5LVLA

Human pdk1 kinase domain in complex with compound ps653 bound to the atp-binding site
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
285
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 285
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvlA01
3EIDA 3FZSA 4YSMA 2QNJA 3R0TA 4WG4A 4D2RA 2VN9A 2J90A 2BAQA 3BV2A 1KV2A 2V62A 1R3CA 5HLNA 3COHA 4BCNA 5IH4A 4R1YA 4DFBA 5TT7A 4UMPA 3QUPA 4O7YA 4AOIA 4OT6A 5HVJA 4A4XA 4ZZMA 3KXXA 1Q8YA 4QPSA 3O7LD 3O8PA 4DLIA 3LOKA 3QUEA 4CV9A 4BCFA 3R8PA 4YUQA 1R39A 4FK6A 2YJSA 4FKGA 3I0QA 4KSQA 4HNIA 5EI6A 3FYKX 2VNWA 5H3QA 4X7QA 4AF3A 2ITNA 5L8KA 4EORA 4AZSA 2CPKE 4CV8A 2Y0AA 4TY1A 2PUPA 2E9PA 3JS2A 4OBOA 1Q61A 1XBCA 5KKRB 5EYCA 3HMMA 4ITHA 3RCDA 3K3IA 3IONA 4PWNA 5CU4A 3TWJA 5GJGA 3TTJA 3IW5A 2C5YA 4C4IA 3P0MA 4QMSA 3VULA 1LEWA 2C6LA 4AQCA 4U7ZA 4TW9A 5BUEA 2PVFA 4QQCA 3FXWA 1CKIA 1W0XC 5FP6A 4FE2A 5DG5A 3NUXA 5EI2A 2J0JA 2QR8A 1H00A 2GS2A 3BBTB 3H9RA 3MPMA 3W2PA 4L3LA 4HGSA 4CEGA 5HORA 3BE2A 4H3PA 5DYJA 2P2HA 5AP0A 2R0UA 4KWPA 2EXMA 3A7JA 1QCFA 4NFMA 1H1PA 4HPTE 4YTIA 3OC1A 3W8QA 4FT7A 5AX3A 3FQSA 2XP2A 4A4LA 1KE6A 3JXWA 4BTJA 4EOJA 4WKQA 3TG1A 5EYDA 3UGCA 2IG7A 2O0UA 3ZSHA 2BRMA 1P2AA 2VO7A 5HCYA 4CFWA 4EUUA 4GUEA 3GC7A 2A2AA 4AG8A 4F0GA 3RAKA 3OCTA 4XP3A 4I5MA 2KTYA 3QCYA 4O38A 3ZUUA 5L6WL 4ALWA 3Q6WA 5JGBA 3V5WA 2GTMA 2W1DA 3OROA 2YLFA 3PIZA 1JSVA 4RWKA 4KKHA 2XEYA 4IMYA 1W7HA 2XNGA 3FHIA 2YM5A 3QRUA 4I20A 5CVFA 1YXXA 4BDAA 4C59A 3R7VA 4X2KA 1RDQE 1Y8GA 4YR8A 3EFJA 3R7YA 3VS5A 4PNKA 4C4JA 2W1HA 4RPVA 4FKTA 4WNOA 4E1ZA 5M57A 2OJGA 3PLSA 3LW0A 4AGCA 3LMIA 4FKPA 2W5BA 4USDA 3EH9A 3R1NA 4GSBA 5KE0A 5GHVA 4IB1A 1Y57A 3Q6UA 4HYSA 2WMBA 3I7BA 4K8AA 2XIRA 5HBEA 5TF9A 5C01A 1O6LA 4QO9A 4UX9A 4EOPA 3IW7A 4NJ3A 4EYJA 2UZEA 5ANEA 5LWMA 4LL0A 3KMWA 5AFVA 2PZRA 4Q5EA 4UBAA 5ETCA 3BV3A 2C6MA 2XK4A 4N6ZA 3ULZA 4BVUA 2BAJA 4J99A 1F5QA 4JS8A 3DQXA 3R30A 3RAWA 4D58A 3F9NA 2UZDA 2XNBA 3DK6A 3HYHA 3KXNA 2OXXA 2GQGA 4KRDA 3HV3A 4IBMA 4NIFA 1PY5A 2A1AB 4AT4A 3DNEA 2OWBA 2C4GA 1WVYA 2BRNA 2V0DA 5HD4A 5E9EA 4BBFA 4OTWA 3TT0A 2WXVA 3C4CA 2ZMCA 4Z3VA 1H28A 3PJ3A 4G34A 3KF4A 1PXJA 4CVAA 2RF9A 5DR6A 2WMXA 4J95A 1Q8TA 2E9OA 3ORXA 3I6WA 5AAGA 1L8TA 3S4QA 3SC1A 5HU9A 3PSDA 3R7OA 3ZHPC 4EQMA 1IRKA 1KE5A 4LFIA 3HMPA 2VWYA 3GCUA 3OW4A 4X2FA 4O7WA 3IOKA 5FUTA 5GZ8A 3S2PA 4PTGA 3KF7A 4DFXE 5CLPA 2WZJA 3OOMA 2J2IB 4GIHA 4D9UA 4MK0A 4BDGA 3JR1A 3ORLA 4I4FA 4EH5A 4Z7GA 4EI4A 1ZOEA 3GVUA 4IIRA 4C2VA 4U97A 3NGAA 3IK3A 4ZXTA 1U5RA 5J79A 2J51A 4E6DA 3UOKA 3V3VA 2WTIA 4S33A 3VS2A 3EL8A 3JPVA 3ITZA 3OVVA 3TL8A 2VUWA 4FV1A 1Z57A 3QXOA 2V7OA 5CXHA 1OPJA 2JAVA 5D12A 3V51A 4O96A 4YZDA 3B8RA 1STCE 3QTQA 4CCBA 4DFLA 2VWBA 4RJ3A 4KIOA 3QTZA 1YOJA 2G2HA 4JAIA 5CF8A 4ERWA 4GKHA 3EQFA 2GTNA 3EQBA 3HRFA 4WBOA 4AW1A 1NXKA 2YCSA 4FIEA 1XQZA 2CCHA 1OL7A 3VUKA 4BHNA 3Q52A 3GBZA 2V5QA 1JQHA 3EB0A 4IAZA 4C35A 2PK9A 5CEPA 5IG1A 5EOLA 3HVCA 4V04A 5IDPA 1KWPA 3UNKA 3TI1A 1M7NA 4KKGA 5M44A 3WF6A 3R22A 5J8IA 4O7RA 3AOXA 3MJ2A 4JQ7A 4G5PA 3RZFA 3NYXA 4HVDA 3CS9A 1JAMA 2E9VA 4AFEA 4X2JA 4O82A 4O0SA 1OPLA 3ZXTA 1H1RA 2JFLA 2ERKA 3ATSA 1T45A 3BLQA 2ZDTA 3TKHA 5J5TA 2ITOA 3U51A 4BWKA 5HE3A 3NMUF 2Z8CA 4R6VA 5HOAA 3GCQA 1J1CA 2WQNA 2VTQA 4GFGA 4I5HA 2B9IA 1GJOA 1OGUA 3PZEA 5BVKA 2W1IA 4E8AA 3H9FA 4PL3A 5T3QA 1BKXA 2CNVA 3OCGA 3QQGA 5A4EA 5AX9A 3QD4A 4UWBA 3R8UA 4FT9A 3FLZA 3R28A 3JY0A 4LRMA 4IM2A 5GNKA 3BI6A 4MF1A 3MTLA 2OICA 3OY1A 2V55A 3M1SA 4IVCA 4TPTA 5IF1A 1ZZ2A 4ZJVA 5KNJA 3AT2A 2I40A 1RJBA 2CGVA 3OZ6A 2UZTA 5IPJA 2YM8A 4QOXA 2HW7A 5DT0A 2XKEA 2WGJA 4PMPA 3ENHA 3AD6A 2I7QA 3MVHA 4AU8A 1ZXEA 1MRUA 4CFUA 5HBHA 5ANKA 3WARA 2JDTA 3PWDA 5K0XA 2VX1A 5DRDA 2XCKA 2XH5A 4ID7A 4HCVA 4R5SA 4FSWA 3V8WA 4XG8A 4YPDA 3BU3A 4RVKA 4QMQA 4Y83A 2JBOA 4O6LA 3KU2A 2FUMA 2UW9A 4XS2A 1SVHA 2FH9A 2OFUA 3PLAE 1YOMA 3LIJA 4JVGA 1REKA 2XIYA 3QA8A 3AQVA 3RAIA 3THBA 4NU1A 4D5HA 4H36A 4QPAA 1XWSA 2BFXA 3G9LX 3P9JA 4GG7A 2YIRA 4HOKA 4S32A 4U3ZA 5ACBC 3DLSA 4BDJA 3GQIA 4RJ6A 3VBVA 2P55A 3BGPA 2WKMA 4FTOA 4W9WA 1MUOA 4G3DA 4FZAB 4DH8A 1E9HA 3GU4A 2RG5A 3AC1A 4DITA 4CTCA 3P86A 3F2RA 4XLIA 4RC4A 5EM5A 4F7SA 1JBPE 3NSZA 3HV4A 3MIYA 4C4EA 4F9WA 4FMQA 1YVJA 4M13A 2UW0A 3FQEA 2XK7A 3FZ1A 3QTXA 3MB6A 3F5GA 4QT1A 4LV8A 3TNPC 3BRBA 3DKCA 3TNWA 4ACHA 4Y72A 4B7TA 5A9UA 3G2FA 2Y9QA 4UN0C 5HE1A 3GU5A 2VTMA 2ZAZA 2I0HA 4DEEA 1BUHA 4N0SA 3H30A 4RWIA 1DAYA 3G51A 4YTHA 4AA0A 2WMQA 2QO7A 3PJ2A 2YFXA 3FMKA 2W5HA 1XH8A 3L8VA 5KO1A 4JBQA 4DG0E 4NUSA 3UQFA 3K3JA 4IJPA 3U4WA 4L68A 2HIWA 3KVXA 4WUAA 3R8LA 3IW8A 4CLIA 1GIJA 3CR0A 5D10A 4B99A 2QOBA 2PUIA 5CEMA 1BL7A 5KCVA 4IFGA 3Q53A 1UU9A 4B8MA 5GIOE 1OL6A 3LLTA 4AOTA 2C1BA 2XK6A 5CU0A 3UVPA 3RPSA 2R3RA 3FLWA 4EHGA 4D2SA 1OUYA 3HA6A 5IA0A 3VF9A 1GNGA 5C8KA 2ZMDA 2W4OA 4F1TA 3SD0A 5HESA 1YXUA 1E1VA 3KK8A 4NWMA 4J7BA 3LKMA 3LFBA 3OWPA 2YIXA 3PXRA 3P79A 5LCKA 4FTTA 5FDPA 3N4UA 5BVEA 2GQRA 3NW5A 5DT4A 4F9CA 4V05A 4Y8DA 5FWKK 4MHAA 4ORKA 1R1WA 5M08A 5C1QB 3OMVA 5ANDA 3QD0A 5GIPE 1CSNA 4FNZA 3OY3A 4HYUA 4C61A 2Y8OA 