3F88A

Glycogen synthase kinase 3beta inhibitor complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
349
structure length
340
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Design, synthesis and structure-activity relationships of 1,3,4-oxadiazole derivatives as novel inhibitors of glycogen synthase kinase-3beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 340
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f88A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f88A01
4ZK5A 2O2UA 3PYYA 4QTBA 1UNGA 5HNIX 2XJ2A 4XP0A 3UO5A 2VWUA 2NPQA 2WTJA 4PQNA 4E6AA 3CY2A 4KABA 4IAAA 3OVVA 4FZAB 3RAHA 3G6HA 3ATSA 4R8QA 5IDNA 4JAIA 4O84A 3V6RA 4A07A 2XNMA 3FBVA 2R3JA 4BCKA 4XX9A 5HG8A 4QMVA 4FVRA 4WG4A 4FGRA 3QCXA 4O7LA 3NS9A 5J9ZA 3UG2A 2VWYA 3QLFA 2V5QA 5LCKA 3SW7A 3TNIA 4GJ3A 4O7RA 2XCHA 4DA5A 4L3LA 5AEPA 4WBBB 4GFMA 3TL8A 4OTIA 4CRSA 1XH5A 3DPKA 4FVPA 4D1XA 1JSVA 1WAKA 1YDRE 3BHVA 4NJ3A 4WKQA 4PTGA 2JDSA 4YZ9A 3SQQA 2ITQA 4FTQA 4IVCA 3OOGA 3AD4A 4KIKA 1OIRA 2VV9A 3NCZA 1A9UA 2BAQA 3KCFA 5JQ5A 2XB7A 2HY81 5LXMA 2H96A 3FMEA 3LFEA 3AC3A 3PZEA 2OIBA 3R6XA 5BUJA 3RKBA 4AAAA 3EKNA 4NTSA 1R78A 3MIYA 2ZM3A 3UO6A 1P4FA 4FV1A 3RAKA 4E5BA 5HNBA 2R64A 3SDJA 4EK3A 2CCIA 2V0DA 2QO2A 3KF4A 5DVRA 3ORTA 2R7IA 3H0ZA 4FSYA 4YURA 3PPJA 5IMEA 4IIRA 4EH5A 5KKRB 1UKIA 3RINA 3UPZA 2VTOA 2R3OA 1JPAA 2W5AA 2UZTA 3FMDA 3HX4A 3R30A 3OW3A 4W4XA 4ALWA 4ZOGA 3PLAE 3R8MA 2PVKA 2W1EA 1H00A 3WZDA 4DG2E 3N4VA 3QLGA 2XBJA 2QG5A 2RFEA 1BLXA 3KU2A 3IECA 4TRLA 3DBQA 3UOKA 4V0GB 5E4HA 2WELA 3VS4A 2V22A 4GUBA 5HOAA 3EFJA 1MRUA 2EB2A 2QVSE 4IB3A 4CFFA 4DTKA 1U54B 1DI9A 5C26A 3E8NA 2JBPA 3EYHA 2F2CB 2C5OA 3CSVA 2KULA 3LFBA 3FE3A 3I4BA 2BIKB 2JKQA 2R4BA 1Z5MA 3QTSA 1DI8A 2RSVA 4I23A 4JNWA 4MHAA 5IUHA 5CEKA 3NUSA 4M69A 4LOQA 4IAZA 5CS6A 4DCAA 4JVGA 4FNZA 4GT5A 3W8LA 4RLKA 4E20A 2CNVA 4D2PA 2UZUE 4M67A 4F9CA 4PNKA 4DTBA 2GHLA 4J53A 3ZO1A 2PSQA 3DK3A 5DN3A 1P2AA 5IQEA 2XNGA 4XJ0A 4ACMA 1XH8A 3GCUA 3KVWA 2LGCA 4JBPA 2PK9A 2BRMA 5JFVA 4AGCA 2X81A 4DT9A 5HU9A 5C01A 1J7LA 3ZSHA 3D83A 4CYJA 3MESA 2QODA 4BDDA 5M57A 3DKOA 4B9DA 2XZSA 3FXXA 5DI1A 4QOXA 3QQFA 1ZOHA 4G9RA 4BWPA 4L67A 3SRVA 4O0XA 4L01A 4X2FA 3PA3A 3FY0A 4EZ7A 4ZZNA 5CU6A 4N70A 4JG8A 4FKWA 4F1MA 4EOOA 5ANDA 5L6PA 3NVMB 1YXTA 1ZY5A 3QWKA 2X9EA 4Y5QA 3UTOA 3PXRA 4L00A 4LUDA 2VWIA 4F0GA 5I5ZA 2PVRA 2BDWA 4WO5A 4Y8DA 5ANGA 4EWQA 4NTTA 5GJFA 2CSNA 4CEGA 4HGSA 3AQVA 3TM0A 3ULIA 4Z9LA 2WQNA 5DNRA 5J8IA 3P7BA 4K1BA 4TKSA 3Q53A 4TYHB 4HGTA 2IWIA 2EXCX 2QOBA 4U81A 5FBOA 5KNJA 1XWSA 3ZHPC 3TXOA 2W1HA 5ETFA 4YBKA 3BEAA 4U7ZA 5CZHA 3W2CA 4CKRA 3QXPA 5F94A 2IPXA 2OSCA 4L44A 3QZIA 1YXUA 4QQCA 4A9UA 5DOSA 4XV3A 4GW8A 2PVYA 2XNPA 3HZTA 4V05A 4EQCA 3F7ZA 4ZSGA 2CNQA 1ND4A 4GH2A 5T68A 5DHJA 4KSQA 3NUAA 3DFCB 4FK3A 2ZV9A 2PY3A 5CASA 4IJPA 4WG5A 5F20A 5K5NA 2PMLX 3HMPA 4G3CA 4O2ZA 1V1KA 2WMVA 1K2PA 2OH0E 3LKMA 2YJSA 1YDSE 3KB7A 3MYGA 3OUNB 4Z55A 4ERKA 1WBNA 5LVMA 2HXQA 4FEXA 4CG9A 3KMMA 4YR8A 5I9ZA 3F3WA 1UWHA 5FWKK 2X7GA 4WG3A 2ZJWA 3Q96A 3ZDIA 3R7IA 5HTIA 2I0HA 4KA3A 3F2NA 3OTUA 2GQRA 4K6ZA 1F5QA 3LLTA 5D1JA 3VC4A 4AZVA 2PWLA 2WMAA 4RIYB 5L6OA 1IA8A 3D7TA 3I5ZA 2VO0A 1H8FA 1CTPE 4BI2A 3FYJX 3SXRA 3ZXZA 3O7LD 3KULA 4AE6A 4WOVA 4F6WA 1KV2A 2J6MA 2R5TA 3BV3A 1K3AA 2YCSA 3AOXA 3F6XA 4L6QA 5FXQA 2UZNA 3BGZA 5C27A 2JKMA 4F6UA 4OTRA 4BZDA 3QRKA 5FTOA 2QOQA 2ZV2A 4O0YA 5A54A 4FC0A 4FNXA 2JDTA 4ZY5A 3E3PA 3WIKA 1EH4A 4RQKA 5I3OA 4AZTA 3EQFA 3HAMA 2R3FA 3D94A 4AZFA 2BTSA 3TWJA 4CFMA 4K2RA 3P86A 5CAQA 2CHLA 1A48A 1FPUA 1JSUA 1PY5A 2XNNA 3QQKA 3IONA 3UODA 4LMNA 2I0EA 3B8QA 3QAME 5IH4A 3LFCA 4O27B 1QPJA 3DU8A 5AADA 3UJGA 4A06A 4FV7A 3T3UA 2F49A 2A0CX 5HCZA 2VU3A 4C3RA 4DEGA 4EONA 5J1VA 4FKSA 3ODYX 3BGQA 4OTGA 3V04A 3OEZA 1J7IA 5GIPE 4I24A 3RZFA 5HO7A 2ETMA 4ITHA 3FPQA 1YQJA 3NYVA 5C4LA 4D9TA 4HJOA 4YZCA 4M15A 4UXLA 3VUDA 3C4XA 2VTLA 4YMJA 2BRNA 4FK6A 4D1ZA 2C6IA 3NUUA 3BQCA 4CZTA 3JYAA 2FB8A 1KWPA 2G15A 2WQEA 5AUVA 4ZAUA 5HTCA 2OICA 3PPZA 3QYZA 4ZZOA 5BNJA 4RG0A 4EOKA 1XBBA 4YJRA 1V0PA 3BE2A 4B7TA 5JRQA 2QR8A 3EN7A 3OMVA 4EOSA 1R3CA 2JFMA 4FX3A 4L46A 4B99A 4DH1A 3QX2A 4LV5A 4FG8A 4F08A 2XK7A 4FV8A 2PPQA 5CF4A 2XKDA 3HV4A 3VBXA 4OUCA 4ZTLA 4QPAA 4KS8A 2OJGA 4I3ZA 2P0CA 2UW8A 4ZS4A 4F64A 4HCTA 3NUNA 4IFCA 4BDIA 5H8EA 2Z60A 2YISA 5AV0A 2YZLA 4B0GA 4ZJVA 5ETAA 3KVXA 3O17A 4FSZA 4EK6A 4C59A 2XYNA 4QMQA 1PXKA 4IAIA 4JLCA 1OL2A 5HE2A 3ZLYA 5M4FA 2W1GA 3ANQA 3IDBA 3O23A 4PL3A 3QRUA 1U5QA 4O83A 5E8VA 4ANMA 3R7OA 4CG8A 1KOBA 1H08A 1M2QA 4M68A 3MVMA 3WF9A 3I1AA 4N6ZA 1MQ4A 1DAWA 3BQRA 3FQEA 3F2RA 2ZV7A 4AG8A 4YJOA 3KRLA 2O8YA 4O7WA 3WOWA 3B2WA 2ZOQA 4NFMA 1FOTA 2R3IA 4YPSA 4CFXA 1L3RE 5AV2A 3VQUA 1NA7A 2IW6A 4O0WA 1YOMA 5M44A 2CGVA 4GVJA 1SM2A 5E7RA 5I4NA 2X39A 3COMA 3VS2A 4DFBA 5FXSA 3L8SA 3UVPA 3PVWA 3HMOA 2BKZA 3AT4A 4R3RA 3DKCA 4X6QC 5G1XA 4JDIA 3PSBA 4H58A 4WT6A 1OUYA 2QCSA 4F65A 1XH7A 1OVEA 2I0VA 3IDPA 4YJVA 3ZUTA 2BAKA 4PV0A 3FC2A 3G51A 3VUKA 3E7VA 3OT3A 3BEGA 5DEYA 5AP4A 3QC4A 3TIYA 3FAAA 5FG8A 2WTKB 5AWMA 4U3ZA 3T8OA 2WEVA 4AGDA 