3QD0A

Phosphoinositide-dependent kinase-1 (pdk1) kinase domain with (2r,5s)-1-[2-amino-6-(3-amino-1h-indazol-6-yl)-4-pyrimidinyl]-6-methyl-n-phenyl-3-piperidinecarboxamide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
274
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Structure-Based Design of Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 (PDK1) Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 274
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qd0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qd0A01
3NIEA 3QTUA 4ZTRA 3CKXA 3UG2A 1FBNA 3MPMA 5A6NA 4HVSA 5KBQA 3BLRA 3OCGA 3S2PA 1ZMWA 4AZTA 4JG6A 3WI6A 3D94A 4O7VA 1BL6A 5M57A 4DH8A 3EYHA 3PSDA 3NSZA 3FKOA 3EKNA 3CD8A 4KIKA 1Q8WA 4QP8A 2JDOA 2RKUA 4FOBA 2QOFA 3RK5A 2YACA 3O0GA 5HE2A 2J4ZA 3PPZA 4BGQA 2XNEA 3QXOA 2OJ9A 1PXKA 5IMXA 4R3CA 5J7BA 2XK8A 3FYJX 3ZFMA 4IVBA 4DFUA 4RT7A 1ZZLA 1SM2A 3G0EA 1DS5A 4M66A 3ORXA 4ANBA 4ITIA 4IZAA 5AP7A 2RIOA 5KMLA 4ZLOA 3LQ8A 4HVHA 5GHVA 3HAMA 2KTYA 5FTQA 2WIHA 2XNBA 3RBWA 5AIKA 3LMIA 1XO2B 3VRZA 2OZAB 3W2SA 2XYUA 3VWAA 3HZTA 1YOLA 1RW8A 3OW3A 5E92A 2JIIA 3GU6A 4EH9A 3FZTA 4G9CA 2PVNA 2CNUA 5B0XA 5EM8A 4RJ3A 4IWDA 3DXQA 3P4KA 5DNRA 2EB3A 3SAYA 2QD9A 4J71A 3EZVA 2YCRA 2PE2A 2YIYA 3WE8A 2G01A 3A8XA 5CNOA 2P55A 5FEDA 5DYJA 2WB8A 2P2HA 4BZDA 3TUDA 2NRYA 2ETMA 3OF0A 5C9CA 4KKEA 4RX8A 4ZSLA 3R1SA 2UZTA 3G51A 1WBVA 4X2KA 1KE6A 1V0PA 3EZRA 3A99A 4G17A 4ACGA 5G6VA 3QUDA 4D0XA 3SOAA 4O86A 4FTJA 3SG9A 4IAAA 3PTGA 2XIYA 2GNLA 4KRCA 2YIWA 4G3CA 4O83A 2O64A 2BALA 2IO6A 3QFVA 4ZJVA 3W16A 2WMQA 2ONLC 4NT4A 4F9AA 3TN8A 4O27B 3ORZA 2XNPA 4IX6A 3MJ1A 4O0WA 3PE2A 1OUKA 4I5HA 3UPXA 2PVMA 4DHFA 2OICA 2W5HA 4FSQA 4ASEA 3FLZA 5BYZA 1ZYLA 1PRYA 3I5ZA 4XUFA 2A27A 4O84A 3MB6A 4JRVA 3VQHA 2WMSA 5GJGA 4QMXA 3F66A 5AUUA 2ZDTA 3M1SA 3D4QA 4C34A 4CD0A 4QNYA 3DFCB 4UXQA 3U54A 3F3ZA 5ANIA 4E4NA 1UA2A 3VF8A 4WUNA 3R7IA 4QP1A 4ZY6A 4X7QA 3RPVA 4OTDA 4F7NA 1GZNA 3VS5A 4HZSA 4CV9A 2HXLA 2OGVA 4XOYA 3N51A 5LCKA 1WBOA 4ANNA 3LXPA 4YNEA 3O7LB 2UZWE 4I6FA 4OTFA 4FI1A 3E5AA 2OW3A 2OIDA 4TW9A 4MNEA 3EHAA 1ZOGA 3MH1A 4AGCA 2B55A 2YCQA 5A9UA 5H2UA 5TKDA 2J9MA 1KOBA 1YI3A 3KULA 