC 5HLWA 1PKGA 4IXPA 4G1WA 3ZZWA 2WTDA 1NXKA 4O7NA 2FUMA 2VV9A 4HCVA 2GHGA 4ASDA 4AOJA 5HTCA 2WMWA 4FKJA 3KULB 1PKDA 4H3PA 3E93A 4C59A 2HW6A 5KZ0A 1ZZ2A 3L8VA 1J7LA 4BDFA 4L44A 4MBJA 3SW4A 3DAJA 2VTTA 2RFSA 4HVIA 5CAUA 3KXXA 5KBRA 1ZRZA 4CQEA 2WIHA 5DOSA 1Q62A 3A7JA 4WT6A 4EONA 4QPAA 5J95A 2JIIA 4AACA 4RJ4A 4EH4A 4PPCA 1FVTA 3GT8A 3UO4A 4RIWB 5BMMA 3DCVA 3T9TA 3LIJA 2CJMA 3EN5A 5KCVA 3R1YA 4EH7A 2QKWB 4KIOA 4BGGA 3TV7A 3HX4A 4RIXB 2HENA 3BV2A 3FV8A 3FWQA 3BBWA 4FYNA 4RQKA 4YPDA 3NYNA 4BCKA 5IH4A 2OJGA 3LM0A 3G2FA 1OIQA 4L53A 1WVWA 4J52A 4YJRA 3DZOA 3CJGA 5LCKA 1P5EA 3EN4A 3R00A 4A4LA 5LXMA 3QWKA 4ZAUA 4BHNA 3W8LA 4O0UA 4X21A 5CAOA 5AM6A 4ZLZA 5J5TA 4IANA 4NL0A 4U45A 5C01A 4Z7GA 4YBJA 2JBOA 3LVPA 5IMEA 3I5NA 4JG8A 3V5JA 2IZUA 5BX0A 5ANOA 1VR2A 5GZ9A 1W83A 2ITOA 2C68A 4GJ2A 2P55A 2W1IA 1JKTA 5HNGA 1R1WA 3QRKA 4ZJVA 4C4EA 5KBQA 4QYHA 5BNJA 4TNBA 2HWOA 4E4MA 3NGAA 4RZWA 3QZHA 4FGBA 5C27A 3U55A 2BRMA 3P4KA 4C36A 1NW1A 2I6LA 2XNGA 3RWPA 3VUDA 3R8VA 4XH6A 3UE4A 1LP4A 2E9PA 1REKA 2ITNA 4YUQA 4U81A 4AGUA 4ZSJA 2QR8A 3R8UA 1ZARA 4UX9A 2BCJA 3PSBA 2YFXA 4XYFA 5IA4A 4ZS4A 3MFRA 3F3UA 1UA2A 3VW8A 3HL7A 4UMQA 4YJNA 4OBPA 4KSPA 3P9JA 4XV2A 3UOLA 2YLFA 4PTEA 5EM7A 3RPSA 2GS7A 3FY0A 2PVYA 2ETKA 3SOCA 3DXQA 4R5YA 3G6HA 3GUBA 3NNUA 4UV0A 2IZRA 3E8DA 3CQUA 2O64A 3LXPA 2YM3A 4EOPA 1Q99A 1XH9A 4O0SA 3KK8A 3LLTA 2WEIA 4DT8A 3C4FA 4PL4A 4GMYA 3ZBFA 1NT2A 5C1QB 3PLAE 1GOLA 5H8EA 4F7SA 4OAVB 4XP3A 5CEOA 4AZSA 4FL1A 3F5UA 4U3ZA 4GS6A 4CYJA 2G1TA 2R4BA 2GMXA 3PSDA 4CT2A 3TTJA 4EI4A 2JDTA 4FNWA 1Q8WA 3PG1A 5FLFA 3P5KA 4P4CA 4DF3A 2BHEA 3ZC6A 5DEWA 4EZ3A 2B52A 4IB0A 1DS5A 2F7EE 5JT2A 3UNKA 4FKUA 2HW7A 3VUIA 4WO5A 3WZUA 4EQUA 4CG9A 3KQ7A 4K2RA 4K8AA 3P7CA 3O2MA 4QMZA 4I6QA 1GNGA 3COMA 5BVEA 4YJUA 3UO6A 3WI6A 3U6HA 1CKIA 3CIKA 3G6GA 4TYHB 1OITA 5DFPA 1PW2A 3FYJX 5A4LA 5AP3A 2EB2A 3UVPA 3QAME 4A4OA 5J5SA 3D94A 5CF4A 4FVPA 4ASZA 3NW7A 3PP0A 1Q3WA 2VN9A 1M2RA 4FTNA 1SNXA 3H0YA 3UQGA 5K9IA 1PXPA 1WZYA 5HO8A 4AW5A 4ZZNA 2PL0A 4UWBA 3UMXA 3R9HA 3LMGA 3TDWA 3HRBA 3IDPA 1JBPE 3P23A 3LCSA 5CNOA 4RVKA 2WMBA 3RTPA 4EOJA 1URCA 4XG3A 1FMOE 2W7XA 4ZY5A 4EK6A 2X6DA 3QHRA 4EUTA 4BGQA 3CXWA 1GY3A 3OTUA 4BN1A 3P7AA 5J9LA 3JS2A 4QP4A 4C61A 3NUAA 5AIRA 2C6IA 3IK3A 3H9OA 4X2GA 4IX3A 1J1BA 1APME 5HG9A 3VS4A 5LWNA 4TYGA 3IOPA 3HMOA 3R7YA 5DT3A 5FEQA 3QX2A 3ZFYA 4GCJA 4Y85A 3R8MA 2OG8A 2WIPA 2YITA 4WA9A 5EOLA 3I6UA 1IRKA 4DH5A 3EJ1A 4H1MA 4EEVA 4OAUC 2WTKB 4ACHA 3S95A 4KABA 3MFSA 3VUKA 2R3MA 1HCLA 1XH5A 1R39A 4WRGA 5TOZA 2YACA 3MH2A 3R7UA 1CSNA 2YIWA 3QQJA 4MNFA 5JRSA 4BWPA 3S00A 4FG9A 1JSVA 2FSOX 3VC4A 3DV3A 2YDKA 4I6FA 4EH5A 3V8SA 4AGWA 3BQCA 3UOHA 3HMNA 3SDJA 4FV5A 4EOSA 5M09A 4ZTNA 4DG0E 3PRFA 3BHVA 5AX9A 4DH3A 1H4LA 2ZAZA 5TR6A 4HYIA 3FZPA 1PMEA 2E9VA 3FMJA 4YTCA 2VTIA 2UZWE 2GNIA 3QD4A 5IUIA 2WTVA 3EQRA 3Q3BA 5FTOA 3M11A 3KB7A 4QP9A 1RQQA 4IFGA 3U9CA 4D1ZA 3DAEA 4EQCA 3IGGA 1VEBA 5AA8A 5JQ5A 3WF7A 2OFUA 4AW2A 4CMTA 3E5AA 4YJOA 3FLWA 3F88A 3D5UA 1BMKA 2RKUA 4QMUA 4R3RA 3W55A 4L7SA 5HVYA 2I0YA 3CKXA 3KXMA 3TNPC 3VBTA 2DWBA 2HZ0A 3DTWA 4FV1A 2OH0E 4G3CA 1DAYA 4I0SA 4MBIA 3ZLXA 5L2IA 2P33A 4R7BA 5CSPA 5FDXA 4LUEA 3CEKA 3LFDA 2X4FA 2ZDUA 3R28A 4MQ1A 2R64A 3EKKA 4HYSA 1KE9A 4BWKA 2X9EA 3NIZA 4QTAA 4IW0A 3RHKA 5IQEA 3OEFX 5L6PA 4GFMA 4HGSA 3W2QA 5B7VA 3MH3A 5EQYA 2CLQA 3HDNA 3QF9A 3F69A 2WQMA 3HUCA 5C8KA 4QYFA 3DXPA 1PXOA 4G5PA 2GHMA 4M97A 4AGCA 5GINE 1OL5A 2XP2A 3FPMA 4QMSA 3NR9A 4XNEA 4QMXA 4QQTA 5E1EA 4H36A 1W84A 5ICPA 2FH9A 4OBQA 2XK8A 3AC8A 5A4EA 2W4JA 1MQ4A 3UIUA 3ZLYA 4BWXA 4Z7HA 5JGDA 3FLSA 2UW7A 2PMOX 2BZJA 2JIUA 2WXVA 4J7BA 4J98A 1GIJA 5F4NA 1FGKA 4AS0A 4QP6A 5ITAA 1H07A 2JFMA 3UOKA 4FOBA 3KXNA 5A6OA 5EM6A 4KIPA 4NUSA 4NIFA 4KRCA 4U9AA 5CQWA 2FYSA 3UODA 4DGGA 3MESA 1QL6A 2A27A 2AYPA 3H30A 1ZZLA 5DI1A 3GVUA 3P7BA 4AWIA 2WQNA 4DFBA 1J3HA 4I0RA 2ZDTA 4TRLA 5EDQA 3O8TA 2XNEA 2XIXA 4G6LA 3BGZA 4JR3A 2YEXA 4QOXA 5LMBA 2JKQA 4FNZA 4HGEA 3G5DA 3QD2B 1Q61A 4GT4A 4GW8A 2R7BA 1OKVA 4HPTE 4TKSA 4U42A 4F7NA 4Q9ZA 3BEGA 2CNUA 2C6EA 5A4CA 5FTGA 1QPDA 1FGIA 2J0KA 4J8MA 4RX7A 4BKYA 2ZVAA 4C2VA 4FEUA 4G17A 5A9UA 1T45A 4ZTQA 2B7AA 3AG9A 3QTUA 3SD0A 5CXHA 4RX5A 3AGMA 3LW0A 3PPJA 4C0TA 4E5BA 2YWPA 3Q52A 4WG4A 2EVAA 3RK9A 3CY2A 4NJDA 1YVJA 1OPKA 2H34A 4O7SA 4JDKA 5EHLA 2C5NA 4QMYA 3W10A 4KIKB 4AAAA 5ETCA 4ARKA 4EC9A 4TL0A 4IIRA 2ITPA 4UWYA 3GCUA 4AQCA 5CVHA 1QMZA 3LQ5A 3FI2A 3NUYA 2F2CB 2WU7A 3TZ7A 5KMLA 2PZYA 3L1SA 4IM2A 4N70A 2YA9A 4DCEA 4NM3A 3TZ9A 4MKCA 3DK6A 4V04A 5AV2A 1P14A 1XO2B 4QP8A 3FC2A 3DKFA 3RZFA 3SC1A 4V0GB 4IVAA 4QQJA 2PMLX 2QI8A 3ALNA 3H10A 4OTRA 2EXEA 5FGKA 4G3DA 1JWHA 4NYEA 4XRLA 3F61A 3SAYA 5A6NA 3GU5A 1Q8UA 4GIHA 5M07A 3LE6A 4JDHA 3A7IA 2CN8A 4EJNA 1Z57A 5IA1A 5IH6A 3N4TA 