4QTDA 3FAAA 4RVLA 4UY9A 4JQEA 4BGQA 4F1OA 3U54A 2WU7A 5JZNA 2RL5A 3TKIA 3D7TA 4MVFA 2JDSA 2PMLX 4TYIA 4CXAA 4EH3A 3VHKA 4UV0A 4BIDA 1H4LA 2AYPA 3C0HA 2JIIA 4QRCA 4QMXA 5L2QA 1S9JA 5AP2A 2HW6A 4IB3A 2BMCA 3KQ7A 3LJ0A 3SOAA 4NL0A 3UMWA 2GNIA 4BICA 1NVSA 4ZTMA 2CN8A 5M53A 1OKVA 3T9TA 1ZARA 2PZPA 5F20A 5IEVA 3NX8A 1OIRA 2E9NA 4YBKA 3ZCLA 1EH4A 4CFNA 3MFSA 3VHEA 4FUXA 4RQKA 3DB8A 5F1ZA 1YHSA 3EOCA 2VO0A 2DS1A 5HNBA 3TEIA 2YCFA 5DT3A 4EH4A 3Q4CA 3VW8A 4BWPA 4CG9A 3ET7A 3LAUA 4FTJA 1NVQA 1U5QA 3ZDIA 3ZRLA 4F99A 1K3AA 3C13A 3F66A 4DEHA 3DDPA 4S2ZA 2VU3A 3ODYX 2OW3A 4KIPA 3MH2A 3PA5A 5CQUA 2QC6A 4UZHA 1QPDA 5AR5A 3SW7A 3DTWA 5AM7A 4L43A 3GOPA 4L67A 5A14A 4FTUA 4UYAA 2YCQA 3CQUA 3TJDA 4L6QA 4AZEA 3G6GA 2GNGA 1ZYLA 3E3PA 5E8YA 5G6VA 3ZXZA 3QD2B 3MPTA 2PZYA 3GC0A 5AWMA 3KXMA 5AIRA 2LGCA 5CTPA 3ZZWA 2WQMA 3K5VA 2J4ZA 4LRKA 4EH2A 3G15A 2FSMX 2RFDA 4JR3A 4GU9A 5CF4A 4E20A 2C30A 4TYJA 4C3FA 4BYIA 1LP4A 3O17A 3W2RA 3WZJA 2IPXA 4OBPA 3LJ1A 3RALA 1UNGA 4J97A 3D5WA 4RSSA 3TCPA 4UMRA 4M97A 3KA0A 3ZONA 3GC9A 3DTCA 4BZDA 3A4OX 3PE2A 2Z60A 4NZWB 2C6DA 3UNZA 3KCFA 3ZH8A 2C3JA 3BE9A 4A7CA 3O50A 5CAQA 2YM4A 4FSQA 1FOTA 5HG5A 1UWHA 5CX9A 5AP4A 5HIBA 3UTOA 4RFZA 3RVGA 2XNOA 1UU7A 5HQ0A 2PY3A 2B9JA 2BFYA 2OFVA 2RGPA 2XCHA 3DU8A 3I81A 5CAVA 5M56A 3LMGA 3P7BA 2ERZE 2HWOA 3D5UA 4LGGA 3HAVA 1MRVA 3BHVA 2J7TA 4RX5A 3GENA 3R01A 3RHKA 3D7TB 2F57A 3LCSA 2CNUA 2ZV9A 4EHEA 1ZYSA 2UW3A 3FI3A 2ZV2A 5IUIA 4QMZA 5C8MA 3E93A 5CALA 5EFQA 3W2CA 1R78A 2GFCA 3TV6A 3FWQA 1GZ8A 4TTHB 2IZSA 3H4JA 5EM6A 3VS4A 4QMYA 4MD9E 4ASZA 5KBRA 1JKKA 3AMBA 3ZS5A 4EHVA 4L44A 1GY3A 1JSTA 2WQBA 3A7HA 4JDIA 1R0PA 4DG2E 3QLFA 4RG0A 1WZYA 2BZJA 2VO3A 2X9EA 3VUMA 4L7SA 1G3NA 2YM6A 3DB6A 1ZYCA 3DXPA 3KFAA 3CGOA 4JDHA 1ZRZA 3F3UA 4IVAA 3RK5A 4BWXA 1IA9A 4ERKA 2P33A 3UJGA 4FEUA 4EL9A 2YWVA 3MY0A 2WEIA 4I0SA 5EKOA 4A9UA 1OM1A 3QKLA 1G5SA 3IDCA 3DCVA 5AP6A 5HD7A 3PA4A 3NUPA 4IZYA 4L7FA 4JT3A 4FODA 5L3AA 3BBWA 4DBXA 2BCJA 3D5VA 3NDMA 3R1YA 3C5UA 3R04A 4FKVA 4IVBA 4KBCA 1APME 4FTMA 3BKBA 4BL1A 2O63A 3MBLA 4C38A 4USEA 4JRNA 2CGXA 4CQGA 2R7IA 3TIZA 2IJMA 5BUJA 5AUZA 3UIBA 5K5XA 5HLWA 5IH6A 2WMSA 2I0YA 1J7UA 3T3VA 3Q32A 5AR4A 5BUIA 3VBTA 2CGWA 1OIYA 3ALOA 2XVDA 3AMYA 4PDOA 3GFEA 5FQDC 4E6QA 1IASA 3KB7A 3Q3BA 4NKSA 3OBGA 2QODA 2J0LA 3SKCA 4DGOA 3LZBA 2ZB0A 4DEGA 5I9UA 2R3GA 3I60A 3P08A 2XM9A 4IFCA 5CF6A 2PVNA 3BGQA 4RZVA 3OT8A 4RBLA 5DIAA 2VWXA 4XG2A 4NM3A 3G33A 3TNHA 2IWIA 3UODA 2W5AA 4GRBA 4H1JA 3R8ZA 3LM5A 2R3FA 2UZLA 2PE1A 4OTPA 2VWZA 4PY1A 5D7VA 3C0IA 5CNOA 3PZHA 4IWOA 4WIHA 2EVAA 2GHGA 4CFXA 4O7VA 2NNWB 4AA4A 4I21A 4U3YA 5IU2A 4MQ2A 3ODZX 2G9XA 3C4ZA 3UQCA 4JG6A 1L3RE 1MP8A 2X2LA 4QP7A 3REPA 2VTPA 1SYKA 5I4NA 3UP2A 1PW2A 4NCTC 4WA9A 4FSNA 4ZY6A 2ZM1A 3EJ1A 4MH7A 2VTRA 2XS0A 4FSRA 4KRCA 4IDTA 4PPCA 5HLPA 4L00A 3UYSA 5AA9A 5IISA 5E90A 2IW8A 4HW7A 3S95A 4CMOA 4WOVA 4XCUA 5CEOA 3G90X 3HL7A 4MAOA 3GGFA 1XBAA 4MF0A 3UO4A 3UO6A 1JPAA 5K0KA 2J5FA 5EOBA 1XH9A 2BILB 3COIA 3KRRA 4PUZA 5ETFA 3R9DA 1XH7A 4QQ5A 4FSTA 2WFYA 4J96A 1M2PA 3WF5A 3H10A 5DRBA 4EEVA 1J1BA 3L8PA 3RK9A 3GU7A 4TWCA 1PYEA 3K2LA 4QYHA 3PY0A 4C02A 2PZ5A 3VS3A 2V7AA 4FV3A 1CKJA 3QWKA 3DBQA 3KK9A 4QMLA 3CJGA 4OLIA 3NNWA 3DBDA 2Y4IC 1FMKA 2GNJA 3VWAA 2OXYA 3CQWA 4BIEA 1SMHA 4CFVA 2QOLA 4JDJA 3C50A 2OZAA 2H9VA 4IM3A 3RNYA 3FI2A 5F94A 3UO5A 2IO6A 4ONAA 4TYHA 2X7GA 4BIBA 1YDTE 1ZLTA 1IEPA 2QOKA 4YJVA 4KS8A 2WOUA 3BWFA 3ZFMA 4E26A 4D4SA 5L2TA 2YAKA 4CMTA 2IZTA 4CZYB 1OMWA 2E9UA 3QWJA 4H3BA 3C0GA 5H9BA 3TTIA 3UC4A 3WZDA 3PPJA 1CM8A 3FLNC 4J53A 2Y6OA 5IEYA 2CDZA 5HG8A 4B4LA 1TQIA 2JKOA 1O6KA 2W7XA 4QTAA 1KSWA 2JDVA 5A3XA 5TR6A 4LOQA 3RBWA 3EYHA 5LMKA 5CENA 4YJUA 4G3CA 1Q41A 4H39A 4TZRA 4ANBA 3U6IA 1O9UA 2BIYA 4TN6A 4DINA 2WTWA 1PXLA 4GJ2A 1KE7A 3KGAA 4A07A 4FVRA 4IC8A 2HZIA 2YIWA 1YXSA 3VS0A 5BVDA 3VBYA 3DQWA 1YW2A 2A19B 2YZLA 2OXDA 3CD8A 4W4XA 4FR4A 1REJA 3GT8A 4F6UA 4D1XA 1YRPA 3NAYA 4I23A 3QX2A 2BTSA 3TN8A 5IQBA 3PVUA 4R3CA 2OLCA 2XA4A 5A4TA 4GYGA 4L8MA 4YZ9A 4O7TA 1TVOA 3PRIA 4RWJA 1OBDA 4DHFA 5LMAA 5EHOA 3ID6C 3NVKI 3QCQA 4FYOA 3KREA 1XH5A 3PP1A 3GXLA 3I4BA 5KMOA 3N9XA 3KMUA 3FLSA 3FC2A 4EOOA 2A27A 5J1WA 2W05A 4U5JA 1PKDA 5CVHA 3F61A 3QC9A 4L42A 5HTIA 5I5ZA 3BYVA 4PQNA 4BGGA 4BGHA 2GNFA 2NP8A 4QMWA 1P4OA 5D7AA 4CG8A 3NLBA 2VTLA 3TUDA 4A9TA 4M69B 4BRXA 3MB7A 2YIYA 4IADA 2W96B 4WNPA 5D41A 5KZ0A 3W1FA 3Q96A 5AUTA 3BZ3A 1PXKA 5KMJA 4AGDA 4IQ6A 5L2WA 2WTJA 5IQFA 3GC8A 5DA3A 2VTHA 1PMUA 3FUPA 4TL0A 4XMOA 1FVRA 1QPJA 2YABA 4QMPA 3RPYA 1GIIA 2R3QA 3HGKA 4Y46A 5FG8A 2O64A 3DK7A 4MBLA 5J87A 4CKIA 4DN5A 3CBLA 3ANRA 4FL1A 4EH9A 4F64A 3QCXA 5KHXA 5CYIA 2R3MA 4IANA 4R3PA 3EQIA 4ZOGA 2CHLA 3JYAA 3D7ZA 4GFMA 4WD5A 2PUNA 3DY7A 3MY5A 2GDOA 2GMXA 1XR1A 1M14A 3OP5A 4BDCA 2CKQA 3DK3A 3EL7A 4RIXA 3D2KA 2OZAB 4PL5A 3SVVA 1NY3A 2CLXA 4JG7A 2R5TA 4TYHB 2CCIA 1H27A 3UC3A 1P4FA 2PL0A 2QHNA 4H58A 3U87A 2HY0A 5CEIA 2YDJA 4Z16A 2ITPA 4U40A 3KVWA 4WNKA 5AJQA 4EUTA 4EH7A 4FF8A 3RM7A 4EK8A 3W2OA 2ZJWA 3ALNA 4DEBA 4FTQA 4I0TA 4PMMA 2C6EA 3UPXA 2B9FA 