3F88A

Glycogen synthase kinase 3beta inhibitor complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
349
structure length
340
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title Design, synthesis and structure-activity relationships of 1,3,4-oxadiazole derivatives as novel inhibitors of glycogen synthase kinase-3beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 340
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f88A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f88A01
5HTCA 1KV1A 3GOPA 4OTFA 2JAVA 4XV3A 4BDCA 4GG5A 3LMGA 4X2JA 4CCUA 3NNWA 4FT9A 4DFZE 1H1QA 2PZPA 3VJNA 3QKLA 4Q9ZA 3D2KA 4NM5A 4D58A 1PF8A 2JKQA 3UZPA 4CQGA 5HESA 4JLCA 4E73A 2OG8A 1SNXA 4LI5A 4X3FB 4EH6A 2GNFA 3BI6A 1W8CA 4TWPA 2WMUA 3QC4A 4NCTC 4DEIA 1FQ1B 4X2NA 5DG5A 4BL1A 5LVOA 4R8QA 3O96A 4FODA 4GVAA 4R7HA 4EHVA 1R0EA 2I6LA 4S31A 2PK9A 1LEZA 2C68A 3QF9A 4D1ZA 3D9VA 4IXPA 2IPXA 3ZSIA 5GJFA 4BDEA 2JKOA 1ZYDA 3HRBA 3QXPA 4CFVA 5KMJA 4IC7A 2VV9A 3QTQA 3FL5A 2XNGA 2X2KA 2X7OA 3GU8A 3UP2A 3UO6A 3LJ0A 2I0HA 3DQWA 3GI3A 4GFOA 4QP2A 4Y85A 1YOJA 3TACA 3W18A 4F0FA 4PNKA 5AADA 4B4LA 5DYJA 5LMAA 5E90A 2P33A 4D2SA 2C3JA 2BTRA 3AXWA 1Q8TA 3EYHA 4C2WA 2EVAA 3DNDA 3FI4A 2OJGA 3GCVA 3PG3A 4DFUA 4BCNA 3D2IA 5AP0A 3VNTA 3VS3A 2H6DA 4XG8A 5CQUA 2C30A 3VBVA 4FTKA 3R9HA 4M7IA 5FLFA 3M1SA 4PRJA 3KKVA 4FV7A 3H9RA 2YWVA 2IO6A 4YO4A 1XBAA 4G3FA 1JKSA 2GS6A 4L53A 2XRUA 2JFMA 3MWUA 4IZ7A 2A1AB 4L45A 3PRIA 5DI1A 4ZJVA 4N6ZA 2O63A 2OWBA 5TKDA 3QBNA 2F2CB 2GNIA 1XHAA 3CP9A 2XK8A 3QTRA 2WTVA 4TWOA 1P4OA 1W84A 3QRTA 4WUAA 3ROYA 1H1PA 1QCFA 2H8HA 4KB8A 4I41A 4O0VA 2W1DA 2OIBA 4H58A 1H26A 1QPJA 3BIZA 4ITHA 3ZMMA 3BPRA 2O65A 4FGBA 3FLQA 3NLBA 2I1MA 1IRKA 4JR3A 3DDPA 4ANBA 3DXQA 4CCBA 3CE3A 3LW0A 5L3AA 4W4XA 1ZYSA 2HYYA 1S9JA 3VS7A 1Y6AA 4FG8A 5CI6A 3O7LB 4B8LA 2W1EA 2GNGA 4YZBA 3BQRA 3C5UA 5AP3A 4AS0A 4FA2A 4PP9A 4HVDA 4BTKA 1R3CA 4F08A 1WCCA 1UU3A 5DFPA 1URCA 2WNTA 4EZ7A 4NW6A 4R7IA 2OJJA 3KF7A 3D7TA 3KC3A 3OWLA 4UMTA 2FSOX 2XK6A 4EKLA 5FQDC 3NVMB 5HO8A 3GQIA 3TJDA 1OKYA 2OF2A 3V5WA 3D15A 4FV5A 3S4QA 2BFYA 4ANOA 4FIIA 2XJ0A 5GZ9A 4AN2A 5AIKA 4RA4A 5HBJA 4Y83A 3GXLA 4I22A 1Y8YA 2LAVA 4AU8A 2ZJWA 3CC6A 3E88A 3H9FA 3HA8A 4RWIA 2ERKA 3PUPA 3RALA 3KREA 2QOIA 3LM0A 2E9NA 4V0GA 2JEDA 4O7NA 1KE5A 4DT8A 4FKTA 3L8VA 4R5SA 4UWYA 3F2AA 4D1XA 2YWPA 2YERA 4NU1A 5I9XA 5HORA 4CFXA 4O38A 3GFEA 1AD5A 1JNKA 4BGQA 4R77A 5IA5A 3OWKA 1UV5A 4FIGA 4FKRA 3KXHA 3RGFA 3FXXA 2A27A 4GK4A 3ZU7A 4AACA 4F7JA 1VEBA 1M7NA 2C4GA 4UYAA 4LOOA 4ZZOA 2WOTA 3OW4A 3ORKA 4EH4A 5C8MA 4FGRA 5CENA 5A4LA 3E8CA 5HD7A 4HZSA 4PY1A 4IQ6A 2C69A 3DKCA 3MW1A 3SV0A 5BVOA 3LM5A 4Y73A 5M08A 2IW6A 4H3QA 4HYSA 4UX9A 4L9IA 4FIEA 5IUHA 4PL3A 4KBAA 4V04A 3EQPA 5KE0A 4QMUA 4OTPA 3DAKA 3BCEA 3RPOA 4JT3A 1PMVA 1YWRA 3O71A 3OZ6A 5C27A 5JKGA 5JZJA 2PZIA 4AT4A 2R3NA 4DTAA 4ID7A 2JKMA 3KCKA 4I5CA 3CQWA 2PVNA 3OEZA 1DAWA 3QUEA 4W9WA 1FGIA 2OZAA 4M67A 2VZ6A 3V6SA 3BWJA 1TQMA 1RQQA 3BLRA 3ORXA 3BHTA 3ZOSA 3F88A 3KN6A 4Z7HA 2GCDA 3PIZA 4YGAA 1A9UA 2ZB1A 2QR7A 4HGTA 4IACA 4O0YA 5HLNA 3OUNB 2Y6OA 5IEXA 4IZAA 4V05A 2B9HA 2WU7A 2BROA 5DE2A 5LQFA 3COIA 4RMZA 3LCOA 4TYHB 3CY3A 5IEVA 1W82A 5J79A 4A4OA 2V7OA 5AX3A 1JQHA 3AGLA 5K5XA 1Q61A 4GU9A 2XK3A 4GT4A 3KRJA 4AA5A 4CKJA 1Z57A 3BBWA 3FL4A 3LE6A 3G2FA 4EHGA 2PZYA 1H28A 2QLUA 3RI1A 4BCPA 3OY3A 3HZTA 3ORMA 4EWQA 2C1AA 3QKMA 4BCKA 4PP7A 5BYLA 3NYNA 3QQGA 5AP2A 3QRUA 5FWKK 2C3KA 3GCSA 4JAJA 3NEWA 4WO5A 4U97A 4BRXA 3F5XA 1TQIA 4ZMEA 1Z5MA 2WQNA 3RPVA 4B6LA 3PXYA 3FKOA 1JKKA 4MXYA 4NKSA 2JIVA 4P7EA 3PIYA 2XNOA 2PVLA 4DEGA 4F7LA 5BVDA 3MESA 3MJ1A 3FBVA 2CCHA 4GK3A 2ACXA 2XYNA 5CF6A 3RM7A 4F7SA 3TTJA 3OBGA 4ZSEA 4O0RA 2CSNA 4RJ7A 4GUEA 4DF3A 4F9YA 3DK7A 2RFEA 5JSMA 3QQJA 5C4KA 2VX1A 2E9OA 4R3PA 4WG3A 2C0IA 1YOMA 2JBOA 5EI2A 4MBIA 2B9FA 2W99B 5I9VA 1G8AA 3KCFA 4LV5A 2A19B 1IA8A 4TN6A 1YWVA 3RK9A 3TXOA 3E64A 4TNDA 2CN5A 3KK8A 2O5KA 4HOKA 4J8NA 4RIWB 2NO3A 3KVWA 3C1XA 2VTIA 3KULB 4DITA 4E4XA 4X3FA 3R1YA 2R5TA 5FBNC 4KS8A 4EBWA 1URWA 5KMOA 4DGLC 1O9UA 4O7RA 3MVMA 2PZRA 3RHXA 3PVWA 1HOWA 1M52A 4BICA 4IZ5A 3IKAA 3HV4A 3HKOA 5EG3A 3UIBA 2HOGA 3TV6A 2IZTA 4FT3A 4QNAA 2UW7A 2QO2A 4F9BA 3DBDA 4IM3A 3DAJA 5C01A 1H07A 2BIKB 3SAYA 3D7ZA 3VS6A 4FSZA 4ITJA 3RKBA 5E1SA 1BI8A 2CKQA 3AD5A 3E93A 4MNEA 2WQOA 3W33A 5AUWA 4OW8A 3FQHA 2RL5A 3HVCA 3QLFA 4E4LA 3HL7A 3ZO4A 2VUWA 1OIQA 3QXOA 4H3PA 4L7SA 2UZVA 4AGUA 4DH8A 4E4NA 3MSSA 5FM2A 3SXFA 1XQZA 2Z2WA 4JDKA 3MBLA 1YWNA 2G1TA 3LFBA 3OCBA 3WARA 4TXCA 3E92A 4WNMA 5LCJA 3V51A 1BKXA 5DPVA 4Z16A 3P7BA 4A9SA 2QO7A 2YIWA 2XKEA 1NXKA 4KINA 4S33A 4EL9A 3FEGA 3VO3A 2UZTA 2BALA 3MTFA 4DEBA 5D12A 4C35A 3ZDIA 3COMA 2PE1A 4J7BA 4D4SA 5LVNA 2P3GX 2ZAZA 4B7TA 5IQCA 5EI8A 3I1AA 3E8EA 5F20A 1M2QA 5E8TA 1TKIA 2YM7A 5D9HA 3EQHA 4C7TA 2OLCA 2EXMA 4LGGA 4C4GA 3HV5A 1WBWA 1XJDA 4FF8A 4FZFB 2B52A 4I3ZA 5ANJA 5ANKA 4ALWA 4E26A 3ZLSA 5LARA 3DXNA 4ZTHA 4EI4A 3LQ3A 4CNHA 3IOPA 3ZZWA 4MKCA 5KX8A 4Z7GA 4O7TA 4GT5A 4LFIA 1F3MC 2C5YA 5GIOE 4AA4A 3QHWA 4AXAA 3F7ZA 3BBTB 3S1HA 3KRRA 1OBDA 4W8EA 