4I0TA 1H1PA 1Q4LA 4QD6A 4NK9A 4W8EA 2UVXA 4F64A 4TZRA 5I9VA 4QQJA 3VS3A 4U3ZA 2GMXA 4HVGA 1SVEA 4QMMA 3SW4A 2WMTA 2HK5A 4DEIA 3UE4A 3I4BA 4PDOA 3UNKA 3CY3A 4CKRA 1YHSA 4UZDA 4R3PA 5ACBC 4JDIA 4O81A 4OTGA 4CKJA 2VGPA 3VUMA 5A4QA 3FE3A 2R3HA 4ZSAA 4HNFA 2XIXA 2QNJA 3HA8A 2BIKB 3QUPA 3CGFA 3I1AA 4NIFB 2JAVA 3E87A 4QP6A 3TKUA 4J1RA 2VTQA 2GU8A 3AMBA 3WBLA 2I0EA 4AA4A 4IZ5A 3RI1A 4KABA 3TT0A 4J98A 3PA4A 4KSQA 3NYNA 2UW9A 4J95A 4EHGA 1NA7A 5M53A 4A4LA 2B9HA 1R0EA 2PUUA 2XEZA 3E8NA 3IW6A 4BRXA 2GTNA 2VWYA 4G3EA 3RM7A 1UVRA 1O6KA 4YLLA 5F20A 2XKEA 1Y6AA 2YM7A 3UZPA 3ZZEA 5KBRA 2XJ2A 3CSVA 1V0OA 4OTRA 2PL0A 3KVWA 5CLPA 4AX8A 4EH8A 4IZYA 3ZLYA 4QP7A 1ZYJA 3LFSA 3QU0A 4IX5A 3MWUA 4GT3A 5BYYA 3QRIA 3D2KA 4XG8A 4CZUA 4IANA 4AGDA 4JX3A 3PRIA 2W1CA 3FI2A 3UPZA 2BRHA 2EWAA 4JAIA 1UKIA 2BAJA 3QYWA 3BBTB 4CV8A 4O6LA 2G15A 3GENA 2YZAA 4O7WA 1LP4A 1MQ4A 4PQNA 3ZUUA 4EOOA 2BMCA 4YURA 3HNGA 2ITVA 3UTOA 5HTBA 4YLJA 4YTHA 3FC1X 5GIPE 4YJUA 2PVHA 4FTOA 2WMWA 4R6VA 4O7NA 2I0HA 5AUVA 4MD7E 5CI7A 3LFFA 3BPRA 5ANGA 4NYEA 4FVRA 4BTJA 2VWBA 2F7EE 2XUUA 2PVRA 4IEBA 3AC5A 5LMKA 4DGLC 2QOIA 4W8DA 4L42A 4JBOA 3JXWA 4RZWA 4FF8A 3MESA 3A7IA 5T68A 3OXTA 5CU2A 2HZNA 2PE0A 5BVEA 2PUNA 3P86A 4UYAA 1YXXA 1UU3A 5HG9A 3ERKA 2OJFE 5A4CA 5AUYA 4A9YA 3A4OX 3C4ZA 3DDQA 1ATPE 3F2NA 2VX0A 3ZBFA 4B99A 4NUSA 4L00A 3KQ7A 2VNWA 4E6AA 4FKWA 5B7VA 2YIQA 3AMAA 4GH2A 5IQAA 5J5TA 3HV6A 1E1XA 3DBCA 2IJMA 2OO8X 2YABA 4QMPA 3T3VA 4YMJA 3OTVA 2QURA 2OF4A 1H07A 3ROYA 2GQGA 3ZEPA 3F61A 4NJDA 1FVRA 5AR8A 3U87A 5B2LA 5F4NA 1ERKA 5EKOA 5HTIA 2CN5A 3FAAA 4LYNA 2Z8CA 4X6QC 5LCJA 3ZEWA 3G33A 4UMTA 4MKCA 5CAOA 3MA3A 3PLSA 2W9ZB 1QCFA 2BZHB 4K1BA 5L6WL 5I9ZA 3QZIA 4AXAA 5K0KA 4V0GB 2OJIA 2J5FA 4BDGA 2X9FA 4W4XA 1Q3WA 1Q8YA 4NM3A 3QCSA 1K3AA 4FE2A 3LFDA 2WU7A 3FBVA 2C69A 1OL5A 1XHAA 3BQCA 3QKLA 3NNXA 4BCHA 3VULA 5IEVA 2QR7A 1XR1A 3MFTA 3TIZA 4KB8A 4UWBA 4CGAA 3BWFA 2F57A 3VS2A 4D5KA 1S9IA 3TNWA 4EOLA 3GU4A 4LGDA 5GJDA 5KCVA 3Q52A 5KX8A 3EQBA 3PXFA 4UBAA 4IFCA 3VVHA 3II5A 1M17A 5E8SA 4ZEGA 3MIAA 2PPQA 5DR6A 4S32A 3OT8A 4XJ0A 2WEVA 3QQLA 5DE2A 3OXZA 3P7CA 1YI6A 3LFCA 4I0RA 4X2JA 4GIIA 2ZAZA 2V5QA 3DY7A 4Y5QA 1H1SA 