4QPMA 1XKKA 4MXAA 3EKKA 3RINA 2NRUA 3R9RA 2XKFA 2I6LA 3BYSA 4DYMA 4YNOA 5BPYA 3D15A 3VQUA 1J3HA 4EC8A 1ERKA 1UNHA 3FSFA 1OB3A 3SOCA 3HKOA 4S34A 4GH2A 5J7HA 3B2WA 4WUNA 3PA3A 2QU6A 3CJFA 3DS6A 2OBJA 1Y6AA 4RJ5A 4D28A 2R7BA 4MD8E 5DPVA 1XHAA 2OJFE 3Q5IA 3EMGA 5HG7A 2FSTX 4N70A 3T3UA 4YU2A 5BMSA 4G5JA 3MW1A 3QQFA 4OW8A 1MQBA 4KAOA 4P5QA 4RX7A 5ETIA 3DOGA 2PMOX 5C26A 5KBQA 3Q4UA 3DFCB 1BYGA 4QMMA 1H24A 3OXIA 4C3RA 2EB2A 3BLRA 1YKRA 3E87A 4R1VA 3CC6A 5H2UA 2ETRA 2ETKA 4PV0A 4W4VA 2XK8A 4X2GA 5LARA 2PVJA 4NK9A 4YJSA 2XRUA 2I1MA 5CAPA 3Q9ZA 2UUEA 3EN5A 5CU3A 3JUHA 3VBXA 4AE6A 4BCIA 5B2LA 2X1NA 4ZZOA 5FGKA 1YWRA 1YXTA 3ZLSA 3SG9A 4F6WA 3C4XA 3R7EA 2QO9A 1OL1A 3O7LB 4Z9LA 5CEQA 3OTUA 1GZOA 1ZAOA 3I79A 2UW5A 3PTGA 3DKOA 3KN5A 1HCLA 4K18A 5IKWA 4FVQA 5DEWA 5IQHA 1YI3A 4JXFA 4Y5QA 5AAFA 2OJIA 2GNHA 3ORKA 2YIQA 5HO7A 4FSZA 2G15A 4FTRA 2HY81 4EOSA 5KMMA 2XNPA 4NT4A 1VYWA 2RFSA 5E4HA 4MXZA 1PMVA 4GCJA 5CZHA 4CKRA 2BHHA 3SAYA 4C4HA 5LVOA 3AC4A 1Q5KA 1YWNA 4FEWA 5IA3A 3PJ1A 4OGRA 5DMZA 5TOZA 4DGMA 3U55A 4AN2A 4C4FA 1ZYDA 3LXPA 2VGPA 3WE4A 1TKIA 3AGLA 2RFNA 5HCZA 3FL5A 4UMUA 3QUDA 4HNFA 1FMOE 1YXVA 4IB5A 4RIXB 2YWPA 4CRLA 4PMTA 3FSKA 2VD5A 4RRVA 4AGWA 3EQPA 3QHRA 1R0EA 2B54A 3LFDA 1QMZA 3G0EA 4IAAA 4LOOA 5DGZA 2XBJA 4C0TA 3NYVA 2Q83A 4IAIA 4MXCA 3MVMA 3VJOA 1VJYA 4UXLA 3IO7A 4CLJA 3ETAA 3BELA 1BL6A 3EQDA 4FEQA 4KB8A 4AW2A 5G1XA 4BDHA 4QP6A 2JFMA 2WTVA 3QQKA 5KZIA 5ACKA 4BTFA 3UP7A 4CQEA 1VEBA 4FTCA 5I9VA 4FT3A 4FV5A 4D1SA 1OI9A 2C5VA 2QO2A 2VWWA 3I5NA 5B2KA 1Q3DA 2W1GA 3SDJA 3HDNA 1HOWA 2VTIA 2WMUA 2JEDA 1PF8A 3HV6A 4ZK5A 5K4IA 2YACA 4CMUA 3NYOA 4OT5A 5CY3A 3V04A 3JVSA 3BHUA 4FICA 3VO3A 2F4JA 5CT7A 2YLEA 2WPAA 4JBVA 3UIUA 3IG7A 3OD6X 5HX8A 4L3JA 4FNYA 4NIFB 4PPBA 4AX8A 4IWQA 4GVJA 5E1SA 1XO2B 4QYEA 3R73A 5I0BA 4MNEA 3CKWA 3NW7A 5C27A 3FZRA 4M66A 4NYEA 4PTCA 1F0QA 2VWVA 4XV2A 4A9YA 3ZRMA 5C4LA 5FRIA 1CTPE 4FIGA 4JI9A 3BGZA 2BAKA 4L01A 3KRXA 1W8CA 4KUJA 2GHLA 1JVPP 2QOFA 5GZAA 2RG6A 5JFWA 4FKWA 2BRHA 3PXZA 3ZSGA 4W8DA 1WCCA 4FTAA 4YBJA 4BI2A 4BI1A 4ANMA 5C4KA 1H0VA 5BVWA 4W9XA 3SW4A 2HOGA 5D11A 2F7XE 3QZGA 4F4PA 3WF8A 2DYLA 4KNBA 4LG4A 4E6AA 4XG6A 3ULIA 2VX3A 4O7ZA 3OFMA 2ONLC 1DI9A 3A2CA 4P4CA 3CSVA 3NNVA 1O6YA 4B0GA 3HNGA 2UW7A 4LM5A 3NWWA 3NUSA 4AT3A 4BYJA 4GIIA 3DLZA 4AE9A 3ZTXA 3B2TA 2YZAA 1ZMUA 1BLXA 2UW6A 4BZOA 3N51A 2BZKB 1LUFA 2F49A 1GIHA 2FGIA 5JGDA 1LR4A 3EQCA 4DC2A 4C36A 2QQ7A 4O0UA 4ITJA 2XJ1A 5LVMA 3KXHA 3S0OA 3OHTA 4GJ3A 3NW6A 1DS5A 4MKCA 4PF4A 5AUYA 3PPKA 2QLUA 2FA2A 5HIDA 4H05A 1YDSE 4JX7A 2RKUA 1Z5MA 3A61A 2SRCA 2EUFB 4QTEA 3QZHA 4NTTA 1PXIA 4IX6A 4D2TA 1OECA 3F7ZA 3TACA 3MTFA 5IQIA 3COKA 1IR3A 1SNUA 2JKKA 3CPCA 4FEVA 4HGTA 4NSTA 2WMVA 5M4IA 3F5XA 3LFFA 4XG3A 2BR1A 2YJRA 5E1EA 5J9ZA 2QOIA 5AM6A 4FX3A 4OTIA 5I3RA 2WIPA 4W8EA 5JSMA 5HI2A 2HXQA 2P3GX 2VTSA 1ND4A 4DE4A 3AXWA 2XNMA 3WI6A 3Q2JA 1PYXA 2PZIA 3V8TA 5C03A 1XJDA 4ANQA 1FGIA 2C3LA 2X6EA 4WRSA 3LFNA 2CKEA 1H0WA 3QTIA 4QYFA 2BZIB 4YGAA 4F6SA 4EWHA 5M09A 1M52A 4MXOA 4K6ZA 4HJOA 3RJCA 4BCMA 4ZMEA 2Q0NA 4LV5A 3BU5A 1K2PA 5EHLA 3VS7A 4MD7E 3VRYA 5L8LA 3A60A 4LUDA 3OXTA 5HKMA 4RFMA 2FSLX 1YQJA 3ORMA 4O0TA 4ZLYA 2XYUA 4DGLC 4F0FA 3MN3A 1FVVA 2WAJA 1H1SA 4FSMA 4WHZA 2JGZA 3UVQA 2CGUA 1NA7A 1F3MC 1Q8WA 3G6HA 3V5TA 3OBJA 5EDQA 5C9CA 5AUUA 4MNEB 3F5PA 3L9NA 3F7WA 4C37A 4S30A 3MS9A 3R8MA 3W32A 3AGMA 4MWIA 4BB4A 3F3VA 3KEXA 2PU8A 3OCSA 1K9AA 2IN6A 2C68A 2WELA 3RPVA 5HVKA 3BU6A 3IDPA 4II5A 3P4KA 3R7GA 2QURA 2RIOA 2VTTA 4IZAA 4ZTLA 3F3TA 1FBNA 3FKLA 3MV5A 4JBPA 2BVAA 4QMUA 1OL2A 3ROYA 3UYTA 5A46A 1ZMWA 5AAEA 2IZUA 3PRFA 1AQ1A 3PY3A 4DT8A 5HO6A 1V0PA 4UALA 3DXQA 4E7WA 3H0ZA 2X0GA 4Q2AA 4C3PA 4Q5HA 3PXYA 5B2MA 4O2ZA 2Y4PA 4A4OA 2B9HA 3TUBA 5CU6A 4F9YA 3O8UA 4RA4A 2GQSA 4IACA 4GV1A 5HEZA 4FNWA 4YHJA 4EQUA 2ZM4A 2OI4X 4O2PA 2BIKB 3FJQE 1ZMVA 2O2UA 2OJ9A 3E63A 4P7EA 3FBVA 3GCPA 2R3NA 3CLYA 3OCBA 1KV1A 2UZNA 4ZTSA 4DCAA 2ZB1A 3L9PA 5AP5A 1PHKA 1GZKA 4YC6A 4G3GA 3TXOA 5J1VA 3VUHA 2WHBA 4FG7A 4ENXA 1ATPE 2J0KA 2R3PA 1YDRE 3L9LA 5EK7A 4O6EA 1JWHA 5JK3A 2ZOQA 3C4FA 4N6YA 4O21A 3E5AA 3DNDA 5HO8A 3VNTA 4CFMA 3QRKA 5HE0A 4PDYA 4AZVA 2F9GA 2RFEA 4YJOA 3A7IA 2Q0BA 1A9UA 4EOMA 2Z2WA 1NVRA 3VQHA 4F7JA 4DTAA 3ORNA 4AFJA 4EK4A 3OUNB 4FV9A 2XJ0A 2WO6A 3GB2A 5JEBA 3BYMA 4BTKA 2W1FA 4NM7A 1IG1A 2X81A 5EDPA 5IUGA 4BN1A 1FINA 4DG3E 1H01A 3V5LA 2EXCX 3EN9A 4MBIA 4U0IA 4E93A 2XNEA 3POOA 4WBBB 4ENYA 5JFVA 1SVEA 3BHHA 3HMNA 1I44A 3VW6A 4AW0A 5KUPA 2C6OA 4RIYA 2HELA 5A6OA 2QLQA 4FOBA 3GQLA 3V5PA 4X3FC 3LHJA 4IB0A 4FT0A 1DM2A 2BDWA 4GL9A 4E4NA 3OW3A 4OUCA 5CEKA 4RZWA 4GK4A 4GUBA 2OO8X 2WMWA 1ZOGA 3DJ5A 4ZIMA 2UVYA 2XKDA 1OUKA 4FZ7A 3ZC6A 2BRBA 4RFYA 5IQEA 1W83A 4DFNA 4FUYA 4JIAA 2UZBA 3QX4A 4E4XA 4ZZNA 4BC6A 3HMOA 3U9CA 5FXSA 4ZY4A 5M07A 1Q4LA 2AC5A 3MVLA 3QGWA 3TKUA 4BBMA 5M4UA 4TKSA 4ASEA 5BQ0A 4ZTNA 4R77A 5IQCA 4EHZA 4ARKA 4CRSA 4YJRA 5AR3A 3QZFA 4EOIA 3UZRA 3LFAA 2GFSA 1OKWA 3DGKA 3Q5ZA 4GT5A 3NVMB 5HZNA 1LPUA 3QQLA 4ZS0A 4MWHA 4DA5A 4F7LA 4YLJA 2B52A 2VTNA 4QTBA 4UWYA 5IA4A 3VUGA 