4IAKA 2VO7A 3DDPA 2ITZA 2ITYA 4X7QA 5IQAA 4QTCA 2DQ7X 4AU8A 4CV9A 3S0OA 4K9YA 2G9XA 2ZV9A 3H4JA 2GNGA 2R3HA 4FTTA 4IH8A 4M84A 4YLLA 2WMUA 1G8AA 2PUNA 2YAKA 5EI6A 5AR3A 5E92A 4V01A 4BCGA 3D7ZA 4S30A 3UTOA 4KIQA 1YHSA 2UUEA 3HMIA 5AP4A 4O1OA 5ETFA 3RCJA 4HVDA 1KUTA 3CTJA 3P0MA 4JBPA 2GQSA 2C5XA 2VX0A 3TNHA 3PDTA 1XHAA 5GZAA 3BGPA 4RIYA 4DN5A 2C0TA 3VRZA 3GFWA 4BBEA 3NEWA 4RG0A 4HNIA 4XP2A 4ERKA 2QC6A 4R7IA 2I1MA 3FL4A 4RC4A 4DC2A 4O38A 3C0IA 4QMQA 4JG7A 3FAAA 2ITQA 2GTNA 4NFNA 5HLPA 3KREA 5DHJA 2W99B 3FZRA 4V05A 1IR3A 4CLJA 4D2WA 5T68A 3OEZA 4KS8A 2R3OA 3EQHA 3TEIA 4LUDA 3I0QA 1WBPA 4QNYA 3EMGA 5CF8A 1SVGA 5L2TA 5AV4A 3LCOA 5ANGA 4IB3A 2QHMA 4F9WA 1OUKA 2UZDA 4BB4A 3G15A 1ZAOA 3EFJA 3ELJA 4R8QA 4XG9A 4D5HA 2C3KA 1IAJA 4DTKA 4X3FB 4B9DA 3CD8A 3E64A 3PYYA 3EL8A 4GL9A 5AP7A 3WZDA 4O7WA 3LXKA 5CZHA 5HCZA 3ZRMA 1G3NA 4OR5A 3QGWA 4ERWA 3I1AA 4J8NA 2XYNA 4WG3A 2UVXA 3PXZA 4FODA 3ZCLA 4AA5A 4ACGA 3TJDA 4DFNA 2V7AA 4QP2A 5IUGA 3N4VA 2XS0A 4FEQA 1H0VA 4O0XA 5DMZA 2XK4A 4AZTA 2R0UA 3BX5A 3GC9A 1OM1A 1GJOA 3O51A 2OJFE 5D11A 1I09A 1M2PA 2OZAA 1ZYDA 5KZIA 3P86A 4AE6A 4CQGA 3RJCA 4HW7A 3ZXZA 3LQ3A 3BE9A 4NKAA 1ZYCA 3PIYA 2J0IA 4JBQA 1URWA 2BDWA 3CQEA 2I0VA 3ITZA 4FZFB 4FV4A 4QRCA 3MGYA 4LL5A 3NYOA 3ULZA 3W2RA 4O2PA 3K3JA 5E90A 3WF5A 3ZS5A 5B2MA 3O7LD 3HP5A 3QRUA 2C5VA 4FSZA 3R2YA 3HP2A 5AMNA 3TUDA 4J97A 5KO1A 2WHBA 3Q60A 4LOQA 4WNPA 2W1GA 4K33A 4XG2A 3K3IA 3R8PA 4UMRA 3WZEA 4GG7A 4NH1A 2XK3A 3CD3A 4JJRA 3WYXA 5IUHA 4BTFA 4XG4A 3AC2A 4E4LA 3QA8A 3PPZA 4BCFA 2BKZA 3BU3A 3FLNC 2RFDA 1JAMA 3P79A 2HZ4A 4XMOA 1ZYJA 2C1AA 4AOIA 5HQ0A 2H9VA 4J71A 4JQ8A 1XH6A 1UNLA 4U8ZA 1J7IA 4IJ9A 5JKGA 4RQVA 3ERKA 4C57A 4ZSLA 5BVKA 2PSQA 4A06A 3L8PA 3DLSA 4CFMA 4ORKA 4FIFA 3KULA 4UMUA 4GG5A 5KMNA 5AEPA 3MJ1A 3NWWA 2R3PA 2VTRA 2H96A 4LGHA 1W0XC 3MJ2A 1OPLA 4LI5A 4FTCA 4M14A 4Q5HA 4XG8A 1Q8YA 5BUEA 4BKZA 3FLQA 4E4NA 4BRXA 4Z16A 3RM6A 1AQ1A 1E9HA 2RSVA 2XF0A 3GEQA 3IW6A 3QWJA 3IW8A 4M0ZA 4PMSA 2ERZE 4ENYA 4DGMA 3AMBA 4LGDA 3NW5A 2X2MA 4QTBA 4RIWA 5AUXA 3NUPA 5HO6A 1Q3DA 4DH1A 2QO7A 4RIXA 3COHA 4TT7A 3SW7A 3FMDA 2B0QA 4YO4A 3D14A 5HORA 4U3YA 4BCQA 5HU9A 4MXAA 4QYGA 2R3JA 2OF2A 5TKDA 3UZPA 3GCQA 3GNIB 3C50A 4LRJA 3WBLA 2PVFA 3COKA 3C13A 4WIHA 3B2TA 4ZK5A 5CEMA 4RIYB 3R73A 2VO0A 1KWPA 3R2BA 4XBUA 1WCCA 4ZJIA 2BPMA 1Y6BA 2ACXA 5I4NA 2G01A 3R9NA 4ACMA 3D2IA 3KU2A 3MI9A 3QKKA 3RAWA 4WUNA 3QRJA 4TY1A 4ITIA 3RM7A 4EZ7A 5IQDA 3TZ8A 4MXYA 4AE9A 2VWIA 4OT6A 3ZZEA 5D7VA 5KX8A 2OZOA 3V5LA 4FG7A 2VWXA 4I20A 4LRMA 3H9RA 4U0IA 2JDVA 1Z5MA 5DR2A 4KUJA 3WF6A 3FLZA 3QZIA 3V51A 4C35A 2QOHA 3ATSA 4CG8A 5BYZA 4ANLA 2B9FA 4DINA 2WKMA 5F20A 3PJ8A 5AAFA 3AOXA 3AC3A 2R3NA 3I4BA 3R6XA 2Y6OA 5CVGA 3N51A 4WNKA 4APPA 3GU6A 5AR4A 2YJSA 4EL9A 3I5ZA 2GU8A 4YJQA 3WZJA 4I0TA 3CKWA 4AW1A 2FSTX 4IZ7A 1H25A 4OBOA 4LGGA 2C47A 3DKOA 4WHZA 1XBCA 2YCQA 4FTQA 2HELA 1H1RA 2OZAB 1Q4LA 3BE2A 4Y5QA 5H8BA 4W9WA 4FIJA 4GKHA 5J87A 3NW6A 3QTRA 5F1ZA 4L01A 2X6EA 5H8GA 5HG7A 2J7TA 4UN0C 3HZTA 3DBQA 5ACKA 2JKKA 5AJQA 2WNTA 4ANSA 5KHWA 2X81A 3VUTA 3RK7A 2NNWB 4O6EA 3DBEA 4ALWA 2WMRA 3LHJA 3AD6A 4QMVA 4H05A 1M2QA 3Q9XA 1A9UA 1PXLA 3KXZA 4D2TA 4F9YA 1KE8A 4O83A 4MK0A 3NRMA 4PL5A 3NUNA 4OGRA 4L9IA 2BTSA 3MFTA 3OMVA 4IAFA 4KINA 1YXXA 5CU4A 1JSUA 4F4PA 4AN2A 4CV8A 4YSMA 5BUIA 1AGWA 4CXAA 4CTCA 3IW5A 3RALA 3PXFA 2KTYA 2PZPA 1H1PA 3QC9A 3ZO4A 2QU5A 4N57A 4ALVA 3DK7A 5EK7A 1FPUA 5HE0A 4G16A 4AFJA 3G0EA 4JIKA 2OFVA 3BKBA 3ZXTA 4MXOA 2B9HA 3NUXA 1JNKA 3PVGA 3VS0A 3FZTA 3PY3A 4LV5A 4NCTC 1Q24A 4S2ZA 4XV1A 5HG8A 3TZMA 2PZ5A 4FR4A 1B39A 2BHHA 5CZIA 4TYHA 3BQRA 3PXKA 5M4UA 3V5WA 3TIYA 4FTUA 1UKIA 4UALA 5M57A 4ZLOA 3HV4A 1IEPA 4EK8A 2UW9A 1W7HA 3W2PA 4J53A 4F0GA 2XIRA 5CEKA 3L8SA 5FP6A 3UP2A 4C4HA 1QPCA 3OXTA 5BMSA 3UNJA 2QOOA 4XOYA 5L8KA 4FTLA 5I9VA 4CKJA 4JL9A 2CGVA 3E88A 4QPMA 4ONAA 4TPTA 3FEGA 2OJIA 1UNGA 4IAYA 3VN9A 4C3RA 5J1VA 2NRUA 4F63A 4MYGA 3SXRA 4EOKA 3ORXA 1MRUA 3AT3A 4FV7A 4AA0A 3EOCA 3NVMB 3ANQA 4I41A 3UMWA 4G34A 1ZLTA 3L8XA 3QBNA 2AC5A 2QU6A 3FE3A 5AP1A 3HDMA 3HV7A 3LMIA 2PE0A 4MWHA 3GBZA 4RT7A 5CANA 3DY7A 4EOIA 4U97A 2X8DA 3QTQA 3GOKA 4KS7A 2ERKA 4X0MA 5D10A 4O0WA 3FXZA 2WMSA 2RG5A 4AXAA 5IQIA 2GS2A 4GFGA 2XIZA 5JRQA 3THBA 2FSMX 3VW6A 3DQWA 5K0KA 4QMPA 3QUDA 1AD5A 3PRIA 4FG8A 1JKSA 1IASA 3ZONA 2IW6A 2SRCA 2XM8A 4DFXE 3ATTA 1H28A 3CSVA 4MD7E 2VWBA 4L8MA 3FKOA 5CS6A 2IJMA 4JX7A 2R2PA 3ORTA 2C69A 5AIKA 2XNMA 2XYUA 4G3FA 2R3KA 3U8WA 4D4YA 5IMXA 3QXOA 4JX3A 3ZFXA 1K3AA 4H58A 5F9EA 4D1SA 2YDIA 4GRBA 3QZGA 2BMCA 4L3LA 2X8EA 3BEAA 4FF8A 1YHVA 3QC4A 5ETAA 3QQHA 1KE6A 3KMUA 4EH2A 2GHLA 4TYIA 3GB2A 3CGFA 3DK3A 3FMNA 4HJOA 4FKLA 4K18A 3GU7A 5EM5A 4DYMA 3L9PA 4BYJA 4JT3A 4APCA 5EKNA 2IN6A 1TQMA 2WAJA 4I5MA 4YPSA 3WIKA 5HCXA 2UW8A 