4ZLYA 3HA6A 3KN5A 4RA5A 4F9WA 4YJUA 2OFVA 3WE4A 3Q04A 1ZZ2A 3RBWA 5HIBA 4QMWA 4MWHA 3FXZA 2VX3A 3NIZA 3QCXA 3SDJA 5DMZA 2B1PA 5E8XA 1YXXA 3H0ZA 4IAYA 4AFEA 2WMVA 4D2WA 2YIQA 4Q9SA 5J7BA 3PVUA 2HENA 3WF6A 4UMPA 2XNMA 1YI3A 3N4VA 5DRDA 2OK1A 3EQRA 3NIEA 2XNEA 5CXZA 5DR2A 3VS0A 4FSWA 4Z55A 5L8KA 2WMAA 4MYGA 5JFXA 3LCKA 3BYSA 4FKLA 2WHBA 3A7GA 4M68A 3EN4A 4YJNA 4HNIA 2QKWB 3P7AA 5HE0A 4EONA 4XP0A 3A7FA 4KWPA 1PHKA 4EUUA 4ANSA 1Q5KA 3DV3A 4EJ7A 3R8LA 4FIFA 4RVTA 2OKRA 2WOUA 4K1BA 4AW2A 3PPKA 5E8SA 3PYYA 1HCLA 4ZLOA 1ZZLA 5DT0A 5AR8A 5KHXA 4BIBA 4IVCA 2XVDA 1QL6A 2YM5A 2R3KA 4I24A 4BKYA 4S32A 1K3AA 1AQ1A 2F49A 5ETFA 5KBQA 2CJMA 4JG6A 1GIHA 1OUKA 3QTUA 2IW9A 3UPXA 3F5UA 2OU7A 4MQ2A 4YNEA 5JFVA 4YC3A 5TOZA 4H1JA 4G31A 2GHMA 2JDOA 3QCQA 2B54A 2BDJA 3PFQA 3Q5ZA 1YHSA 5KKRC 2QC6A 3FJQE 3IGGA 2FH9A 4B9DA 4E5WA 3L9NA 4GW8A 4J71A 4YLLA 4LUDA 4JIKA 4EH7A 4D1SA 1UWJA 3ZO3A 3U9CA 4ZTMA 2PULA 2W1GA 2ITZA 4FT5A 4BVUA 3E8DA 4AP7A 3LCTA 2WB8A 1YDRE 1SM2A 4G16A 5CXHA 3SHEA 3EFKA 3QTSA 2R3LA 4HVGA 4TZRA 2OXYA 5IA2A 1CKIA 2P55A 1OM1A 2IZRA 2PZ5A 4ZSJA 2GHLA 2IZSA 4XH6A 4FTIA 1GZKA 4KIOA 4CV9A 3GB2A 3SOCA 1UNLA 5M4FA 3K2LA 4U40A 2UZWE 2C6EA 5IUGA 3VWAA 3WYXA 4EK6A 4RVMA 3Q53A 3F2NA 5EM7A 2YFXA 3EQDA 3PPJA 3OY1A 5L8JA 4RQVA 2ONLA 5AUVA 5B0XA 2QU6A 3MY5A 5FXSA 3UPZA 3VS4A 3Q4CA 3GCQA 4HNFA 3BWFA 4AF3A 5KMIA 3KRXA 2UVZA 3HUBA 4AQCA 3RHKA 3TZ8A 3F7WA 3HRFA 4M0YA 3RTPA 1U54B 5L2WA 4EC8A 3C4EA 3PRFA 4RWLA 3NR9A 5HE1A 1LP4A 4F0IA 5BQ0A 4TYHA 2IJMA 5IA3A 3ALOA 4C3FA 5JZNA 4QPSA 2PHKA 2WMBA 3NPCA 5E7RA 4QRCA 4BDAA 2CNUA 4QD6A 3OCSA 3PA4A 3ZBFA 5E1EA 4CMUA 4CSVA 4DFBA 1H25A 3K54A 2XH5A 1OIRA 3CXWA 3ZDUA 3CTJA 4EOQA 4NH1A 3BRBA 3Q9ZA 1PW2A 2BDFA 4C38A 4WSQA 4IWDA 3PP1A 4BCOA 3CQEA 2JDRA 2VWVA 1FVTA 5H8EA 4IIRA 5BMSA 3MFTA 4Q2AA 3U51A 2YJSA 5LMKC 4U79A 1JAMA 4G6LA 4WNPA 2GMXA 4ZY5A 4D0WA 2C1BA 4X21A 5GJDA 3UNKA 3SC1A 3DFCB 3NUNA 4XV1A 3P08A 5FDXA 3EQIA 2G01A 3LFNA 4CZUA 5EDRA 3ZXZA 2C5VA 2I7QA 2WEVA 2PE0A 3LFCA 3PA3A 3IECA 4TL0A 1PRYA 2XRWA 3MPMA 4FIJA 3N4TA 4FV4A 4RFMA 5DBXA 4DTKA 1PYXA 4FTLA 1WAKA 4BCQA 5DNRA 3VC4A 4E6DA 5B7VA 3U6HA 3FMKA 4RX7A 3AMAA 2XBJA 5ANEA 3UTOA 3AC1A 3PZEA 1ZMUA 2G2IA 4C4JA 1H27A 3EQGA 4MBLA 4C3PA 2WTIA 4EOLA 3AC2A 3RZBA 2Z7RA 4RIWA 3UDBA 4ZJJA 4IB3A 3FWQA 4G3DA 4IJPA 2UZOA 5HTBA 4L00A 2BKZA 2PVHA 2X0GA 4X2FA 5HIDA 3VULA 3W2SA 2O64A 3KMUA 3KULA 2JDTA 3QQKA 3VHEA 1OL6A 5CAQA 5A54A 5F4NA 3RWPA 3HMIA 4AW1A 4C34A 2I0VA 1YW2A 4FNYA 3RAIA 4LUEA 4EQMA 2G9XA 3BHUA 4RIXB 3EB0A 4FZ6A 2E2BA 2Z8CA 3SD0A 2BMCA 2R3MA 3D0EA 3KF4A 3PVGA 4YNOA 1WBNA 3ZO2A 5HNBA 3CD8A 3LXNA 4NSTA 3POZA 5E8UA 3RVGA 3BZ3A 2UZUE 4DFYA 2WPAA 4IANA 5CEMA 4EH9A 2UZEA 3L1SA 3OTUA 4GYGA 4FKIA 3HP2A 4G2FA 3ULIA 4Y5HA 2PVMA 1LUFA 1ZOGA 4CV8A 2X9EA 4Y46A 4QYGA 4DCEA 4U43A 5ETAA 4G17A 3Q9YA 4EH8A 4QP7A 4WNKA 2JITA 4M12A 4UWBA 4D28A 5CF8A 5GZ8A 4IBMA 1R39A 2W4OA 4PL5A 4P2KA 4JNWA 4KIKB 4YSMA 3QQFA 5AM6A 4MXCA 2YIYA 5FGKA 3ATTA 4GJ2A 3FZ1A 3WBLA 1QPDA 2IWIA 5LWMA 4FZAB 2BIYA 2B9IA 3PTGA 4CT2A 2YN8A 5IQHA 3QWKA 1OGUA 2EWAA 3NYVA 2BZIB 2R9SA 3HV7A 3PJ3A 3HDMA 5EYMA 3UMXA 4O27B 5CZHA 4DH1A 2WMXA 4O0XA 5D1JA 4DINA 5KUPA 4RLKA 2V55A 4FSQA 3MGYA 1B38A 1H00A 2QLQA 3VRYA 3A7JA 4NEUA 3EKKA 5BYZA 3ZLWA 3JYAA 4DFLA 3BEAA 3F61A 5HKMA 4IM2A 4L46A 4UB7A 2XNNA 4F1OA 1BX6A 3O8PA 3BHVA 3QZHA 3IW6A 2WQBA 4J95A 3DY7A 4L01A 2WQEA 4JR7A 4FKOA 4UYNA 3S0OA 1UNGA 2HW6A 4K11A 5IA4A 2B0QA 2OICA 4UMQA 3JVSA 3LJ2A 4II5A 2RFNA 2X9FA 4XS2A 3LMIA 3WZDA 2HXQA 3R7GA 5AA9A 4O86A 4TRLA 4BI0A 3QRIA 4XG7A 4RFYA 2CGXA 4USFA 3MFSA 1PYEA 5DIAA 3KXGA 4K77A 5DEWA 2W9ZB 2IN6A 1YHWA 4RFZA 3LFAA 1P5EA 2YIXA 3F82A 3GT8A 4QMMA 3TV4A 3C9WA 3FE3A 4AN3A 4DH7A 1EH4A 2F7EE 2J9MA 5KNJA 1WFCA 4JG7A 4TT7A 3RPYA 2I40A 1OPKA 5I9UA 4YBJA 1IEPA 2R0IA 3VUHA 4ZZNA 1H08A 1V0OA 4EBVA 1WVYA 4MAOA 4S34A 2V7AA 4J8MA 2BCJA 2YCRA 2GQGA 2YAAA 2BRGA 3A4OX 4FV3A 4GYIA 4YJOA 1SVGA 4EORA 3MS9A 3MYGA 5M53A 2F2UA 2X4ZA 2Z60A 3U8WA 2HAKA 2W05A 5LCKA 3ZTXA 1K2PA 4A07A 3TTIA 4IDVA 5ANIA 3MH0A 5BYYA 2IW8A 4DG0E 4DA5A 1UKIA 5E4HA 4I6HA 3LHJA 2BZJA 4AW0A 1L3RE 4C36A 5CU3A 3VBTA 4IWQA 4I94A 4ZSLA 4E7WA 2WTJA 3EN6A 4WT6A 1F5QA 2AC5A 3PXZA 3QCSA 3AQVA 3ORTA 4OTWA 1BYGA 4L3JA 4HW7A 4L43A 4PMMA 3QD2B 2WMRA 2WU6A 3PXQA 4GVJA 4ZSAA 1XH6A 4E5BA 4JBQA 1E9HA 3I6UA 4WRSA 4D2TA 3W16A 1O6LA 2C47A 3HMMA 4XEYA 1CMKE 4OLIA 2XIKA 4QP3A 4CVAA 3DKGA 5HVJA 2X7GA 4PDSA 5HCXA 3TG1A 2DQ7X 2OJ9A 5FEQA 5C1QB 3TKUA 3QQUA 4ANQA 1OBGA 3EN5A 1YDTE 1Q8YA 3G33A 4MXOA 1JBPE 5HBEA 4KIQA 1B39A 1R1WA 5DOSA 4NTSA 2GPHA 4DTBA 2XUUA 3OCTA 3A4PA 4UZDA 3EMGA 5F95A 4ACCA 3I5ZA 1J7IA 4FVRA 4RIOA 1H01A 3MFRA 4EOMA 4FNXA 2HZIA 2AUHA 3CIKA 1NT2A 4NFNA 4ZOGA 3LFQA 3L9LA 4N0SA 3ZH8A 4YJTA 3DBFA 3SA0A 4XOYA 2IZUA 2QOOA 5M4UA 3HAMA 4MX9A 3SG8A 3QUPA 3R9OA 4F70A 3FSKA 5J9YA 4HJOA 3F5PA 4C02A 4V01A 4CFMA 3OP5A 3K3IA 4N6YA 3TM0A 3IDBA 3FZPA 3R63A 3COKA 4DEHA 4CLJA 1JKLA 4RRVA 3AT3A 1Q8UA 2OIQA 5DN3A 1U54A 1GIJA 3CS9A 2ITVA 4KRDA 4XG3A 1JKTA 1WBVA 1S9IA 2QHNA 2OJFE 3ORPA 4O22A 3OT8A 4C37A 4GFMA 2PWLA 3IW7A 4YU2A 