3WZUA 2H34A 3CXWA 5CANA 3V5QA 4FK3A 3PG3A 4F65A 4UXQA 3BHYA 3NIZA 4Q9ZA 3M2WA 4JJRA 5E7RA 4C33A 2GSFA 3DAEA 4R7IA 4AN9A 5KMIA 3QCSA 3FXXA 3AD4A 4IDVA 1UKIA 3E64A 3BWJA 5LMBA 3MI9A 2W4JA 5CSPA 4FKQA 4PPAA 3QRIA 2C6TA 2BPMA 2J0MB 4GT4A 3ZDUA 4W4WA 3V5JA 4C57A 2FB8A 1GOLA 3LJ2A 2P2IA 4QP3A 3R9HA 4Y95A 3LM0A 4U79A 1X8BA 3HECA 4YURA 1URCA 5FLFA 4M0YA 4BCKA 2A4LA 3D9VA 3OWJA 3QTWA 1WAKA 4M84A 4OTGA 4HZSA 4O0RA 4APCA 3BYUA 3FI8A 2C1AA 4WNMA 5JKGA 3UVRA 2J6MA 4EZ3A 2J50A 2QD9A 4ZMFA 3MIAA 2BTRA 4M3QA 3WYXA 3T8OA 4IC7A 1M7QA 3E8CA 4DGNA 4M15A 4OTHA 3QGYA 3VJNA 3ZUTA 3NEWA 2ITQA 4D5KA 4AT5A 2B4SB 2FVDA 2GHMA 3V6RA 2XYNA 3R6XA 4I22A 1VR2A 4ZLOA 4XYFA 3E7VA 3E7OA 2PE0A 5JT2A 4FIFA 4I4EA 5EYMA 4UWCA 4DH7A 4RIYB 4IAKA 3E8EA 2V22A 4YC8A 5DN3A 5L2SA 2IVVA 3FV8A 1JNKA 3NUAA 4AGUA 3I0OA 1SNXA 3CPBA 3F3WA 3ORIA 4DF3A 4NFNA 2WTKC 2YDIA 3DDQA 3PE1A 2F7EE 4E73A 4EJNA 4DLJA 5IMEA 4YZBA 2VX0A 5L6PA 3U6HA 5HNIX 2C6IA 2WD1A 3PXKA 5CSHA 3SRVA 4K0YA 5FP5A 1LEZA 4DFUA 3L9MA 2X8DA 4XX9A 3R1SA 4TNBA 3KL8A 3R71A 2H96A 3E8NA 4EOKA 2JD5A 4I92A 3RNIA 5M4FA 3IDBA 2PMIA 2CNQA 3I7CA 3QTRA 5LCJA 2Y6MA 4U45A 2DUVA 1UA2A 3R63A 4CTBA 2CKPA 2O5KA 3MDYA 2VO6A 2UZUE 2Z7RA 2Z7QA 4FV0A 1URWA 3HZTA 5L4QA 2JBPA 2O65A 1Z9XA 4E4MA 1ZWSA 2J0IA 3BEGA 4YHFA 3NAXA 4ZSJA 2X4ZA 5KKRC 3TZMA 3DAJA 2IW6A 3B8QA 3PJ8A 2VTAA 3E62A 3C51A 5BYZA 1U4DA 3C9WA 4D55A 4FNXA 1BI8A 4JDKA 3TZ7A 2X6DA 4ANOA 2G2FA 1AGWA 3A99A 3S3IA 4CSVA 2OK1A 3K5UA 5AUVA 1B38A 4NM0A 2UVXA 3RWPA 1KE8A 3VRZA 5B7VA 1J7LA 3QALE 2VV9A 2WEVA 3P1AA 3CIKA 4A06A 2W0JA 4V01A 3QXPA 4IWPA 3FI4A 5ANIA 2AUHA 3HEGA 3A8WA 3ZC5A 4AN3A 1T46A 3Q4TA 4X6RA 3LQ5A 3C4EA 4K1BA 2QOCA 4NCTA 3PIXA 4C8BA 3O51A 4CD0A 2OIBA 5CSXA 1V0OA 5DI1A 5AUWA 4QMOA 2EXEA 5D9HA 3TV4A 1JLUE 5LVLA 4MXYA 3A7FA 4MBJA 3QLGA 5HE2A 4ZTHA 3BIZA 5FXQA 4FTNA 3BHTA 4GFOA 3UG2A 5AV2A 4K11A 4KINA 4DT9A 1OZ1A 2JIVA 4HCUA 4E5WA 5F9EA 3HAMA 4M67A 4O1OA 5IQGA 2ESMA 2H6DA 5L8JA 4YLLA 3FXZA 3ZO2A 2EB3A 5CS6A 3RZBA 4N57A 3MH0A 3KN6A 3HRCA 4HVGA 2HCKA 5AMNA 3O71A 1PRYA 4O0WA 4ZSAA 3CEKA 4G3FA 4OTDA 2G2IA 4TWNA 3NUYA 2OF2A 5E91A 4R78A 4AACA 3ZMMA 4UZDA 1HCKA 5CSVA 2XNNA 3MGYA 3VC4A 5F95A 2BHEA 2PPQA 1Q8UA 2GS7A 4IZ5A 4OAUC 3FQHA 2QOQA 2VTJA 4EBVA 5IA5A 2WQEA 1H1QA 3Q9XA 5HHWA 3KRLA 5HGIA 3M42A 1H25A 4FZ6A 2JLDA 5E92A 3EWHA 3SRVB 3WYYA 3DZQA 4AOJA 5LOHA 2WMRA 3DV3A 2ZV7A 4PL4A 4RVMA 2C69A 2P4IA 2R64A 3SXFA 3NYNA 5HICA 3ZLXA 4ACGA 4YTCA 2JDOA 4GEOA 4PMSA 3NS9A 4XV9A 5E8UA 3ZRKA 2YN8A 3VBWA 3QQHA 4EZ5A 5A6NA 4KBAA 3OWKA 3LCDA 3GUBA 5M06A 2WU6A 3QQJA 3KXGA 3DAKA 2XEZA 2X7OA 4KS7A 3Q04A 5M51A 1UV5A 2IVTA 1DI8A 3ZSIA 1WBSA 3QTSA 1BMKA 3WZKA 3R83A 2UVZA 5FTQA 4LUEA 3NZ0A 3Q4ZA 3ZZEA 5J9YA 4YJPA 4U41A 4JQ8A 4Q9SA 3LQ3A 2VAGA 3D4QA 1H8FA 4ZP5A 4E5AX 3ZBFA 2F2CB 3ZFXA 3ZYAA 3LCOA 2QU5A 4MCVA 5TE0A 4TYGA 5HG9A 2OZOA 5AR2A 4ALUA 3O8TA 4MEDA 2JAMA 1PXPA 4UYNA 4EKKA 3FC1X 4LRJA 4U8ZA 5E8TA 3LQ8A 4BHZA 5ICPA 3SX9A 5LJJA 4MX9A 2QKWB 5JH6A 3TDWA 2XMYA 3FY0A 3BCEA 4HGEA 1JKSA 1UNLA 4LL5A 2C6KA 2IVUA 4RC2A 5E8SA 4ZSLA 1JKTA 4HVSA 4KABA 3MESA 4FA2A 2H8HA 2PVYA 4ZLZA 3QHWA 4RVTA 5IEXA 4PDSA 3F6XA 4PP7A 2QI8A 2YITA 2YM3A 4FBXA 1H08A 4NH1A 2J9MA 3F3ZA 2G1TA 3DT1A 3ORZA 4O91A 3MFRA 4U43A 4YJNA 4I24A 2B53A 5HIEA 5IH5A 4I6QA 3G5DA 5FEEA 4OR5A 5FBNC 3OUKA 3H3CA 2ITXA 3P7CA 4J8MA 4WSYA 2NRYA 3CY2A 4PRJA 1Y91A 2R4BA 4D9TA 5I9XA 4EH8A 4XV3A 3N4TA 1WBPA 4Z55A 2F7ZE 5DBXA 5HCXA 2RSVA 3MWUA 4LGDA 3QQUA 4YHTA 3FKOA 4O81A 2OSCA 4M12A 2AC3A 2ZDUA 5FTGA 3U8WA 2Z02A 3HV7A 4QD6A 4O0VA 4RIOA 3SXRA 5CASA 3D5XA 2BZHB 2HZ4A 4BCJA 2GCDA 4ZTQA 3VVHA 3P78A 3FZTA 1W82A 4O84A 3UMXA 4R3RA 3IKAA 3DZOA 3E3BX 3PVWA 3Q9WA 2JC6A 4LGHA 3ZUVA 3FMDA 2Y4IB 2R9SA 1UU8A 2IW9A 1RE8A 2VNYA 2WNTA 4XNEA 5LXMA 3VAPA 3FPMA 2XZSA 3LXNA 3AT4A 3LVPA 4HZRA 4F0IA 3QU0A 5DEYA 4L45A 3MFTA 3QFVA 2CN5A 5AR8A 2QG7A 4USFA 4I6BA 5DVRA 4QP9A 4FT5A 2C0OA 2PTKA 2XIZA 4G17A 4ANNA 5GJFA 2ITVA 3FL4A 5I9YA 3FLQA 2P0CA 1WVXA 4IVDA 5FTOA 4A9RA 1WBNA 3UIMA 4BY9E 3TZ8A 5CXZA 3RWQA 3DBCA 4FI1A 5KHWA 3MVJA 1KOAA 1PXOA 2EWAA 3AT3A 4L3PA 1XH6A 5DH3A 3V6SA 3W2QA 4DTBA 3O2MA 2Z7LA 3UPZA 4YPSA 1ZY4A 2XJ2A 3F88A 2PYWA 4G9CA 4BTMA 2XKCA 1J91A 2OJJA 4FL2A 4AZFA 1WMKA 4D0WA 5C8NA 3V01A 5KMNA 2O3PA 5ANOA 1P5EA 3HX4A 4C62A 3R9NA 1YHWA 4QP1A 5JFSA 1UWJA 4BCQA 3R8VA 2X4FA 4YZMA 5ETAA 3OTVA 1M17A 3FHRA 3U9NA 4EWQA 3VS6A 2EU9A 4QNAA 4RGJA 3KCKA 4FYNA 4YJTA 3ZFYA 2JKMA 1QL6A 1OIQA 4I5CA 4KA3A 2W1ZA 3MJ1A 4ZJJA 3VF8A 3DJ7A 4O22A 5CU2A 4RT7A 3ZO1A 4C58A 4FTKA 4G31A 4U80A 3R2YA 4U6RA 3EN6A 3FE3A 4GMYA 1U54A 2PVRA 2HYYA 3NPCA 3WBLA 3BX5A 4YLKA 1AD5A 4QMNA 5DR2A 3S00A 1U59A 3RAHA 4TWPA 5JGAA 3SG8A 2W06A 3I6UA 4RJ4A 1MRYA 3LMHA 3N4VA 5J5SA 4APPA 5EQPA 2HZNA 1RQQA 1DAWA 2W17A 2YCRA 2X7FA 5EI8A 3GP0A 3H9OA 4D2PA 4F9AA 3IPHA 4O7SA 2FO0A 3L8SA 2WTCA 3FMJA 2IZRA 3MPAA 3KMMA 4R5YA 4GKIA 3L1SA 5I3OA 4BKZA 5AUXA 5TKDA 5KMKA 4WT6A 3FLYA 2DWBA 3DXNA 1WBWA 1PJKA 4LQMA 2PVHA 3EFKA 5EM7A 2I0EA 3DPKA 4RX8A 4ACDA 2ITZA 2X2KA 1PMEA 3I1AA 5E8ZA 4F09A 3TJCA 4LOPA 3CP9A 