5JEBA 1T46A 2WMQA 3LM5A 1EH4A 3N9XA 3Q96A 1OL2A 4IE9A 4X3JA 4D55A 5J7HA 4W8EA 3F7ZA 4D9UA 4JOAA 1OZ1A 2IVVA 5LQFA 1RJBA 3R22A 4E93A 3MBLA 3V3VA 4NM7A 3KXGA 3OD6X 2PHKA 3CCNA 2QVSE 2V55A 4FX3A 4I4FA 5AUZA 4ZP5A 4U40A 2QLUA 4CFFA 5CY3A 4A9YA 5HX6A 5KHXA 1JPAA 4MNEB 5AUTA 2OXXA 2OKRA 4I24A 4L67A 1LPUA 4M66A 3RGFA 5KMIA 1GAGA 4G9RA 4FKWA 2X4ZA 4KNBA 2VO3A 4E1ZA 4IVBA 3Q9WA 5J8IA 5IF1A 3KMWA 1HOWA 1XBAA 1PY5A 3F2AA 4GKIA 2OWBA 3QTZA 3MS9A 4HGTA 3EN6A 4BYIA 4LG4A 2JDRA 3DQXA 3RPVA 5I9XA 2UZNA 2ZV2A 3OFMA 2Q0NA 4ZTLA 5CQUA 4DGLC 2V5QA 4X6QC 3VF9A 1UV5A 3KMMA 5DNRA 5IG1A 3KA0A 3ZDUA 2EB3A 1J91A 3D7TB 4E3CA 5L8JA 4DBNA 4FSTA 5IU2A 4NM0A 5C4LA 2VWUA 1OECA 3P08A 3B2WA 3C4EA 1U5QA 4AA4A 5E9EA 3DGKA 4MX9A 2OIDA 4IB5A 5I9YA 1DI8A 1LR4A 1TKIA 2BIKB 3A8WA 2GS6A 2PZIA 4GT3A 3V6SA 4IBMA 3OHTA 3RCDA 2FO0A 4U6RA 4BI2A 5ETIA 3IPHA 4AZEA 2PUPA 4DFUA 4UYNA 3NUSA 3R9RA 2VTAA 3KRJA 5D1JA 1QCFA 3C7QA 1XJDA 3FPQA 3KK9A 4CEGA 5LVMA 4R5SA 4BDIA 1JQHA 4ZXTA 2X2KA 3D5VA 4QPSA 5I9ZA 2X7FA 2BALA 3F82A 3KCKA 3ACKA 2PVLA 3K5UA 1YHWA 4L45A 1WFCA 3KGAA 4CZYB 5K3YA 5FM2A 3HECA 3MVMA 5LMAA 3NPCA 3RK5A 3GENA 3PSCA 3QRIA 2XM9A 5AUUA 4IC7A 5LJJA 2FVDA 3EN7A 2VNYA 3Q6UA 3TUBA 4CTBA 2F49A 3LMHA 4PRJA 4DGNA 2QHNA 4ZTMA 3KRLA 2UVZA 4USEA 3LFCA 4ZLYA 1V1KA 3TNWA 3QCYA 4MEDA 4DG2E 4KBCA 4CFWA 2WPAA 4QMNA 4YURA 5KKRB 4MF1A 4PDYA 4DCAA 1FQ1B 2B53A 2OF4A 5JZNA 3A60A 3WZKA 2O5KA 3L9NA 2PE1A 3WARA 5DH3A 2UVYA 4DEIA 2BVAA 1BI7A 3UDBA 4W4WA 4CCUA 2G2IA 4H3BA 3UZRA 1OIUA 5C4KA 5CWZA 4ZTRA 4FBXA 3C5IA 3CPCA 4AN9A 3OBJA 3LXNA 4FKGA 4YC3A 5DG5A 4KIKA 3R8ZA 5CAQA 1YOJA 4N4SA 2PZRA 4JG6A 3F5XA 4RWLA 4KA3A 3QFVA 4KBAA 4XBRA 5FD2A 3DU8A 5IQGA 3EL7A 3A4PA 1JOWB 4JAJA 2XNOA 2J90A 3NS9A 1ZYLA 2VAGA 3OOGA 4F9BA 4HVSA 1NA7A 3E8CA 1K2PA 3V8WA 4TXCA 4BI0A 3BELA 3MVJA 1YXUA 4JQEA 3C4WA 3MW1A 4NZWB 2J0MB 4PPBA 3OT3A 3UYTA 4H39A 4E5WA 3OWJA 5GJFA 5GIOE 3QGYA 2GCDA 3JVSA 3EN9A 5AR2A 5IH5A 4V0GA 4EK4A 2Z2WA 3QUPA 2C3JA 4FKTA 3NMUF 3PJ2A 1CKPA 3LFSA 4AZFA 4O86A 2C0IA 4F6SA 3FMMA 5AP2A 4L46A 3EQCA 3IDCA 1W8CA 2XK9A 2XZSA 3PVBA 1OIYA 2BDFA 3KN5A 3SHEA 2CKPA 5CT0A 1LEWA 2R3LA 4LQMA 5JMSA 1VYWA 4BFMA 2IVUA 4DGOA 3QTIA 4JXFA 1VYZA 3VS2A 3KRRA 4P5ZA 2X8IA 5I3OA 4JLCA 4RJ6A 1X8BA 1NVRA 4MH7A 4QNAA 3K5VA 5CVFA 4NU1A 3AT4A 3DKCA 3HV3A 4IWPA 4GVAA 1W98A 2GNFA 3ORLA 4PY1A 4YC6A 2ETRA 3LJ1A 3G90X 4HGLA 3ORKA 1PMVA 4CNHA 1A06A 3U4UA 2YAAA 5LWMA 2IW9A 3ZSGA 2BRBA 3ET7A 1VZOA 3WIGA 4ITJA 4FTRA 5HEZA 1ZXEA 1DI9A 4GFOA 4IWOA 1YI3A 1PXIA 3F5GA 3ORNA 2VWYA 5CI6A 2ZMCA 5A14A 3T3VA 3W16A 1Y8GA 4YZBA 4FUXA 1KSWA 2IZTA 3I7BA 2NPQA 2LGCA 5AUYA 3RBWA 3MDYA 3RAHA 2WOUA 4EHGA 2BILB 3DXNA 3QCQA 1ZWSA 5F94A 4FZ7A 4D2VA 3OW3A 3FDNA 4HVHA 4OTQA 4YSJA 4O7RA 4QMWA 5FP5A 4XHKB 4AZVA 4EWHA 3A4OX 4O7VA 4CFNA 2R3QA 3NLBA 4ZSGA 3MSSA 4PP7A 3SXSA 2E9NA 1J1CA 2J4ZA 4RLKA 4EQMA 2PE2A 1PYEA 2OK1A 5IEXA 1SVEA 3E92A 3QL8A 5AAGA 2G15A 2HWPA 2XA4A 1H01A 1YRPA 4K1BA 4Y95A 4RLLA 3MTLA 1GZNA 3F9NA 4AX8A 1TVOA 2QQ7A 4X3FA 3TDVA 4CMOA 2QO9A 4IZYA 5I9UA 1JVPP 3OTVA 4F9CA 3ANRA 1YXVA 3KL8A 3O23A 4HCTA 3GC7A 3KF4A 2HAKA 3DNDA 4S34A 3WE4A 2XJ1A 4L7FA 4F6WA 4Y83A 4O7ZA 4DTBA 3GC8A 3AGLA 4W4YA 1BL7A 3NZ0A 4BBFA 1M14A 5E8TA 4IAAA 3ODZX 3Q9ZA 1DAWA 4FT5A 1F5QA 1GZKA 4FV2A 3IOKA 4RVMA 2XJ2A 5M4FA 4DEAA 3Q04A 4BY9E 3O7LB 4L00A 4DFLA 4EJ7A 2Z7SA 4U44A 2EWAA 2PY3A 2QOQA 2W17A 3DTCA 4YTFA 3VS3A 2BROA 3LFAA 3HKOA 2PWLA 4Y72A 1LUFA 3FQEA 2BZHB 2Y7JA 1F0QA 5HO7A 4RPVA 2JKMA 3BYVA 1YDSE 5AUVA 5AX3A 2XBJA 2W1ZA 3MYGA 1O9UA 2REIA 2PVJA 2VTOA 1WVXA 4NK9A 4FEWA 3F3TA 4EH8A 4XRJA 1U59A 5E7RA 3ZLWA 1H08A 3TCPA 2PMNX 4ZSEA 4UZHA 3VQUA 5L6OA 4QMOA 2QNJA 4AT5A 4F70A 4FKSA 4ANQA 3R04A 4WRSA 2WU6A 5AA9A 1L8TA 3BYOA 4MXXA 4OTIA 3R1NA 2XCKA 1U54B 1HCKA 3IG7A 2WTJA 3MVHA 2R3RA 3DKGA 3DJ5A 3AD4A 3PTGA 4NW5A 3UG2A 4UMTA 3LZBA 2BAQA 3JUHA 4RJ8A 2F7ZE 2X2LA 1ZMWA 3LJ0A 4IM3A 4TZRA 4YHJA 2X7OA 4YTHA 5AR5A 3MY5A 4IQ6A 5CU0A 4KD1A 4OTPA 3HLLA 1SNUA 2VGPA 3COIA 3G9LX 5AM7A 1Y6AA 2W05A 2W1CA 2ITUA 4ZOGA 5AFVA 3QRTA 1OKWA 4FT7A 5ANJA 4ASXA 5HTBA 3Q32A 2WGJA 1MRVA 3C0GA 4B99A 2GQRA 2DUVA 2UZBA 5CTPA 3KRXA 1MQBA 4F64A 1WBVA 3GCVA 4LFIA 3ROCA 2Z8CA 4KAOA 4EWQA 4G9CA 2XIKA 2V62A 3SQQA 3LPBA 2WELA 1P4OA 3QQGA 4MD9E 4PP9A 5HKMA 4RVTA 4BHZA 3ZC5A 2QKRA 1FVRA 4FZAB 5FDPA 5E4HA 2JEDA 3V5TA 2F7XE 5H2UA 4YR8A 3NYXA 5L2SA 2C30A 4BZOA 2Z7QA 2AC3A 2VTLA 4X6RA 5HE2A 3QTWA 1XWSA 4M8TA 4F9AA 4TYJA 4GEOA 2OJJA 3ETAA 4FSUA 1PXMA 3R1QA 3NAXA 5KKRC 3H0ZA 2CKEA 3OROA 4GYGA 5IEYA 2X1NA 2YM7A 3U6IA 3SX9A 3OVVA 3MB7A 4ID7A 1LEZA 3O0GA 4TTHB 3EQFA 3TNQB 3FQSA 4O2ZA 4U41A 3I7CA 2W4KA 2WQOA 3VUMA 4MXZA 4C33A 5DA3A 5DRBA 4IWDA 2HZNA 2C6KA 2ZB1A 4S33A 4FSWA 4F08A 2W1HA 1YW2A 4O0VA 5JFXA 4U43A 2NRYA 5CNNA 4RFYA 4YHTA 