5EQEA 1PMNA 4I92A 4UV0A 5E8WA 2BHEA 3G0FA 1GZ8A 4F6SA 1Q97A 3TNWA 1A48A 5EYKA 3QUDA 5FP5A 2EXEA 2BHHA 2E9PA 4NCTA 5FTQA 4L52A 3NNXA 4OBPA 1MRYA 4K9YA 4RZVA 5CLPA 3POOA 5CEOA 3VBWA 1DS5A 2BKKA 5EYDA 3PP0A 3UQCA 5IH6A 2VWXA 2CGVA 3E5AA 3FZRA 3PXFA 4BGHA 3WE8A 4OT5A 2R3FA 2FA2A 2GNJA 4CFWA 4YP8A 4EOSA 5JQ5A 3D5XA 3H3CA 4IVBA 4KS7A 3OT3A 4NM3A 4XHKB 4ALVA 3C5IA 4IEBA 5HE3A 4C4FA 5AUXA 2HCKA 4IMYA 4FK6A 4WG5A 3VBQA 3SGCA 2XM9A 4MD9E 2JLDA 4XV9A 4YZMA 4O83A 4RVKA 4L6QA 4I4FA 2W5HA 4WKQA 4BDJA 5C26A 5IMXA 3MH3A 3NUPA 3QKKA 4JQ7A 5HNIX 2ESMA 4JBOA 2F57A 4IAIA 4L44A 4PUZA 1A06A 2YDJA 4EK5A 1R0PA 4ITIA 1J3HA 5HLWA 4O21A 5LVLA 1BI7A 2NRYA 3C4CA 5EOLA 5HX6A 1BLXA 2QG5A 3MTLA 4APPA 2W5BA 2W0JA 3WILA 3FC2A 4IHPA 3Q4UA 4PMSA 4IX5A 4DG3E 5A3XA 3P79A 4H39A 3LQ8A 1W0XC 2J6MA 2FYSA 4ZEGA 3TNIA 1WBTA 4NK9A 3DQXA 2CGUA 3EL8A 4B0GA 2WZJA 4GJ3A 3TNHA 3LAUA 4XBUA 4YO6A 3D5WA 1PXKA 4A4XA 5I9ZA 4RIXA 5DWRA 5HVYA 3U55A 2Y4IC 3PZHA 4L67A 3Q5IA 4U3YA 2OO8X 4BKJA 2VNWA 3V5LA 3UNZA 4JQEA 3PY3A 3R02A 3ZFXA 3FLNC 2QOBA 4KSQA 4NZWB 3PE1A 4JXFA 1SVEA 3QZIA 1NVSA 2GFSA 4C3RA 5A4EA 3R28A 5AUUA 4FSRA 4W4VA 4M15A 1RDQE 3ROCA 4ZAUA 4AGCA 4RBLA 3BGZA 1OI9A 1WBPA 5A14A 2PMIA 4FKWA 5EHLA 3DK6A 4KBCA 3GU7A 3AGMA 4BDKA 2CPKE 2WFYA 4BYIA 3GNIB 5EOBA 5KZIA 4KIKA 4UY9A 3RK7A 1ZY5A 1XWSA 2A2AA 2E9UA 5C9CA 4BZNA 5C4LA 5H3QA 2VO3A 1PKGA 3PE2A 4A9UA 4F7NA 2FSLX 1JSTA 3PA5A 2ITPA 3NUYA 4ZMFA 4DEDA 4FI1A 1U4DA 4HPUE 4A4LA 4ACHA 1APME 1CSNA 4M0ZA 4F6UA 3DA6A 3PSDA 3OS3A 5AR2A 4IE9A 2G2FA 1PXMA 1REJA 3AOXA 4XP2A 3ZLXA 4TYJA 4USDA 4DGNA 2VWWA 2XCHA 5LXMA 5EQYA 4WBOA 2CCIA 4BBMA 4ZXTA 2FVDA 5C03A 4AOTA 3R71A 1T46A 4D4YA 2JBPA 1L8TA 5EKOA 3R83A 3OW3A 1IG1A 2A4LA 4XG6A 4YLJA 4QQCA 3HDNA 4GL9A 1Q8WA 3NW6A 5AIRA 2UW4A 1OL7A 5CAOA 3EHAA 4X3FC 3PPZA 2VTRA 4L42A 4XNEA 5L6OA 3CPCA 5CYIA 3BE9A 2OH4A 5I9YA 3F5GA 5JQ8A 4RIYA 3NYXA 5L2QA 5I9WA 2NNWB 4QP4A 3VBYA 4GMYA 3FKLA 3DBQA 1Y57A 3ACKA 4G5JA 3GU5A 5KKRB 4HVSA 2OXDA 2PUIA 2ZMDA 4H1MA 3MB6A 4IZYA 3DFAA 4HGSA 4OGRA 2ITWA 3QX4A 3MJ2A 2UW0A 4BDFA 5J7HA 1STCE 1Q4LA 5M09A 4UXQA 3UQFA 2J50A 2O2UA 4O2ZA 4R6VA 3C13A 3GC0A 3R1QA 4TYGA 4AWIA 5AEPA 3LXLA 2VX0A 4C4IA 5GIPE 5L2SA 4RX5A 5HG9A 5AAGA 4JI9A 4B8MA 2AYPA 4AT3A 2J0MB 2XIXA 4ZK5A 4DC2A 3S95A 1H0WA 5HG5A 3IDCA 3T9TA 2CMWA 3CD3A 2F4JA 4ASDA 3ZC5A 3V6RA 2YHVA 1WZYA 4AE9A 3TUDA 4AGDA 3ZFYA 3KL8A 1J7LA 4ORKA 3ZCLA 4F9AA 2PVFA 3NUSA 3OMVA 2PUPA 3IK3A 4FV2A 4FK3A 5AAEA 5M44A 3R9RA 3ACJA 2R7IA 2WTKC 3E7OA 2HXLA 4FVQA 2ZV7A 4IVDA 3SOAA 4LMUA 3FMEA 4BIDA 4XRLA 1QPCA 4FL1A 1RW8A 2BRBA 4I21A 4YTCA 5H8GA 5FRIA 4J98A 4L7FA 1YDSE 5JRSA 3L9MA 4D4RA 3UVPA 3TI1A 4XP3A 2ZOQA 3LLAA 4NKAA 3CQUA 4GG7A 2I0YA 2ITXA 4R1VA 3UOLA 3PVBA 3OCGA 4GKIA 4U44A 4YZDA 5D11A 3NVKI 2QOFA 3FDNA 4AX8A 4TYIA 4F6WA 1H0VA 3VUMA 4OBQA 4AZFA 1VYZA 2VTAA 4XCUA 4CEGA 3KRLA 3OXZA 4PWNA 4I4EA 5I3OA 3TN8A 1Z9XA 1GOLA 4C58A 1J7UA 3Q3BA 3GU6A 1OKZA 4FTRA 4A9YA 4RJ5A 4CZYB 3CGFA 5IH5A 3R8ZA 4BCHA 3WZJA 3T8OA 2Y9QA 3Q9WA 2OIDA 3FMHA 3GC8A 4WIHA 4PTCA 3FMMA 3TKIA 4BCMA 4C61A 2HELA 1JSUA 4M8TA 4I6BA 4CTBA 3QA8A 3QD4A 2J0KA 5HNGA 1U5QA 4X6RA 4TNBA 5A6OA 2GQSA 2QONA 5TR6A 2YZAA 2W06A 4FTUA 1FOTA 4I5MA 3C4XA 3F3WA 4W4WA 2DS1A 2QCSA 5CY3A 3V5PA 4DCAA 2IVVA 4UWCA 4CG8A 1OVEA 5CZIA 3R9DA 3VBXA 3Q2JA 5ITAA 2JIUA 3W8QA 2P0CA 1X8BA 2ETKA 4G9RA 4LOQA 5A4CA 5EI6A 3FC1X 4DEEA 3BLQA 1H4LA 2HK5A 3NAYA 2RIOA 3IDPA 1PKDA 5EHOA 3AT4A 3I7CA 3GENA 4PMPA 2C6IA 1JLUE 3FY0A 4EK3A 5LJJA 2IG7A 4MBJA 2OBJA 4C59A 1TQPA 4RPVA 3A7IA 3AD6A 2R3IA 4WG4A 4NL0A 4AE6A 2XZSA 2WMTA 3OFMA 3MIAA 5A4QA 4YR8A 4HYIA 4DGGA 3QHRA 3ID6C 3HGKA 3R8VA 2O8YA 2QU5A 5CSWA 1KUTA 4YC8A 3ZSHA 2PY3A 3VQUA 5AUTA 5EH0A 4DN5A 2QOLA 2XKDA 5HD4A 2WO6A 4TW9A 3F9NA 3FY2A 2W4JA 3EQBA 4FT7A 3EIDA 2JFLA 3LIJA 1E1VA 3E87A 4M13A 3UZTA 3UOKA 4BDBA 4OTIA 5CEPA 3LPBA 3ZM9A 3DKFA 5DRBA 3KY2A 3OXIA 5TT7A 2W1HA 3ZHPC 4EHZA 4E6AA 5LVPA 1XKKA 4ZSGA 3OXTA 4IJ9A 4DFXE 3TDVA 3A7HA 4C33A 5HEZA 4J53A 3UYTA 4M14A 2WAJA 3IW8A 2C6DA 3AT2A 4BKZA 3IS5A 5IZFA 4JRNA 3ZSGA 4RJ3A 1XH7A 3MH1A 5CEKA 3SRVB 4ARKA 2H96A 2QG7A 4MWIA 2HZNA 3ZFMA 4LRMA 2XIZA 4FTQA 3UP7A 4AAAA 2HY0A 4D4VA 3PSCA 5J9LA 5BNJA 5HU3A 2X8IA 2ZV9A 3FQEA 4FIHA 4J97A 3G9LX 3L8SA 4AN9A 3UOHA 2ONLC 2WMWA 2YEXA 4IAFA 4IAKA 4O1PA 1FBNA 5M57A 2YZLA 1UU9A 3FPQA 3MH2A 2BPMA 3NDMA 4M3QA 5IH4A 2WKMA 3V01A 3RP9A 4FNWA 4X7QA 2QI8A 4WRGA 3I60A 2R3RA 4UBAA 3UMWA 4IDTA 4DFNA 5ICPA 3FI2A 3G51A 3ZBXA 1P2AA 5AR5A 5CQWA 2VN9A 2VTHA 3Q2MA 5K4IA 4H36A 1IASA 4Y8DA 4LOPA 3RCJA 5CX9A 3W2CA 4IAZA 2QKRA 4LL0A 2X1NA 4U7ZA 3EL7A 1I09A 4NJDA 4RX8A 3BYOA 3DZQA 5JGAA 4PF4A 4C0TA 3UVQA 3I5NA 4I6FA 2X81A 4EKKA 3O8UA 1KE6A 2XNPA 2GS2A 4FSMA 3EFLA 1V1KA 2V22A 5CAPA 2BAJA 3IOKA 3F3ZA 3WF8A 3G15A 1MRVA 3TIZA 3V8TA 5CAVA 4FEUA 4CT1A 4E8AA 4HGEA 1W7HA 2X8DA 2YIRA 3HUCA 5AUYA 5AV4A 3R9NA 4DBXA 4M69B 4QTAA 2REIA 3AC8A 5JK3A 2Z7LA 1GZNA 3FHIA 3H9OA 4K6ZA 4UN0C 2V0DA 3R7IA 4BDDA 5CF5A 2FB8A 1G3NA 3IGOA 3G90X 1JOWB 2RFDA 5K0KA 2XIRA 3LOKA 4OTGA 4CQEA 4GK2A 4EK8A 5J9ZA 3HMNA 3CY2A 3V8SA 2O0UA 5EKNA 3R1NA 