2W5BA 5TO8A 4FTJA 3BRBA 1OPLA 3P4KA 3LMIA 4NM5A 4KNBA 3D5UA 4QMPA 3UBDA 4C02A 4F9BA 5BVFA 5IQAA 3M11A 4X3FC 3Q2MA 4XG4A 2PMNX 4AF3A 3AMBA 1ZMUA 2IVUA 5M08A 1M2RA 2B9JA 5JSMA 2UUEA 1NVQA 3N9XA 2HZIA 4L42A 4NWMA 2FH9A 1ATPE 4I0SA 2WZJA 5FXRA 3RJCA 4O7VA 3I5NA 2QOKA 4FV5A 4Q9SA 3N51A 2RFDA 3JVRA 4JX3A 4WNOA 5CT0A 3NRMA 3PE1A 5HBJA 4FEQA 5C8MA 3U9CA 4F99A 5M4CA 2VTJA 3GVUA 2UZWE 2AC3A 4DFNA 5IUIA 4KIKB 3FL5A 4BRXA 3ORZA 4UYAA 5EHYA 1JKSA 2R0UA 3C1XA 4J7BA 2VX0A 3I79A 4U43A 4DG3E 2YM4A 3DGKA 5L2QA 3PXKA 4WBOA 3NEWA 3HDMA 4JQEA 4BVUA 1NVSA 3MJ1A 3RK5A 1OL7A 4U79A 3COIA 5D10A 4DEEA 5I9WA 5KBQA 2W7XA 4QYFA 2GFCA 3R9OA 1PMUA 5AMNA 3II5A 5ITAA 4HPTE 4RA5A 3QTWA 3RWQA 4YJNA 2Y0AA 2VTIA 5ICPA 1A06A 2WAJA 3BLRA 2GDOA 4ZIMA 4C3FA 4S33A 3EIDA 3VN9A 4D2SA 3EN4A 4DGMA 4DINA 5LMKC 3DZOA 3R1NA 4EORA 2ZVAA 4F1TA 5KMLA 5EOBA 3OBGA 4G6LA 3PRFA 2HZ0A 2VX3A 3DDQA 2QLUA 3Q6UA 4LGHA 4R3PA 4RWKA 5JZNA 2WXVA 5HICA 4DG0E 2PUNA 3HUCA 3C50A 4AW5A 2ZM4A 1YDTE 2EU9A 2PTKA 2W1IA 4X3FA 4D5HA 4L68A 4IX3A 1J1BA 2XVDA 3DNEA 3F82A 4FBXA 3NR9A 4P90A 3QRJA 2UZBA 4U8ZA 2YIRA 5DRDA 4YTIA 4BGHA 1E1VA 2R3LA 4I22A 3TACA 4KIPA 3UC4A 1YHWA 3UIUA 2BHEA 5FEEA 5JFSA 4MH7A 5KBRA 4FKOA 4LRKA 5FTQA 3UOLA 3NPCA 1OKWA 4M69B 1WBPA 4BTFA 4EHZA 1GZKA 4JT3A 3L9PA 4D2RA 1XJDA 3NX8A 2ITZA 4FIEA 3ZLSA 3LW0A 4AT4A 2H6DA 4EHGA 5JQ8A 1PXPA 2IN6A 2GS6A 3E8CA 3QYWA 4J8NA 2O0UA 2Y6MA 5CSXA 3DLSA 4FZDB 3OW4A 4O7SA 3KEXA 2PUUA 1REKA 3VUHA 4Q5EA 4XV2A 4BCFA 4C4FA 5K0XA 4IWPA 3Q2JA 1URWA 3ZXTA 2ITPA 4ZMEA 4F0IA 4NK9A 1IEPA 4IMYA 2A4LA 2NO3A 5TE0A 1H1PA 3LPBA 2I6LA 3HV7A 4Z7GA 4QD6A 1YXVA 3QUEA 3ALNA 3TUBA 3GCQA 3RPRA 3SRVB 1H28A 4ZSJA 5LMKA 4RC4A 3VRYA 1KSWA 2CMWA 3JPVA 2VTNA 2BAJA 4NCTC 2J51A 2XF0A 2YIWA 4I1ZA 5JRSA 2YITA 2NRYA 3UOJA 4MF1A 4O7YA 3QCQA 2BZIB 4I93A 4F9AA 4FL2A 4RZVA 4R1VA 2WOTA 4ASEA 5CF5A 4YSJA 2RIOA 3QCYA 2FO0A 3G0EA 3P78A 5I9YA 5BVEA 4AT5A 2YIYA 4KBCA 3UC3A 4CFWA 5GHVA 3ZBFA 1OBDA 4XLIA 2C6TA 3B2TA 2Q83A 4NKAA 2ERZE 3ZFXA 1H4LA 4EHVA 3OROA 4ANLA 2VN9A 3CTJA 4H3QA 4Q5HA 5LVLA 5HG9A 3P0MA 5AP7A 2JIVA 3W33A 5GJGA 3R9DA 3MI9A 3MFRA 3SOAA 3CXWA 2H9VA 2FSOX 3FPMA 3OF0A 4V04A 4C2WA 2HZNA 4FKUA 3R0TA 1YW2A 3VJOA 3ERKA 4DEBA 4CMUA 5J9LA 3BYMA 3HRFA 2W5HA 3P9JA 4GFGA 4ZTNA 3VS7A 4CZYB 5K4JA 4EH3A 2X2KA 5KX8A 2YM7A 4EH8A 2GQGA 2QU6A 3QGWA 3HA8A 1Q8TA 3KRXA 3NDMA 4RBLA 3FI4A 4AOIA 3P7CA 2G2HA 1BUHA 4XG6A 4S2ZA 4D4VA 4MQ2A 2VUWA 4JBOA 5F1ZA 2VWVA 1R1WA 3B8RA 3FV8A 3H3CA 3CIKA 1H26A 3W16A 2WMWA 2WPAA 4LRJA 4ZY4A 3CLYA 4EKLA 1Q8WA 3TTJA 4I6QA 1PXJA 4JRNA 5EDQA 4WRSA 4EJ7A 4NCTA 3SX9A 1Q8UA 5EG3A 1PJKA 1RDQE 4PRJA 3FDNA 3NVKI 3D7TB 3E63A 4HYIA 3UP2A 4AW0A 3QKKA 5IEYA 1Z9XA 3OCSA 4JR3A 5DGZA 5HHWA 3L1SA 4I6BA 4ALVA 3KULB 3CJFA 4FIHA 4E6DA 4EJNA 3RWPA 4DTAA 1FGIA 2E9UA 3DAEA 5HE0A 5J95A 4D5KA 4MAOA 3MVLA 3NW6A 3E64A 5KMJA 1ZYLA 3GOKA 2F4JA 2GNFA 1OB3A 3FZOA 4IZAA 4W9XA 3EFLA 3EL8A 3IKAA 4G5JA 4DFYA 5LJJA 3PWYA 2DS1A 3RTPA 2J5EA 3H9FA 5DBXA 4G2FA 1PXNA 3ORLA 3L8VA 3R8VA 4QMNA 5D7AA 4IB0A 2C6DA 1J3HA 2X0GA 4LQMA 4KAOA 3PP0A 3UIXA 1UV5A 3HRBA 1UVRA 4JJRA 4AXAA 3ZZEA 3LFNA 3LVPA 3PFQA 3CEKA 2XJ0A 2RG6A 5B2KA 3LXKA 3IW5A 3V5LA 4GK2A 2W4KA 5L8LA 2YM5A 3UPXA 2RF9A 3WE4A 4HOKA 2WU6A 2V62A 5HG5A 5DA3A 4FE2A 2BPMA 5ETCA 4FODA 4F63A 5JKGA 3GOPA 3NIZA 3OP5A 4TWPA 3U6HA 2XNBA 4I4FA 5CSWA 3GFEA 3ORPA 2UW4A 3E5AA 4RMZA 4G3FA 3NW7A 1PW2A 4GK4A 2BMCA 3G9NA 3Q9XA 4DGGA 3MA6A 5I3RA 4UWYA 1GAGA 5D41A 3DCVA 5GNKA 3R71A 2XYUA 4E4XA 3EQBA 4M3QA 4C35A 3KK8A 4NH1A 5ANEA 3RP9A 4NYEA 3QRIA 4EH7A 2C6MA 4BY9E 5CVHA 2YCFA 4UEUA 1OKVA 1WVYA 2GNIA 4FKTA 4HYHA 2BIYA 3FLWA 2B7AA 3FQHA 3UNZA 4EK5A 2WMSA 5C4KA 5H9BA 4RPVA 3GCVA 2OFVA 3VO3A 2ZMDA 3PJ1A 5FGKA 3EQPA 3R01A 3ZCLA 5L4QA 4O7NA 4XRLA 1Q61A 3M1SA 4HW7A 4HVHA 3F9NA 3D2KA 3HEGA 4G6OA 2JIIA 4PNIA 2O65A 2XIKA 5CANA 5CAOA 3FC1X 4EZ3A 4AE9A 2WQOA 3VUGA 3L9LA 4BDKA 4QP8A 2UZDA 4KWPA 2XEYA 4ZLZA 3VIDA 4RJ5A 3RHXA 4L3JA 4XP2A 4CT1A 2OK1A 3DJ6A 4CTBA 1H01A 3W18A 3I0OA 2C1AA 4E4NA 1JKTA 3S00A 1KOAA 1FINA 4GU6A 5CU0A 4U42A 3HMNA 5CLPA 4Z3VA 2B4SB 4FSTA 5EQEA 1JOWB 3NIEA 4GEOA 4NW6A 3IW8A 3GP0A 3VUIA 5AV4A 5LVNA 3ORXA 3V51A 1Y8GA 4DEDA 2OIQA 2QKRA 3OFMA 1W83A 3K2LA 2FUMA 4RVTA 4ONAA 4YGAA 4FT0A 4II5A 2P4IA 1O6YA 4H3PA 5A4LA 2XRWA 3PXFA 3QQGA 2QC6A 2W0JA 5HIBA 4ITIA 2VGOA 3VAPA 2JLDA 4QMZA 2VO6A 4BTJA 4BL1A 3RCDA 2HOGA 2Z7QA 5FBNC 4BTMA 1P5EA 3OCBA 4YTHA 5A4TA 5EK7A 2Y8OA 4X21A 5AP0A 4BCGA 3OT8A 4RVMA 4JL9A 1Q3DA 3PRIA 1OPKA 3ZO4A 2R3PA 3PSCA 2PU8A 5E8YA 4BDJA 3Q9ZA 3IW6A 4UV0A 5DR9A 1UNLA 3TKIA 3PVBA 3Q32A 4OT5A 1H0WA 1YI6A 4O38A 3WYYA 2I7QA 2XK8A 1W82A 1YKRA 2WGJA 3OUKA 4H1JA 4G34A 5AUXA 1OBGA 3V01A 3HMIA 4C33A 3D9VA 4HZRA 5FQDC 5HCXA 5LVPA 3A8XA 4QQ5A 4QRCA 3ANRA 2GTMA 2REIA 2YABA 5BYYA 4I94A 2XRUA 4TYEA 5EM6A 4C57A 3MBLA 4CLIA 4C4EA 5EYDA 2QURA 4N0SA 3I81A 4ARKA 1U5RA 2VTAA 4IANA 3PIYA 4MNEA 3PJCA 4EC9A 4AW1A 4HVSA 1TQIA 1IRKA 2ITOA 4ZMFA 3QUDA 3VW6A 3DBCA 5HVJA 4AZWA 3ORKA 3COHA 3S4QA 3O7LB 4RWLA 5EI8A 3ZLWA 4QTDA 2QO9A 4Q9ZA 2AC5A 4JXFA 1GIHA 4XBRA 1BYGA 4F4PA 4F6SA 3RGFA 