5GHVA 2HYYA 5I3RA 3DAKA 3MB6A 4DFZE 1KOAA 2R0IA 2H6DA 5FEEA 2JGZA 3QQLA 5IQBA 4BKJA 3MH1A 3LKMA 3KF7A 4Y5HA 3ZHPC 3AC5A 3MY1A 4R6VA 4RFMA 3W2SA 3ZO3A 1G8SA 4E6CA 1OI9A 3QUEA 4G2FA 5AADA 4EYMA 4CD0A 3B8RA 2HK5A 3DOGA 4BR3A 3GU4A 4E6QA 3HNGA 3K2LA 4YHFA 4M7IA 3ZYAA 5DT0A 4B8LA 4KWPA 1RW8A 3TWJA 2JAVA 5EM8A 4AG8A 2ZMDA 4BBMA 4O0RA 2C6OA 3NCGA 4ZEGA 1OIRA 2CHLA 4QQCA 1KE7A 1OUYA 4FIHA 1KOBA 2I7QA 3O17A 1XH7A 1IG1A 2PYWA 2GSFA 2VD5A 2VTMA 4YZNA 1BX6A 3FMEA 4GK2A 1E1XA 2C6DA 5A4QA 4DBXA 3QLFA 1WBNA 3EYHA 4HOKA 4EBVA 5EW3A 3VBWA 2YM8A 4RA4A 4FSNA 2VTPA 3IONA 1Z9XA 4LRKA 2BFYA 2Y4IC 2ZJWA 4BIDA 5CAVA 1MP8A 4GV1A 4R78A 1SVHA 4PX6A 3FI8A 2IZSA 2W0JA 5KMMA 3RNYA 2OI4X 2WFYA 2VO6A 4IZAA 5ANIA 4ZY6A 2CGUA 3VNTA 2IVTA 2R7IA 2GNJA 4CGAA 3GXLA 2OSCA 3MY0A 5CEIA 3FLYA 3Q4ZA 5AAEA 3OUNB 4FTOA 4XJ0A 3ZRLA 3RWQA 5HIBA 4FE2A 4WNOA 3P78A 3UGCA 3TIZA 5CALA 3PJCA 1Q97A 4QP3A 2J2IB 2W1FA 3G9NA 3HAMA 2J50A 1ZY4A 2PVMA 1XH4A 3UPXA 5BPYA 5KUPA 5AUWA 4FTKA 2X0GA 2VWZA 5DPVA 4MHAA 2C6MA 3OS3A 4A7CA 2UZEA 3F2NA 1J7UA 5BYLA 2QOBA 5ANKA 2JBPA 3UNZA 2UW6A 1WBOA 2CCIA 1JKLA 4BTJA 3A7GA 5HE1A 2ITXA 4FKRA 4LM5A 4O6LA 4GUBA 4PDPA 5M51A 3DS6A 1JSTA 4A4XA 4EOQA 3NVKI 5H9BA 5L4QA 4OTDA 3NNXA 2OO8X 4QMTA 1G5SA 3DB8A 3MPTA 5FTQA 3GCPA 3PPKA 2YN8A 1H24A 4EZ5A 4CT1A 1S9IA 4DFYA 2B9IA 1ZMUA 2EXCX 2RFNA 1YXTA 2X7GA 3UVRA 5EG3A 1OL7A 3MIAA 2XVDA 3EYGA 3PP1A 3LFBA 3U4WA 4FKVA 3WF9A 3FMHA 5F95A 4IAZA 2VNWA 3QLGA 5CU3A 3CGOA 2X9FA 3VUHA 1MUOA 2XH5A 3E8EA 2HY0A 2YM6A 4D28A 4G6NA 4PNKA 3UQCA 2YISA 1M7QA 1O6KA 3I60A 5EW8A 3OXIA 2P2IA 3UC4A 4X2NA 1WAKA 3U51A 3FSFA 3GGFA 4PV0A 5C9CA 3C4ZA 4TNDA 4BDEA 4M3QA 2BRHA 4L42A 4Y73A 3KC3A 1L3RE 3I0OA 3S2PA 4PPAA 2IVSA 1O6LA 3GFEA 2QODA 2Q0BA 3OXZA 4CMUA 1TQPA 4AFEA 4DE4A 3RAIA 4D0WA 3R01A 4RA5A 2ZB0A 2CSNA 4BCMA 2W1DA 5FG8A 5DIAA 4YZ9A 3JR1A 5EYDA 3TKHA 1ZOHA 5IQCA 1XKKA 4YNEA 3QKLA 4NW6A 2PTKA 5DT4A 5E8YA 3V04A 3O96A 4CYIA 4D4RA 4FEVA 3A61A 3II5A 5BQ0A 2P3GX 5ACBC 2YJRA 3WILA 3QQFA 2XJ0A 2P0CA 3PXQA 4X2KA 4FSMA 5M55A 5CSXA 3FXXA 1CTPE 2OGVA 3ENMA 3R7VA 5BVNA 3GQLA 5CSVA 4XP0A 4CSVA 2YM4A 1NVSA 5I9WA 3BZ3A 5IDPA 3W1FA 5BVOA 2O2UA 5E8XA 4ZMEA 1OB3A 3LCDA 2OIQA 4LYNA 4N0SA 5J7BA 4N6YA 4IEBA 4QTDA 2HIWA 4ZZMA 4O21A 3EQIA 4CLIA 3Q4CA 2F9GA 4YMJA 4W8DA 2YDJA 2UZOA 2DYLA 3PLSA 2CN5A 3ORMA 3RINA 3W2OA 1FMKA 3LFNA 4MNEA 4E4XA 3FZSA 3HGKA 4F0IA 2VGOA 3LXLA 3QX4A 4ZTHA 4JBOA 5G1XA 3O8PA 4CVAA 2HZIA 2IWIA 4GVJA 1XBBA 2CMWA 2WMTA 3FMLA 4JRVA 3T3UA 4PNIA 4Q5EA 4IC8A 5LVLA 3V8TA 4C37A 3NUUA 2YCRA 4F1MA 5IQFA 5EQPA 3FY2A 3BLHA 1R78A 1GZOA 3DFCB 3LCKA 4O0YA 5FBNC 2QO2A 5HGIA 4BDHA 4CRSA 5LCJA 4IWQA 4YZDA 2JIVA 2YABA 3EZVA 2UZVA 5HICA 3QD0A 3VVHA 4K0YA 4YTIA 4C4IA 3D7TA 2QOKA 1Q41A 3WOWA 3HVCA 3TI1A 4EORA 5J79A 2CCHA 2J0LA 3PXRA 1RDQE 5HBJA 4C38A 1F3MC 1BL6A 5E8WA 4CKRA 4Y46A 4L3JA 2C5YA 5EW9A 4D9TA 3OCBA 2ESMA 3MVLA 5FXSA 3PVWA 3TTIA 3F2RA 2OJ9A 4ANOA 2Z60A 4RWKA 4WKQA 3VS7A 3ZRKA 1IA8A 3QYZA 2JKOA 3PWDA 3PA4A 3BHHA 5KE0A 2QR7A 3DZQA 5EH0A 4E73A 2JLDA 4NWMA 5CENA 5DE2A 3BWFA 3DFAA 5FRIA 3T8OA 5JQ8A 3TM0A 2BFXA 2VWVA 4FSQA 4KBKA 4OT5A 1Q8ZA 3EFLA 5TO8A 3A2CA 3O71A 5E91A 3VJOA 4B0GA 3CY3A 4FL3A 3TUCA 5DR9A 5DWRA 2HOGA 2Y6MA 5HI2A 5L6WL 1GIIA 2QONA 3UQFA 4FKPA 3PIXA 2ZM4A 3BYSA 4MXCA 4D2RA 3EQDA 4H3QA 2Y8OA 4UEUA 3QA0A 3O50A 4PMTA 1A48A 4C62A 2O8YA 3FSKA 4WSYA 5IKWA 3PWYA 4IACA 4LL0A 2VWWA 3PJ1A 2FSLX 3VUGA 3W18A 3E87A 3FBVA 3POZA 3UG1A 5BVFA 4F09A 3VULA 3VJNA 3DBDA 3C9WA 3SKCA 4AOTA 1M17A 4II5A 2GQGA 1XQZA 3ZSIA 3E8NA 4D0XA 5DGZA 3R30A 1STCE 3K54A 3AD5A 4U79A 4WBBB 4XV3A 1FBNA 3ULIA 2KULA 2ZOQA 2XRUA 4R7HA 5JFVA 5D12A 2R5TA 5LMKC 3A99A 3MV5A 3NYVA 4G3EA 3EB0A 2F57A 1QPJA 3BHTA 1YDRE 5BVWA 3U87A 2VX1A 3KKVA 2QG7A 4FVQA 4TN6A 2OXYA 1IAHA 1PF8A 2R9SA 3SG8A 3BHYA 1P2AA 4BCNA 3H3CA 5KMJA 2V7OA 4ZZOA 3OZ6A 5FWKK 4C02A 5CF5A 5I0BA 4TW9A 5IA2A 5HESA 3RI1A 4EOLA 4M68A 5K4JA 2B1PA 3LQ8A 3BWJA 4GU6A 4WD5A 4D2SA 4RFZA 3AT2A 4L68A 5AWMA 1H1QA 2F4JA 4XG7A 3CR0A 4A9UA 2ZV7A 1Y91A 4O22A 4EK3A 4CZUA 4GUEA 3EHAA 3OOMA 4BZDA 3BU5A 4XOZA 5HIEA 3S3IA 4M13A 5HNBA 4FL2A 4QYYA 2YIQA 3U54A 4P5QA 4ANNA 2XNBA 4BCIA 1SMHA 3MA6A 2YERA 4YU2A 5BYYA 3I81A 4FKOA 4PMMA 5CEPA 3F3WA 2WOTA 2YZAA 4O7LA 2V0DA 3C4CA 3GC0A 4TWPA 1R3CA 5B2KA 3V5PA 4F1OA 3R83A 3QTSA 2EU9A 2PUUA 3UYSA 2E9UA 2UW0A 4USFA 5DVRA 4JNWA 3E7OA 3LFQA 4FKIA 1YWVA 4CRLA 4Z9LA 4E8AA 2QOIA 4L3PA 3VAPA 2WQEA 2FGIA 2PUIA 4M0YA 5CYIA 4HYHA 3TNIA 3UZTA 1VJYA 4I22A 3BV3A 3U6JA 5EFQA 3OWLA 5EYMA 4FNXA 4R77A 1REJA 4JS8A 1SYKA 2W9ZB 5HBEA 5KNJA 5LVOA 1OBDA 4A9RA 4EKKA 3TG1A 5EQEA 3EIDA 4WBOA 4FVRA 3ZUUA 2WEVA 4E7WA 3FZOA 4FK3A 4GSBA 2UW5A 4IX6A 2BZKB 4H1JA 4JAIA 2YLEA 4QYEA 1H8FA 3U9NA 3KXHA 3S1HA 5HIDA 2B4SB 2VU3A 5HU3A 4I4EA 3R02A 3HMPA 