2WOTA 5DNRA 3R7UA 2Z7SA 5LQFA 5BYLA 3U6JA 5T68A 3W8LA 2PMNX 3KRJA 4F9BA 4XEYA 3ZLYA 5CVGA 3FMEA 3NUUA 2C3KA 4JRVA 2BKKA 4FKJA 4D4VA 3ACKA 1A06A 3PYYA 4R7HA 1Q97A 5H8GA 3ANQA 1Y8YA 5AV3A 3RHXA 2VWIA 3UOJA 1WBVA 3VS1A 1CKPA 5H8BA 4NKAA 3VBQA 3HRBA 3ZM9A 4TWOA 3FYJX 5CWZA 3UZPA 3COMA 3RM6A 4F70A 3K54A 4BKJA 1TQMA 2ZVAA 3CCNA 4AW5A 3W55A 4DH1A 5A54A 4LMUA 4BCGA 3TDVA 3DKGA 4YZCA 3RPRA 5AP7A 1QPEA 3WE8A 5IUHA 4FV6A 4CCUA 2ETMA 4FIHA 4A9SA 2X9FA 4D4RA 5JRQA 3DA6A 3CKXA 1KUTA 4R8QA 2R3HA 3E88A 2OGVA 3IS5A 4C7TA 5IQDA 3MA3A 3UZTA 4YTFA 5EDRA 5A4CA 1OKZA 4OTQA 4B6LA 4WRGA 3HLLA 2C3IB 4EK3A 4RC3A 5E8WA 5EM8A 3BQRA 4C34A 3HP2A 5EW3A 3F2AA 2ITUA 4HPUE 3RKBA 3U4UA 4C4GA 4D1ZA 1J7IA 2O8YA 2BALA 4QNYA 3FEGA 4CT1A 3KKVA 4WG3A 1KE9A 3CY3A 5FBOA 5BVOA 4FIJA 3E8DA 1PXMA 3HP5A 3F2NA 4AAAA 5IMXA 3QYZA 4BR3A 1CDKA 1OKYA 3BYOA 3GU6A 2W1CA 5CI6A 3ZOSA 5A4QA 2E2BA 3R1QA 4LI5A 2ACXA 2HK5A 4G2FA 4UB7A 5CAOA 4CZUA 4U9AA 5JMSA 2R3LA 4RMZA 1U54B 4EOLA 5FEDA 3LXKA 4KIQA 4RA5A 4FKSA 5HU3A 4AZWA 4EYMA 2YISA 2HZ0A 2UZOA 4TRLA 2R3JA 4DCEA 4F63A 1H1WA 2GU8A 3POZA 3HDMA 4PDPA 5BX0A 5K9IA 2ONLA 4XP2A 3W10A 3FY2A 3QRTA 5HTCA 4MXXA 3UIXA 4UMQA 4NM5A 3TUCA 5EW9A 3BQCA 3CQEA 5AADA 1Q3WA 2R0IA 2ZM3A 1ZYJA 3H0YA 4JNWA 4CYIA 3AG9A 3LFSA 2X8EA 2YHVA 2XK3A 3GEQA 3QYWA 4FKRA 5FDXA 4TNDA 4Y5HA 3TNQB 4DBNA 3SHEA 3WF9A 2OKRA 5KX8A 2PVLA 3OF0A 4K2RA 4CGAA 4L52A 2B0QA 5CSWA 2QONA 4ITIA 4P2KA 4QMVA 5ANGA 3Q9YA 3LFQA 4JAJA 4GU6A 4QMTA 3FDNA 4KKEA 3A7GA 4GYIA 4I94A 3BLHA 4E4LA 3IECA 3EFLA 1Q24A 4JIKA 3ZO3A 4FSUA 1Q99A 5TO8A 3VIDA 5FM2A 3AC2A 3PXFA 3MH1A 4GK2A 2JIUA 2QVSE 5CZIA 4X21A 2WQOA 2QCSA 2X8IA 3P7AA 4D0XA 4QQTA 4PP9A 3RMFA 1ZY5A 4AA5A 3HA8A 2W9ZB 2W4KA 1GZNA 3NIEA 4G3EA 1P14A 5ITAA 1WBTA 3R02A 4IX3A 4FC0A 4CNHA 4ACCA 4JX3A 4FKLA 2R2PA 2VGOA 5ANJA 4P90A 3ZEWA 3GOKA 4DFZE 3W2SA 5AEPA 5DFPA 2LAVA 5L6OA 5I9ZA 2XM8A 3LXLA 1KOBA 3PDTA 5DWRA 3KXZA 2PE2A 1B6CB 4HCTA 4ACMA 1IAJA 3CE3A 2QG5A 4IX4A 4BF2A 2GNLA 4RLKA 4HVIA 4J1RA 4IWDA 4OTRA 2UV2A 4XUFA 4XV1A 4KIKA 4P5ZA 3PJCA 3PFQA 5EYKA 4ZTRA 3UNJA 3IW6A 4YMJA 4QP2A 3LCKA 4MTAA 5J7BA 4IHPA 4FV2A 4GT3A 1XBBA 3DJ6A 4IX5A 4QP8A 4XRJA 3EYGA 5E8VA 3MSSA 4YO4A 5LVPA 2VZ6A 4X6QC 3D94A 1H26A 4DEAA 5HVYA 1V1KA 1TQPA 3NUNA 4M14A 3UQGA 4R7BA 3GCSA 5IDNA 1UVRA 2JDRA 5EHYA 3RCJA 2OG8A 3ACJA 2CLQA 4HYHA 2QHMA 3SA0A 3DFAA 4ZJIA 1VYZA 3RPOA 1UKHA 3CTHA 3NRMA 4JBOA 4XBRA 3ROCA 1PXNA 3F69A 3TV7A 4E5BA 2OIDA 2REIA 5FXRA 3OWLA 4XOZA 4B8LA 4ASDA 5HTBA 2WMTA 3DKFA 4FKOA 2NO3A 4I6HA 5GZ9A 5BVNA 2B1PA 4JR7A 4L46A 4K33A 3OG7A 4AP7A 2W99B 3NCGA 4J8NA 4XG9A 1IA8A 3EN4A 4J71A 2BDJA 3KRWA 1BX6A 3EQRA 3KULA 2C47A 3UOHA 3EN7A 5DE2A 3IW4A 2C0IA 2XIXA 1WVWA 2PVKA 3G9NA 4IAYA 3SXSA 4FZDB 5HBJA 2QOHA 4M8TA 3D14A 4GVAA 4OAVB 4QP4A 3KY2A 4IZ7A 2XB7A 1U46A 3FMLA 3OEFX 3SV0A 1E1XA 4KBKA 4M68A 4YSJA 3LCTA 5GINE 4ZS4A 2A0CX 1ZOHA 3PSBA 4M0ZA 3W18A 2PULA 5J9LA 2UZVA 5DOSA 4FV7A 4CT2A 1RW8A 4FIIA 2PHKA 4EBWA 2OU7A 2HXLA 3GFWA 4G9RA 3UE4A 4DGGA 3OS3A 3O96A 4XOYA 4YNEA 4JL9A 5EG3A 4CZTA 2WIHA 4Z7HA 4DTKA 4DH5A 2OIQA 3RK7A 2W9FB 3W33A 2G01A 4HVHA 4G16A 3IGOA 5GJDA 4Y73A 3PSCA 4FZFB 4RJ7A 3VUDA 4BCPA 2WMAA 1VZOA 1YWVA 4AS0A 2YA9A 4EK6A 5CAUA 1YI6A 4F7NA 4NW6A 3VUTA 4PX6A 5CNNA 4CFFA 5EQYA 4EJ7A 3OT3A 4FTLA 2W1EA 3PG1A 4ZSEA 4D2VA 3WIGA 1A48A 4DEIA 3QTUA 5DHJA 4XG7A 3WOWA 2OH0E 1JOWB 2CMWA 4CKJA 3MH3A 4X3FA 5DR9A 4M7IA 5BVFA 2DQ7X 2YEXA 3AC5A 3D2IA 4HYIA 4I3ZA 4BZNA 3JY9A 4J52A 5JRSA 3CTJA 3I5ZA 3MFUA 1QPCA 1V0BA 3GNIB 3HUBA 5H8EA 4L9IA 4ANLA 1Q62A 3EQHA 4BKYA 1OITA 4BDKA 2R3KA 4ZEGA 4O83A 4KIKB 3UOLA 3DBEA 3ZM4A 4B9DA 4RIWA 1OIUA 5IQAA 4V0GA 4QYGA 3EZVA 4FKUA 5AP3A 4ANSA 5FM3A 2OH4A 3OEZA 2VRXA 1Q8ZA 3ENMA 4I6FA 4FSYA 2F2UA 4DAWA 3GCVA 5K4JA 2XIKA 5M4CA 4U81A 3P5KA 2OF4A 4DFYA 3LFEA 4FGRA 1W84A 2QOOA 4G1WA 5EH0A 3AD5A 1PKGA 5IA1A 2CKOA 4RWLA 3PVBA 4IAFA 2PWLA 4DEDA 5AP1A 5IA2A 3ZEPA 3QC4A 3RI1A 3PPZA 3QBNA 3UBDA 3QAME 2PSQA 3GU8A 3M11A 2XUUA 4GW8A 2JKQA 4S31A 3MYGA 3PWYA 4IE9A 3EKNA 3V8SA 4F1MA 1FQ1B 2YERA 3C1XA 3UDBA 2BKZA 1JKLA 3R00A 1H07A 4X0MA 4O0YA 3BEAA 1I09A 1OVEA 4FL3A 3R7IA 3TZ9A 3IQ7A 4O0XA 4K9YA 4O1PA 4E3CA 5EKNA 3FKNA 3KULB 4FTIA 4KD1A 2YDKA 3QRJA 5J95A 4AXAA 3CD3A 4BFMA 3QF9A 5A4LA 4MQ1A 1GAGA 2GPHA 2ZV8A 5AV4A 2JITA 4O27B 2CJMA 5B0XA 4BDEA 4NJDA 4TYEA 3ELJA 4MYGA 2UZWE 4OTFA 3ZU7A 3EQGA 4I5PA 4ALVA 2UW8A 2BDFA 4NTSA 4X2NA 3RP9A 5JQ8A 3PP0A 4NW5A 3IGGA 3LE6A 5F4NA 3WIKA 3G0FA 2UW4A 5L2IA 3LPBA 3NNXA 2IVSA 4O86A 4YP8A 2XBAA 3RGFA 4BCOA 4ZY5A 5AA8A 3QA0A 3FZPA 3W16A 4JLCA 4K77A 5JFXA 5KMLA 4UMTA 5T6KA 1SM2A 1W98A 2C0TA 1M2RA 4BDDA 4EC9A 5CF5A 2B7AA 4EOQA 3EHAA 5CT0A 4QQJA 2QR7A 3Q60A 4BDIA 3LLAA 5JQ5A 1YOLA 4C2WA 1Y6BA 4EQCA 4BI0A 3OOGA 2FSOX 3LFCA 4QYYA 1SVGA 4WSQA 4I41A 4N4SA 3VN9A 2XF0A 1YI4A 4U42A 3C5IA 5K5NA 4XH6A 3FMNA 2GS6A 3QKMA 4X3FB 4WG5A 2B55A 3II5A 4TXCA 3ZLWA 4FEXA 5BNJA 3QD3A 4XRLA 3RTPA 4BBEA 2Y7JA 3ZBXA 2YAAA 5FD2A 2ITWA 4JG8A 2KULA 1NT2A 4IH8A 1G8SA 1JSUA 2ZYBA 3OXZA 4IM0A 3KC3A 4H3QA 4WO5A 5HNGA 3S1HA 1CMKE 3O0GA 2C5NA 