3QTWA 3KVXA 3R1SA 4IB1A 4XUFA 5D41A 4JX3A 5ACKA 5BVKA 3QGWA 3RNYA 3LFEA 4FYNA 5CT0A 3UYSA 2BILB 5A4TA 5CAUA 2OSCA 3ET7A 4LL5A 4C62A 1PMEA 4UXLA 5HU9A 1GNGA 2P2IA 4HGLA 4XG4A 4YJVA 5KCVA 4U8ZA 4O2PA 4G34A 4FT0A 5IKWA 5F9EA 4FSNA 4BC6A 4QMLA 5AP1A 4BYJA 2JC6A 1Q62A 2VWIA 3R00A 3L8XA 4EWHA 2JD5A 4DHFA 3R22A 3MI9A 4FSTA 1ZARA 5IQEA 3F3VA 3BX5A 2HZ4A 3C51A 3VRZA 3LLTA 4MF1A 4IH8A 4FL2A 3C0IA 3F3UA 3GBZA 3UJGA 2XP2A 3ELJA 5EM8A 1P14A 3BYMA 5J87A 3UGCA 4A7CA 1ZRZA 4ASEA 5HVKA 2RGPA 3ANRA 3HV3A 5KMLA 4ACDA 5TO8A 5AP7A 2Z02A 3NUUA 2CLXA 2Q0BA 4GCJA 5J1WA 2VO6A 2R7BA 3CJGA 2VGOA 2PSQA 4FKVA 1KE8A 3KMWA 1OIYA 4QMSA 2X2LA 3C0GA 4Y72A 4U5JA 3VIDA 5GJGA 2G2HA 4BDIA 3AG9A 5L2TA 3D7TB 3A61A 4FV8A 3UQGA 5L6PA 1LR4A 2PTKA 4I23A 4RT7A 4A9RA 4O7WA 3TEIA 4BTFA 5FM3A 2PMOX 2UW3A 3P9JA 3DDQA 4LV8A 4QPAA 3RJCA 5EFQA 4AOIA 4TYEA 5CVGA 5HOAA 4XG2A 3F2RA 2ZMCA 4K33A 5M07A 1OZ1A 4O7LA 3OG7A 1KOBA 2HZ0A 3VUIA 1MUOA 4KBKA 3QYWA 3NGAA 4QOXA 4R78A 2RSVA 3P5KA 3Q60A 1PXNA 4BCJA 4FV6A 5KZ0A 2QQ7A 3RWQA 4AZSA 4KNBA 5AP4A 4DH5A 4HCUA 3ZEWA 2C6KA 1YKRA 3O0GA 3JXWA 4RQKA 1YXUA 3QQLA 5E8ZA 3FI8A 5HQ0A 4EQCA 3P23A 4IVAA 1ATPE 3RPRA 4NUSA 5I4NA 3EOCA 3HMOA 3R8UA 1UWHA 4ENXA 3RAKA 2GNHA 1WVXA 4RJ8A 5AWMA 5TF9A 2CNVA 5EQPA 4F65A 2WIHA 2W1ZA 2YM6A 4PQNA 3JY9A 4O0SA 3NMUF 5BUEA 4O96A 3G5DA 2BDWA 4FKQA 4PMTA 4JOAA 4QPMA 3UC3A 4IWPA 2Z7QA 4QMXA 4S2ZA 3CJFA 3T3VA 2VTNA 2X6DA 3GOKA 4E6QA 4ZLZA 2VWYA 3RAWA 3RPSA 2FGIA 3NUAA 2OW3A 4L3PA 5FG8A 5LMBA 4O81A 3CTHA 3B2WA 3QA0A 3R30A 4I6QA 4QYYA 4ZJIA 4OAUC 4O0WA 4F63A 1KE7A 5IA0A 3OTVA 3PLAE 2ZDUA 4U6RA 4ALUA 4FKGA 4FE2A 3E7VA 5BMMA 5BUJA 2YDIA 3UBDA 3L8PA 3T9IA 4U45A 4K8AA 4RWJA 2R3PA 1AGWA 4ZP5A 3EQFA 4GIIA 1OITA 3QX2A 2ZV8A 3QC9A 3U6JA 2CGWA 3GP0A 3ZEPA 4EK4A 4BTMA 4JJRA 2UW8A 4OUCA 3T3UA 1OB3A 5FDPA 3SKCA 1JWHA 5CALA 3DJ5A 3DZOA 3TZMA 4NIFB 3TZ7A 3RCDA 4QMPA 3V5QA 1GY3A 2XS0A 3QTIA 1OIUA 3OF0A 3QTXA 1B6CB 3DU8A 4FV0A 4WHZA 3EZRA 2UW5A 3AC5A 1GAGA 4XG9A 5FD2A 5IUIA 4DG2E 4FR4A 4XBRA 2J0LA 2OI4X 4FMQA 2PE2A 3TKHA 3CBLA 3UIUA 5HCYA 1UU7A 3VUKA 4TWCA 2WEIA 2Z7SA 2Y4IB 3QL8A 4U42A 4E20A 4BR3A 2ZVAA 3FQSA 3PJ2A 4GIHA 5DLSA 2R4BA 1JPAA 2VTOA 1YXTA 3QYZA 4QMOA 4CGAA 5J95A 3F66A 4A9TA 3QQHA 4S30A 2WMSA 2FO0A 3HNGA 2EB2A 1G5SA 3R0TA 4J99A 3LKMA 3F6XA 5HO6A 5HZNA 2QOCA 3M2WA 1NY3A 4RWKA 2YA9A 2XEYA 4ANMA 4EH3A 3EN9A 3V5JA 3DLZA 2JDVA 3R04A 3OD6X 3R7EA 3SRVA 1LEWA 1XR1A 4OTHA 3ZYAA 4QMQA 5J5SA 3QU0A 3QTZA 2BZKB 5A6NA 5CSPA 3R7OA 3B2TA 4TY1A 5J8IA 2PUNA 2BUJA 2GSFA 2R3OA 3L9PA 4YURA 2W9FB 1O6KA 4OR5A 4MXZA 4FKUA 5K3YA 4G1WA 3FHRA 4KRCA 4D55A 2BRHA 4GFGA 3DNEA 4GV1A 2ITOA 2GHGA 2WMQA 4CYIA 5KHWA 3U6IA 4AGWA 1WVWA 1KSWA 2OGVA 5HICA 5IISA 1J1CA 4U80A 2XCKA 1TVOA 3Q52A 4OTQA 5AR3A 3LVPA 2DWBA 3A60A 3MN3A 2BRNA 3N51A 2FSTX 2JAMA 3E3PA 4I0SA 4O0UA 3QALE 4UALA 2PVYA 2XNBA 5E91A 3U87A 4YLKA 4ACGA 1CDKA 5KMNA 4BGGA 5KMKA 4H3BA 4PPBA 3AMBA 4YJPA 1OPJA 3KGAA 5AV0A 4KUJA 4BHZA 3O23A 3BEGA 3BGQA 4PTGA 4U41A 2JDSA 5HBHA 1MQBA 3DS6A 5EYCA 4ASZA 3VHKA 4OTDA 3RNIA 3U9NA 3QFVA 4RGJA 2ITYA 4ERWA 5AFVA 3I81A 1FVVA 4FTTA 5D7AA 3FYKX 2UVXA 2VO0A 5JH6A 4UZHA 2HIWA 4YC6A 5AMNA 1GIIA 2ITNA 5HI2A 1HCKA 3PG1A 3VVHA 5AM7A 1PXPA 3Q96A 2ZDTA 3S3IA 4G9CA 4BWKA 3ZRKA 4BHNA 3WZEA 3VS2A 2ETRA 1REKA 3CKXA 4F1MA 4PPAA 3C4FA 5EK7A 3GCUA 4LRJA 4M69A 5FEEA 3VW6A 4MNEB 4AZWA 5B2LA 4DT9A 3JS2A 2G15A 1XH4A 1VJYA 2C5XA 4QMZA 3FZTA 3CKWA 3PY1A 3JUHA 4LG4A 4CMTA 2BR1A 2C3LA 3HMPA 5FTOA 3O17A 5JMSA 2NRUA 3D83A 5L6WL 1YQJA 4IAAA 4QYEA 3PXRA 3UO4A 4ACMA 2VD5A 5LVMA 4KKHA 4BTJA 4EOIA 2EB3A 3BU3A 1Q8ZA 5C8NA 3I0QA 4RC3A 4PNIA 4RSSA 3UE4A 2H9VA 3QZFA 4FUYA 2WTKB 5G6VA 4CMOA 1XH5A 3ETAA 4AZEA 5DH3A 4D2PA 5L2IA 1OKVA 3MIYA 4HYHA 2YCSA 4MTAA 5EM6A 3ZUUA 5AA8A 4FEWA 3V04A 2PVRA 2J5EA 1SMHA 4OT6A 4EOJA 3Q6WA 5BUIA 1FMOE 4FEQA 1Y6BA 4FC0A 4IADA 5IDNA 3HLLA 4O1OA 3K5VA 2BVAA 5D10A 3DKOA 3GUBA 4BCFA 4E6CA 4EUTA 2WQMA 4E3CA 3U54A 3PJCA 2XF0A 2BRMA 1PJKA 4L8MA 5B2KA 5CASA 1H1WA 4JQ8A 4DAWA 5CNOA 4JDIA 4OBOA 5I0BA 3BHHA 3WF7A 4FG9A 4PL4A 3O8TA 4I93A 3CTQA 2CKPA 5IQGA 2VRXA 3E62A 4B99A 3MVLA 2Y6MA 4ZTSA 3KB7A 2UW9A 4H05A 3UOJA 5JGBA 4C8BA 4MD7E 3ZONA 1U46A 4KD1A 1I44A 2X8EA 4FX3A 2YCFA 5L4QA 3REPA 5AJQA 4GRBA 3FLWA 4QMYA 1M14A 4U3ZA 4IB0A 4F09A 1GZOA 4J52A 3W2OA 3FV8A 4PPCA 1Q3WA 3FZSA 3S00A 3EKNA 3NNVA 4CFUA 5E8VA 4DGOA 2C0OA 3JY0A 1KWPA 3ATSA 3NWWA 2JKKA 1ZMVA 1M2RA 5HG7A 4D9TA 1CKPA 4YTHA 1UNHA 4C2VA 3EJ1A 4QMTA 3O50A 4YZNA 1BL7A 2YLEA 2GTNA 3MA3A 1F0QA 4QP1A 3VF9A 1ZOEA 3H30A 4EH2A 4G6NA 4HYUA 2QD9A 4RLLA 3ULZA 3VUTA 3FPMA 5CU2A 3NSZA 4D5KA 3NAXA 4EHEA 1QPEA 3K5UA 4G3CA 5IG1A 5AV1A 2CHLA 1VZOA 3IONA 4FTJA 4G3EA 5DT4A 4K18A 3U4WA 3WIKA 4GSBA 3TNQB 2B4SB 5EM5A 5HTIA 3DTWA 2ZYBA 2SRCA 2WD1A 2J5FA 3OWJA 3SLSA 3FZOA 3NW5A 3QRKA 4BZDA 2W7XA 4ONAA 3RZFA 5AV2A 2QOHA 2QHMA 3LXPA 4R5YA 4XOZA 3RMFA 4FTNA 3O2MA 4Y95A 4FICA 3DK3A 5FBOA 3O51A 4HCTA 4DH3A 4BBFA 3E8NA 2R64A 4O91A 1YOLA 4CLIA 5A9UA 1DAYA 5K9IA 3C50A 3BLHA 4EYMA 2VAGA 1J91A 4QQJA 3LJ1A 2Y4PA 4AZVA 4QQTA 1NVQA 2R0UA 2XIYA 4X0MA 1NW1A 5FXQA 