4FTMA 4BIBA 3QZFA 3GP0A 5BUJA 3BLQA 4EHEA 3GQIA 3NAYA 4FSRA 5JZJA 3UOJA 2PU8A 4X2FA 5M4IA 4YO6A 1BI8A 2O65A 5D9HA 1I44A 4PL3A 5B2LA 5EYKA 5JGAA 4JBVA 3VBQA 2OIBA 4XG6A 4A9TA 4C4GA 1H1WA 5BVDA 5HTIA 4WNMA 1PYXA 3PVUA 4E6AA 2C6LA 2WZJA 4GK3A 4C34A 4DEBA 4L6QA 5HLNA 2OH4A 4YC8A 4L52A 3UIBA 2Y0AA 3JY9A 3OT8A 4I5PA 1H27A 4QP7A 2R3GA 2CGWA 5A3XA 2OU7A 4TYEA 5JFWA 1UU8A 2W5BA 4BL1A 4ZJJA 1YXSA 1ATPE 4QTEA 4YNOA 4DEEA 4AT4A 1UKHA 1UU9A 3HA8A 3GU8A 5TE0A 4D4SA 5EI8A 4ENXA 5CASA 4USDA 1ZMVA 3BRBA 4G3GA 2C0OA 4QD6A 4DHFA 3RNIA 2XEZA 4U80A 5J1WA 3PJ3A 5DN3A 4ZY4A 4I94A 5AR7A 3CE3A 3FUPA 4C4FA 2CGXA 4F7LA 1OBGA 4EK5A 3OC1A 4NTSA 3D2KA 3FHIA 3FC1X 3IW4A 3PG3A 4FV0A 4D1XA 4BTKA 2QCSA 3E62A 2IG7A 4CKIA 5TT7A 3B8QA 3KFAA 4L43A 2XBAA 4RGJA 5EYCA 4BZNA 2HXQA 3LFEA 3RVGA 1YQJA 2A4LA 3DT1A 1BLXA 5K4IA 4AN3A 2CLXA 3TT0A 5C8MA 3MWUA 5AP5A 4XLIA 3S4QA 4EC8A 3ZM9A 3FI3A 2UZTA 4F7JA 5AV0A 5CT7A 5M44A 2RG6A 4ZMFA 4MTAA 4I5HA 3QCSA 4RX9A 2ONLC 3QU0A 2VTNA 3CS9A 3QXPA 2Z7LA 3CLYA 2W5HA 1U54A 3BHUA 3DBCA 3NX8A 4ACDA 1BYGA 4RX8A 5AP6A 4YLJA 4C4JA 3NSZA 5IDNA 3TV6A 5L8LA 3NIEA 2J5EA 3ZLSA 4C58A 5IA3A 1UU7A 3ID6C 5HD7A 3BGQA 3M42A 4MWIA 2C4GA 2BAKA 1TQIA 2CPKE 1GIHA 1WBWA 4P2KA 1NVQA 3PY1A 3BU6A 4I21A 4NKSA 1U46A 5CSHA 3W33A 3VQHA 4EOOA 3V5QA 4DH8A 1PXJA 1UU3A 2YCFA 4GU9A 4C3PA 3BYMA 2PVRA 4BF2A 4J96A 3I79A 4ZTSA 2GNHA 3IDBA 3EFKA 3VS5A 4B7TA 2W06A 4E26A 5GIPE 4IVDA 5EI2A 5J9YA 4AP7A 2WD1A 4GIIA 5M53A 3HA6A 3RMFA 4EOMA 4O7TA 2E2BA 5E8ZA 4F0FA 1U4DA 3DA6A 4BIEA 2BAJA 5DBXA 4FV8A 4R3PA 3NNVA 2WTCA 3E3PA 3QALE 4KRDA 4DT9A 5J9ZA 1U5RA 3OF0A 3VHKA 3RPYA 2Y4IB 2X39A 4BDGA 3SG9A 2JDOA 2WQBA 4UYAA 3OUKA 4RMZA 1P4FA 3IECA 4J95A 4Z55A 2WB8A 2E9OA 3IO7A 4R3CA 2V22A 4D4VA 1B38A 4FICA 1KE5A 2JDSA 5EHOA 5T3QA 4PF4A 1W82A 4PMPA 4CCBA 3KVWA 2ETMA 4JDIA 3R9OA 4UWCA 4Y8DA 5K0XA 3IW7A 4BICA 4CFVA 2OXDA 4YP8A 3C51A 4BCPA 3SOAA 4QP1A 4EH3A 5CF6A 3F7WA 1KV1A 3BPRA 2G2HA 3W32A 2ZV8A 3C0HA 3HEGA 3Q2MA 4O27B 4RC2A 1ZOGA 2AUHA 2GPHA 3ODYX 4X2JA 3W8QA 3JXWA 4HZSA 3PZHA 5T6KA 4J1RA 4KB8A 4G5JA 1OGUA 3L9LA 2B54A 3GCSA 4OTWA 3EWHA 2A19B 4C8BA 4ACCA 4ZSAA 2XKCA 3OCSA 3AQVA 3VBXA 4BI1A 1V0BA 3UBDA 3BYUA 3EZRA 3QD3A 4EHZA 4NCTA 2FB8A 3Q5ZA 2XNPA 4NT4A 2PVNA 3PE2A 5JGBA 3ZUTA 1Q8TA 3ALOA 1YWNA 3V01A 1SZMA 4D58A 3G51A 4B6LA 5IISA 3WF8A 4O7YA 3CP9A 1H26A 3DB6A 4WSQA 3G33A 3PUPA 2CKQA 3KCFA 3VWAA 4IX5A 4IM0A 2IW8A 1JLUE 5FXQA 2UZUE 2YZLA 4BDKA 5KMOA 1WBSA 4FOCA 4OLIA 4OTFA 3C1XA 4DLIA 4ANBA 2ZM3A 3R63A 1PXKA 2Z7RA 2B55A 3A7HA 4UBAA 4FTIA 4FIGA 4BC6A 2ITTA 3OCGA 3LAUA 5CU2A 3FZ1A 3AC1A 2C1BA 3C5UA 2XRWA 3BLRA 4B4LA 3CBLA 2F2UA 3F5PA 1R0EA 3A7FA 4LV8A 3DJ6A 5GJGA 3RPRA 3TXOA 3HMMA 3SA0A 2PULA 4JI9A 4KSQA 1QPEA 2H8HA 2YIRA 2YHVA 3Q6WA 5IA0A 4K77A 1NY3A 4AW0A 5KMKA 2EXMA 5L2QA 1CKJA 2C3LA 4U5JA 5FBOA 2PK9A 3D15A 3NNWA 3Q4TA 4FYOA 5M4CA 2BZIB 3ROYA 3HRFA 4GK4A 5FQDC 4YJSA 2BDJA 2VTJA 2P4IA 5CEQA 3VBVA 4DA5A 2ZYBA 4MAOA 5C03A 4FI1A 3RHXA 2O3PA 3N4UA 2CNQA 4O1PA 3CC6A 5LMKA 2J51A 3LCTA 4JIAA 4JQ7A 3KVXA 4MCVA 1RE8A 2QOCA 3RZBA 3OY1A 3SV0A 4BCOA 3ZO2A 3CPBA 1WBTA 1ZOEA 2XIYA 3EQBA 4GJ3A 5FM3A 3TL8A 2CKOA 4LMNA 1OMWA 2WTIA 1YDTE 4FT0A 5LVNA 1GZ8A 1UNHA 2J6MA 4FNYA 3VS6A 4I23A 2R3IA 3BCEA 4EKLA 4W9XA 4K6ZA 3UO5A 5FUTA 1UWHA 1B6CB 1CM8A 3AMYA 3VO3A 2BIYA 2NP8A 4DEHA 2XEYA 3IKAA 4UB7A 3G0FA 2J5FA 5A54A 2I0EA 2OW3A 5CU6A 5EHYA 4BVUA 4UZDA 3UIMA 3Q2JA 3F3ZA 1OVEA 1R0PA 2O63A 3OCTA 5CLPA 5E8SA 3CJFA 3FHRA 3FYKX 2CNVA 2BR1A 5EOBA 3QCXA 3MPMA 4YJTA 4IADA 3MPAA 5GZ8A 4NJ3A 4FKQA 1ERKA 3JYAA 5GJDA 2HXLA 3Q9YA 3VIDA 3PIZA 5IPJA 3E63A 3R7OA 4MD8E 4PUZA 3JVRA 5AV3A 5E1SA 4I6BA 4IAIA 2VTSA 3ZTXA 3D83A 4ANMA 3F3VA 3SRVA 3DNEA 1YWRA 4PTGA 2VX3A 2VTHA 5M06A 3R71A 4KKHA 4PDOA 4U7ZA 5EDPA 2WTWA 4IVCA 1Q5KA 1YKRA 4PQNA 3VS1A 1JKKA 1Y8YA 3I6WA 1XH8A 3FL5A 3PZEA 2LAVA 3ZSHA 3ZH8A 3SGCA 3ZUVA 4GT5A 4IJPA 3MN3A 3UIXA 3QYWA 4BDJA 5A4TA 3V6RA 2GNLA 2P2HA 3Q53A 3LLAA 1M7NA 5E8VA 3UC3A 1DM2A 5JSMA 4FTJA 3OY3A 3SLSA 3OWPA 3TV4A 2QOFA 4PDSA 2BRNA 4C2WA 4EUUA 4FZDB 3D5WA 5EDRA 3M2WA 3FI4A 5DEYA 2WTKC 5HZNA 2RFEA 4QO9A 4JVGA 4ITHA 2UZLA 1E1VA 1V0PA 2CDZA 2XKEA 3MTFA 4ZS0A 4RVLA 2A1AB 3D9VA 4G31A 4YJPA 1OPJA 2YM5A 4C7TA 1S9JA 2WMVA 3ZEPA 4I92A 5HD4A 2JD5A 3DBFA 1PXNA 4W4XA 4YZMA 4DITA 5L3AA 5AV1A 4CFXA 3FJQE 1BUHA 5DR6A 3PE1A 4FEXA 4MQ2A 4ASEA 4D2PA 1KV2A 4FSYA 3KN6A 3PA5A 3H9FA 4MF0A 2R3FA 4MBLA 2OBJA 3MIYA 3D5XA 3E3BX 3KY2A 4RJ7A 3EKNA 1O6YA 4XCUA 5JH6A 3REPA 5LOHA 3BIZA 4IB1A 2HY81 5H3QA 4XS2A 3ZFMA 4XV9A 4GH2A 3FKNA 4FT9A 2XKFA 4JRNA 5K5XA 5C8NA 4RJ5A 3EQGA 3IQ7A 5FEDA 5HVKA 4NIFB 2QURA 5IEVA 4O0TA 1ND4A 4O81A 3DDQA 4BCJA 3E7VA 4IDTA 2Y4PA 2BTRA 3QTXA 4BDCA 1BKXA 1YOMA 2ZM1A 2UW4A 3ZO1A 4IHPA 2I40A 3OW4A 4F6UA 1XR1A 2UW3A 5CAPA 3GI3A 5L2WA 4EYJA 2BUJA 3CTQA 4AUAA 1MRYA 3A62A 4IDVA 4OTGA 4RZVA 4O82A 2RL5A 4UMPA 1Y57A 4M69A 4JDJA 2W4OA 1OL6A 2ONLA 2RGPA 3L9MA 2A2AA 2Q83A 1PMNA 4A07A 2OLCA 2XK6A 4TWNA 3R9DA 3W2CA 3A8XA 4HCUA 3FXWA 5LVPA 4UY9A 2YWVA 4IFCA 2NO3A 4K11A 5HE3A 3VF8A 2JITA 4FIIA 2WMXA 3EFWA 1UWJA 2XUUA 3DLZA 3MH0A 4PWNA 4RBLA 4IMYA 4FIEA 1PMUA 4DEDA 4ALUA 2ITWA 4FZ6A 4QMMA 4I1ZA 4YJVA 3RP9A 3WE8A 3KEXA 5TF9A 1OKYA 3PA3A 3ACJA 2YIXA 4J99A 1H0WA 3UVQA 1WVYA 5JK3A 5HX8A 3IGOA 4DH7A 5K5NA 5HHWA 5A46A 2J9MA 3R7GA 4RRVA 2GFSA