2WB8A 1OPKA 4U44A 1NW1A 1B39A 5K3YA 4RIWB 4V0GB 3SLSA 3FPQA 3WILA 4E6CA 3E92A 4IW0A 4YC3A 3QKKA 2I0VA 2HWPA 2ITYA 2QKRA 4BCHA 2CSNA 1WBOA 3O23A 5JN2A 2C5XA 1G8AA 4G6NA 4XBUA 5EQEA 3F82A 5I9WA 4Y85A 4IEBA 2ITTA 4IJ9A 4L53A 5CI7A 5HX6A 4NEUA 1IAHA 3CGFA 5FEQA 4FV8A 2BROA 4GS6A 4PTEA 1OBGA 2XRWA 1FPUA 2YM7A 3A4PA 4G6OA 3WF7A 1S9IA 4ZSGA 4DH3A 4FG8A 3PY1A 3NR9A 4BDFA 3AC3A 3FZOA 5BMMA 3T9IA 2PVMA 3PVGA 4XLVA 3PUPA 4HGLA 5M55A 3TNIA 4LMNA 4QTCA 4OBQA 4J98A 4TT7A 4JOAA 4FV4A 1BI7A 4W4YA 3ORPA 3A8XA 3C7QA 3PXQA 3HV5A 4XG4A 5AV0A 4XHKB 3ZO4A 1XH4A 3EFWA 4I1ZA 5AR7A 3VUIA 5CQWA 4YJQA 4D2WA 4RJ8A 2BUJA 2X39A 3P23A 4AUAA 3HUCA 2HAKA 2PUUA 4I0RA 1YHVA 4M69A 5DLSA 4UEUA 4EKLA 3IOPA 5IZFA 5EW8A 2BRGA 4ASXA 3BPRA 3R2BA 5AIKA 4IXPA 3C4WA 3JVRA 3CTQA 4EK5A 2WTDA 4I93A 4PNIA 4EZ7A 2R3OA 3MY1A 1FVTA 2X2MA 3D0EA 3EZRA 4KSPA 4AWIA 3ERKA 4FOCA 5LVNA 2VWUA 5BYYA 1M2QA 3AC8A 4RQVA 4O7LA 4BDBA 5JZJA 3GI3A 4FG9A 2VTOA 3ATTA 3L8XA 4EH6A 4YZNA 5E8XA 1PMNA 2FYSA 4LYNA 4XJ0A 4X3JA 4MNFA 4F08A 4FGBA 4YO6A 3MA6A 1OL5A 3FMHA 2HENA 4CYJA 4G6LA 3FMMA 1FGKA 2J5EA 3PIYA 4FKIA 3F5UA 3HMIA 3WZEA 3NCZA 2NPQA 5LWNA 3TM0A 5LMKC 5AV1A 4XP0A 1SZMA 3D83A 4RX9A 4AZTA 3R9OA 4GK3A 4EONA 3QZIA 3TIYA 1UU3A 2R3IA 2XK9A 4D4YA 2C5OA 3R21A 1WFCA 3NNUA 3AMAA 3Q2MA 3SQQA 1MQ4A 3UG1A 3QL8A 1ZZLA 2WTKB 3A62A 3DBFA 4FVPA 4GG5A 4RLLA 4O7NA 5D1JA 4ZAUA 3SGCA 3ORTA 4H1MA
chains in the Genus database with same CATH superfamily
3EIDA 3FZSA 4YSMA 2QNJA 3R0TA 4WG4A 4D2RA 2VN9A 2J90A 2BAQA 3BV2A 1KV2A 2V62A 1R3CA 5HLNA 3COHA 4BCNA 5IH4A 4R1YA 4DFBA 5TT7A 4UMPA 3QUPA 4O7YA 4QDEA 4AOIA 4OT6A 5HVJA 4A4XA 4ZZMA 3KXXA 1Q8YA 4QPSA 3O7LD 3O8PA 4DLIA 3LOKA 3QUEA 4CV9A 4BCFA 3R8PA 4YUQA 1R39A 4FK6A 2YJSA 4FKGA 3I0QA 4KSQA 4HNIA 5EI6A 3FYKX 2VNWA 5H3QA 4X7QA 4AF3A 2ITNA 5L8KA 4EORA 4AZSA 2CPKE 4CV8A 2Y0AA 4TY1A 2PUPA 2E9PA 3JS2A 4OBOA 1Q61A 1XBCA 5KKRB 5EYCA 3HMMA 4ITHA 3RCDA 3K3IA 3IONA 4PWNA 5CU4A 3TWJA 5GJGA 3TTJA 3IW5A 2C5YA 4C4IA 3P0MA 4QMSA 3VULA 1LEWA 3W0RA 2C6LA 4AQCA 4U7ZA 4TW9A 5BUEA 2PVFA 4QQCA 3FXWA 1CKIA 1W0XC 5FP6A 4FE2A 5DG5A 3NUXA 5EI2A 2J0JA 2QR8A 1H00A 2GS2A 3BBTB 3H9RA 3MPMA 3W2PA 4L3LA 4HGSA 4CEGA 5HORA 3BE2A 4H3PA 5DYJA 2P2HA 5AP0A 2R0UA 4KWPA 2EXMA 3A7JA 1QCFA 4NFMA 1H1PA 4HPTE 4YTIA 3OC1A 3W8QA 4FT7A 5AX3A 3FQSA 2XP2A 4A4LA 1KE6A 3JXWA 4BTJA 4EOJA 4WKQA 3TG1A 5EYDA 3UGCA 2IG7A 2O0UA 3ZSHA 2BRMA 1P2AA 2VO7A 5HCYA 4CFWA 4EUUA 4GUEA 3GC7A 2A2AA 4AG8A 4F0GA 3RAKA 3OCTA 4XP3A 4I5MA 2KTYA 3QCYA 4O38A 3ZUUA 5L6WL 4ALWA 3Q6WA 5JGBA 3V5WA 2GTMA 2W1DA 3OROA 2YLFA 3PIZA 1JSVA 4RWKA 4KKHA 2XEYA 4IMYA 1W7HA 2XNGA 3FHIA 2YM5A 3QRUA 4I20A 5CVFA 1YXXA 4BDAA 4C59A 3R7VA 4X2KA 1RDQE 1Y8GA 4YR8A 3EFJA 3R7YA 3VS5A 4PNKA 4C4JA 2W1HA 4RPVA 4FKTA 4WNOA 4E1ZA 5M57A 2OJGA 3PLSA 3LW0A 4AGCA 3LMIA 4FKPA 2W5BA 4USDA 3EH9A 3R1NA 4GSBA 5KE0A 5GHVA 4IB1A 1Y57A 4BJJB 3Q6UA 4HYSA 2WMBA 3I7BA 4K8AA 2XIRA 5HBEA 5TF9A 5C01A 1O6LA 4QO9A 4UX9A 4EOPA 3IW7A 4NJ3A 4EYJA 2UZEA 5ANEA 5LWMA 4LL0A 3KMWA 5AFVA 2PZRA 4Q5EA 4UBAA 5ETCA 3BV3A 2C6MA 2XK4A 4N6ZA 3ULZA 4BVUA 2BAJA 4J99A 1F5QA 4JS8A 3DQXA 3R30A 3RAWA 4D58A 3F9NA 2UZDA 2XNBA 3DK6A 3HYHA 3KXNA 2OXXA 2GQGA 4KRDA 3HV3A 4IBMA 4NIFA 1PY5A 2A1AB 4AT4A 3DNEA 2OWBA 2C4GA 1WVYA 2BRNA 2V0DA 5HD4A 5E9EA 4DDGA 4BBFA 4OTWA 3TT0A 2WXVA 3C4CA 2ZMCA 2ZFYA 4Z3VA 1H28A 3PJ3A 4G34A 3KF4A 1PXJA 4CVAA 2RF9A 5DR6A 2WMXA 4J95A 1Q8TA 2E9OA 3ORXA 3I6WA 5AAGA 1L8TA 3S4QA 3SC1A 5HU9A 3PSDA 3R7OA 3ZHPC 4EQMA 1IRKA 1KE5A 4LFIA 3HMPA 2VWYA 3GCUA 3OW4A 4X2FA 4O7WA 3IOKA 5FUTA 5GZ8A 3S2PA 4PTGA 3KF7A 4DFXE 5CLPA 2WZJA 3OOMA 2J2IB 4GIHA 4D9UA 4MK0A 4BDGA 3JR1A 3ORLA 4I4FA 4EH5A 4Z7GA 4EI4A 1ZOEA 3GVUA 4IIRA 4C2VA 4U97A 3NGAA 3IK3A 4ZXTA 1U5RA 5J79A 2J51A 4E6DA 3UOKA 3V3VA 2WTIA 4S33A 3VS2A 3EL8A 3JPVA 3ITZA 3OVVA 3TL8A 2VUWA 4FV1A 1Z57A 3QXOA 2V7OA 5CXHA 1OPJA 2JAVA 5D12A 3V51A 4O96A 1G8JA 4YZDA 3B8RA 1STCE 3QTQA 4CCBA 4DFLA 2VWBA 4RJ3A 4KIOA 3QTZA 1YOJA 2G2HA 4JAIA 5CF8A 4ERWA 4GKHA 3EQFA 2GTNA 3W0MA 3EQBA 3HRFA 4WBOA 4AW1A 1NXKA 2YCSA 4FIEA 1XQZA 2CCHA 1OL7A 3VUKA 4BHNA 3Q52A 3GBZA 2V5QA 1JQHA 3EB0A 4IAZA 4C35A 2PK9A 5CEPA 5IG1A 5EOLA 3HVCA 4V04A 5IDPA 1KWPA 3UNKA 3TI1A 1M7NA 4KKGA 5M44A 3WF6A 3R22A 5J8IA 4O7RA 3AOXA 3MJ2A 4JQ7A 4G5PA 3RZFA 3NYXA 4HVDA 3CS9A 1JAMA 2E9VA 4AFEA 4X2JA 4O82A 4O0SA 1OPLA 3ZXTA 1H1RA 2JFLA 2ERKA 3ATSA 1T45A 3BLQA 2ZDTA 3TKHA 5J5TA 2ITOA 3U51A 4BWKA 5HE3A 3NMUF 2Z8CA 4R6VA 5HOAA 3GCQA 1J1CA 2WQNA 2VTQA 4GFGA 4I5HA 2B9IA 1GJOA 1OGUA 3PZEA 5BVKA 2W1IA 4E8AA 3H9FA 4PL3A 5T3QA 1BKXA 2CNVA 3OCGA 3QQGA 5A4EA 5AX9A 3QD4A 4UWBA 2XAOA 3R8UA 4FT9A 3FLZA 3R28A 3JY0A 3O5AA 4LRMA 4IM2A 5GNKA 3BI6A 4MF1A 3MTLA 2OICA 3OY1A 2V55A 3M1SA 4IVCA 4TPTA 5IF1A 1ZZ2A 4ZJVA 5KNJA 3AT2A 2I40A 1RJBA 2CGVA 3OZ6A 2UZTA 5IPJA 2X0QA 2YM8A 4QOXA 2HW7A 5DT0A 2XKEA 2WGJA 4PMPA 3ENHA 3AD6A 2I7QA 3MVHA 4AU8A 1ZXEA 1MRUA 4CFUA 5HBHA 5ANKA 3WARA 2JDTA 3PWDA 5K0XA 2VX1A 5DRDA 2XCKA 2XH5A 4ID7A 4HCVA 4R5SA 4FSWA 3V8WA 4XG8A 4YPDA 3BU3A 4RVKA 4QMQA 4Y83A 2JBOA 4O6LA 3KU2A 