3DPKA 3ORZA 4FG7A 3ZLYA 3AD4A 5AP5A 4RC2A 2J7TA 4MXXA 4EEVA 5IQIA 4AZTA 1OPLA 1PY5A 1ZLTA 1OKWA 3KXXA 4FBXA 5HHWA 5FUTA 2J51A 1ZY4A 3IW5A 4U0IA 4QTEA 3PWDA 4X2KA 3R8PA 2C3IB 4D2RA 4IX3A 4D5HA 5K5NA 1SZMA 2VTSA 5DVRA 5K0XA 5CTPA 2NPQA 3KXNA 4YHFA 2QO9A 5TE0A 4YPDA 4YJQA 3D4QA 5EHYA 2XK4A 3BQCA 2RKUA 5GINE 4NIFA 5JEBA 3FI3A 2OJIA 3WIGA 2W1CA 5JT2A 1VR2A 4AFJA 5IQBA 5JN2A 3MA6A 5CSXA 3IQ7A 5KMMA 4QP6A 4YSJA 1OL2A 1OUYA 2P2HA 4WBBB 4PTEA 4ENYA 2QODA 3NZ0A 4OTRA 4KABA 3KQ7A 3W2QA 4ANLA 4D2VA 3E3BX 3KEXA 3R7UA 4N57A 2YDKA 3BV2A 4QP8A 2XKFA 3SX9A 5HIEA 5F1ZA 4R3CA 4BIEA 2VGPA 4GUBA 3CCNA 4CKIA 2ZM1A 4WNOA 2UUEA 3GFWA 3TV7A 3DGKA 2WIPA 3MV5A 4I5PA 4BI1A 4O82A 3H10A 4FZDB 2XKCA 1ZXEA 2W17A 4FKPA 2NP8A 4JAIA 3DJ6A 1FPUA 4JX7A 3VJOA 1KOAA 1KV2A 1Q99A 1ZYJA 2B53A 3I79A 1Y8GA 3PSBA 3QCYA 3QGYA 3ZUTA 4O7YA 3P86A 2F7XE 4WUNA 4AA0A 1PXOA 2YABA 4HCVA 5BVEA 3S2PA 4ZIMA 4MEDA 4QT1A 3VUDA 4ZTLA 3TUCA 4O84A 4GU6A 4FOBA 4EYJA 2EXCX 1RJBA 2YITA 1WMKA 1U59A 4MHAA 3FYJX 2VTTA 3QZGA 4FVPA 5E92A 3VS5A 1IAHA 4BI2A 3A62A 1O6YA 3SVVA 2V62A 3GVUA 2JIIA 3COHA 4QTDA 2YJRA 2YLFA 4ASXA 4BF2A 4KSPA 2RG6A 4PV0A 3FMDA 3OWPA 4YUQA 3MY1A 4NTTA 3V5TA 4NM0A 2UW6A 3DTCA 4MCVA 2IVTA 5FEDA 1BL6A 1QMZA 2GNLA 3KFAA 3OC1A 2VTQA 3ALNA 3KA0A 5I5ZA 2Y8OA 3ZS5A 3JPVA 5L8LA 5M55A 3OROA 4USEA 4I0RA 3K3JA 3FLSA 4L68A 1H1RA 2PVJA 2XYUA 3QD3A 2XK9A 1U5RA 2VWBA 4GEOA 4E4MA 3R7YA 4BZOA 4N4SA 3WZKA 4IM0A 5HGIA 3UG2A 4FZ7A 5CS6A 3FSFA 3TCPA 5CEIA 5DEYA 2E9VA 2RF9A 1GJOA 3DB8A 3MPTA 4FV9A 5M56A 2LGCA 3QWJA 5F94A 3LFDA 4EZ3A 4U81A 1MRUA 2FUMA 2OFUA 1SNUA 4HZRA 2OXXA 4JDHA 4JL9A 1WBSA 3JVRA 4F0GA 3GC7A 5GNKA 3BGPA 5IQAA 4DE4A 2IVUA 5T6KA 2QNJA 1NA7A 2YCQA 3SW7A 3B8QA 3JR1A 3HP5A 2BFXA 2OF4A 3R7VA 2QOKA 3W2RA 1IR3A 4TWNA 4F64A 2J90A 3P78A 5CSVA 1XH9A 4NT4A 2VTJA 3D94A 5AV3A 3PIXA 1RE8A 3GU4A 3F3TA 4FTMA 1JVPP 1OL1A 2XMYA 1Y91A 3LQ5A 4XYFA 3EZVA 4YPSA 1XBCA 3ENHA 4IC8A 3UC4A 2YM3A 5J1VA 3BHYA 3IG7A 3Q32A 4M97A 4X3JA 2KTYA 4WSYA 4XLIA 4O7VA 4I0TA 1YXVA 3VAPA 5CWZA 3DCVA 4F99A 5B2MA 5IQFA 2W1IA 3P0MA 2XK7A 4RX9A 5EW3A 3M11A 2HW7A 4KKEA 3FXWA 3OVVA 5KBRA 5A46A 5LOHA 2XBAA 3SXSA 2R3QA 1OECA 3MPAA 4E93A 2R3HA 3SW4A 3BE2A 3A8WA 3ZZEA 5CNNA 3EH9A 3IPHA 5HO7A 1ZYLA 5FP6A 3Q4TA 1J1BA 3AC3A 4RZWA 2VWZA 4YJSA 4NYEA 3FLZA 2W4KA 4PDPA 3ITZA 4G5PA 4M66A 4J96A 4CRLA 3BYVA 4XV2A 5DR6A 5ANOA 5E9EA 3BU6A 5HX8A 2F7ZE 2RFSA 4Q5EA 1DI9A 3C4WA 4O7SA 4I5HA 3D14A 3PLSA 2ITUA 3RK5A 1LPUA 1M7QA 2BAQA 3ORIA 4YZ9A 3R2BA 4NWMA 3BYUA 4X6QC 3HECA 4LGDA 4NW5A 4BB4A 3DT1A 4JVGA 2XJ2A 2C5NA 5CF4A 2C6LA 4HPTE 2PMLX 4QMVA 5HLPA 3A2CA 4P5ZA 3I7BA 4RG0A 3TWJA 4MH7A 4AT5A 5BX0A 5C8KA 3N4UA 4YHJA 2UVYA 1YI6A 4CRSA 2CN8A 4BBEA 3CGOA 5EW9A 5CU0A 4PDYA 3SG9A 2V5QA 3P4KA 2YAKA 1ZOHA 3ZRLA 3R21A 4ZY6A 4CXAA 3GQLA 4FV1A 3VUGA 5M06A 5IA1A 1MP8A 2I0EA 4A06A 2VTPA 4LRKA 4P4CA 3EYGA 1YHVA 3ZO1A 4XLVA 4BWXA 4EQUA 5FXRA 2YISA 5ANDA 4CFNA 2C0TA 3KMMA 5CSHA 5H8BA 4RC4A 4FTOA 4O0TA 4YZCA 4CYJA 3ERKA 4FKSA 4IX4A 4FL3A 2X6EA 1ZMWA 4IW0A 4QNYA 1PMUA 1PXIA 2VWUA 4R3RA 2PYWA 3TT0A 2HWPA 4P90A 4W9XA 3HAVA 4FSUA 2BTSA 4Q5HA 2B9JA 3WF5A 4C4HA 4RJ6A 3UO5A 4FEVA 3UNJA 4XX9A 1XBBA 4PX6A 2PUUA 3SQQA 2H34A 3ZXTA 2X7FA 5DHJA 1V0PA 4ZTNA 5IMEA 4KKGA 3LFSA 3NW7A 3RINA 4DGMA 3O7LD 5KO1A 5JGDA 2J0IA 4IWOA 3KK9A 5G1XA 5M4CA 2Y0AA 5HCZA 3ODZX 2IVSA 1IAJA 2WXVA 1PXJA 3W55A 1T45A 1ZWSA 4FSYA 4AOJA 4BN1A 2AC3A 3OHTA 5BVFA 1CKJA 3VW8A 2Q0NA 3W10A 5GZAA 4YBKA 1H8FA 2B55A 4TPTA 2W5AA 4DBNA 4F1TA 3D5UA 3DB6A 3PJ8A 3EQCA 3LZBA 5DGZA 4EC9A 5CVFA 5IDPA 3PDTA 2Q83A 1YRPA 5CEQA 4DLIA 4X2GA 5ACBC 4W8DA 4PDOA 2GQRA 2XEZA 5CU4A 3R73A 1V0BA 4FEXA 3W2PA 5IU2A 1E1XA 2O3PA 2P4IA 2ZB0A 1IA9A 1FGKA 4NJ3A 2B7AA 4FTCA 4O6EA 4UMRA 3TIYA 3NCZA 2JGZA 4YJRA 3UIXA 4Z3VA 2UZLA 3HEGA 3HV6A 4UEUA 4CZTA 2UV2A 4KAOA 2R3GA 2J0JA 2YACA 3LCDA 3NS9A 3NNUA 4FTAA 3FMJA 5HE2A 4IB5A 1R78A 5CT7A 2ZM3A 4K2RA 3UIMA 1PXLA 3QD0A 2WTWA 4I20A 3WYYA 5AAFA 1W98A 4XMOA 3HRCA 1DM2A 3MDYA 4CTCA 4GS6A 3W8LA 3VQHA 4BY9E 1ZAOA 5AUZA 3V3VA 3IO7A 3WOWA 2CDZA 3Q4ZA 3C7QA 1ERKA 4R1YA 4DYMA 4LQMA 5M51A 5I3RA 4RJ4A 3WZUA 3QLGA 5ETIA 5D7VA 4LM5A 1P4FA 2XB7A 4MVFA 3TZ9A 1M17A 2PVKA 2GU8A 3UODA 3H4JA 2RG5A 3B8RA 4JBPA 1XH8A 4DEAA 4FOCA 2CKEA 3A99A 2ITTA 4APCA 1OMWA 3DAEA 3HYHA 3R2YA 2UZNA 5CU6A 3SXRA 4CG9A 3VS1A 3VF8A 1YVJA 2ZV2A 4TKSA 4YTFA 3DXPA 4ZTRA 4G3GA 4FKJA 5J5TA 2CKOA 2DUVA 5H2UA 2Y7JA 1DI8A 2ETMA 1K9AA 1CTPE 2QVSE 3G6GA 4MD8E 4EZ5A 4F9CA 4YMJA 2QOQA 2BZHB 3IW4A 4JS8A 5BVWA 4BDGA 5IF1A 5EDPA 5IEYA 5JFSA 3MB7A 1SVHA 3AMYA 3NCGA 4MNFA 5ANGA 5EW8A 2C6MA 4HVIA 4Z9LA 2C6OA 3UZRA 3ORNA 3BKBA 3F69A 3KRWA 3LFFA 1NVRA 4MK0A 3RAHA 3BU5A 3ZRMA 4AUAA 4MQ1A 3GC9A 1WBOA 3CEKA 3E63A 3KXMA 1H1SA 3NRMA 2CLQA 4FUXA 4V0GB 3FMLA 4I1ZA 5DR9A 3PXKA 4JRVA 2QR8A 3ORLA 3PWYA 4QO9A 3DOGA 3EFJA 1CM8A 3TNPC 3C0HA 4AG8A 3C4ZA 1W83A 4D9UA 4U9AA 1Q24A 5CI7A 1FMKA 3EN7A 4JBVA 4BWPA 1KE9A 3NYOA 3P1AA 5ETCA 4QTCA 4O6LA 5DT3A 2F9GA 3MFUA 4WA9A 2QURA 4Y5QA 5T68A 3BV3A 5H9BA 4EH5A 3RM6A 2XJ1A 3ZC6A 4M84A 2PPQA 1XO2B 4L3LA 3H0YA 4JIAA 4D0XA 2J4ZA 