chains in the Genus database with same CATH superfamily
4NTTA 3OP5A 4EBWA 2O0UA 3HRCA 2PVHA 1PJKA 3HV6A 2W5AA 4OW8A 5JN2A 3JPVA 4RJ3A 3EH9A 2G2FA 3VBYA 3UPZA 3BI6A 4I5CA 3KRWA 4FC0A 1CDKA 4NFMA 3D0EA 2VUWA 4O91A 4W4VA 5D7AA 5EKOA 3SRVB 5M56A 1UVRA 2RIOA 4QQ5A 4E5AX 4FV3A 4O96A 4CZTA 2BRGA 3HAVA 4DTAA 4WUAA 3WYYA 1YI4A 2XKDA 4YZCA 4DG3E 3P1AA 1WMKA 4FTAA 3D4QA 4UXQA 4S32A 3ZEWA 2Z02A 5I5ZA 2XB7A 3EQPA 2XALA 3PFQA 2HCKA 4NSTA 2IPXA 4P90A 3NCZA 3ZOSA 4EH9A 4FUYA 4BDAA 2PVKA 3OG7A 1PRYA 5ANEA 4HNFA 4RWIA 3ZM4A 3UP7A 4D5KA 2XNNA 3RPOA 3JY0A 2EUFB 3BL7A 3LJ2A 5HBHA 5B0XA 5IA5A 2WO6A 4N6ZA 4GYIA 3HYHA 2C5OA 4S31A 2YIYA 4I3ZA 2Y9QA 4AGDA 2W96B 3QQUA 3VHEA 3R0TA 3RAKA 5DRDA 1H00A 4FGRA 2PMIA 4FV6A 2RF9A 3FKLA 2QG5A 4F99A 2GFCA 2QLQA 2W1EA 2XMYA 3OWKA 4KKGA 2UV2A 4TWCA 4C3FA 2XCHA 4Q2AA 2PPQA 4F65A 4HPUE 4EHVA 1FINA 4QMLA 4XEYA 3UJGA 3MA3A 4O84A 5M08A 3NDMA 4TWOA 4MVFA 1YOLA 1ZY5A 3OBGA 5ANDA 5E8UA 3UDZA 3BBTB 5HG5A 3DJ7A 4AF3A 4F1TA 3AXWA 4KKEA 3ENHA 2J0JA 1M52A 3C4XA 3LFFA 4LOOA 1CMKE 4HYUA 3VRYA 4FMQA 4E20A 5CX9A 5C26A 5HNIX 3HUBA 3T9IA 3F6XA 4EH6A 3R7EA 4RSSA 3R8LA 3TN8A 4DAWA 3ML1A 4ZIMA 3QQKA 4BCHA 3HV5A 2WMAA 3RKBA 3AMAA 3ZDIA 4PTCA 4M67A 2YCSA 2W9FB 5DYJA 2QOLA 3GOPA 4DLJA 5GNKA 3ORPA 3TKIA 2A0CX 3M1SA 1IA9A 2X0QA 5HOAA 3ORIA 4R1VA 4I93A 3PY0A 4LMUA 3R7IA 3ORZA 4DEGA 3TACA 3SXFA 2JC6A 4RWJA 3CTHA 4Q9SA 4LOPA 2DS1A 3IS5A 3R1SA 2VZ6A 4WG5A 5AP0A 5LARA 3QHWA 3SVVA 1SM2A 4A9SA 1OKZA 4M12A 4XUFA 5HVJA 5IQHA 3DPKA 3R21A 3FQHA 5HCYA 4M69B 4IX4A 4RC3A 4BDBA 1FVVA 1K9AA 2JFLA 3ZMMA 2FA2A 4XLVA 5JFSA 3CQWA 4I6HA 2XK7A 3ZBXA 2ITVA 2GDOA 4YGAA 1OL1A 3TJCA 4QT1A 3ZU7A 4AT3A 3Q5IA 5D41A 2QD9A 4WOVA 2GTMA 4E6DA 4NM5A 4M15A 4OTHA 4RIOA 4UXLA 5DLSA 5IZFA 4AXDA 1ZYSA 3FMKA 4G6OA 4FK6A 4OUCA 5CXZA 1H1SA 5CI7A 2OICA 2JAMA 3F66A 4B8MA 4IZ5A 4BGHA 3AC4A 3QKMA 2ZFYA 3TKUA 3POOA 4JR7A 4HZRA 3O8UA 5AR8A 5G6VA 2C3IB 4CFUA 1V0OA 2VRXA 2B9JA 2IO6A 4FV9A 4HVGA 4YLKA 4R1YA 4P7EA 4XX9A 4AZWA 2VTQA 3LOKA 2C6TA 3MFUA 4YBKA 5CSWA 1PHKA 1FOTA 4BTMA 4FA2A 2I0HA 4FT3A 4BDDA 1YI6A 2BKKA 3PXYA 3Q4UA 4Z3VA 4NEUA 5FXRA 4X3FC 5HLWA 1PKGA 4IXPA 4G1WA 3ZZWA 2WTDA 1NXKA 4O7NA 2FUMA 2VV9A 4HCVA 2GHGA 4ASDA 4AOJA 5HTCA 2WMWA 4FKJA 3KULB 1PKDA 4H3PA 3E93A 4C59A 2HW6A 5KZ0A 1ZZ2A 3L8VA 1J7LA 4BDFA 4L44A 4MBJA 3SW4A 3DAJA 2VTTA 2RFSA 4HVIA 5CAUA 3KXXA 5KBRA 3W0MA 1ZRZA 4CQEA 2WIHA 5DOSA 1Q62A 3A7JA 4WT6A 4EONA 4QPAA 5J95A 2JIIA 4AACA 4RJ4A 4EH4A 4PPCA 1FVTA 3GT8A 3UO4A 4RIWB 5BMMA 3DCVA 3T9TA 3LIJA 2CJMA 3EN5A 5KCVA 3R1YA 4EH7A 2QKWB 4KIOA 4BGGA 3TV7A 3HX4A 4RIXB 2HENA 3BV2A 3FV8A 3FWQA 3BBWA 4FYNA 4RQKA 4YPDA 3NYNA 4BCKA 5IH4A 2OJGA 3LM0A 3G2FA 1OIQA 4L53A 1WVWA 4J52A 4YJRA 3DZOA 3CJGA 5LCKA 1P5EA 3EN4A 3R00A 4A4LA 5LXMA 3QWKA 4ZAUA 4BHNA 3W8LA 4O0UA 4X21A 5CAOA 5AM6A 4ZLZA 5J5TA 4IANA 4NL0A 4U45A 5C01A 4Z7GA 4YBJA 2JBOA 3LVPA 5IMEA 3I5NA 4JG8A 3V5JA 2IZUA 5BX0A 5ANOA 1VR2A 5GZ9A 1W83A 2ITOA 2C68A 4GJ2A 4LV7A 2P55A 2W1IA 1JKTA 5HNGA 1R1WA 3QRKA 4ZJVA 4C4EA 5KBQA 4QYHA 5BNJA 4TNBA 2HWOA 4E4MA 3NGAA 4RZWA 3QZHA 4FGBA 5C27A 3U55A 2BRMA 3P4KA 4C36A 1NW1A 2I6LA 2XNGA 3RWPA 3VUDA 3R8VA 4XH6A 3UE4A 1LP4A 2E9PA 1REKA 2ITNA 4YUQA 4U81A 4AGUA 4ZSJA 2QR8A 3R8UA 1ZARA 4UX9A 2BCJA 3PSBA 2YFXA 4XYFA 5IA4A 4ZS4A 3MFRA 3F3UA 1UA2A 3VW8A 3HL7A 4UMQA 4YJNA 4OBPA 4KSPA 3P9JA 4XV2A 3UOLA 2YLFA 4PTEA 5EM7A 3RPSA 2GS7A 3FY0A 2PVYA 2ETKA 3SOCA 3DXQA 4R5YA 3G6HA 3GUBA 3NNUA 4UV0A 2IZRA 3E8DA 4AXEA 3CQUA 2O64A 3LXPA 2YM3A 4EOPA 1Q99A 1XH9A 4O0SA 3KK8A 3LLTA 2WEIA 3KIOC 4DT8A 3C4FA 4PL4A 4GMYA 3ZBFA 1NT2A 5C1QB 3PLAE 1GOLA 5H8EA 4F7SA 4OAVB 4XP3A 5CEOA 4AZSA 4FL1A 3F5UA 4U3ZA 4GS6A 4CYJA 2G1TA 2R4BA 2GMXA 3PSDA 4CT2A 3TTJA 4EI4A 2JDTA 4FNWA 1Q8WA 3PG1A 5FLFA 3P5KA 4P4CA 4DF3A 2BHEA 3ZC6A 5DEWA 4EZ3A 2B52A 4IB0A 1DS5A 2F7EE 5JT2A 3UNKA 4FKUA 2HW7A 3VUIA 4WO5A 3WZUA 4EQUA 4CG9A 3KQ7A 4K2RA 4K8AA 3P7CA 3O2MA 4QMZA 4I6QA 1GNGA 3COMA 5BVEA 4YJUA 3UO6A 3WI6A 3U6HA 1CKIA 3CIKA 4DHZA 3G6GA 4TYHB 1OITA 5DFPA 1PW2A 3FYJX 5A4LA 5AP3A 4AXFA 2EB2A 3UVPA 3QAME 4A4OA 5J5SA 3D94A 5CF4A 4FVPA 4ASZA 3NW7A 3PP0A 1Q3WA 2VN9A 1M2RA 4FTNA 1SNXA 3H0YA 3UQGA 5K9IA 1PXPA 1WZYA 5HO8A 4AW5A 4ZZNA 2PL0A 4UWBA 3UMXA 3R9HA 3LMGA 