4CMOA 3MTFA 3QD4A 3ITZA 4K77A 3BBWA 5GZ9A 3SKCA 4NM0A 3TDVA 2IW8A 4L3PA 4YO6A 4YJSA 1PRYA 1M14A 3Q52A 3ETAA 2X6EA 4FV0A 4PMPA 3Q3BA 2I0YA 1ZOGA 3EOCA 4WNKA 1JSTA 4MVFA 3UOHA 4MKCA 4CCUA 3IQ7A 3VRZA 3QZFA 3NAYA 1S9IA 3GFWA 4BDFA 2R2PA 1HCKA 3CPCA 5DEWA 2IZSA 3KY2A 2EXMA 3BX5A 4YLJA 3QU0A 2IVTA 2HWPA 4U40A 5IMXA 3QTQA 4LV8A 3LXPA 4D4SA 2VTTA 5C9CA 5BMSA 3AT2A 3H9OA 4P7EA 4M0ZA 3VBVA 3FHRA 1R0PA 4X3FB 2AUHA 2WD1A 5HVKA 4C4GA 3ZC6A 4J52A 4O91A 3ROYA 5CNNA 5J7HA 3DTWA 4Y5HA 5FM3A 4F0FA 3MDYA 5CZIA 1JBPE 2DYLA 1CKJA 3R02A 3OS3A 4H39A 3QC9A 4FIFA 3TKHA 2CJMA 3NZ0A 2CN8A 3QHWA 4GT4A 4IWOA 4G5PA 5AUZA 3WBLA 2YACA 2C5VA 1OGUA 2P55A 3LXNA 3FLZA 4YJQA 4FYNA 1H0VA 2BFXA 4W4VA 4X2KA 5BVKA 2F57A 3Q4CA 5EDPA 3LMGA 5GZAA 3SXFA 3RVGA 4ACGA 1Q8YA 2C3KA 4M14A 4ID7A 5EDRA 3DKGA 2CKEA 2GFSA 1OPJA 3V5JA 4BBEA 4EH2A 4MBLA 4QMOA 4K18A 3CS9A 1NVRA 2WNTA 4ANOA 3O96A 1WCCA 2BRBA 2IVVA 2OU7A 4G16A 5JT2A 2JAVA 4TPTA 4JBQA 1I44A 3GB2A 1G3NA 4QP3A 2Z7SA 1JKLA 3P7AA 4C2VA 4ENXA 4BI0A 2GHMA 1W84A 5CVFA 2B9FA 2BZJA 4BICA 5L2TA 1H24A 1QPCA 1KE8A 5E8ZA 5IQIA 3DK6A 2IVSA 5J87A 3UO4A 1MRVA 3LFQA 3ROCA 3U6IA 4APPA 4WNMA 3CKWA 2OZOA 1PF8A 4FV6A 4LYNA 5L6WL 3QUPA 3R04A 5AR8A 1FMKA 2B9IA 2ZAZA 4YP8A 4RX9A 4J71A 4P4CA 2V7AA 3E88A 4ORKA 4WHZA 3ZMMA 1H1QA 3GC9A 3PXQA 3UIBA 3QQHA 5DFPA 2JKKA 3AC1A 1YOLA 4UXQA 4KSPA 3FKOA 3R83A 4BZOA 4EK8A 4BCNA 4QTEA 4DFXE 5H8BA 4OBPA 1FVVA 2UVZA 3QD0A 1PKDA 3ZONA 4QP4A 2OJJA 3LMHA 3MB6A 4FSWA 5DE2A 2DWBA 2EXEA 4XV9A 4FA2A 5JH6A 4O0VA 3FMJA 5K9IA 5HQ0A 1MP8A 4I5MA 1MQBA 3IG7A 2X7FA 1UA2A 3QFVA 3RBWA 5IU2A 2YDJA 4FTIA 3WF6A 5GINE 3T9IA 1XR1A 5AV3A 3D14A 5JN2A 1YWVA 4RFYA 3GBZA 2KTYA 3PY1A 1RW8A 5AUUA 1YHVA 4GT3A 3UDBA 3ZRMA 3R73A 4WIHA 4BCPA 5FDPA 5BMMA 5IA2A 4TZRA 1Q62A 3GUBA 5AV1A 3R7YA 5EW3A 2V7OA 3KCKA 2PL0A 3KMUA 3AGLA 5AJQA 5E8TA 3S1HA 1WBTA 5AM6A 3KMWA 1WBOA 1IAJA 3QZGA 4NJDA 4DGLC 1OECA 2F7EE 2HK5A 5F9EA 5CEPA 3FEGA 4AWIA 4EOMA 2C47A 2RL5A 2PVHA 4MXZA 5KCVA 1JWHA 4YZDA 1GIIA 2YM6A 2R3NA 2WTVA 1XHAA 3ZEWA 2OF2A 4IM0A 3IW4A 2BRGA 4IAKA 4E73A 3A62A 5CSPA 4IZ7A 2J5FA 2R3MA 1JKKA 4FV9A 3HAVA 3A99A 3IPHA 4FEVA 4IB1A 4AFEA 3VBWA 3D5XA 1XH4A 4IAYA 3NLBA 5HD7A 1H1SA 1R39A 2WQBA 3O51A 3BHUA 1CKIA 5CXHA 3F3VA 4AN9A 4C0TA 1Y91A 3DV3A 3W2QA 2FYSA 3F5UA 5DH3A 3QF9A 4FTAA 4FV3A 4GRBA 3RAWA 4DBNA 2ZYBA 2UZVA 3C0HA 3VF8A 3ZOSA 4MBIA 3HVCA 3WF8A 1SNUA 2IZRA 4J99A 4I21A 3VJNA 4DC2A 5BYZA 2YWVA 4G3DA 3UMXA 3KXHA 3P08A 5KO1A 2OGVA 2QHNA 3U4UA 3PLSA 3FSFA 4M7IA 3F5PA 2OKRA 4K33A 4MNFA 4MWHA 4CT2A 2IG7A 4FTUA 4MD9E 1PXMA 2PE2A 5BVDA 3VBQA 1FVTA 3Q5ZA 5KHXA 2J0LA 3EFWA 2Q0BA 4O1OA 5H2UA 5M07A 4TWNA 3C5UA 2WMTA 3DAJA 3N4UA 2Z2WA 4CKIA 4D2WA 2GMXA 4IACA 3A7IA 3TIZA 3GU8A 2JDOA 1DM2A 5CVGA 3JY9A 4JDHA 3DFAA 2C0TA 2Y4PA 2PHKA 3BYUA 3NMUF 4GYIA 4KRCA 5IQFA 1CDKA 1QL6A 2I40A 3O8TA 3OWJA 4NM7A 2WEIA 2OXDA 3O0GA 5CF8A 3IW7A 1ERKA 3LM5A 3AG9A 4GKHA 2R3HA 2YERA 5A4CA 3GU6A 3LCTA 5HG7A 3F5GA 3AGMA 5HESA 4AZSA 2ESMA 4D2TA 3VUTA 4RJ8A 5EFQA 3KA0A 4WUAA 5AA8A 2J0KA 1FGKA 3ALOA 3H0YA 4UB7A 3DQWA 5CU3A 5DG5A 4EOQA 3C7QA 3Q9YA 5AX3A 5HVYA 3VS1A 2C5NA 3WILA 1B39A 3CPBA 4E26A 4PPBA 5A14A 3PXYA 3SLSA 3SHEA 3LFSA 3TZ8A 5CAVA 2UW0A 1ZYJA 3AXWA 3POOA 4MWIA 4RC2A 5CNOA 1Q99A 3FKNA 4R7HA 1OUKA 4I5HA 4C36A 1PXOA 5DLSA 1SNXA 1XQZA 4FNYA 4FZ7A 3UZTA 4QPSA 5ANIA 3AC5A 2HW7A 1Q24A 2J4ZA 4L7SA 1O6LA 2JGZA 2JC6A 4ZEGA 4CTCA 5IH5A 2R0IA 3Q9WA 1T46A 3LCKA 4LGDA 4MD7E 4ZTHA 1OKZA 1GZ8A 5IUGA 3Q4TA 3DY7A 4PY1A 4RIXA 4XV1A 5HORA 3CD8A 4EI4A 3CCNA 1J7UA 2HCKA 4EOPA 3HDNA 4DEIA 4QP1A 5A4QA 2PVNA 3QWJA 2PULA 5HI2A 5JMSA 5T6KA 5LOHA 5DYJA 2XM8A 1F3MC 3MJ2A 5AIKA 4GFOA 3VS5A 3W32A 4AP7A 3R21A 3U51A 1Q97A 3TV4A 2QU5A 1REJA 2XK9A 3BYVA 5D12A 3LCOA 1RQQA 4JQ8A 3JVSA 3NNUA 4IB5A 3CQWA 4R7BA 4GL9A 4PMSA 3W2RA 2J7TA 5HLWA 5IA0A 2QOCA 2YM3A 3PVUA 1ZWSA 5M4IA 3SVVA 3HMMA 3UZRA 3HNGA 2I1MA 1IASA 5AR7A 3MY1A 3H10A 2E9OA 3C51A 3SW4A 5LQFA 4D4YA 4PWNA 3CJGA 4ANSA 4F9WA 2Z8CA 3IO7A 4E4MA 3AMAA 1E1XA 3ENHA 2YCQA 2JFLA 3W2SA 3KKVA 2ZDUA 3ELJA 3ZO2A 4X3JA 4LFIA 1JLUE 4MXAA 4OBQA 4QMWA 2QOHA 3UVRA 3VUMA 2XUUA 4ASZA 4PL5A 2G2IA 1Q4LA 3CC6A 3MPTA 1Q5KA 3L8PA 4IVDA 3KRJA 4XMOA 4A9RA 2CGUA 3DJ7A 4MNEB 2B52A 4FL3A 3K5VA 3MWUA 2BUJA 4RFZA 3RCJA 3FMHA 4XBUA 2PVFA 4MX9A 2ZB1A 4S30A 1SVEA 4U41A 4XG3A 3MS9A 5FLFA 4EWHA 1XH6A 2PZ5A 2XK6A 2OBJA 3ZEPA 1RE8A 4CQGA 5AP5A 2WMBA 1AGWA 4IH8A 3VS0A 1YXXA 4WD5A 3O8UA 4EOLA 2J0MB 3C13A 5TKDA 4PMTA 3W55A 3JS2A 3KREA 3CTHA 4IC7A 4FEUA 5TOZA 3TEIA 4BWKA 5FRIA 2ONLC 4FTNA 1ZLTA 4XNEA 4ZLOA 1U46A 2C3LA 2XK3A 5B2LA 4PDSA 4FGBA 1PMEA 4P5ZA 3EH9A 4DFUA 3LJ2A 2XBAA 3A7JA 3I0QA 4JS8A 2QI8A 1ZXEA 4QP9A 4FT7A 4EYJA 3FI8A 4IJ9A 4KB8A 4E1ZA 3TT0A 2B0QA 5J5SA 3MIAA 3FHIA 4RIOA 5FD2A 2IW9A 3A4OX 2F7XE 3FMNA 1J91A 3EQCA 5AX9A 3HP2A 3MH2A 4XCUA 4QMMA 2B53A 3GNIB 3PXZA 4YJTA 3W8QA 2OZAA 3ZH8A 4I4EA 4E5AX 4AOTA 2WTDA 4MXYA 2NRUA 3GC7A 3M42A 4UMTA 1SVGA 4B4LA 1XKKA 4BDGA 4IX6A 3DKFA 3LCSA 5AAGA 4PTCA 3FYKX 4GVAA 4IE9A 5BPYA 3R7UA 3P1AA 4FTOA 3AMYA 3FLNC 3SGCA 5AUWA 5J7BA 4CGAA 3GENA 5TR6A 2QQ7A 