3GEQA 3DBEA 3G0EA 3W1FA 2GDOA 3R6XA 2PU8A 3V8WA 4C57A 4BDHA 5LMKA 3M42A 3MVJA 3ANQA 3ZUVA 4QYFA 2UZDA 4IX6A 3FKNA 2OH0E 1YXSA 3HX4A 1YI4A 2DYLA 3CR0A 3OEFX 2X39A 3MVHA 4G6OA 1BUHA 3R01A 5GHVA 3UG1A 3W32A 2BAKA 4FYOA 4DLJA 5AX9A 3A8XA 2ZM4A 2UZBA 1SYKA 2WTDA 3DBCA 3PJ1A 3D5VA 3KXZA 3OOGA 3OUKA 3NUXA 5AP6A 2WGJA 5AR4A 4ANNA 3U4UA 4EJNA 3TUBA 5FTGA 4NFMA 3G6HA 1BMKA 1ZYCA 5E8YA 1FINA 4RVLA 4BCIA 4F4PA 2OZAB 5K4JA 1Q41A 1M2PA 2VU3A 2XA4A 3FMNA 4KIPA 3II5A 3WI6A 5CANA 3DLSA 4BFMA 5EDQA 2EUFB 2ITQA 2R2PA 2J2IB 2R3JA 3I6WA 3QRJA 3UVRA 4AW5A 4UMUA 5CVHA 2PL0A 3AC4A 3FLYA 3N9XA 5T3QA 5IQDA 2W96B 4E5AX 5IPJA 4XRJA 1VYWA 1UVRA 5AR7A 3PY0A 4NM7A 3CPBA 2VTMA 4EOPA 1UA2A 3THBA 2VTLA 3ODYX 4QTBA 2X4FA 4TTHB 2OZOA 4WD5A 3MY0A 3P7CA 4N70A 4QYHA 2GFCA 3I0OA 2FSMX 4QQ5A 1H24A 4CKRA 3LXKA 4FNZA 1G8SA 2ERZE 2HY81 3FUPA 3GGFA 3LCSA 4JG8A 4W4YA 2EU9A 5DA3A 4JDJA 4EOKA 3BELA 2XM8A 3FAAA 4ZS4A 2VNYA 2GTMA 3OBJA 4HVHA 3CSVA 3LMHA 2A0CX 2VO7A 5BVNA 1FVRA 4QP9A 5JRQA 3Q9XA 3ZM4A 4YTIA 4P5QA 3WF9A 4IFCA 4LMNA 2C5OA 4GKHA 3G9NA 1OL5A 4GH2A 2HWOA 2WTCA 5M4IA 2YM8A 4MXAA 4RIYB 5HG8A 2CNQA 4OAVB 2YM4A 3DJ7A 4ZTQA 4ZZMA 4BCGA 2PMNX 2GS7A 4GT3A 4J1RA 3KU2A 3EFWA 5LWNA 4LGHA 3EWHA 3Q6UA 4ERKA 4YHTA 4KA3A 4MF0A 3TL8A 4E1ZA 3GCPA 4C4EA 2X2MA 4K0YA 4XJ0A 4ZY4A 3VN9A 1UKHA 4O7ZA 1Q3DA 2WELA 5BPYA 4R7BA 3TDWA 4CD0A 3CLYA 3OOMA 4LYNA 3QAME 4ZS0A 3TJCA 1ND4A 2KULA 4QMNA 4EOOA 3R8MA 4CFFA 2W1FA 4IFGA 1MQ4A 5JFWA 3ENMA 1UU8A 1JSVA 4WOVA 3NX8A 2C6TA 3I4BA
chains in the Genus database with same CATH superfamily
5HTCA 4O4CA 1KV1A 3GOPA 4OTFA 2JAVA 4XV3A 4BDCA 4GG5A 3LMGA 4X2JA 4CCUA 3NNWA 4FT9A 4DFZE 1H1QA 2PZPA 3VJNA 3QKLA 4Q9ZA 3D2KA 4NM5A 4D58A 1PF8A 2JKQA 3UZPA 4CQGA 5HESA 4JLCA 4E73A 2OG8A 1SNXA 4LI5A 4X3FB 4EH6A 2GNFA 3BI6A 1W8CA 4TWPA 2WMUA 3QC4A 4NCTC 4DEIA 1FQ1B 4X2NA 5DG5A 4BL1A 5LVOA 4R8QA 3O96A 4FODA 4GVAA 4R7HA 4EHVA 4QDVA 1R0EA 2I6LA 4S31A 2PK9A 1LEZA 2C68A 3QF9A 4D1ZA 3D9VA 4IXPA 2IPXA 3ZSIA 5GJFA 4BDEA 2JKOA 1ZYDA 3HRBA 3QXPA 4CFVA 5KMJA 4IC7A 4AAYA 2VV9A 3QTQA 3FL5A 2XNGA 2X2KA 2X7OA 3GU8A 3UP2A 3UO6A 3LJ0A 2I0HA 3DQWA 3GI3A 4GFOA 4QP2A 4Y85A 1YOJA 3TACA 3W18A 4F0FA 4PNKA 5AADA 4B4LA 5DYJA 3W0RA 5LMAA 5E90A 2P33A 4D2SA 2C3JA 2BTRA 3AXWA 1Q8TA 3EYHA 4C2WA 2EVAA 3DNDA 3FI4A 2OJGA 3GCVA 3PG3A 4DFUA 4BCNA 3D2IA 5AP0A 3VNTA 3VS3A 2H6DA 4XG8A 5CQUA 2C30A 3VBVA 4FTKA 3R9HA 4M7IA 5FLFA 3M1SA 4PRJA 3KKVA 4FV7A 3H9RA 2YWVA 2IO6A 4YO4A 4FJVA 1XBAA 4G3FA 1JKSA 2GS6A 4L53A 2XRUA 2JFMA 3MWUA 4IZ7A 2A1AB 4L45A 3PRIA 5DI1A 4ZJVA 4N6ZA 2O63A 2OWBA 5TKDA 3QBNA 2F2CB 2GNIA 1XHAA 3CP9A 2XK8A 3QTRA 2WTVA 4TWOA 1P4OA 1W84A 3QRTA 4WUAA 2XAOA 3ROYA 1H1PA 1QCFA 2H8HA 4KB8A 4I41A 4O0VA 2W1DA 2OIBA 4H58A 1H26A 1QPJA 3BIZA 4ITHA 3ZMMA 3BPRA 2O65A 4FGBA 3FLQA 3NLBA 2I1MA 1IRKA 4JR3A 3DDPA 4ANBA 3DXQA 4CCBA 3CE3A 3LW0A 5L3AA 4W4XA 1ZYSA 2HYYA 1S9JA 3VS7A 1Y6AA 4FG8A 5CI6A 3O7LB 4B8LA 2W1EA 2GNGA 4YZBA 3BQRA 3C5UA 5AP3A 4AS0A 4FA2A 4PP9A 4HVDA 4BTKA 1R3CA 4F08A 1WCCA 1UU3A 5DFPA 1URCA 2WNTA 4EZ7A 4NW6A 4R7IA 2OJJA 3KF7A 3D7TA 3KC3A 3OWLA 4UMTA 2FSOX 2XK6A 4EKLA 5FQDC 3NVMB 5HO8A 3GQIA 3TJDA 1OKYA 2OF2A 3V5WA 3D15A 4FV5A 3S4QA 2BFYA 4ANOA 4FIIA 2XJ0A 5GZ9A 4AN2A 4MUQA 5AIKA 4RA4A 5HBJA 4Y83A 3GXLA 4I22A 1Y8YA 2LAVA 4AU8A 2ZJWA 3CC6A 3E88A 3H9FA 3TYKA 3HA8A 4RWIA 2ERKA 3PUPA 3RALA 3KREA 2QOIA 3LM0A 2E9NA 4V0GA 2JEDA 4O7NA 1KE5A 4DT8A 4FKTA 3L8VA 4R5SA 4UWYA 3F2AA 4D1XA 2YWPA 2YERA 4NU1A 5I9XA 5HORA 4CFXA 4O38A 3GFEA 1AD5A 1JNKA 4BGQA 4R77A 5IA5A 3OWKA 1UV5A 4FIGA 4FKRA 3KXHA 3RGFA 3FXXA 2A27A 4GK4A 3ZU7A 4AACA 4F7JA 1VEBA 1M7NA 2C4GA 4UYAA 4LOOA 4ZZOA 2WOTA 3OW4A 3ORKA 4EH4A 5C8MA 4FGRA 1W2DA 5CENA 5A4LA 3E8CA 5HD7A 4HZSA 4PY1A 4IQ6A 2C69A 3AKLA 3DKCA 3MW1A 3SV0A 5BVOA 3LM5A 4Y73A 5M08A 2IW6A 4H3QA 4HYSA 4UX9A 4L9IA 4FIEA 5IUHA 4PL3A 4KBAA 4V04A 3EQPA 5KE0A 4QMUA 4OTPA 3DAKA 3BCEA 3RPOA 4JT3A 1PMVA 1YWRA 3O71A 3OZ6A 5C27A 5JKGA 5JZJA 2PZIA 4AT4A 2R3NA 4DTAA 4ID7A 2JKMA 3KCKA 4I5CA 3CQWA 2PVNA 3OEZA 1DAWA 3QUEA 4W9WA 1FGIA 2OZAA 4M67A 2VZ6A 3V6SA 3BWJA 1TQMA 1RQQA 3BLRA 3ORXA 3BHTA 3ZOSA 3F88A 3KN6A 4Z7HA 2GCDA 3PIZA 4YGAA 1A9UA 2ZB1A 2QR7A 4HGTA 4IACA 4O0YA 5HLNA 3OUNB 2Y6OA 5IEXA 4IZAA 4V05A 2B9HA 2WU7A 2BROA 5DE2A 5LQFA 3COIA 4RMZA 3LCOA 4DHIB 4TYHB 3CY3A 5IEVA 1W82A 5J79A 4A4OA 2V7OA 5AX3A 1JQHA 3AGLA 5K5XA 1Q61A 4GU9A 2XK3A 4GT4A 3KRJA 4AA5A 4CKJA 1Z57A 3BBWA 3FL4A 3LE6A 3G2FA 4EHGA 2PZYA 1H28A 2QLUA 3RI1A 4BCPA 3OY3A 3HZTA 3ORMA 4EWQA 2C1AA 3QKMA 4BCKA 4PP7A 5BYLA 3NYNA 3QQGA 5AP2A 3QRUA 5FWKK 2C3KA 3GCSA 4JAJA 3NEWA 4WO5A 4U97A 4BRXA 3F5XA 1TQIA 2ZFYA 1Z5MA 2WQNA 3RPVA 4B6LA 3PXYA 4ZMEA 3FKOA 1JKKA 4MXYA 4NKSA 2JIVA 4P7EA 3PIYA 2XNOA 2PVLA 4DEGA 4F7LA 5BVDA 3MESA 3MJ1A 3FBVA 2CCHA 4GK3A 2ACXA 2XYNA 5CF6A 3RM7A 4F7SA 3TTJA 3OBGA 4ZSEA 4O0RA 2CSNA 4RJ7A 4GUEA 4DF3A 4F9YA 3DK7A 2RFEA 5JSMA 3QQJA 5C4KA 2VX1A 2E9OA 4R3PA 4WG3A 2C0IA 1YOMA 1G8KA 2JBOA 5EI2A 4MBIA 2B9FA 2W99B 5I9VA 1G8AA 3KCFA 4LV5A 2A19B 1IA8A 4TN6A 1YWVA 3RK9A 3TXOA 3E64A 4TNDA 2CN5A 3KK8A 2O5KA 4HOKA 4J8NA 4RIWB 