3TDWA 3HRBA 3IDPA 1JBPE 3P23A 3LCSA 5CNOA 4RVKA 2WMBA 3RTPA 4EOJA 1URCA 4XG3A 1FMOE 2W7XA 4ZY5A 4EK6A 2X6DA 3QHRA 4EUTA 4BGQA 3CXWA 1GY3A 3OTUA 4BN1A 3P7AA 5J9LA 3JS2A 4QP4A 4C61A 3NUAA 5AIRA 2NYAA 2C6IA 3IK3A 3H9OA 4X2GA 4IX3A 1J1BA 1ST4A 3PUFC 1APME 5HG9A 3VS4A 5LWNA 4TYGA 3IOPA 3HMOA 3R7YA 5DT3A 5FEQA 3QX2A 3ZFYA 4GCJA 4Y85A 3R8MA 2OG8A 2WIPA 2YITA 4WA9A 5EOLA 3I6UA 1IRKA 4DH5A 3EJ1A 4H1MA 4EEVA 4OAUC 2WTKB 4ACHA 3S95A 4KABA 3MFSA 3VUKA 2R3MA 1VLRA 1HCLA 1XH5A 1R39A 4WRGA 5TOZA 2YACA 3MH2A 3R7UA 1CSNA 2YIWA 3QQJA 4MNFA 5JRSA 4BWPA 1G8KA 3S00A 4FG9A 1JSVA 2FSOX 3VC4A 3DV3A 2YDKA 4I6FA 4EH5A 3V8SA 4AGWA 3BQCA 3UOHA 3HMNA 3SDJA 4FV5A 4EOSA 5M09A 4ZTNA 4DG0E 3PRFA 3BHVA 5AX9A 4DH3A 1H4LA 2ZAZA 5TR6A 4HYIA 3FZPA 1PMEA 2E9VA 3FMJA 4YTCA 2VTIA 2UZWE 2GNIA 3QD4A 5IUIA 2WTVA 3EQRA 3Q3BA 5FTOA 3M11A 3KB7A 4QP9A 1RQQA 4IFGA 3U9CA 4D1ZA 3DAEA 4EQCA 3IGGA 1VEBA 5AA8A 5JQ5A 3WF7A 2OFUA 4AW2A 4CMTA 3E5AA 4YJOA 3FLWA 3F88A 3D5UA 1BMKA 2RKUA 4QMUA 4R3RA 3W55A 4L7SA 5HVYA 2I0YA 3CKXA 3KXMA 3TNPC 3VBTA 2XANA 2DWBA 2HZ0A 3DTWA 4FV1A 2OH0E 4G3CA 1DAYA 4I0SA 4MBIA 3ZLXA 5L2IA 2P33A 4R7BA 5CSPA 5FDXA 4LUEA 3CEKA 3LFDA 2X4FA 2ZDUA 3R28A 4MQ1A 2R64A 3EKKA 4HYSA 1KE9A 4BWKA 2X9EA 3NIZA 4QTAA 4IW0A 3RHKA 5IQEA 3OEFX 5L6PA 4GFMA 4HGSA 3W2QA 5B7VA 3MH3A 5EQYA 2CLQA 3HDNA 3QF9A 3F69A 2WQMA 3HUCA 5C8KA 4QYFA 3DXPA 1PXOA 4G5PA 2GHMA 4M97A 4AGCA 5GINE 1OL5A 2XP2A 3FPMA 4QMSA 3NR9A 4XNEA 4QMXA 3W0SA 4QQTA 5E1EA 4H36A 1W84A 5ICPA 2FH9A 4OBQA 2XK8A 3AC8A 5A4EA 2W4JA 1MQ4A 4QDVA 3UIUA 3ZLYA 4BWXA 4Z7HA 5JGDA 3FLSA 2UW7A 2PMOX 2BZJA 2JIUA 2A98A 2WXVA 4J7BA 4J98A 1GIJA 5F4NA 1FGKA 4AS0A 4QP6A 5ITAA 1H07A 2JFMA 3UOKA 4FOBA 3KXNA 5A6OA 5EM6A 4KIPA 4NUSA 4NIFA 4KRCA 4U9AA 5CQWA 2FYSA 3UODA 4DGGA 3MESA 1QL6A 2A27A 2AYPA 3H30A 1ZZLA 5DI1A 3GVUA 3P7BA 4AWIA 2WQNA 4DFBA 1J3HA 4I0RA 2ZDTA 4TRLA 5EDQA 3O8TA 2XNEA 2XIXA 4G6LA 3BGZA 4JR3A 2YEXA 4QOXA 5LMBA 2JKQA 4FNZA 4HGEA 3G5DA 3QD2B 1Q61A 4GT4A 4GW8A 2R7BA 1OKVA 4HPTE 4TKSA 4U42A 4F7NA 4Q9ZA 3BEGA 2CNUA 2C6EA 5A4CA 5FTGA 1QPDA 1FGIA 2J0KA 4J8MA 4RX7A 4BKYA 2ZVAA 4C2VA 4FEUA 4G17A 5A9UA 1T45A 4ZTQA 2B7AA 3AG9A 3QTUA 3SD0A 5CXHA 4RX5A 3AGMA 3LW0A 3PPJA 4C0TA 4E5BA 2YWPA 3Q52A 4WG4A 2EVAA 3RK9A 3CY2A 4NJDA 1YVJA 1OPKA 2H34A 4O7SA 4JDKA 5EHLA 2C5NA 4QMYA 3W10A 4KIKB 4AAAA 5ETCA 4ARKA 4EC9A 4MUQA 4TL0A 4IIRA 2ITPA 4UWYA 3GCUA 4AQCA 5CVHA 1QMZA 3LQ5A 3FI2A 3NUYA 2F2CB 2WU7A 3TZ7A 5KMLA 2PZYA 3L1SA 4IM2A 4N70A 2YA9A 5BV3A 4DCEA 4NM3A 3TZ9A 4MKCA 3DK6A 4V04A 5AV2A 1P14A 1XO2B 4QP8A 3FC2A 3DKFA 3RZFA 3SC1A 4V0GB 4IVAA 4QQJA 2PMLX 2QI8A 3ALNA 3H10A 4OTRA 2EXEA 5FGKA 4G3DA 1JWHA 4NYEA 4XRLA 3F61A 3SAYA 5A6NA 3GU5A 1Q8UA 4GIHA 5M07A 3LE6A 4JDHA 3A7IA 2CN8A 4EJNA 1Z57A 5IA1A 5IH6A 3N4TA 4IAKA 2VO7A 3DDPA 2ITZA 2ITYA 4X7QA 5IQAA 4QTCA 2DQ7X 4AU8A 4CV9A 3S0OA 4K9YA 2G9XA 2ZV9A 3H4JA 2GNGA 2R3HA 4FTTA 4IH8A 4M84A 4YLLA 2WMUA 1G8AA 2PUNA 2YAKA 5EI6A 5AR3A 5E92A 4V01A 4BCGA 3D7ZA 4S30A 3UTOA 4KIQA 1YHSA 2UUEA 3HMIA 5AP4A 4O1OA 5ETFA 3RCJA 4HVDA 1KUTA 3CTJA 3P0MA 4JBPA 2GQSA 2C5XA 2VX0A 3TNHA 3PDTA 1XHAA 5GZAA 3BGPA 4RIYA 4DN5A 2C0TA 3VRZA 3GFWA 4BBEA 3NEWA 4RG0A 4HNIA 4XP2A 4ERKA 2QC6A 4R7IA 2I1MA 3FL4A 4RC4A 4DC2A 4O38A 3C0IA 4QMQA 4JG7A 3FAAA 2ITQA 2GTNA 4NFNA 5HLPA 3KREA 5DHJA 2W99B 3FZRA 4V05A 1IR3A 4CLJA 4D2WA 5T68A 3OEZA 4KS8A 2R3OA 3EQHA 3TEIA 4LUDA 3I0QA 1WBPA 4QNYA 3EMGA 5CF8A 1SVGA 5L2TA 5AV4A 3LCOA 5ANGA 4IB3A 2QHMA 4F9WA 1OUKA 2UZDA 4BB4A 3G15A 1ZAOA 3EFJA 3ELJA 4R8QA 4XG9A 4D5HA 1XMLA 2C3KA 1IAJA 4DTKA 4X3FB 4B9DA 3CD8A 3E64A 3PYYA 3EL8A 4GL9A 5AP7A 3WZDA 4O7WA 3LXKA 5CZHA 5HCZA 3ZRMA 1G3NA 4OR5A 3QGWA 4ERWA 3I1AA 4J8NA 2XYNA 4WG3A 2UVXA 3PXZA 4FODA 3ZCLA 4AA5A 4ACGA 3TJDA 4DFNA 2V7AA 4QP2A 5IUGA 3N4VA 2XS0A 4FEQA 1H0VA 4O0XA 5DMZA 2XK4A 4AZTA 2R0UA 3BX5A 3GC9A 1OM1A 1GJOA 3O51A 2OJFE 5D11A 1I09A 1M2PA 2OZAA 1ZYDA 5KZIA 3P86A 4AE6A 4CQGA 3RJCA 4HW7A 3ZXZA 3LQ3A 3BE9A 4NKAA 1ZYCA 3PIYA 2J0IA 4JBQA 1URWA 2BDWA 3CQEA 2I0VA 3ITZA 4FZFB 4FV4A 4QRCA 3MGYA 4LL5A 3NYOA 3ULZA 3W2RA 4O4FA 4O2PA 3K3JA 5E90A 3WF5A 3ZS5A 5B2MA 3O7LD 3HP5A 3QRUA 2C5VA 4FSZA 3R2YA 3HP2A 5AMNA 3TUDA 4J97A 5KO1A 2WHBA 3Q60A 4LOQA 4WNPA 2W1GA 4K33A 4XG2A 3K3IA 3R8PA 4UMRA 3WZEA 4GG7A 4NH1A 2XK3A 3CD3A 4DDIA 4JJRA 3WYXA 5IUHA 4BTFA 4XG4A 3AC2A 4E4LA 3QA8A 3PPZA 4BCFA 2BKZA 3BU3A 3FLNC 2RFDA 1JAMA 3P79A 2HZ4A 4XMOA 1ZYJA 2C1AA 4AOIA 5HQ0A 2H9VA 4J71A 4JQ8A 1XH6A 1UNLA 4U8ZA 1J7IA 4IJ9A 5JKGA 4RQVA 3ERKA 4C57A 4ZSLA 5BVKA 2PSQA 4A06A 3L8PA 3DLSA 4CFMA 4ORKA 4FIFA 3KULA 4UMUA 4GG5A 5KMNA 5AEPA 3MJ1A 4JMQA 3NWWA 2R3PA 2VTRA 2H96A 4LGHA 1W0XC 3MJ2A 1OPLA 4LI5A 4FTCA 4M14A 4Q5HA 4XG8A 1Q8YA 5BUEA 4BKZA 3FLQA 4E4NA 4BRXA 4Z16A 3RM6A 1AQ1A 1E9HA 2RSVA 2XF0A 3GEQA 