2ITVA 2WHBA 4RWIA 5HIDA 3E93A 5B0XA 4JOAA 3QX4A 3TV6A 2H8HA 3R7EA 4HPUE 5IQDA 2QOOA 4EZ5A 5KMOA 3RPSA 4BF2A 5KMMA 4ZJJA 3CP9A 4JG7A 3MN3A 5L2SA 4EC8A 3R8ZA 3TI1A 4JDJA 3HL7A 2PYWA 1JQHA 2ZDTA 3LOKA 3VW8A 4PMMA 1WBSA 1UU9A 5FP5A 3JXWA 3LM0A 4W8EA 5L2IA 4LGGA 5AUYA 2BR1A 4JX7A 4BKZA 2ONLA 4CFUA 4E6CA 3IK3A 4FYOA 2QOFA 4HYUA 4RA4A 5E8XA 2RGPA 3P79A 5CT7A 1UU7A 2QHMA 5JFWA 2C6LA 3LJ1A 5EW8A 2VNYA 1WBVA 4Y83A 5EH0A 3V5PA 1APME 4FOCA 3D5VA 4YZNA 3EYGA 3MFSA 3QRTA 4FUXA 2NNWB 4FG7A 1DAYA 4OTQA 4C38A 2XJ1A 3NGAA 4ZTRA 3NNVA 3AC8A 3W2OA 3R7VA 4XG2A 4X2NA 2C69A 4RRVA 4GSBA 3LFAA 4XH6A 2X1NA 1LP4A 4XLVA 3ZLXA 5E8UA 3FZTA 2JITA 1DS5A 2UW5A 3L9NA 4A4OA 4USDA 5I0BA 2UW9A 5LMBA 4M97A 4BCJA 1GZNA 5D9HA 2QG7A 4UALA 4TYIA 4C3PA 4UMUA 4A7CA 5EI6A 3VWAA 3CGOA 2JIUA 2RKUA 3BLQA 3OWPA 4O0SA 4XG7A 4BCOA 4LMUA 2X2LA 5BUIA 4BTKA 4QMXA 1GY3A 3DJ5A 5GIOE 2Z7LA 4ZS0A 5M51A 5CYIA 1WVXA 3A2CA 4P2KA 4D2VA 5CU2A 5CEMA 4C62A 4EEVA 4YUQA 4CSVA 5LWMA 4NL0A 2JBOA 4RX8A 5TF9A 3HGKA 3KXXA 3PZHA 1B38A 3C0GA 3EFKA 3UYSA 2VTPA 4IQ6A 3ZO3A 4UMRA 3DS6A 1YOJA 3OXTA 4G3EA 5LVOA 3LHJA 2VZ6A 4O6LA 4NKSA 4BN1A 3OXIA 5CQWA 4YU2A 3TNWA 1FMOE 2E9NA 4HCUA 4QYHA 3ZRLA 4BIEA 5A6NA 2PZRA 1F0QA 4O22A 4PTEA 4QP7A 4J97A 4JRVA 4FKJA 1BI7A 3PPKA 3OD6X 2WOUA 3QTUA 4PX6A 3R1SA 3KFAA 3VNTA 4D9UA 1XH9A 2FSMX 4DN5A 4PDYA 1JVPP 3PUPA 4QQTA 4IZYA 3ZRKA 3QKMA 3DDPA 4XG9A 4AT3A 4KD1A 4BB4A 4ERWA 4ZTMA 4AQCA 5IQGA 3G33A 4KRDA 4AZEA 2CGXA 3R63A 3F61A 4JBVA 3U9NA 5M56A 3H30A 4CVAA 2WB8A 1G8SA 1WMKA 4DH3A 3FMMA 3PP1A 2F9GA 4JR7A 1YXSA 1VEBA 4NIFA 5CTPA 2PZPA 4L9IA 5KMNA 1Y6AA 2HXLA 5HEZA 2C3IB 4UWCA 1UWJA 2XIYA 4B8MA 4WRGA 2WFYA 2BROA 1Q3WA 4I5PA 3R1YA 2WMUA 5BQ0A 2C4GA 1XBCA 2X8DA 4W4WA 4FV4A 1YVJA 5HLPA 2OI4X 3AC2A 4U9AA 3MB7A 3VULA 4OTWA 4FEWA 2OJIA 3KGAA 3ORIA 5DT3A 4EUUA 3DBEA 2C0IA 1OMWA 3LFDA 1W8CA 2O63A 3PIXA 2HWOA 4Z7HA 1R0EA 2A27A 4OT6A 4W4YA 5DWRA 4G31A 4GIHA 4KINA 4U5JA 4AACA 2JKOA 3FLQA 5HBHA 3KL8A 3TNHA 4FT9A 3OCTA 2Y9QA 2R3RA 5E1EA 3FJQE 1FVRA 1RJBA 5CEIA 5AR4A 1UKHA 1FQ1B 1URCA 4YNOA 4RX7A 4ZSAA 3ZDUA 4DH8A 4BKYA 3RHKA 5AP2A 4YZBA 1OITA 4Q2AA 3O8PA 5EQYA 3MSSA 3KXMA 2W9FB 3F66A 1TVOA 1WBWA 3VS6A 4R6VA 4CRLA 3GC8A 4O0UA 5IA3A 3F88A 3OZ6A 3R9RA 4JDKA 2A1AB 3U8WA 3WZUA 5BX0A 1SVHA 3CR0A 3QD3A 5AR3A 3LIJA 5IPJA 2B1PA 4IVBA 4FUYA 3PTGA 4MYGA 5JZJA 4L8MA 4RJ3A 5J9YA 1AD5A 3M2WA 4BCIA 3FSKA 4N4SA 4CYIA 1OKYA 3FZ1A 2ZM1A 5EW9A 2W9ZB 1ZOEA 4RIWA 4L45A 5AAFA 4ACDA 4E3CA 3VS3A 5M09A 4J8MA 3FZRA 4GJ2A 3AC4A 5FDXA 3Q5IA 4LL0A 1IG1A 4PP9A 3TNPC 3TUDA 1ZZLA 2GU8A 3A4PA 3OCGA 4TTHB 5ACKA 2VTSA 4DAWA 2HAKA 5M4UA 3MVHA 4R78A 1W7HA 4AA0A 4RX5A 5CSVA 3V5TA 1ZRZA 3CY3A 2C6OA 4YC6A 3MH0A 1BL7A 3BHYA 2ERKA 3ORNA 4FTCA 4XOZA 3R8LA 4AA4A 3UIMA 5HX8A 2OLCA 4H36A 5EYCA 4D58A 3BV2A 4BFMA 4FTLA 2WTCA 3GCSA 2XEZA 3O2MA 4EBVA 1KE5A 3NWWA 4QT1A 2VWXA 4W8DA 3K3JA 3LQ8A 1OI9A 4KKEA 4CZUA 5IA4A 4X6RA 2F7ZE 2QLQA 5J79A 5CI7A 3DXQA 3BYSA 5I9XA 1YI4A 2P2HA 4FIIA 5K5XA 3QCSA 5JK3A 4G6NA 4TYJA 4FV2A 1X8BA 3CQEA 3FXZA 4A9SA 1PMVA 4KS7A 4AU8A 4EQUA 1VYWA 2E9PA 3OC1A 3FLSA 4OW8A 4HNIA 3HP5A 3E3BX 3FMKA 4MCVA 4UYNA 4R3CA 4U0IA 4ALUA 5B7VA 5HU3A 3TJDA 4EUTA 2C0OA 4JG6A 1H07A 5HBEA 4DITA 4DFLA 2HY0A 5HTBA 2YWPA 2ZV8A 2Y4IC 4MF0A 4C58A 4RT7A 1ZMWA 3TTIA 3GEQA 4AFJA 2C30A 4FZ6A 4Y46A 2P33A 2XA4A 2YEXA 3HA6A 3W2PA 3EB0A 3WF7A 1OIUA 2XH5A 2GNLA 2R7BA 3RZBA 4E8AA 3A60A 4S34A 5AM7A 3TV7A 4QNYA 2CDZA 1GNGA 3NNXA 3DBDA 3DT1A 3FUPA 3E92A 4YTFA 3F7WA 2XM9A 3NW5A 2W05A 5EHOA 4PPAA 5A4EA 3R1QA 2VTHA 2G1TA 1Y8YA 4FZFB 3NCGA 3KC3A 5JGDA 2IO6A 4BKJA 5FEDA 5A46A 4HYSA 3PE2A 4YHTA 4EYMA 4FKRA 3FWQA 2QONA 3QHRA 3OEFX 4RJ7A 2R3KA 4ZXTA 2X6DA 4ZTSA 2CKOA 4IWQA 3KF7A 4MK0A 5DPVA 4OTPA 3UG1A 2LAVA 4TN6A 4IXPA 3KRRA 2G01A 2UW3A 3NYOA 3CBLA 4NM3A 3ET7A 3ZYAA 2CNUA 5AAEA 4NZWB 3MFTA 3HV5A 1AQ1A 3OOMA 2P3GX 2PUIA 3SXSA 2BHHA 2YHVA 5KUPA 4QPMA 2P2IA 3PY3A 4M84A 1Q8ZA 4DH5A 4IDVA 2FSTX 4DT8A 2WO6A 2OZAB 4UWBA 4IHPA 3WIGA 4DYMA 3DNDA 2Y7JA 4MBJA 2NP8A 4AGWA 4BGGA 5AUTA 1M2PA 3MPAA 4WSYA 3VBYA 5JEBA 4O86A 2YIXA 4C4IA 4EKKA 5CSHA 2VO3A 1QCFA 3EQDA 2QNJA 3DBFA 3C5IA 3U55A 2BFYA 4FNWA 3C9WA 2X9FA 3VQHA 4OTDA 5IA1A 5AA9A 2B55A 5IH6A 5TT7A 3NUXA 4ZZMA 4QYYA 3EHAA 3GI3A 2XKEA 4G1WA 4DCEA 4H05A 4BCHA 3PVGA 4KIOA 2FSLX 4F7SA 2BZKB 2A19B 3PG3A 4CV8A 3HV3A 5IZFA 4CQEA 2HZ4A 4DGNA 2WTWA 2VWZA 5E92A 2UV2A 2WMRA 4AOJA 5CAUA 3QBNA 3MV5A 4IX5A 5HNGA 1LPUA 5DMZA 3BI6A 3COKA 5L3AA 3V5QA 4X0MA 3V5WA 4LUEA 3SV0A 3L8XA 4EOJA 3KN6A 2BTRA 3RM7A 2JD5A 5CEOA 1E9HA 3QQLA 4YJPA 1OIYA 2PUPA 4FKLA 4A9YA 4BDBA 3GU4A 2E9VA 5A3XA 3UQFA 4DLIA 3OWKA 4Y85A 4AA5A 4YPDA 4FTTA 1KE6A 4QP2A 4G9CA 3EL7A 2YCRA 3CE3A 4OTFA 3ZSIA 5CU4A 3SOCA 5DT0A 5E90A 5ANOA 3PIZA 4Y73A 2X4ZA 3DOGA 3NAXA 1T45A 5J5TA 3OY1A 5E9EA 4FT5A 2XKCA 1TQPA 4LRMA 5CWZA 3TCPA 4YHJA 2YAKA 4C37A 3K54A 5EKNA 3R9HA 3RNIA 2W06A 3MY5A 2JDVA 1PKGA 3O71A 1LR4A 3PA4A 4L52A 4E4LA 2UW6A 4HGEA 4GS6A 1W98A 2A2AA 2OF4A 2QOIA 3AD5A 2WIPA 2HW6A 3I7BA 3IS5A 5KMKA 4DHFA 2GPHA 3EQHA 3DA6A 4O1PA 2GS2A 3A61A 4FKQA 4IM3A 2J50A 3GC0A 5AP3A 4J96A 