2FUMA 2UW9A 4XS2A 1SVHA 2FH9A 2OFUA 3PLAE 1YOMA 3LIJA 4JVGA 1REKA 2XIYA 3QA8A 3AQVA 3RAIA 3THBA 4NU1A 4D5HA 4H36A 4QPAA 1XWSA 2BFXA 3G9LX 3P9JA 4GG7A 2YIRA 4HOKA 4S32A 4U3ZA 5ACBC 3DLSA 4BDJA 3GQIA 4RJ6A 3VBVA 2P55A 3BGPA 2WKMA 4FTOA 4W9WA 1MUOA 4G3DA 4FZAB 4DH8A 1E9HA 3GU4A 2RG5A 3AC1A 4DITA 4CTCA 3P86A 3F2RA 4XLIA 4RC4A 5EM5A 4F7SA 1JBPE 3NSZA 3HV4A 3MIYA 4C4EA 4F9WA 4FMQA 1YVJA 4M13A 2UW0A 3FQEA 2XK7A 3FZ1A 3QTXA 3MB6A 3F5GA 4QT1A 4LV8A 3TNPC 3BRBA 3DKCA 3TNWA 4ACHA 1TFFA 4Y72A 4B7TA 5A9UA 3G2FA 2Y9QA 4UN0C 5HE1A 3GU5A 2VTMA 2ZAZA 2I0HA 4DEEA 1BUHA 4N0SA 3H30A 4RWIA 1DAYA 3G51A 4YTHA 4AA0A 2WMQA 2QO7A 3PJ2A 2YFXA 3FMKA 2W5HA 1XH8A 3L8VA 5KO1A 4JBQA 4DG0E 4NUSA 3UQFA 3K3JA 4IJPA 3U4WA 4L68A 2HIWA 3KVXA 4WUAA 3R8LA 3IW8A 4CLIA 1GIJA 3CR0A 5D10A 4B99A 2QOBA 2PUIA 5CEMA 1BL7A 5KCVA 4IFGA 3Q53A 1UU9A 4B8MA 5GIOE 1OL6A 3LLTA 3NFGB 4AOTA 2C1BA 2XK6A 5CU0A 3UVPA 3RPSA 2R3RA 3FLWA 4EHGA 4D2SA 1OUYA 3HA6A 5IA0A 3VF9A 1GNGA 5C8KA 2ZMDA 2W4OA 4F1TA 3SD0A 5HESA 1YXUA 1E1VA 3KK8A 2XARA 4NWMA 4J7BA 3LKMA 3LFBA 3OWPA 2YIXA 3PXRA 3P79A 5LCKA 4FTTA 5FDPA 3N4UA 5BVEA 2GQRA 3NW5A 5DT4A 4F9CA 4V05A 4Y8DA 5FWKK 4MHAA 4ORKA 1R1WA 5M08A 5C1QB 3OMVA 5ANDA 3QD0A 5GIPE 1CSNA 4FNZA 3OY3A 4HYUA 4C61A 2Y8OA 4QTDA 3FAAA 4RVLA 4UY9A 4JQEA 4BGQA 4F1OA 3U54A 2WU7A 5JZNA 2RL5A 3TKIA 3D7TA 4MVFA 2JDSA 2PMLX 4TYIA 4CXAA 4EH3A 3VHKA 4UV0A 4BIDA 1H4LA 2AYPA 2JIIA 3C0HA 4QRCA 4QMXA 5L2QA 1S9JA 5AP2A 2HW6A 4IB3A 2BMCA 3KQ7A 3LJ0A 3SOAA 4NL0A 3UMWA 2GNIA 4BICA 1NVSA 4ZTMA 2CN8A 5M53A 1OKVA 3T9TA 1ZARA 2PZPA 5F20A 5IEVA 3NX8A 1OIRA 2E9NA 4YBKA 3ZCLA 1EH4A 4CFNA 3MFSA 3VHEA 4FUXA 4RQKA 3DB8A 5F1ZA 1YHSA 3EOCA 2VO0A 2DS1A 5HNBA 3TEIA 2YCFA 5DT3A 4EH4A 3Q4CA 3VW8A 4BWPA 4CG9A 3ET7A 3LAUA 4FTJA 1NVQA 1U5QA 3ZDIA 3ZRLA 4F99A 1K3AA 3C13A 3F66A 4DEHA 3DDPA 4S2ZA 2VU3A 3ODYX 2OW3A 4KIPA 3MH2A 3PA5A 5CQUA 2QC6A 4UZHA 1QPDA 5AR5A 3SW7A 3DTWA 5AM7A 4L43A 3GOPA 4L67A 5A14A 4FTUA 4UYAA 2YCQA 3CQUA 3TJDA 4L6QA 4AZEA 3G6GA 2GNGA 1ZYLA 3E3PA 5E8YA 5G6VA 3ZXZA 3QD2B 3MPTA 2PZYA 4I6LA 3GC0A 5AWMA 3KXMA 5AIRA 2LGCA 5CTPA 3ZZWA 2WQMA 3K5VA 2J4ZA 4LRKA 4EH2A 3G15A 2FSMX 2RFDA 4JR3A 4GU9A 5CF4A 4E20A 2C30A 4TYJA 1VLRA 4C3FA 4BYIA 1LP4A 3O17A 3W2RA 3WZJA 2IPXA 4OBPA 3LJ1A 3RALA 1UNGA 4J97A 3D5WA 4RSSA 3TCPA 4UMRA 4M97A 3KA0A 3ZONA 3GC9A 3DTCA 4BZDA 3A4OX 3PE2A 2Z60A 4NZWB 2C6DA 3UNZA 3KCFA 3ZH8A 2C3JA 3BE9A 4A7CA 3O50A 5CAQA 2YM4A 4FSQA 1FOTA 5HG5A 1UWHA 5CX9A 5AP4A 5HIBA 3UTOA 4RFZA 3RVGA 2XNOA 1UU7A 5HQ0A 2PY3A 2B9JA 2BFYA 2OFVA 2RGPA 2XCHA 3DU8A 3I81A 5CAVA 5M56A 3LMGA 3P7BA 2ERZE 2HWOA 3D5UA 4LGGA 3HAVA 1MRVA 3BHVA 2J7TA 4RX5A 3GENA 3R01A 3RHKA 3D7TB 2F57A 3LCSA 2CNUA 2ZV9A 4EHEA 1ZYSA 2UW3A 3FI3A 2ZV2A 5IUIA 4QMZA 5C8MA 3E93A 5CALA 5EFQA 3W2CA 1R78A 2GFCA 3TV6A 3FWQA 1GZ8A 4TTHB 2IZSA 3H4JA 5EM6A 3VS4A 4QMYA 4MD9E 4ASZA 5KBRA 1JKKA 3AMBA 3ZS5A 4EHVA 4L44A 1GY3A 1JSTA 2WQBA 3A7HA 4JDIA 1R0PA 4DG2E 3QLFA 4RG0A 1WZYA 2BZJA 2VO3A 2X9EA 3VUMA 4L7SA 1G3NA 2YM6A 3DB6A 1ZYCA 3DXPA 3KFAA 3CGOA 4JDHA 1ZRZA 3F3UA 4IVAA 3RK5A 4BWXA 1IA9A 4ERKA 2P33A 3UJGA 4FEUA 4EL9A 2YWVA 3MY0A 2WEIA 4I0SA 5EKOA 4A9UA 1OM1A 3QKLA 1G5SA 3IDCA 3DCVA 5AP6A 5HD7A 3PA4A 3NUPA 4IZYA 4L7FA 4JT3A 4FODA 5L3AA 3BBWA 4DBXA 2BCJA 3D5VA 3NDMA 3R1YA 3C5UA 3R04A 4FKVA 4IVBA 4KBCA 1APME 4FTMA 3BKBA 3AKLA 4BL1A 2O63A 3MBLA 4C38A 4USEA 4JRNA 2CGXA 4CQGA 2R7IA 3TIZA 2IJMA 5BUJA 5AUZA 3UIBA 5K5XA 5HLWA 5IH6A 2WMSA 2I0YA 1J7UA 3T3VA 3P5JC 3Q32A 5AR4A 5BUIA 3VBTA 2CGWA 1OIYA 3ALOA 2XVDA 3AMYA 4PDOA 3GFEA 5FQDC 4E6QA 1IASA 3KB7A 3Q3BA 4NKSA 3OBGA 2QODA 2J0LA 3SKCA 4DGOA 3LZBA 2ZB0A 4DEGA 5I9UA 2R3GA 3PUFC 3I60A 3P08A 2XM9A 4IFCA 5CF6A 2PVNA 3BGQA 4RZVA 4AXDA 3OT8A 4RBLA 5DIAA 2VWXA 4XG2A 4NM3A 3G33A 3TNHA 2IWIA 3UODA 2W5AA 3AKJA 4GRBA 4H1JA 3R8ZA 3LM5A 2R3FA 2UZLA 2PE1A 4OTPA 2VWZA 4PY1A 5D7VA 3C0IA 5CNOA 3PZHA 4IWOA 4WIHA 2EVAA 2GHGA 4CFXA 4O7VA 2NNWB 4AA4A 4I21A 4U3YA 5IU2A 4MQ2A 3ODZX 2G9XA 3C4ZA 3UQCA 4JG6A 1L3RE 1MP8A 2X2LA 3KIOC 4QP7A 3REPA 2VTPA 1SYKA 5I4NA 3UP2A 1PW2A 4NCTC 4WA9A 4FSNA 4ZY6A 2ZM1A 3EJ1A 4MH7A 2VTRA 2XS0A 4FSRA 4KRCA 4IDTA 4PPCA 5HLPA 4L00A 3UYSA 5AA9A 5IISA 5E90A 2IW8A 4HW7A 3S95A 4CMOA 4WOVA 4XCUA 5CEOA 3G90X 3HL7A 4MAOA 3GGFA 1XBAA 4MF0A 3UO4A 3UO6A 1JPAA 5K0KA 2J5FA 5EOBA 1XH9A 2BILB 3COIA 3KRRA 4PUZA 5ETFA 3R9DA 1XH7A 4QQ5A 4FSTA 2WFYA 4J96A 1M2PA 3WF5A 3H10A 5DRBA 4EEVA 1J1BA 3L8PA 3RK9A 3GU7A 4TWCA 1PYEA 3K2LA 4QYHA 3PY0A 4C02A 4FJVA 2PZ5A 3VS3A 2V7AA 4FV3A 1CKJA 3QWKA 3DBQA 3KK9A 4QMLA 3CJGA 4OLIA 3NNWA 3DBDA 2Y4IC 1FMKA 2GNJA 3VWAA 2OXYA 3CQWA 4BIEA 1SMHA 4CFVA 2QOLA 4JDJA 3C50A 2OZAA 2H9VA 4IM3A 3RNYA 3FI2A 5F94A 3UO5A 2IO6A 4ONAA 4TYHA 2X7GA 4BIBA 1YDTE 1ZLTA 1IEPA 2QOKA 4YJVA 4KS8A 2WOUA 3BWFA 3ZFMA 4E26A 4D4SA 5L2TA 2YAKA 4CMTA 2IZTA 4CZYB 1OMWA 2AQXA 2E9UA 3QWJA 4H3BA 3C0GA 5H9BA 3TTIA 3UC4A 3WZDA 3PPJA 1CM8A 3FLNC 4J53A 2Y6OA 5IEYA 2CDZA 5HG8A 4B4LA 1TQIA 2JKOA 1O6KA 2W7XA 4QTAA 1KSWA 2JDVA 5A3XA 5TR6A 4LOQA 3RBWA 3EYHA 5LMKA 5CENA 4YJUA 4G3CA 1Q41A 4H39A 4TZRA 