3IW6A 3QWJA 3UDSA 3IW8A 4M0ZA 4PMSA 2ERZE 4ENYA 4DGMA 3AMBA 4LGDA 3NW5A 2X2MA 4QTBA 4RIWA 5AUXA 3NUPA 5HO6A 1Q3DA 4DH1A 2QO7A 4RIXA 3COHA 4TT7A 3SW7A 3FMDA 2B0QA 4YO4A 3D14A 5HORA 4U3YA 4BCQA 5HU9A 4MXAA 4QYGA 2R3JA 2OF2A 5TKDA 3UZPA 3GCQA 3GNIB 3C50A 4LRJA 3WBLA 2PVFA 3COKA 3C13A 4WIHA 3B2TA 4ZK5A 5CEMA 4RIYB 3R73A 2VO0A 1KWPA 3R2BA 4XBUA 1WCCA 4ZJIA 2BPMA 1Y6BA 2ACXA 5I4NA 2G01A 3R9NA 4ACMA 3D2IA 3KU2A 3MI9A 3QKKA 3RAWA 4WUNA 3QRJA 4TY1A 4ITIA 3RM7A 4EZ7A 5IQDA 3TZ8A 4MXYA 4AE9A 2VWIA 4OT6A 3ZZEA 5D7VA 5KX8A 2OZOA 3V5LA 4FG7A 2VWXA 4I20A 4LRMA 3H9RA 4U0IA 2JDVA 1Z5MA 5DR2A 4KUJA 3WF6A 3FLZA 3QZIA 3V51A 4C35A 2QOHA 3ATSA 4CG8A 5BYZA 4ANLA 2B9FA 4DINA 2WKMA 5F20A 3PJ8A 5AAFA 1W2CA 3AOXA 3AC3A 2R3NA 3I4BA 3R6XA 2Y6OA 5CVGA 3N51A 4WNKA 4APPA 3GU6A 5AR4A 2YJSA 1W2DA 3I5ZA 4EL9A 2GU8A 4YJQA 3WZJA 4I0TA 3CKWA 4AW1A 2FSTX 4IZ7A 1H25A 4OBOA 4LGGA 2C47A 3DKOA 4WHZA 1XBCA 2YCQA 4FTQA 2HELA 1H1RA 2OZAB 1Q4LA 3BE2A 4Y5QA 5H8BA 4W9WA 4FIJA 4GKHA 5J87A 3NW6A 3QTRA 5F1ZA 4L01A 2X6EA 5H8GA 5HG7A 2J7TA 4UN0C 3HZTA 3DBQA 5ACKA 2JKKA 5AJQA 2WNTA 4ANSA 5KHWA 2X81A 3VUTA 3RK7A 2NNWB 4O6EA 3DBEA 4ALWA 2WMRA 3LHJA 3AD6A 4QMVA 4H05A 1M2QA 3Q9XA 1A9UA 1PXLA 3KXZA 4D2TA 4F9YA 1KE8A 4O83A 4MK0A 3NRMA 4PL5A 3NUNA 4OGRA 4L9IA 2BTSA 3MFTA 3OMVA 4IAFA 4KINA 1YXXA 5CU4A 1JSUA 4F4PA 3W0RA 4AN2A 4CV8A 4YSMA 5BUIA 1AGWA 4CXAA 4CTCA 3IW5A 3RALA 3PXFA 2KTYA 2PZPA 1H1PA 3QC9A 3ZO4A 2QU5A 4N57A 4ALVA 3DK7A 5EK7A 1FPUA 5HE0A 4G16A 4AFJA 3G0EA 4JIKA 2OFVA 3BKBA 3ZXTA 4MXOA 2B9HA 3NUXA 1JNKA 3PVGA 3VS0A 3FZTA 3PY3A 4LV5A 4NCTC 1Q24A 4S2ZA 4XV1A 5HG8A 3TZMA 3BLAA 2PZ5A 4FR4A 1B39A 2BHHA 5CZIA 4TYHA 3BQRA 3PXKA 2IEWA 5M4UA 3V5WA 3TIYA 4FTUA 1UKIA 4UALA 5M57A 4ZLOA 3HV4A 1IEPA 4EK8A 2UW9A 1W7HA 3W2PA 4J53A 4F0GA 2XIRA 5CEKA 3L8SA 5FP6A 3UP2A 4C4HA 1QPCA 3OXTA 5BMSA 3UNJA 2QOOA 4XOYA 5L8KA 4FTLA 5I9VA 4CKJA 4JL9A 2CGVA 3E88A 4QPMA 4ONAA 4TPTA 3FEGA 2OJIA 1UNGA 4IAYA 3VN9A 4C3RA 5J1VA 2NRUA 4F63A 4MYGA 3SXRA 4EOKA 3ORXA 1MRUA 3AT3A 4FV7A 4AA0A 3EOCA 3NVMB 3ANQA 4I41A 3UMWA 4G34A 1ZLTA 3L8XA 3QBNA 2AC5A 2QU6A 3FE3A 5AP1A 3HDMA 3HV7A 3LMIA 2PE0A 4MWHA 3GBZA 4RT7A 5CANA 3DY7A 4EOIA 4U97A 2X8DA 3QTQA 3GOKA 4KS7A 2ERKA 4X0MA 5D10A 3W0QA 4O0WA 3FXZA 2WMSA 2RG5A 4AXAA 5IQIA 2GS2A 4FJVA 4GFGA 2XIZA 5JRQA 3THBA 2FSMX 3VW6A 3DQWA 5K0KA 4QMPA 3QUDA 1AD5A 3PRIA 4FG8A 1JKSA 1IASA 3ZONA 2IW6A 2SRCA 2XM8A 4DFXE 3ATTA 1H28A 3CSVA 4MD7E 2VWBA 4L8MA 3FKOA 5CS6A 2IJMA 4JX7A 2R2PA 3ORTA 2C69A 5AIKA 2XNMA 2XYUA 4G3FA 2R3KA 3U8WA 4D4YA 5IMXA 3QXOA 4JX3A 3ZFXA 1K3AA 4H58A 5F9EA 4D1SA 2YDIA 4GRBA 3QZGA 2BMCA 4L3LA 2X8EA 3BEAA 4FF8A 1YHVA 3QC4A 1ST0A 5ETAA 3QQHA 1KE6A 3KMUA 4EH2A 2GHLA 4TYIA 3GB2A 3CGFA 3DK3A 3FMNA 4HJOA 4FKLA 4K18A 3GU7A 5EM5A 4DYMA 3L9PA 4BYJA 4JT3A 2AQXA 4APCA 5EKNA 2IN6A 1TQMA 2WAJA 4I5MA 4YPSA 3WIKA 5HCXA 2UW8A 5JEBA 1T46A 2WMQA 3LM5A 1EH4A 3N9XA 3Q96A 1OL2A 4IE9A 4X3JA 4D55A 5J7HA 3NFGB 4W8EA 3F7ZA 4D9UA 4JOAA 1OZ1A 2IVVA 5LQFA 1RJBA 3R22A 4E93A 3MBLA 3V3VA 4NM7A 3KXGA 3OD6X 2PHKA 3CCNA 2QVSE 2V55A 4FX3A 4I4FA 5AUZA 4ZP5A 4U40A 2QLUA 4CFFA 5CY3A 4A9YA 5HX6A 5KHXA 1JPAA 4MNEB 5AUTA 2OXXA 2OKRA 4I24A 4L67A 1LPUA 4M66A 3RGFA 5KMIA 1GAGA 4G9RA 4FKWA 2X4ZA 4KNBA 2VO3A 4E1ZA 4IVBA 3Q9WA 5J8IA 5IF1A 3KMWA 1HOWA 1XBAA 1PY5A 3F2AA 4GKIA 1TZDA 2OWBA 3MS9A 3QTZA 4HGTA 3EN6A 4BYIA 4LG4A 2JDRA 3DQXA 3RPVA 5I9XA 2UZNA 2ZV2A 3OFMA 2Q0NA 4ZTLA 5CQUA 4DGLC 2V5QA 4X6QC 3VF9A 1UV5A 3KMMA 5DNRA 5IG1A 1G8JA 2XAOA 3KA0A 3ZDUA 2EB3A 1J91A 3D7TB 4E3CA 5L8JA 4DBNA 4FSTA 5IU2A 4NM0A 5C4LA 2VWUA 1OECA 3P08A 3B2WA 3C4EA 1U5QA 4AA4A 5E9EA 4QEBA 3DGKA 4MX9A 2OIDA 4IB5A 5I9YA 1DI8A 1LR4A 1TKIA 2BIKB 3A8WA 2GS6A 2PZIA 4GT3A 3V6SA 4IBMA 4AXCA 4F78A 3OHTA 3RCDA 2FO0A 4U6RA 4BI2A 5ETIA 3IPHA 4AZEA 2PUPA 4DFUA 4UYNA 3NUSA 3BL9A 3R9RA 2VTAA 3KRJA 5D1JA 1QCFA 3C7QA 1XJDA 3FPQA 3KK9A 4CEGA 5LVMA 4R5SA 4BDIA 1JQHA 4ZXTA 2X2KA 3D5VA 4QPSA 5I9ZA 2X7FA 2BALA 3F82A 3KCKA 3ACKA 2PVLA 3K5UA 1YHWA 4L45A 1WFCA 3KGAA 4CZYB 5K3YA 5FM2A 3HECA 3MVMA 5LMAA 3NPCA 3RK5A 3GENA 3PSCA 3QRIA 2XM9A 5AUUA 4IC7A 5LJJA 2FVDA 3EN7A 2VNYA 3Q6UA 3TUBA 4CTBA 2F49A 3LMHA 4PRJA 4DGNA 2QHNA 4ZTMA 3KRLA 2UVZA 4USEA 3LFCA 4ZLYA 1V1KA 3TNWA 3QCYA 4MEDA 3TMOA 4DG2E 4KBCA 4CFWA 2WPAA 4QMNA 4YURA 5KKRB 4MF1A 4PDYA 4DCAA 1FQ1B 2B53A 2OF4A 5JZNA 3A60A 3WZKA 2O5KA 3L9NA 2PE1A 3WARA 5DH3A 2UVYA 4DEIA 2BVAA 1BI7A 3UDBA 4W4WA 4CCUA 2G2IA 4H3BA 3UZRA 1OIUA 5C4KA 5CWZA 4ZTRA 4FBXA 3C5IA 3CPCA 4AN9A 3OBJA 3LXNA 4FKGA 4YC3A 5DG5A 4KIKA 3R8ZA 5CAQA 1YOJA 4N4SA 2PZRA 4JG6A 3F5XA 4RWLA 4KA3A 3QFVA 4KBAA 4XBRA 5FD2A 3DU8A 5IQGA 3EL7A 3A4PA 1JOWB 4JAJA 4I6LA 2XNOA 2J90A 3NS9A 1ZYLA 2VAGA 3OOGA 4F9BA 4HVSA 1NA7A 3E8CA 1K2PA 3V8WA 4TXCA 4BI0A 3BELA 3MVJA 1YXUA <