4J98A 1BL6A 5HX6A 3D2IA 3MVJA 1OM1A 3I6WA 2AYPA 4CV9A 4D0WA 1H27A 3H4JA 5C8NA 4HNFA 5K4IA 1KE9A 5ANKA 4GK3A 3DXPA 3KXNA 4NEUA 2OXYA 4Y95A 5AR2A 1VR2A 5EOLA 2VWWA 4YLLA 5L8JA 4C8BA 3LQ3A 5EQPA 5FM2A 2VNWA 4ZP5A 2WQMA 4F7NA 3LCDA 2J90A 3QZHA 5IEVA 4LI5A 4F09A 5E91A 3FMLA 4RJ6A 4JIKA 5EYMA 3I6UA 4IFGA 4RJ4A 4ANBA 4EK4A 2GCDA 2WKMA 4GG7A 4ZSLA 2YA9A 4U44A 4XEYA 1YWNA 2YAAA 4Z16A 1PYEA 3MTLA 3LE6A 3QA8A 1IAHA 5DR6A 3TZ7A 2YLEA 4U97A 4I20A 2FA2A 4BDHA 5AFVA 4H3BA 2GHGA 4NUSA 1U4DA 3OY3A 2VRXA 3E7OA 3NUYA 4IADA 5KZIA 3G15A 3GU5A 2OXXA 2ITWA 3DB8A 3BCEA 3G6GA 3QGYA 4FKGA 2J2IB 4Y72A 5BVNA 2YIQA 4BHZA 4NIFB 3R9NA 4YC8A 3AD6A 2CKPA 4QMTA 4F70A 3S2PA 3HV6A 1M7NA 5CENA 5F4NA 4GUEA 3R22A 2WMQA 5B2MA 4L43A 3MFUA 3G2FA 4E7WA 3ACJA 2BRHA 4MTAA 4UN0C 3ACKA 3VVHA 3EQRA 4JI9A 4R77A 4RQVA 4IM2A 5LWNA 3HRCA 3DTCA 2EUFB 4FSMA 2W1ZA 3W10A 3ENMA 4TL0A 4D1SA 1H1WA 2XS0A 3L9MA 5AP1A 4BBMA 4BDEA 3A7GA 2BCJA 5HD4A 5FTGA 3U54A 1KV1A 3NYXA 3TUCA 4IEBA 3F3TA 2YDKA 4O81A 1TQMA 4QTAA 2C3JA 4EH4A 2VTMA 3R28A 4WA9A 1ZAOA 3EN9A 4PDOA 3T9TA 5M53A 3PY0A 3JY0A 2VTQA 3WYXA 2X2MA 1QMZA 1ZYCA 2EVAA 3BLHA 3PG1A 1BI8A 4K8AA 3DZQA 2YZAA 3WZJA 3QALE 3F2AA 3JUHA 4AUAA 3FQSA 2DUVA 4FR4A 4R1YA 1KE7A 3SA0A 3E8DA 2GS7A 4FSRA 3EMGA 4FL1A 5DRBA 3W1FA 1Q41A 3MPMA 3ZS5A 4TT7A 4APCA 1W0XC 1Y6BA 3VHKA 3WZEA 5HZNA 3E8EA 1ZYSA 4UX9A 3RMFA 2PZYA 4MXXA 2OFUA 2SRCA 2QO7A 3BIZA 3C4CA 3S3IA 4DGOA 1L8TA 2GNHA 2O64A 4FKVA 4IVAA 2PVMA 3QTIA 3RK9A 4KKHA 4FI1A 4P5QA 3RI1A 3BKBA 3FI2A 2C5XA 2VWBA 5CAPA 5CALA 3GCPA 3WI6A 4U45A 4FMQA 4CKJA 3Q60A 1HCLA 4ANQA 1G5SA 4TXCA 4EQMA 5E8SA 5I9VA 4FF8A 3UMWA 4PUZA 2C1BA 3WF5A 4RIWB 1LEZA 3TZ9A 5LARA 2VD5A 3RK7A 3ZUVA 4QMLA 2J9MA 4AS0A 3RPOA 5GZ8A 5IG1A 1ZYDA 2JDRA 5H8GA 3D4QA 4XP3A 3HECA 3QKLA 3MH3A 1BKXA 2VX1A 4O7ZA 1UU8A 2Y6OA 2RFNA 3CGFA 3EKKA 3HUBA 4BIBA 1IA9A 4O0RA 4PF4A 3GGFA 5HO6A 3PJ2A 3TZMA 4QNAA 1QPDA 1M52A 2UW7A 2QOLA 5C03A 4C34A 2CLQA 4LOPA 2YJRA 2ITYA 2H34A 4M12A 3R2BA 3FKLA 4XUFA 3F5XA 4O7TA 2OH4A 1YHSA 2ETKA 5CX9A 1GOLA 4GIIA 4FOBA 2WTIA 1H25A 4YTCA 1CMKE 1P14A 3NSZA 4ASDA 4AX8A 3V3VA 4CD0A 3GXLA 1Z57A 1OL5A 4RLLA 4UMQA 3FI3A 5KKRC 3FL4A 3U87A 4AGUA 4M13A 3SG8A 2W4JA 2QD9A 3DK7A 4FTKA 4UMPA 5EM8A 4FG9A 3C4WA 1SYKA 2EWAA 2GQSA 1MRYA 4DBXA 3UNJA 4XYFA 2JAMA 2Z7RA 3A7HA 1WZYA 1BX6A 3EJ1A 4TWOA 5DR2A 5ANJA 3PSDA 3UQGA 4B8LA 4F7LA 3BHTA 3IGGA 3CTQA 3OBJA 4ENYA 4KIQA 4FSQA 5HLNA 1STCE 5E1SA 1FBNA 4U80A 4K11A 3KRWA 2PVJA 4ASXA 2C6EA 3KK9A 3BE9A 4HZSA 1PXIA 5BVWA 4E93A 3BELA 2ZB0A 2UZOA 4QMSA 2XIZA 2GTNA 4O2PA 4W9WA 5G6VA 4F9YA 1VJYA 1PYXA 2J0IA 5EYKA 4ZJIA 4MQ1A 5CXZA 4USEA 1YRPA 5IISA 3LLAA 1JAMA 1CM8A 3WZKA 3LJ0A 5BVOA 3Q4ZA 4N57A 3ZUUA 4D55A 4RVKA 3D5WA 4BDCA 4YO4A 2CGWA 2VO7A 2IJMA 3MGYA 2UVYA 4OTHA 3ZFYA 5FUTA 4TNDA 2CKQA 3THBA 4IWDA 2Q0NA 1VZOA 4K0YA 4EBWA 3CD3A 2C6KA 3VF9A 3ZSGA 1I09A 3HLLA 4QMYA 2ZMCA 4O82A 2CPKE 4BZNA 3D0EA 4N6YA 3JR1A 5IA5A 1CSNA 3WE8A 3ULZA 5ETIA 3V6SA 1WFCA 1MUOA 3U4WA 2Z02A 2YN8A 4M66A 3UGCA 4L53A 4PPCA 3UE4A 2HIWA 4M0YA 4ACHA 3BZ3A 4BDAA 4YHFA 4S31A 5JFXA 3AT3A 5HKMA 5ACBC 2HYYA 3EQIA 3QTZA 1V0BA 3SAYA 4NW5A 1ZARA 4A4XA 4JQ7A 2O5KA 2XP2A 4O96A 2RFSA 3BYOA 1Y57A 4XG8A 2W96B 1OIQA 5C8KA 1LUFA 2E2BA 2OG8A 2OWBA 3ZM4A 3MW1A 5EI2A 3EN6A 3QTRA 4O6EA 2XKFA 4O0TA 1BMKA 4I6HA 4V0GA 4YC3A 1KUTA 3KXZA 4DF3A 2G2FA 2Y4IB 3NYNA 3R8UA 4IX4A 4ZLYA 1U54A 5CY3A 4FIJA 5EM5A 4AN2A 3R00A 2OW3A 4F1OA 3PDTA 2RG5A 4OGRA 2V55A 3BU6A 3BBTB 5JGAA 4FTMA 4OAUC 5AR5A 2HELA 3G0FA 4V01A 3K3IA 5IKWA 4TWCA 4L7FA 4YZMA 5HCYA 4D28A 2C68A 2PMOX 4NSTA 2HENA 4ITJA 4QQJA 3BWJA 3NNWA 2EB3A 3H9RA 3BWFA 2ITXA 3V8SA 4GG5A 1OL6A 3TG1A 4I0RA 3RPVA 4EL9A 1G8AA 2IZTA 5M06A 4BWXA 2BDJA 2XMYA 3BPRA 4R7IA 1B6CB 3SG9A 2PZIA 3D7ZA 2CLXA 1SZMA 3BHHA 3IOPA 4NFNA 4D4RA 5LCJA 3PJ8A 3C4EA 4I0TA 4TNBA 4ZSEA 2OIDA 3ZFMA 3N4TA 4CFVA 5CQUA 1ZZ2A 3G5DA 4FKPA 4FT3A 4GU9A 4YNEA 4ZTQA 3S95A 5HIEA 5BUEA 1M7QA 4U3YA 4GV1A 4IAFA 4ZY6A 4IBMA 3ZU7A 3ZM9A 4FSNA 4CCBA 3LXLA 4WSQA 3F3UA 5D7VA 1YI3A 4RSSA 4A4LA 2CCHA 1K9AA 5DIAA 4RWJA 3TKUA 4MXCA 3IDCA 3FY2A 4M8TA 4RVLA 4KBAA 2WU7A 2X8IA 4KBKA 2OO8X 2R9SA 2FVDA 2BILB 3IGOA 3V8WA 5DT4A 4UZDA 5D11A 2W17A 1NW1A 4XS2A 3S0OA 2CN5A 3BGPA 4GCJA 4I6FA 4TYHA 4DEHA 1GIJA 3QTXA 3T3VA 4BGQA 2GNJA 1H1RA 4ACCA 4QMUA 4C4JA 1O6KA 1OL1A 1XO2B 2GSFA 2W99B 3GQIA 3FXWA 4MEDA 3GQLA 4O21A 3DB6A 1CKPA 2XNOA 3RALA 2O3PA 4XHKB 4JAJA 4HGLA 2XIRA 4GMYA 3QD2B 5H3QA 4QTCA 3A8WA 4NU1A 3PJ3A 1LEWA 2ETRA 3DAKA 2XCKA 3REPA 4BI1A 2IZUA 3C0IA 5KMIA 5CI6A 5AP6A 4YJUA 2X4FA 1M17A 2FGIA 2OJ9A 3C4FA 3EZRA 5FEQA 5FP6A 3UVQA 4H1MA 2DQ7X 3GT8A 4HVIA 4CLJA 1VYZA 4WNPA 4USFA 2BKKA 5C1QB 4NT4A 4WUNA 3UZPA 3ZBXA 1U59A 4TW9A 4AN3A 3P5KA 2QKWB 2WMXA 4JIAA 3SD0A 2XNEA 2VTRA 3Q04A 4IZ5A 4CMTA 3KQ7A 1JNKA 4CXAA 2ACXA 1NXKA 4IW0A 1ZY4A 4EH9A 2YFXA 3R2YA 3R7GA 3BU5A 4C4HA 5CF6A 3OHTA 4GYGA 4PL4A 4RIYA 4XOYA 2BALA 4KUJA 1PMNA 3MY0A 4OLIA 3UNKA 5EM7A 3ZC5A 4BC6A 3V8TA 3HYHA 4LM5A 4DLJA 3I7CA 5A6OA 4ANNA 1SMHA 4BYJA 4CFNA 5T3QA 3TJCA 4B6LA 3ZTXA 4J95A 4OAVB 3F69A 2ITTA 3K5UA 3U6JA 1J1CA 