4ANBA 3U6IA 1O9UA 2BIYA 4TN6A 4DINA 2WTWA 1PXLA 4GJ2A 1KE7A 3KGAA 4A07A 4FVRA 4IC8A 4O4EA 2HZIA 2YIWA 1YXSA 3VS0A 5BVDA 3VBYA 3DQWA 1YW2A 2A19B 2YZLA 2OXDA 3CD8A 4W4XA 4FR4A 1REJA 3GT8A 4F6UA 4D1XA 1YRPA 3NAYA 4I23A 3QX2A 2BTSA 3TN8A 5IQBA 3PVUA 3W0SA 4R3CA 2OLCA 2XA4A 5A4TA 4GYGA 4L8MA 4YZ9A 4O7TA 1TVOA 3PRIA 4RWJA 1OBDA 4DHFA 5LMAA 5EHOA 3ID6C 3NVKI 3QCQA 4FYOA 3KREA 1XH5A 3PP1A 3GXLA 3I4BA 5KMOA 3N9XA 3KMUA 3FLSA 3FC2A 4EOOA 2A27A 5J1WA 2W05A 4U5JA 3TYKA 1PKDA 5CVHA 3F61A 3QC9A 4L42A 5HTIA 5I5ZA 3BYVA 4PQNA 4BGGA 4BGHA 2GNFA 2NP8A 4QMWA 1P4OA 5D7AA 4CG8A 3NLBA 2VTLA 3TUDA 4A9TA 4M69B 4BRXA 3MB7A 2YIYA 4IADA 2W96B 4WNPA 5D41A 5KZ0A 3W1FA 3Q96A 5AUTA 3BZ3A 1PXKA 5KMJA 4AGDA 4IQ6A 5L2WA 2WTJA 5IQFA 3GC8A 5DA3A 2VTHA 1PMUA 3FUPA 4TL0A 4XMOA 1FVRA 1QPJA 2YABA 4QMPA 3RPYA 2IEWA 1GIIA 2R3QA 3HGKA 4Y46A 5FG8A 2O64A 3DK7A 4MBLA 5J87A 4CKIA 4DN5A 3CBLA 3ANRA 4FL1A 4EH9A 4F64A 3QCXA 5KHXA 5CYIA 2R3MA 4IANA 4R3PA 3EQIA 4ZOGA 2CHLA 3JYAA 3D7ZA 4GFMA 4WD5A 2PUNA 3DY7A 3MY5A 2GDOA 2GMXA 1XR1A 1M14A 3OP5A 4BDCA 2CKQA 3DK3A 3EL7A 4RIXA 3D2KA 2OZAB 4PL5A 3SVVA 1NY3A 2CLXA 4JG7A 2R5TA 4TYHB 2CCIA 1H27A 3UC3A 1P4FA 2PL0A 2QHNA 4H58A 3U87A 1XMLA 2HY0A 5CEIA 2YDJA 4Z16A 2ITPA 4U40A 3KVWA 4WNKA 5AJQA 4EUTA 4EH7A 4FF8A 3RM7A 4EK8A 3W2OA 2ZJWA 3ALNA 4DEBA 4FTQA 4I0TA 4PMMA 2C6EA 3UPXA 2B9FA 4QPMA 1XKKA 4MXAA 3EKKA 3RINA 2NRUA 3R9RA 2XKFA 2I6LA 3BYSA 4DYMA 4YNOA 5BPYA 3D15A 3VQUA 1J3HA 4EC8A 1ERKA 1UNHA 3FSFA 1OB3A 3SOCA 3HKOA 4S34A 4GH2A 5J7HA 3B2WA 4WUNA 3PA3A 2QU6A 3CJFA 3DS6A 2OBJA 1Y6AA 4RJ5A 4D28A 2R7BA 4MD8E 5DPVA 1XHAA 2OJFE 3Q5IA 3EMGA 5HG7A 2FSTX 4N70A 3T3UA 4YU2A 5BMSA 4G5JA 3MW1A 3QQFA 4OW8A 1MQBA 4KAOA 4P5QA 4RX7A 5ETIA 3DOGA 2PMOX 5C26A 5KBQA 3Q4UA 3DFCB 1BYGA 4QMMA 1H24A 3OXIA 4C3RA 2EB2A 3BLRA 1YKRA 3E87A 4R1VA 3CC6A 5H2UA 2ETRA 2ETKA 4PV0A 4W4VA 2XK8A 4X2GA 5LARA 2PVJA 4NK9A 4YJSA 2XRUA 2I1MA 5CAPA 3Q9ZA 2UUEA 3EN5A 5CU3A 3JUHA 3VBXA 4AE6A 4BCIA 5B2LA 2X1NA 4ZZOA 5FGKA 1YWRA 1YXTA 3ZLSA 3SG9A 4F6WA 3C4XA 3TMOA 3R7EA 2QO9A 1OL1A 3O7LB 4Z9LA 5CEQA 3OTUA 1GZOA 1ZAOA 3I79A 2UW5A 3PTGA 3DKOA 3KN5A 1HCLA 4K18A 5IKWA 4FVQA 5DEWA 5IQHA 1YI3A 4JXFA 4Y5QA 5AAFA 2OJIA 2GNHA 3ORKA 2YIQA 5HO7A 4FSZA 2G15A 4FTRA 2HY81 4EOSA 5KMMA 2XNPA 4NT4A 1VYWA 2RFSA 5E4HA 4MXZA 1PMVA 4GCJA 5CZHA 4CKRA 2BHHA 3SAYA 4C4HA 5LVOA 4AXEA 3AC4A 1Q5KA 1YWNA 4FEWA 5IA3A 3PJ1A 4OGRA 5DMZA 5TOZA 4DGMA 3U55A 4DHZA 4AN2A 4C4FA 1ZYDA 3LXPA 2VGPA 3WE4A 1TKIA 3AGLA 2RFNA 5HCZA 3FL5A 4UMUA 3QUDA 2XAMA 4HNFA 1FMOE 1YXVA 4IB5A 4RIXB 2YWPA 4CRLA 4PMTA 3FSKA 2VD5A 4RRVA 4AGWA 3EQPA 3QHRA 1R0EA 2B54A 3LFDA 1QMZA 3G0EA 4IAAA 4LOOA 5DGZA 2XBJA 4C0TA 3NYVA 2Q83A 4IAIA 4MXCA 3MVMA 3VJOA 1VJYA 4UXLA 3IO7A 4CLJA 3ETAA 3BELA 1BL6A 3EQDA 4FEQA 4KB8A 4AW2A 5G1XA 4LDTA 4BDHA 4QP6A 2JFMA 2WTVA 3QQKA 5KZIA 5ACKA 4BTFA 3UP7A 4CQEA 1VEBA 4FTCA 5I9VA 4FT3A 4FV5A 4D1SA 1OI9A 2C5VA 2QO2A 2VWWA 3I5NA 5B2KA 1Q3DA 2W1GA 3SDJA 3HDNA 1HOWA 2VTIA 2WMUA 2JEDA 1PF8A 3HV6A 4ZK5A 5K4IA 2YACA 4CMUA 3NYOA 4OT5A 5CY3A 3V04A 3JVSA 3BHUA 4FICA 3VO3A 2F4JA 5CT7A 2YLEA 2WPAA 4JBVA 4AXFA 3UIUA 3IG7A 3OD6X 5HX8A 4L3JA 4FNYA 4NIFB 4PPBA 4AX8A 4IWQA 4GVJA 5E1SA 1XO2B 4QYEA 3R73A 5I0BA 4MNEA 4F78A 3CKWA 3NW7A 5C27A 3FZRA 4M66A 4NYEA 4PTCA 1F0QA 2VWVA 4XV2A 4A9YA 3ZRMA 5C4LA 5FRIA 1CTPE 4FIGA 4JI9A 3BGZA 2BAKA 4L01A 3KRXA 1W8CA 4KUJA 2GHLA 1JVPP 2QOFA 5GZAA 2RG6A 5JFWA 4FKWA 2BRHA 3PXZA 3ZSGA 4W8DA 1WCCA 4FTAA 4YBJA 4BI2A 4BI1A 4ANMA 5C4KA 1H0VA 5BVWA 4W9XA 3SW4A 2HOGA 5D11A 2F7XE 3QZGA 4F4PA 3WF8A 2DYLA 4KNBA 4LG4A 4E6AA 4XG6A 3ULIA 4DDIA 2VX3A 4O7ZA 3OFMA 2ONLC 1DI9A 3A2CA 4P4CA 3CSVA 3NNVA 1O6YA 4B0GA 3HNGA 2UW7A 4LM5A 3NWWA 3NUSA 4AT3A 4BYJA 4GIIA 3DLZA 4AE9A 3ZTXA 3B2TA 2YZAA 1ZMUA 1BLXA 2UW6A 4BZOA 3N51A 2BZKB 1LUFA 2F49A 1GIHA 2FGIA 5JGDA 1LR4A 3EQCA 4DC2A 4C36A 2QQ7A 4O0UA 4ITJA 2XJ1A 5LVMA 3KXHA 3S0OA 3OHTA 4GJ3A 3NW6A 1DS5A 4MKCA 4PF4A 5AUYA 3PPKA 2QLUA 2FA2A 5HIDA 4H05A 1YDSE 4JX7A 2RKUA 1Z5MA 3A61A 2SRCA 2EUFB 4QTEA 3QZHA 4NTTA 1PXIA 4IX6A 4D2TA 1OECA 3F7ZA 3TACA 3MTFA 5IQIA 3COKA 1IR3A 1SNUA 2JKKA 3CPCA 4FEVA 4HGTA 4NSTA 2WMVA 5M4IA 3F5XA 3LFFA 4XG3A 2BR1A 2YJRA 5E1EA 5J9ZA 2QOIA 5AM6A 4FX3A 4OTIA 5I3RA 2WIPA 4W8EA 5JSMA 5HI2A 2HXQA 2P3GX 2VTSA 1ND4A 4DE4A 3AXWA 2XNMA 3WI6A 3Q2JA 1PYXA 2PZIA 3V8TA 5C03A 1XJDA 4ANQA 1TZDA 1FGIA 2C3LA 2X6EA 4WRSA 3LFNA 2CKEA 1H0WA 3QTIA 4QYFA 2BZIB 4YGAA 4F6SA 4EWHA 5M09A 1M52A 4MXOA 4K6ZA 4HJOA 3RJCA 4BCMA 4ZMEA 2Q0NA 4LV5A 3BU5A 1K2PA 5EHLA 3VS7A 4MD7E 3VRYA 5L8LA 3A60A 4LUDA 3OXTA 5HKMA 4RFMA 2FSLX 1YQJA 3ORMA 4O0TA 4ZLYA 2XYUA 4DGLC 4F0FA 3MN3A 1FVVA 2WAJA 1H1SA 4FSMA 4WHZA 1W2CA 2JGZA 3UVQA 2CGUA 1NA7A 1F3MC 1Q8WA 3G6HA 3V5TA 3OBJA 5EDQA 5C9CA 5AUUA 4MNEB 3F5PA 3L9NA 3F7WA 4C37A 4S30A 3MS9A 3R8MA 3W32A 3AGMA 4MWIA 4BB4A 3F3VA 3KEXA 2PU8A 3OCSA 1K9AA 2IN6A 2C68A 2WELA 3RPVA 5HVKA 3BU6A 3IDPA 4II5A 3P4KA 3R7GA 2QURA 2RIOA 2VTTA 4IZAA 4ZTLA 3F3TA 1FBNA 3FKLA 3MV5A 4JBPA 2BVAA 4QMUA 1OL2A 3ROYA 3UYTA 5A46A 1ZMWA 5AAEA 2IZUA 3PRFA 1AQ1A 3PY3A