2NO3A 3KVWA 3C1XA 2VTIA 3KULB 4DITA 4E4XA 4X3FA 3R1YA 2R5TA 5FBNC 4KS8A 4EBWA 1URWA 5KMOA 4DGLC 1O9UA 4O7RA 3MVMA 2PZRA 3RHXA 3PVWA 1HOWA 1M52A 4BICA 4IZ5A 3IKAA 3HV4A 3HKOA 5EG3A 3UIBA 2HOGA 3TV6A 2IZTA 4FT3A 4QNAA 2UW7A 2QO2A 4F9BA 3DBDA 4IM3A 3DAJA 5C01A 1H07A 2BIKB 3SAYA 3D7ZA 3VS6A 4FSZA 4ITJA 3RKBA 5E1SA 1BI8A 2CKQA 3AD5A 3E93A 4MNEA 2WQOA 3W33A 5AUWA 4OW8A 3FQHA 2RL5A 3HVCA 3QLFA 4E4LA 3HL7A 3ZO4A 2VUWA 1OIQA 3QXOA 4JMQA 4H3PA 4L7SA 2UZVA 4AGUA 4DH8A 4E4NA 3MSSA 5FM2A 3SXFA 1XQZA 2Z2WA 4JDKA 3MBLA 1YWNA 2G1TA 3LFBA 3OCBA 3WARA 4TXCA 3E92A 4WNMA 5LCJA 3V51A 1BKXA 5DPVA 4Z16A 3P7BA 4A9SA 2QO7A 2YIWA 2XKEA 1NXKA 4KINA 4S33A 4EL9A 3FEGA 3VO3A 2UZTA 2BALA 3MTFA 4DEBA 5D12A 4C35A 3ZDIA 3COMA 2PE1A 4J7BA 4D4SA 5LVNA 2P3GX 2ZAZA 4B7TA 5IQCA 5EI8A 3I1AA 3E8EA 5F20A 1M2QA 5E8TA 1TKIA 2YM7A 5D9HA 3EQHA 4C7TA 2OLCA 2EXMA 4LGGA 4C4GA 3HV5A 1WBWA 1XJDA 4FF8A 4FZFB 2B52A 4I3ZA 5ANJA 5ANKA 4ALWA 4E26A 3ZLSA 5LARA 3DXNA 4ZTHA 4EI4A 3LQ3A 4CNHA 3IOPA 3ZZWA 4MKCA 5KX8A 4Z7GA 4O7TA 4GT5A 4LFIA 1F3MC 2C5YA 5GIOE 4AA4A 3QHWA 3KIOC 4AXAA 3F7ZA 3BBTB 3S1HA 3KRRA 1OBDA 4W8EA 4ZLYA 3HA6A 3KN5A 4RA5A 4F9WA 4YJUA 2OFVA 3WE4A 3Q04A 1ZZ2A 3RBWA 5HIBA 4QMWA 4MWHA 3FXZA 2VX3A 3NIZA 3QCXA 3SDJA 5DMZA 2B1PA 5E8XA 1YXXA 3H0ZA 4IAYA 4AFEA 2WMVA 4D2WA 2YIQA 4Q9SA 5J7BA 3PVUA 2HENA 3WF6A 4UMPA 2XNMA 1YI3A 3N4VA 5DRDA 2OK1A 3EQRA 3NIEA 2XNEA 4DHZA 1G8JA 5CXZA 5DR2A 3VS0A 4FSWA 4Z55A 5L8KA 2WMAA 4MYGA 5JFXA 3LCKA 3BYSA 4FKLA 2WHBA 3A7GA 4M68A 3EN4A 4YJNA 4HNIA 2QKWB 3P7AA 5HE0A 4EONA 4XP0A 3A7FA 4KWPA 1PHKA 4EUUA 4ANSA 1Q5KA 3DV3A 4EJ7A 3R8LA 4FIFA 4RVTA 2OKRA 2WOUA 4K1BA 4AW2A 3PPKA 5E8SA 3PYYA 1HCLA 4ZLOA 1ZZLA 5DT0A 5AR8A 5KHXA 4BIBA 4IVCA 2XVDA 1QL6A 2YM5A 2R3KA 4I24A 4BKYA 4S32A 3BL7A 1K3AA 1AQ1A 2F49A 5ETFA 5KBQA 2CJMA 4JG6A 1GIHA 1OUKA 3QTUA 2IW9A 3UPXA 3F5UA 2OU7A 4MQ2A 4YNEA 5JFVA 4YC3A 5TOZA 4H1JA 4G31A 2GHMA 2JDOA 3QCQA 2B54A 2BDJA 3PFQA 3Q5ZA 1YHSA 5KKRC 2QC6A 3FJQE 3IGGA 2FH9A 4B9DA 4E5WA 3L9NA 4GW8A 4J71A 4YLLA 4LUDA 4JIKA 4EH7A 4D1SA 1UWJA 3ZO3A 3U9CA 4ZTMA 2PULA 2W1GA 2ITZA 4FT5A 4BVUA 3E8DA 4AP7A 3LCTA 2WB8A 1YDRE 1SM2A 4G16A 5CXHA 3SHEA 3EFKA 3QTSA 2R3LA 4HVGA 4TZRA 2OXYA 5IA2A 1CKIA 2P55A 1OM1A 2IZRA 2PZ5A 4ZSJA 2GHLA 2IZSA 4XH6A 4FTIA 1GZKA 4KIOA 4CV9A 3W0PA 3GB2A 3SOCA 1UNLA 5M4FA 3K2LA 4U40A 2UZWE 2C6EA 5IUGA 3VWAA 3WYXA 4EK6A 4RVMA 3Q53A 3F2NA 5EM7A 2YFXA 3EQDA 3PPJA 3OY1A 5L8JA 4RQVA 2ONLA 3AKKA 5AUVA 5B0XA 2QU6A 3MY5A 5FXSA 3UPZA 3VS4A 3Q4CA 3GCQA 4HNFA 3BWFA 4AF3A 5KMIA 3KRXA 2UVZA 3HUBA 4AQCA 3RHKA 4AXEA 3TZ8A 3F7WA 3HRFA 4M0YA 3RTPA 1U54B 5L2WA 4EC8A 3C4EA 3PRFA 4RWLA 3NR9A 5HE1A 1LP4A 4F0IA 5BQ0A 4TYHA 2IJMA 5IA3A 3ALOA 4C3FA 5JZNA 4QPSA 2PHKA 2WMBA 3NPCA 5E7RA 4QRCA 4BDAA 2CNUA 4QD6A 3OCSA 3PA4A 3ZBFA 5E1EA 4CMUA 4CSVA 3NFFB 4DFBA 1H25A 3K54A 2XH5A 1OIRA 3CXWA 3ZDUA 3CTJA 4EOQA 4NH1A 3BRBA 3Q9ZA 1PW2A 2BDFA 4C38A 4WSQA 4IWDA 3PP1A 4BCOA 3CQEA 2JDRA 2VWVA 1FVTA 5H8EA 4IIRA 5BMSA 3MFTA 4Q2AA 4O4BB 3U51A 2YJSA 5LMKC 4U79A 1JAMA 4G6LA 4WNPA 2GMXA 4ZY5A 4D0WA 2C1BA 4X21A 5GJDA 3UNKA 3SC1A 3DFCB 3NUNA 4XV1A 3P08A 5FDXA 3EQIA 2G01A 3LFNA 4CZUA 5EDRA 3ZXZA 2C5VA 2I7QA 2WEVA 2PE0A 3LFCA 3PA3A 3IECA 4TL0A 1PRYA 2XRWA 3MPMA 4FIJA 3N4TA 4FV4A 4RFMA 5DBXA 4DTKA 1PYXA 4FTLA 1WAKA 4BCQA 5DNRA 3VC4A 4E6DA 5B7VA 3U6HA 3FMKA 4RX7A 3AMAA 2XBJA 5ANEA 3UTOA 3AC1A 3PZEA 1ZMUA 2G2IA 1XMMA 4C4JA 1H27A 3EQGA 4MBLA 4C3PA 2WTIA 4EOLA 3AC2A 3RZBA 2Z7RA 4RIWA 3UDBA 4ZJJA 4IB3A 3FWQA 4G3DA 4IJPA 2UZOA 5HTBA 4L00A 2BKZA 2PVHA 2X0GA 4X2FA 5HIDA 3VULA 3W2SA 2O64A 3KMUA 3KULA 2JDTA 3QQKA 3VHEA 1OL6A 5CAQA 5A54A 5F4NA 3RWPA 3HMIA 4AW1A 4C34A 2I0VA 1YW2A 4FNYA 3RAIA 4LUEA 4EQMA 2G9XA 3BHUA 4RIXB 3EB0A 4FZ6A 2E2BA 2Z8CA 3SD0A 2BMCA 2R3MA 3D0EA 3KF4A 3PVGA 4YNOA 1WBNA 3ZO2A 5HNBA 3CD8A 3LXNA 4NSTA 3POZA 5E8UA 3RVGA 3BZ3A 2UZUE 4DFYA 2WPAA 4IANA 5CEMA 4EH9A 2UZEA 3L1SA 3OTUA 4GYGA 4FKIA 3HP2A 4G2FA 3ULIA 4Y5HA 2PVMA 1LUFA 1ZOGA 4CV8A 2X9EA 4Y46A 4QYGA 4DCEA 4U43A 5ETAA 4G17A 3Q9YA 4EH8A 4QP7A 4WNKA 2JITA 4M12A 4UWBA 4D28A 5CF8A 5GZ8A 4IBMA 1R39A 2W4OA 4PL5A 4P2KA 4JNWA 4KIKB 4YSMA 3QQFA 5AM6A 4MXCA 2YIYA 5FGKA 3ATTA 4GJ2A 3FZ1A 3WBLA 1QPDA 2IWIA 5LWMA 4FZAB 2BIYA 2B9IA 3PTGA 4CT2A 2YN8A 5IQHA 3QWKA 1OGUA 2EWAA 3NYVA 2BZIB 2R9SA 3HV7A 3PJ3A 3HDMA 5EYMA 3UMXA 4O27B 5CZHA 4DH1A 2WMXA 4O0XA 5D1JA 4DINA 5KUPA 4RLKA 2V55A 4FSQA 3MGYA 1B38A 1H00A 2QLQA 3VRYA 3A7JA 4NEUA 3EKKA 5BYZA 3ZLWA 3JYAA 4DFLA 3BEAA 3F61A 5HKMA 4IM2A 4L46A 4UB7A 2XNNA 4F1OA 1BX6A 3O8PA 3BHVA 3QZHA 3IW6A 2WQBA 4J95A 3DY7A 4L01A 2WQEA 4JR7A 4FKOA 4UYNA 3S0OA 1UNGA 2HW6A 4K11A 5IA4A 2B0QA 2OICA 4UMQA 3JVSA 3LJ2A 4II5A 2RFNA 2X9FA 4XS2A 3LMIA 3WZDA 2HXQA 3R7GA 5AA9A 4O86A 4TRLA 4BI0A 3QRIA 4XG7A 4RFYA 2CGXA 4USFA 3MFSA 1PYEA 5DIAA 3KXGA 4K77A 5DEWA 2W9ZB 2IN6A 1YHWA 4RFZA 3LFAA 1P5EA 2YIXA 3F82A 3GT8A 4QMMA 3TV4A 3C9WA 3FE3A 4AN3A 4DH7A 1EH4A 2F7EE 2J9MA 5KNJA 1WFCA 4JG7A 4TT7A 3RPYA 2I40A 1OPKA 5I9UA 4YBJA 3VONA 1IEPA 2R0IA 3VUHA 4ZZNA 1H08A 1V0OA 4EBVA 1WVYA 4MAOA 4S34A 2V7AA 4J8MA 2BCJA 2YCRA 2GQGA 