5M55A 5L8KA 5I9UA 4QYGA 3RNYA 3OWLA 3IOKA 3MA3A 3MH1A 4I5CA 5A9UA 4HVGA 5CEQA 4C7TA 5J1WA 4G17A 2W1FA 3ZZWA 2B54A 3EZVA 1V0OA 4QP6A 4FICA 3QXOA 4U6RA 5LMAA 2W4OA 4RGJA 3FZPA 3FLYA 4FIGA 1UU3A 4BYIA 4QYEA 4RFMA 4TY1A 4DH7A 4HCVA 4IC8A 3G90X 3QQUA 3ORMA 3OTVA 4LOOA 3UP7A 4D0XA 4X2JA 5JGBA 1YWRA 4BBFA 4OBOA 3UQCA 2BZHB 3E62A 3ODZX 4BIDA 4E5WA 3UYTA 4QO9A 2GNGA 4I41A 4UZHA 4PDPA 1IR3A 2QR7A 2X7OA 1NY3A 4I92A 5E8WA 3R8PA 1PXLA 1O9UA 3QQJA 5F95A 3EN5A 4YLKA 2JEDA 3QA0A 4UY9A 4OR5A 5HO8A 4X2GA 3SC1A 2B9HA 3FZSA 3A7FA 4RZWA 2YLFA 3VHEA 4BR3A 2R3GA 3OG7A 3DQXA 5KE0A 4HVDA 3EWHA 4FKIA 2UZLA 2VAGA 3P23A 4K9YA 1XBAA 2OJFE 4C61A 5BYLA 3PA5A 3LFFA 2PMIA 5K0KA 2BVAA 1NT2A 1S9JA 2XIXA 5EKOA 3E87A 3I60A 1WVWA 4BCMA 4GKIA 2UZEA 4CNHA 2J0JA 2WTKC 4S32A 2WIHA 4LL5A 4YBJA 1UNHA 1QPEA 3LZBA 1GZOA 2BDFA 4FVQA 4UBAA 4R5YA 3TNQB 3DXNA 3RAIA 4IDTA 5KZ0A 5HE1A 4XRJA 5IDPA 3EQGA 1OZ1A 3F3ZA 3Q6WA 5IQBA 1PHKA 3C4ZA 5IQCA 3RM6A 2XK4A 4BHNA 3VBTA 4PP7A 1TKIA 3GU7A 3DLZA 4EH6A 2W1CA 4FTRA 4RC3A 4YSMA 3TDWA 5IF1A 2F2UA 3HKOA 4MXOA 2G9XA 4R5SA 5AIRA 3TN8A 3QL8A 3KN5A 5IQHA 2ITUA 3ATTA 3NUPA 2YM8A 3CKXA 4J1RA 5K3YA 4A9TA 2ITNA 2R3QA 5HGIA 4F7JA 3RPYA 2PE0A 2UVXA 3ID6C 4FSUA 3POZA 2YDIA 3LQ5A 3PWDA 4G3GA 4AW2A 4BCQA 4DE4A 2PVLA 3Q4UA 4RIXB 2PE1A 3G9LX 3KXGA 4DFZE 2X8EA 4LG4A 2C5YA 3D15A 4KKGA 3WARA 2VGPA 4DEAA 5L2WA 1ZMVA 4MD8E 5KHWA 5IEXA 1HOWA 4EOIA 3CQUA 5GJDA 4X7QA 4EHEA 3BU3A 3OXZA 4E6QA 5HE3A 1P4OA 1GJOA 4TYGA 3O50A 2W1DA 3LAUA 5EHLA
chains in the Genus database with same CATH superfamily
4ZK5A 2O2UA 3PYYA 4QTBA 1UNGA 5HNIX 2XJ2A 4XP0A 3UO5A 2VWUA 2NPQA 2WTJA 4PQNA 4E6AA 3CY2A 4KABA 4IAAA 3OVVA 4FZAB 3RAHA 3G6HA 3ATSA 4R8QA 5IDNA 4O4BB 4JAIA 4O84A 3V6RA 4A07A 2XNMA 3FBVA 2R3JA 4BCKA 4XX9A 5HG8A 4QMVA 4FVRA 4WG4A 4FGRA 3QCXA 4O7LA 3NS9A 5J9ZA 3UG2A 2VWYA 3QLFA 2V5QA 5LCKA 3SW7A 3TNIA 4GJ3A 4O7RA 2XCHA 4DA5A 4L3LA 5AEPA 4WBBB 4GFMA 3TL8A 4OTIA 4CRSA 1XH5A 3DPKA 4FVPA 4D1XA 1JSVA 1WAKA 1YDRE 3BHVA 4NJ3A 4WKQA 4PTGA 2JDSA 4YZ9A 3SQQA 4AXDA 2ITQA 4FTQA 4IVCA 3OOGA 3AD4A 4KIKA 1OIRA 2VV9A 3NCZA 1A9UA 2BAQA 3KCFA 5JQ5A 2XB7A 2HY81 5LXMA 2H96A 3FMEA 3LFEA 3AC3A 3PZEA 2OIBA 3R6XA 5BUJA 3RKBA 4AAAA 3EKNA 4NTSA 1R78A 3MIYA 2ZM3A 3UO6A 1P4FA 4FV1A 3RAKA 4E5BA 5HNBA 2R64A 3SDJA 4EK3A 2CCIA 2V0DA 2QO2A 3KF4A 5DVRA 3ORTA 2R7IA 3H0ZA 4FSYA 4YURA 3PPJA 5IMEA 4IIRA 4EH5A 5KKRB 1UKIA 3RINA 3UPZA 2ZFYA 3BL9A 2VTOA 2R3OA 1JPAA 2W5AA 2UZTA 3FMDA 3HX4A 3R30A 3OW3A 4W4XA 4ALWA 4ZOGA 3PLAE 3R8MA 2PVKA 2W1EA 1H00A 3WZDA 4DG2E 3N4VA 3QLGA 2XBJA 2QG5A 2RFEA 1BLXA 3KU2A 1G8KA 3IECA 4TRLA 3DBQA 3UOKA 4V0GB 5E4HA 2WELA 3VS4A 2V22A 4GUBA 5HOAA 3EFJA 1MRUA 2EB2A 2QVSE 4IB3A 4CFFA 4DTKA 1U54B 1DI9A 5C26A 3E8NA 2JBPA 3EYHA 2F2CB 2C5OA 3CSVA 2KULA 3LFBA 3FE3A 3I4BA 2BIKB 2JKQA 2R4BA 1Z5MA 3QTSA 1DI8A 2RSVA 4I23A 4JNWA 4MHAA 5IUHA 5CEKA 3NUSA 4M69A 4LOQA 4IAZA 5CS6A 4DCAA 4JVGA 4FNZA 4GT5A 3W8LA 4RLKA 4E20A 2CNVA 4D2PA 2UZUE 4M67A 4F9CA 4PNKA 4DTBA 2GHLA 4J53A 3ZO1A 2PSQA 3DK3A 5DN3A 1P2AA 5IQEA 2XNGA 4XJ0A 4ACMA 1XH8A 3GCUA 3KVWA 2LGCA 4JBPA 2PK9A 2BRMA 5JFVA 4AGCA 2X81A 4DT9A 5HU9A 5C01A 4BJJA 1J7LA 3ZSHA 3D83A 4CYJA 3MESA 2QODA 4BDDA 5M57A 3DKOA 4B9DA 2XZSA 3FXXA 2A98A 5DI1A 4QOXA 3QQFA 1ZOHA 4G9RA 4BWPA 4L67A 3SRVA 4O0XA 4L01A 4X2FA 3PA3A 3FY0A 4EZ7A 4ZZNA 5CU6A 4N70A 4JG8A 4FKWA 4F1MA 4EOOA 5ANDA 5L6PA 3NVMB 1YXTA 1ZY5A 3QWKA 2X9EA 4Y5QA 3UTOA 3PXRA 4L00A 4LUDA 2VWIA 4F0GA 5I5ZA 2PVRA 2BDWA 4WO5A 4Y8DA 3BLAA 5ANGA 4EWQA 4NTTA 5GJFA 2CSNA 4CEGA 4HGSA 3AQVA 3TM0A 3ULIA 4Z9LA 2WQNA 5DNRA 5J8IA 3P7BA 4K1BA 4TKSA 3Q53A 4TYHB 4HGTA 2IWIA 2EXCX 2QOBA 4U81A 5FBOA 5KNJA 1XWSA 3ZHPC 3TXOA 2W1HA 5ETFA 4YBKA 3BEAA 4U7ZA 5CZHA 3W2CA 4CKRA 3QXPA 5F94A 2IPXA 2OSCA 4L44A 3QZIA 1YXUA 4O4FA 4QQCA 4A9UA 5DOSA 4XV3A 4GW8A 2PVYA 2XNPA 3HZTA 4V05A 4EQCA 3F7ZA 4ZSGA 2CNQA 1ND4A 4GH2A 5T68A 5DHJA 4KSQA 3NUAA 3DFCB 4FK3A 2ZV9A 2PY3A 5CASA 4IJPA 2IF8A 4WG5A 5F20A 5K5NA 2PMLX 3HMPA 4G3CA 4O2ZA 1V1KA 2WMVA 1K2PA 2OH0E 3LKMA 2YJSA 1YDSE 3KB7A 3MYGA 3OUNB 4Z55A 4ERKA 1WBNA 5LVMA 2HXQA 4FEXA 4CG9A 3KMMA 4YR8A 5I9ZA 3F3WA 1UWHA 5FWKK 2X7GA 4WG3A 2ZJWA 3Q96A 3ZDIA 3R7IA 5HTIA 2I0HA 4KA3A 3F2NA 3OTUA 2GQRA 4AAYA 4K6ZA 1F5QA 3LLTA 5D1JA 3VC4A 4AZVA 2PWLA 2WMAA 4RIYB 5L6OA 1IA8A 3D7TA 3I5ZA 2VO0A 1H8FA 1CTPE 4BI2A 3FYJX 3SXRA 3ZXZA 3O7LD 3KULA 4AE6A 4WOVA 4F6WA 1KV2A 2J6MA 2R5TA 3BV3A 1K3AA 2YCSA 3AOXA 3F6XA 4L6QA 5FXQA 2UZNA 3BGZA 5C27A 2JKMA 4F6UA 4OTRA 4BZDA 1W2DA 3QRKA 5FTOA 2QOQA 2ZV2A 4O0YA 5A54A 4FC0A 4FNXA 2JDTA 4ZY5A 3E3PA 3WIKA 1EH4A 4RQKA 5I3OA 4AZTA 3EQFA 3HAMA 2R3FA 3D94A 4AZFA 2BTSA 3TWJA 4CFMA 4K2RA 3P86A 5CAQA 2CHLA 1A48A 1FPUA 1JSUA 1PY5A 2XNNA 3QQKA 3W0NA 3IONA 3UODA 4LMNA 2I0EA 3B8QA 3QAME 5IH4A 3LFCA 4O27B 1QPJA 3DU8A 5AADA 3UJGA 4A06A 4FV7A 3T3UA 2F49A 2A0CX 5HCZA 2VU3A 4C3RA 4DEGA 4EONA 5J1VA 4FKSA 3ODYX 3BGQA 4OTGA 3V04A 3OEZA 1J7IA 5GIPE 4I24A 3RZFA 5HO7A 2ETMA 4ITHA 3FPQA 1YQJA 3NYVA 5C4LA 4D9TA 4HJOA 4YZCA 4M15A 3KIOC 4UXLA 3VUDA 3C4XA 2VTLA 4YMJA 2BRNA 4FK6A 4D1ZA 2C6IA 3NUUA 3BQCA 4CZTA 