2YAAA 2BRGA 3A4OX 4FV3A 4GYIA 4YJOA 1SVGA 4EORA 3MS9A 3MYGA 5M53A 2F2UA 2X4ZA 2Z60A 3U8WA 2HAKA 2W05A 5LCKA 3ZTXA 1K2PA 4A07A 3TTIA 4IDVA 5ANIA 3MH0A 5BYYA 2IW8A 4DG0E 4DA5A 1UKIA 5E4HA 4I6HA 3LHJA 2BZJA 4AW0A 1L3RE 4C36A 5CU3A 3VBTA 4IWQA 4I94A 4ZSLA 4E7WA 2WTJA 3EN6A 4WT6A 1F5QA 2AC5A 3PXZA 3QCSA 3AQVA 3ORTA 4OTWA 1BYGA 4L3JA 4HW7A 4L43A 4PMMA 3QD2B 2WMRA 2WU6A 3PXQA 4GVJA 4ZSAA 1XH6A 4E5BA 4JBQA 1E9HA 3I6UA 4WRSA 4D2TA 3W16A 1O6LA 2C47A 3HMMA 4XEYA 1CMKE 4OLIA 2XIKA 4QP3A 4CVAA 3DKGA 5HVJA 2X7GA 4PDSA 5HCXA 3TG1A 2DQ7X 2OJ9A 5FEQA 5C1QB 3TKUA 3QQUA 4ANQA 1OBGA 3EN5A 1YDTE 1Q8YA 3G33A 4MXOA 1JBPE 5HBEA 4KIQA 1B39A 1R1WA 5DOSA 4NTSA 2GPHA 4DTBA 2XUUA 3OCTA 3A4PA 4UZDA 3EMGA 5F95A 4ACCA 3I5ZA 1J7IA 4FVRA 4RIOA 3TMOA 1H01A 3MFRA 4EOMA 4FNXA 2HZIA 2AUHA 3CIKA 3UDZA 1NT2A 4NFNA 4ZOGA 3LFQA 3L9LA 3W0OA 4N0SA 3ZH8A 4YJTA 3DBFA 3SA0A 4XOYA 2IZUA 2QOOA 5M4UA 3HAMA 4MX9A 3SG8A 3QUPA 3R9OA 4F70A 3FSKA 5J9YA 4HJOA 3F5PA 4C02A 4V01A 4CFMA 3OP5A 3K3IA 4N6YA 3TM0A 3IDBA 3FZPA 3R63A 3COKA 4DEHA 4CLJA 1JKLA 4RRVA 3AT3A 1Q8UA 2OIQA 5DN3A 1U54A 1GIJA 2ITVA 3CS9A 4KRDA 4XG3A 1JKTA 1WBVA 1S9IA 2QHNA 2OJFE 3ORPA 4O22A 3OT8A 4C37A 4GFMA 2PWLA 3IW7A 4YU2A 3ML1A 1PMNA 5EQEA 4I92A 4UV0A 5E8WA 2BHEA 3G0FA 1GZ8A 4F6SA 1Q97A 3TNWA 1A48A 5EYKA 3QUDA 5FP5A 2EXEA 2BHHA 2E9PA 4NCTA 5FTQA 4L52A 3NNXA 4OBPA 1MRYA 4K9YA 4RZVA 5CLPA 3POOA 5CEOA 3VBWA 1DS5A 2BKKA 5EYDA 3PP0A 3UQCA 5IH6A 2VWXA 2CGVA 3E5AA 3FZRA 3PXFA 4BGHA 3WE8A 4OT5A 2R3FA 2FA2A 2GNJA 4CFWA 4YP8A 4EOSA 5JQ5A 2X0PA 3D5XA 3H3CA 4IVBA 3OT3A 4KS7A 4NM3A 4XHKB 4ALVA 3C5IA 4IEBA 5HE3A 4C4FA 5AUXA 2HCKA 4IMYA 4FK6A 4WG5A 3VBQA 3SGCA 2XM9A 4MD9E 2JLDA 4XV9A 4YZMA 4O83A 4RVKA 4L6QA 4I4FA 2W5HA 4WKQA 4BDJA 5C26A 5IMXA 3MH3A 3NUPA 3QKKA 4JQ7A 5HNIX 2ESMA 4JBOA 2F57A 4IAIA 4L44A 4PUZA 1A06A 2YDJA 4EK5A 1R0PA 4ITIA 1VLRA 1J3HA 5HLWA 4O21A 5LVLA 1BI7A 2NRYA 3C4CA 5EOLA 5HX6A 1BLXA 2QG5A 3MTLA 4APPA 2W5BA 2W0JA 3WILA 3BLAA 3FC2A 4IHPA 3Q4UA 4PMSA 4IX5A 4DG3E 5A3XA 3P79A 4H39A 3LQ8A 1W0XC 2J6MA 2FYSA 4ZEGA 3TNIA 1WBTA 4NK9A 3DQXA 2CGUA 3EL8A 4B0GA 2WZJA 4GJ3A 3TNHA 3LAUA 4XBUA 4YO6A 3D5WA 1PXKA 4A4XA 5I9ZA 4RIXA 5DWRA 5HVYA 4BJJB 3U55A 2Y4IC 3PZHA 4L67A 3Q5IA 4U3YA 2OO8X 4BKJA 2VNWA 3V5LA 3UNZA 3BL9A 4JQEA 3PY3A 3R02A 3ZFXA 3FLNC 2QOBA 4KSQA 4NZWB 3PE1A 4JXFA 1SVEA 3QZIA 1NVSA 2GFSA 4C3RA 5A4EA 3R28A 5AUUA 4FSRA 4W4VA 4M15A 1RDQE 3ROCA 4ZAUA 4AGCA 4RBLA 3BGZA 1OI9A 1WBPA 5A14A 2PMIA 4FKWA 5EHLA 3DK6A 4KBCA 3GU7A 3AGMA 4BDKA 2CPKE 2WFYA 4BYIA 3GNIB 5EOBA 5KZIA 4KIKA 4UY9A 3RK7A 1ZY5A 1XWSA 2A2AA 2E9UA 5C9CA 4BZNA 5C4LA 5H3QA 2VO3A 1PKGA 3PE2A 4A9UA 4F7NA 2FSLX 1JSTA 3PA5A 2ITPA 3NUYA 4ZMFA 4DEDA 4FI1A 1U4DA 4HPUE 4A4LA 4ACHA 1APME 1CSNA 4M0ZA 4F6UA 3DA6A 3PSDA 3OS3A 5AR2A 4IE9A 2G2FA 1PXMA 1REJA 3AOXA 4XP2A 3ZLXA 4TYJA 4USDA 4DGNA 2VWWA 2XCHA 5LXMA 5EQYA 4WBOA 2CCIA 4BBMA 4ZXTA 2FVDA 5C03A 4AOTA 3R71A 4QDEA 1T46A 4D4YA 2JBPA 1L8TA 5EKOA 3R83A 3OW3A 1IG1A 2A4LA 4LDTA 4XG6A 4YLJA 4QQCA 3HDNA 4GL9A 1Q8WA 3NW6A 5AIRA 2UW4A 1OL7A 5CAOA 3EHAA 4X3FC 3PPZA 2VTRA 4L42A 4XNEA 5L6OA 3CPCA 5CYIA 3BE9A 2OH4A 5I9YA 3F5GA 5JQ8A 4RIYA 3NYXA 5L2QA 1OGYA 5I9WA 2NNWB 4QP4A 3VBYA 4GMYA 3FKLA 3DBQA 1Y57A 3ACKA 4G5JA 3GU5A 5KKRB 4HVSA 2OXDA 2PUIA 2ZMDA 4H1MA 3MB6A 4IZYA 3DFAA 4HGSA 4OGRA 2ITWA 3QX4A 3MJ2A 3AKJA 2UW0A 4BDFA 5J7HA 1STCE 1Q4LA 5M09A 4UXQA 3UQFA 2J50A 2O2UA 4O2ZA 4R6VA 3C13A 3GC0A 3R1QA 4TYGA 4AWIA 5AEPA 3LXLA 2VX0A 4C4IA 5GIPE 5L2SA 4RX5A 5HG9A 5AAGA 4JI9A 4B8MA 2AYPA 4AT3A 2J0MB 2XIXA 4ZK5A 4DC2A 3S95A 1H0WA 5HG5A 3IDCA 3T9TA 2CMWA 3CD3A 2F4JA 4ASDA 3ZC5A 3V6RA 2YHVA 1WZYA 4AE9A 3TUDA 4AGDA 3ZFYA 3KL8A 1J7LA 4ORKA 3ZCLA 4F9AA 2PVFA 3NUSA 3OMVA 2PUPA 3IK3A 4FV2A 4FK3A 5AAEA 5M44A 3R9RA 3ACJA 2R7IA 2WTKC 3E7OA 2HXLA 4FVQA 2ZV7A 4IVDA 3SOAA 4LMUA 3FMEA 4BIDA 4XRLA 1QPCA 4FL1A 1RW8A 2BRBA 4I21A 4YTCA 5H8GA 5FRIA 4J98A 4L7FA 1YDSE 5JRSA 3L9MA 4D4RA 3PFYA 4I6LA 3UVPA 3TI1A 4XP3A 2ZOQA 3LLAA 4NKAA 3CQUA 4GG7A 2I0YA 2ITXA 4R1VA 3UOLA 3PVBA 3OCGA 4GKIA 4U44A 4YZDA 5D11A 3NVKI 2QOFA 3FDNA 4AX8A 4TYIA 4F6WA 1H0VA 3VUMA 4OBQA 4AZFA 1VYZA 2VTAA 4XCUA 4CEGA 3KRLA 3OXZA 4PWNA 4I4EA 5I3OA 3TN8A 1Z9XA 1GOLA 4C58A 1J7UA 3Q3BA 3GU6A 1OKZA 4FTRA 4A9YA 4RJ5A 4CZYB 3CGFA 5IH5A 2XAMA 3R8ZA 4BCHA 3WZJA 3T8OA 2Y9QA 3Q9WA 2OIDA 3FMHA 3GC8A 4WIHA 4PTCA 3FMMA 3TKIA 4BCMA 4C61A 2HELA 1JSUA 4M8TA 4I6BA 4CTBA 3QA8A 3QD4A 2J0KA 5HNGA 1U5QA 4X6RA 4TNBA 5A6OA 2GQSA 2QONA 5TR6A 2YZAA 2W06A 4FTUA 1FOTA 4I5MA 3C4XA 3F3WA 4W4WA 2DS1A 2QCSA 5CY3A 3V5PA 4DCAA 2IVVA 4UWCA 4CG8A 1OVEA 5CZIA 3R9DA 3VBXA 3Q2JA 5ITAA 2JIUA 3W8QA 2P0CA 1X8BA 2ETKA 4G9RA 4LOQA 5A4CA 5EI6A 3FC1X 4DEEA 3BLQA 1H4LA 2HK5A 3NAYA 2RIOA 3IDPA 1PKDA 5EHOA 3AT4A 3I7CA 3GENA 4PMPA 2C6IA 1JLUE 3FY0A 4EK3A 5LJJA 2IG7A 4MBJA 2OBJA 4C59A 1TQPA 4RPVA 3A7IA 3AD6A 2R3IA 4WG4A 4NL0A 4AE6A 2XZSA 2WMTA 3OFMA 3MIAA 5A4QA 4YR8A 4HYIA 4DGGA 3QHRA 3ID6C 3HGKA 3R8VA 2O8YA 2QU5A 5CSWA 1KUTA 4YC8A 3ZSHA 2PY3A 3VQUA 5AUTA 5EH0A 4DN5A 2QOLA 2XKDA 5HD4A 2WO6A 4TW9A 3F9NA 3FY2A 2W4JA 3EQBA 4FT7A 3EIDA