3JYAA 2FB8A 1KWPA 2G15A 2WQEA 5AUVA 4ZAUA 5HTCA 2OICA 3PPZA 3QYZA 4ZZOA 5BNJA 4RG0A 4EOKA 1XBBA 4YJRA 1V0PA 3BE2A 4B7TA 5JRQA 2QR8A 3EN7A 3OMVA 4EOSA 1R3CA 2JFMA 4FX3A 4L46A 4B99A 4DH1A 3QX2A 4LV5A 4FG8A 4F08A 2XK7A 4FV8A 2PPQA 5CF4A 2XKDA 3HV4A 3VBXA 4OUCA 4ZTLA 4QPAA 4KS8A 2OJGA 4I3ZA 2P0CA 2UW8A 4ZS4A 4F64A 4HCTA 3NUNA 4IFCA 4BDIA 5H8EA 2Z60A 2YISA 5AV0A 2YZLA 4B0GA 4ZJVA 5ETAA 3KVXA 3O17A 4FSZA 4EK6A 4C59A 2XYNA 4QMQA 1PXKA 4IAIA 4JLCA 1OL2A 5HE2A 3ZLYA 5M4FA 2W1GA 3ANQA 3IDBA 3O23A 4PL3A 3QRUA 1U5QA 4O83A 5E8VA 4ANMA 3R7OA 4CG8A 1KOBA 1H08A 1M2QA 4M68A 3MVMA 3WF9A 3I1AA 4N6ZA 1MQ4A 1DAWA 3BQRA 3FQEA 3F2RA 2ZV7A 4AG8A 4YJOA 3KRLA 2O8YA 4O7WA 3WOWA 3B2WA 2ZOQA 4NFMA 1FOTA 2R3IA 4YPSA 4CFXA 1L3RE 5AV2A 3VQUA 1NA7A 2IW6A 4O0WA 1YOMA 5M44A 2CGVA 4GVJA 1SM2A 5E7RA 5I4NA 2X39A 3COMA 3VS2A 4DFBA 5FXSA 3L8SA 3UVPA 3PVWA 3HMOA 2BKZA 3AT4A 4R3RA 3DKCA 4X6QC 5G1XA 4JDIA 3PSBA 4H58A 4WT6A 1OUYA 2QCSA 4F65A 1XH7A 1OVEA 2I0VA 3IDPA 4YJVA 3ZUTA 2BAKA 4PV0A 3FC2A 3G51A 3VUKA 3E7VA 3OT3A 3BEGA 5DEYA 5AP4A 3W0QA 3QC4A 3TIYA 3FAAA 5FG8A 2WTKB 5AWMA 4U3ZA 3T8OA 2WEVA 4AGDA 2W5BA 5TO8A 4FTJA 3BRBA 1OPLA 3P4KA 3LMIA 4NM5A 4KNBA 3D5UA 4QMPA 3UBDA 4C02A 4F9BA 5BVFA 5IQAA 3M11A 4X3FC 3Q2MA 4XG4A 2PMNX 4AF3A 3AMBA 1ZMUA 2IVUA 5M08A 1M2RA 2B9JA 5JSMA 2UUEA 1NVQA 3N9XA 2HZIA 4L42A 4NWMA 2FH9A 1ATPE 4I0SA 2WZJA 5FXRA 3RJCA 4O7VA 3I5NA 2QOKA 4FV5A 4Q9SA 3N51A 2RFDA 3JVRA 4JX3A 4WNOA 5CT0A 3NRMA 3PE1A 5HBJA 4FEQA 5C8MA 3U9CA 4F99A 5M4CA 2VTJA 3GVUA 2UZWE 2AC3A 4DFNA 5IUIA 4KIKB 3FL5A 4BRXA 3ORZA 4UYAA 5EHYA 1JKSA 2R0UA 3C1XA 4J7BA 2VX0A 3I79A 4U43A 4DG3E 2YM4A 3DGKA 5L2QA 3PXKA 4WBOA 3NEWA 3HDMA 4JQEA 4BVUA 1NVSA 3MJ1A 3RK5A 1OL7A 4U79A 3COIA 5D10A 4DEEA 5I9WA 5KBQA 2W7XA 4FJVA 4QYFA 2GFCA 3R9OA 1PMUA 5AMNA 3II5A 4O4DA 4HPTE 5ITAA 4RA5A 3QTWA 3RWQA 4YJNA 2Y0AA 2VTIA 5ICPA 1A06A 2WAJA 3BLRA 2GDOA 4ZIMA 4C3FA 4S33A 3EIDA 3VN9A 4D2SA 3EN4A 4DGMA 4DINA 5LMKC 3DZOA 3R1NA 4EORA 2ZVAA 4F1TA 5KMLA 5EOBA 3OBGA 4G6LA 3PRFA 2HZ0A 2VX3A 3DDQA 2QLUA 3Q6UA 4LGHA 4R3PA 4RWKA 5JZNA 2WXVA 5HICA 4DG0E 2PUNA 3HUCA 3C50A 4AW5A 2ZM4A 1YDTE 2EU9A 2PTKA 2W1IA 4X3FA 4D5HA 4L68A 4IX3A 1J1BA 2XVDA 3DNEA 3F82A 4FBXA 3NR9A 4P90A 3QRJA 2UZBA 4U8ZA 2YIRA 5DRDA 4AXCA 4YTIA 4BGHA 3W0RA 1E1VA 2R3LA 4I22A 3TACA 4KIPA 3UC4A 1YHWA 3UIUA 2BHEA 5FEEA 5JFSA 4MH7A 5KBRA 4FKOA 4LRKA 5FTQA 3UOLA 3NPCA 1OKWA 4M69B 1WBPA 4BTFA 4EHZA 1GZKA 4JT3A 3L9PA 4D2RA 1XJDA 3NX8A 2ITZA 4FIEA 3ZLSA 3LW0A 4AT4A 2H6DA 4EHGA 5JQ8A 1PXPA 2IN6A 2GS6A 3E8CA 3QYWA 4J8NA 2O0UA 2Y6MA 5CSXA 3DLSA 4FZDB 3OW4A 4O7SA 3KEXA 2PUUA 1REKA 3VUHA 4Q5EA 4XV2A 4BCFA 4C4FA 5K0XA 4IWPA 3Q2JA 1URWA 3ZXTA 2ITPA 3W0OA 4ZMEA 4F0IA 4NK9A 1IEPA 4IMYA 4BJJB 2A4LA 2NO3A 5TE0A 1H1PA 3LPBA 2I6LA 3HV7A 4Z7GA 4QD6A 1YXVA 3QUEA 3ALNA 3TUBA 3GCQA 3RPRA 3SRVB 1H28A 4ZSJA 5LMKA 4RC4A 3VRYA 1KSWA 2CMWA 3JPVA 2VTNA 2BAJA 4NCTC 2J51A 2XF0A 2YIWA 4I1ZA 5JRSA 2YITA 2NRYA 3UOJA 4MF1A 4O7YA 3QCQA 2BZIB 4I93A 4F9AA 4FL2A 4RZVA 4R1VA 2WOTA 4ASEA 5CF5A 4YSJA 2RIOA 3QCYA 2FO0A 3G0EA 3P78A 5I9YA 5BVEA 4AT5A 2YIYA 4KBCA 3UC3A 4CFWA 5GHVA 3ZBFA 1OBDA 4XLIA 2C6TA 3B2TA 2Q83A 4NKAA 2ERZE 3ZFXA 1H4LA 4EHVA 3OROA 4ANLA 2VN9A 3CTJA 4H3QA 4Q5HA 5LVLA 5HG9A 3P0MA 5AP7A 2JIVA 3W33A 5GJGA 3R9DA 3MI9A 3MFRA 3SOAA 3CXWA 2H9VA 2FSOX 3FPMA 3OF0A 4V04A 4C2WA 2HZNA 4FKUA 3R0TA 1YW2A 3VJOA 3ERKA 4DEBA 4CMUA 5J9LA 3BYMA 3HRFA 2W5HA 3P9JA 4GFGA 4ZTNA 3VS7A 4CZYB 5K4JA 4EH3A 2X2KA 5KX8A 2YM7A 4EH8A 2GQGA 2QU6A 3QGWA 3HA8A 1Q8TA 3KRXA 3NDMA 4RBLA 3FI4A 4AOIA 3P7CA 2G2HA 1BUHA 4XG6A 4S2ZA 4D4VA 4MQ2A 2VUWA 4JBOA 5F1ZA 2VWVA 1R1WA 3B8RA 3FV8A 3H3CA 3CIKA 1H26A 3W16A 2WMWA 2WPAA 4LRJA 4ZY4A 3CLYA 4EKLA 1Q8WA 3TTJA 4I6QA 3PUFC 4AQKA 1PXJA 4JRNA 5EDQA 4WRSA 4EJ7A 4NCTA 3SX9A 1Q8UA 5EG3A 1PJKA 1RDQE 4PRJA 3FDNA 3NVKI 3D7TB 3E63A 4HYIA 3UP2A 4AW0A 3QKKA 5IEYA 1Z9XA 3OCSA 4JR3A 5DGZA 5HHWA 3L1SA 4I6BA 4ALVA 3KULB 3CJFA 4FIHA 4E6DA 4EJNA 3RWPA 4DTAA 1FGIA 2E9UA 3DAEA 5HE0A 5J95A 4D5KA 4MAOA 3MVLA 3NW6A 3E64A 5KMJA 1ZYLA 3GOKA 3W0MA 2F4JA 2GNFA 1OB3A 3FZOA 4IZAA 4W9XA 3EFLA 3EL8A 3IKAA 4G5JA 4DFYA 5LJJA 3PWYA 2DS1A 3RTPA 2J5EA 3H9FA 5DBXA 4G2FA 1PXNA 3ORLA 3L8VA 3R8VA 4QMNA 5D7AA 4IB0A 2C6DA 1J3HA 2X0GA 4LQMA 4KAOA 3PP0A 3UIXA 1UV5A 3HRBA 1UVRA 4JJRA 4AXAA 3ZZEA 3LFNA 3LVPA 3PFQA 3CEKA 2XJ0A 2RG6A 5B2KA 3LXKA 3IW5A 3V5LA 4GK2A 2W4KA 5L8LA 2YM5A 3UPXA 2RF9A 3WE4A 4HOKA 2WU6A 2V62A 5HG5A 5DA3A 4FE2A 2BPMA 5ETCA 4FODA 4F63A 5JKGA 3GOPA 3NIZA 3OP5A 4TWPA 3U6HA 2XNBA 4I4FA 5CSWA 3GFEA 3ORPA 2UW4A 3E5AA 4RMZA 4G3FA 3NW7A 1PW2A 4GK4A 2BMCA 3G9NA 3Q9XA 4DGGA 3MA6A 5I3RA 4UWYA 1GAGA 5D41A 3DCVA 5GNKA 3R71A 2XYUA 4E4XA 3EQBA 4M3QA 4C35A 3KK8A 4NH1A 5ANEA 3RP9A 4NYEA 3QRIA 4EH7A 2C6MA 4BY9E 5CVHA 2YCFA 4UEUA 1OKVA 1WVYA 2GNIA 4FKTA 4HYHA 2BIYA 3FLWA 2B7AA 3FQHA 3UNZA 4EK5A 2WMSA 5C4KA 5H9BA 4RPVA 3GCVA 2OFVA 3VO3A 2ZMDA 3PJ1A 5FGKA 3EQPA 3R01A 3ZCLA 5L4QA 4O7NA 4XRLA 1Q61A 3M1SA 4HW7A 4HVHA 3F9NA 3D2KA 3HEGA 4G6OA 2JIIA 4PNIA 2O65A 2XIKA 5CANA 5CAOA 3FC1X 4EZ3A 4AE9A 2WQOA 3VUGA 3L9LA 4BDKA 4QP8A 2UZDA 4KWPA 2XEYA 4ZLZA 3VIDA 4RJ5A 3RHXA 4L3JA 4XP2A 4CT1A 2OK1A 3DJ6A 4CTBA 1H01A 4QDEA 3W18A 3I0OA 2C1AA 4E4NA 1JKTA 3S00A 1KOAA 1FINA 4GU6A 5CU0A 4U42A 3HMNA 5CLPA 4Z3VA 2B4SB 4FSTA 5EQEA 1JOWB 3NIEA 4GEOA 4NW6A 4O4EA 3IW8A 3GP0A 3VUIA 5AV4A 5LVNA 3ORXA 3PFYA 3V51A 1Y8GA 4DEDA 2OIQA 2QKRA 3OFMA 1W83A 3K2LA 2FUMA 4RVTA 4ONAA 4YGAA 4FT0A 4II5A 2P4IA 1O6YA 4H3PA 5A4LA 2XRWA 3PXFA 3QQGA 2QC6A 2W0JA 5HIBA 4ITIA 2VGOA 3VAPA 2JLDA 4QMZA 2VO6A 4BTJA 4BL1A 3RCDA 2HOGA 2Z7QA 5FBNC 4BTMA 1P5EA 3OCBA 4YTHA 2X0QA 5A4TA 5EK7A 2Y8OA 4X21A 5AP0A 4BCGA 3OT8A 4RVMA 4JL9A 1Q3DA 3PRIA 1OPKA 3ZO4A 2R3PA 3PSCA 2PU8A 5E8YA 4BDJA 3Q9ZA 3IW6A 4UV0A 5DR9A 1UNLA 3TKIA 3PVBA 3Q32A 4OT5A 1H0WA 1YI6A 4O38A 3WYYA 2I7QA 2XK8A 1W82A 1YKRA 2WGJA 3OUKA 4H1JA 4G34A 5AUXA 1OBGA 3V01A 3HMIA 4C33A 3D9VA 4HZRA 5FQDC 5HCXA 5LVPA 3A8XA 4QQ5A 4QRCA 3ANRA 2GTMA 2REIA 2YABA 5BYYA 4I94A 2XRUA 4TYEA 5EM6A 4C57A 3MBLA 4CLIA 4C4EA 5EYDA 2QURA 4N0SA 3I81A 4ARKA 3TYKA 1U5RA 2VTAA 4IANA 3PIYA 4MNEA 3PJCA 4EC9A 4AW1A 4HVSA 1TQIA 1IRKA 2ITOA 4ZMFA 3QUDA 3VW6A 3DBCA 5HVJA 4AZWA 3ORKA 3COHA 3S4QA 3O7LB 4RWLA 5EI8A 3ZLWA 4QTDA 2QO9A 4Q9ZA 2AC5A 4JXFA 1GIHA 4XBRA 1BYGA 4F4PA 4F6SA 3RGFA 4CMOA 3MTFA 3QD4A 3ITZA 4K77A 3BBWA 5GZ9A 3SKCA 4NM0A 3TDVA 2IW8A 4L3PA 4YO6A 4YJSA 1PRYA 1M14A 3Q52A 3ETAA 2X6EA 4FV0A 4PMPA 3Q3BA 2I0YA 1ZOGA 3EOCA 4WNKA 1JSTA 3TMOA 4MVFA 3UOHA 4MKCA 4FRFA 3IQ7A 3VRZA 4CCUA 3QZFA 3NAYA 1S9IA 3GFWA 4BDFA 2R2PA 1HCKA 3CPCA 5DEWA 2IZSA 3KY2A 2EXMA 3BX5A 4YLJA 3QU0A 2IVTA 2HWPA 4U40A 5IMXA 3QTQA 4LV8A 3LXPA 4D4SA 2VTTA 5C9CA 5BMSA 3AT2A 3H9OA 4P7EA 4M0ZA 3VBVA 3FHRA 1R0PA 3W0SA 4X3FB 2AUHA 2WD1A 5HVKA 4DDGA 4C4GA 3ZC6A 4J52A 4O91A 3ROYA 5CNNA 5J7HA 3DTWA 4Y5HA 5FM3A 4F0FA 3MDYA 5CZIA 1JBPE 2DYLA 1CKJA 3R02A 3OS3A 4H39A 3QC9A 4FIFA 3TKHA 2CJMA 3NZ0A 2CN8A 3QHWA 4GT4A 4IWOA 4G5PA 5AUZA 3WBLA 2YACA 2C5VA 1OGUA 2P55A 3LXNA 3FLZA 4YJQA 4FYNA 1H0VA 2BFXA 4W4VA 4X2KA 5BVKA 2F57A 3Q4CA 5EDPA 3LMGA 5GZAA 3SXFA 3RVGA 4ACGA 5BV3A 1Q8YA 2C3KA 4M14A 4ID7A 5EDRA 3DKGA 2CKEA 2GFSA 1OPJA 3V5JA 4BBEA 4EH2A 4MBLA 4QMOA 4K18A 3CS9A 1NVRA 2WNTA 4ANOA 3O96A 1WCCA 2BRBA 2IVVA 2OU7A 4G16A 5JT2A 2JAVA 4TPTA 4JBQA 1I44A 3GB2A 1G3NA 4QP3A 2AEGA 2Z7SA 1JKLA 3P7AA 4C2VA 4ENXA 4DHJA 4BI0A 2GHMA 1W84A 5CVFA 2B9FA 2BZJA 4BICA 5L2TA 1H24A 1QPCA 1KE8A 5E8ZA 5IQIA 3DK6A 2IVSA 5J87A 3UO4A 1MRVA 3LFQA 3ROCA 3U6IA 4APPA 4WNMA 3CKWA 2OZOA 1PF8A 4FV6A 4LYNA 5L6WL 3QUPA 3R04A 5AR8A 1FMKA 2B9IA 2ZAZA 4YP8A 4RX9A 4J71A 4P4CA 2V7AA 3E88A 4ORKA 4WHZA 3ZMMA 1H1QA 3GC9A 3PXQA 3UIBA 3QQHA 5DFPA 2JKKA 3AC1A 1YOLA 4UXQA 4KSPA 3FKOA 3R83A 4BZOA 4EK8A 4BCNA 4QTEA 4DFXE 5H8BA 4OBPA 1FVVA 2UVZA 3QD0A 1PKDA 3ZONA 4QP4A 2OJJA 3LMHA 3MB6A 4FSWA 5DE2A 2DWBA 2EXEA 4XV9A 4FA2A 5JH6A 4O0VA 3FMJA 5K9IA 5HQ0A 1MP8A 4I5MA 1MQBA 3IG7A 2X7FA 1UA2A 3QFVA 3RBWA 5IU2A 2YDJA 4FTIA 3WF6A 5GINE 3T9IA 1XR1A 5AV3A 3D14A 5JN2A 1YWVA 4RFYA 4LV7A 3GBZA 2KTYA 3PY1A 1RW8A 5AUUA 1YHVA 4GT3A 3UDBA 3ZRMA 3R73A 4WIHA 4BCPA 5FDPA 5BMMA 5IA2A 4TZRA 1Q62A 3GUBA 5AV1A 3R7YA 5EW3A 2V7OA 3KCKA 2PL0A 3KMUA 3AGLA 5AJQA 5E8TA 3S1HA 1WBTA 5AM6A 3KMWA 1WBOA 1IAJA 3QZGA 4NJDA 4DGLC 1OECA 2F7EE 2HK5A 5F9EA 5CEPA 3FEGA 4AWIA 4EOMA 2C47A 2RL5A 2PVHA 3UDZA 4MXZA 5KCVA 1JWHA 4YZDA 1GIIA 2YM6A 2R3NA 2WTVA 1XHAA 3ZEWA 2OF2A 4IM0A 3IW4A 2BRGA 4IAKA 4E73A 3A62A 5CSPA 4IZ7A 2J5FA 2R3MA 1JKKA 4FV9A 3HAVA 3A99A 3IPHA 4FEVA 4IB1A 4AFEA 3VBWA 3D5XA 1XH4A 4IAYA 3NLBA 5HD7A 3BL7A 1H1SA 1R39A 2WQBA 3O51A 3BHUA 1CKIA 5CXHA 3F3VA 4AN9A 4C0TA 1Y91A 3DV3A 3W2QA 2FYSA 3F5UA 5DH3A 3QF9A 4FTAA 4FV3A 4GRBA 3RAWA 4DBNA 2ZYBA 2UZVA 3C0HA 3VF8A 3ZOSA 4MBIA 3HVCA 3WF8A 1SNUA 2IZRA 4J99A 4I21A 3VJNA 4DC2A 5BYZA 2YWVA 4G3DA 3UMXA 3KXHA 3P08A 5KO1A 2OGVA 2QHNA 3U4UA 3PLSA 3FSFA 4M7IA 3F5PA 2OKRA 4K33A 4MNFA 4MWHA 4CT2A 2IG7A 4FTUA 4MD9E 1PXMA 2PE2A 5BVDA 3VBQA 1FVTA 3Q5ZA 5KHXA 2J0LA 3EFWA 2Q0BA 4O1OA 5H2UA 5M07A 4TWNA 3C5UA 2WMTA 3DAJA 3N4UA 2Z2WA 4CKIA 4D2WA 2GMXA 4IACA 3A7IA 3TIZA 3GU8A 2JDOA 1DM2A 5CVGA 3JY9A 4JDHA 3DFAA 2C0TA 2Y4PA 2PHKA 3BYUA 3NMUF 4GYIA 4KRCA 5IQFA 1CDKA 1QL6A 2I40A 3O8TA 3OWJA 4NM7A 2WEIA 2OXDA 3O0GA 2XAMA 5CF8A 3IW7A 1G8JA 1ERKA 3LM5A 3AG9A 4GKHA 2R3HA 2YERA 5A4CA 3GU6A 3LCTA 5HG7A 3F5GA 3AGMA 5HESA 4AZSA 2ESMA 4D2TA 3VUTA 4RJ8A 5EFQA 3KA0A 4WUAA 5AA8A 2J0KA 1FGKA 3ALOA 3H0YA 4UB7A 3DQWA 5CU3A 5DG5A 4EOQA 3C7QA 3Q9YA 5AX3A 5HVYA 3VS1A 2C5NA 3WILA 1B39A 3AKKA 3CPBA 4E26A 4PPBA 5A14A 3PXYA 3SLSA 3SHEA 3LFSA 3TZ8A 5CAVA 2UW0A 1ZYJA 3AXWA 3POOA 4MWIA 4RC2A 5CNOA 1Q99A 3FKNA 4R7HA 1OUKA 4I5HA 4C36A 1PXOA 5DLSA 1SNXA 1XQZA 4FNYA 4FZ7A 3UZTA 4QPSA 5ANIA 3AC5A 2HW7A 1Q24A 2J4ZA 4L7SA 1O6LA 2JGZA 2JC6A 4ZEGA 4CTCA 5IH5A 2R0IA 3Q9WA 1T46A 3LCKA 4LGDA 4MD7E 4ZTHA 1OKZA 1GZ8A 5IUGA 3Q4TA 3ML1A 3DY7A 4PY1A 4RIXA 4XV1A 5HORA 3CD8A 4EI4A 3CCNA 1J7UA 2HCKA 4EOPA 3HDNA 4DEIA 4QP1A 5A4QA 2PVNA 3QWJA 2PULA 5HI2A 5JMSA 5T6KA 5LOHA 5DYJA 2XM8A 1F3MC 3MJ2A 5AIKA 4GFOA 3VS5A 3W32A 4AP7A 3R21A 3U51A 1Q97A 3TV4A 2QU5A 1REJA 2XK9A 3BYVA 5D12A 3LCOA 1RQQA 4JQ8A 3JVSA 3NNUA