4EH4A 4XH6A 1PMNA 3EN6A 1IG1A 3MIYA 1OL2A 4CT2A 4FKQA 3QZGA 4Z16A 2PVYA 2UW6A 4RC2A 1FMOE 2PVKA 2WNTA 1TQIA 3COMA 3QGYA 3RK7A 4ENXA 5BVNA 2VWZA 1M7NA 2HWPA 3IO7A 4JR3A 3H9FA 4BB4A 4E3CA 2XH5A 4AFJA 2V7OA 4YJQA 2ZV7A 1NVRA 3LCTA 3HRBA 1Y8YA 4RQVA 2FGIA 5D12A 3L8XA 4CTBA 4K6ZA 3MS9A 4DTKA 4QQTA 3MGYA 1W84A 4NCTA 2BROA 3W55A 2YIXA 4YLKA 3HMMA 3DTCA 4O0XA 3KREA 1PY5A 1UV5A 4BYJA 4O0UA 4EC8A 5EQEA 3PA3A 3UQCA 1JSTA 2QC6A 1IAJA 3PYYA 1KE9A 4H39A 4U3YA 1OL6A 3H9OA 2UZNA 5DT3A 3A61A 4BBMA 4F9YA 5ICPA 4MQ1A 4AW5A 2J0IA 5LVOA 2R5TA 4YTCA 3H3CA 5IH6A 4L68A 4BCFA 1H4LA 3CE3A 4EOMA 5BX0A 3QHRA 3MBLA 5HGIA 4EYJA 3JY9A 2SRCA 2XIKA 2YLEA 5AV1A 5HD4A 2GNJA 2VZ6A 4U97A 1DI9A 4TYEA 3KCKA 3PIZA 3FZ1A 5J87A 3SDJA 3K3JA 3MYGA 3BLQA 1XH7A 3NLBA 5EHLA 4TTHB 2JDVA 1RQQA 4AU8A 5EKNA 4FKJA 5J9YA 2PZYA 2LGCA 4U40A 1DAYA 4D4VA 5CI6A 1H01A 4FODA 2GNHA 4F99A 3DBQA 2Z02A 2BTRA 2F7ZE 1T45A 4X3JA 5DN3A 4YJTA 2W1DA 3T9IA 2JDTA 4ZAUA 4IWOA 4XYFA 3F5PA 5DBXA 3SRVB 3T3UA 3K2LA 2R0UA 4ASZA 3PDTA 3Q2JA 3HA6A 3V8WA 5IA1A 4AW2A 4BI0A 3RTPA 1YVJA 4UMQA 4EH3A 4E73A 3C7QA 4YJPA 4NTTA 3FMMA 3COIA 4RWIA 2R2PA 4YSJA 4IAFA 4F0IA 5DHJA 4U9AA 3D15A 2VAGA 3ZYAA 1H08A 4C3RA 1BI7A 2ESMA 4I3ZA 1Q61A 3EQIA 5C27A 4FT5A 5A46A 2VTLA 3COHA 3ZM9A 3Q32A 4LL0A 2GQRA 5FQDC 4C36A 3RWQA 3B2WA 4JIKA 4BY9E 2YWPA 4K33A 3HV4A 4TYJA 5HCYA 2P33A 3OY3A 4FX3A 3LCKA 2JKQA 5CQUA 4ZZOA 4ZLYA 4I5PA 4RBLA 3SLSA 3TUBA 3KU2A 3GC8A 2V62A 3TNQB 1R3CA 4IAYA 3OWJA 1OBGA 5TO8A 3ODZX 4FTUA 3NVKI 5DRDA 4Y5HA 3UGCA 5K4JA 5DR9A 5EH0A 3C51A 4FV3A 5G1XA 4AACA 4UY9A 2XK9A 5DI1A 3VHEA 4DEDA 3ZDIA 3HECA 3ZHPC 3BGZA 4O6EA 3D7TB 4OUCA 3IKAA 2UW8A 1OPJA 3R02A 3EQPA 3DCVA 4HPTE 3VS0A 2XK4A 1JSVA 4QTAA 4QMOA 3RPOA 2AC3A 2X7GA 5LWMA 3CLYA 3OWKA 2CMWA 3R01A 3CPCA 4FTAA 2XCHA 4IFGA 4XEYA 2GNGA 4E5BA 1OKYA 4WRSA 3I7CA 2UVYA 5TOZA 4GG5A 4FSMA 5IU2A 3NYXA 4BKYA 1WVWA 4JIAA 5LQFA 2A4LA 2E9VA 4YHFA 4AQCA 3QQKA 4ZS4A 4EQUA 3D9VA 4JG8A 4DH3A 4MYGA 4EH6A 1Q99A 3KF7A 4FT9A 3R9OA 4NM5A 4XBRA 4DLJA 3UOLA 2ZOQA 5AADA 2Y4IC 1TQPA 4YJVA 3BHVA 2BAQA 4CEGA 1KSWA 2OK1A 2VTIA 2I0YA 4QMYA 4ENYA 4DGNA 4O1OA 4EOKA 2VWIA 4AN2A 4RC4A 2YZLA 4AS0A 4A06A 2F2CB 2FVDA 4FTTA 2WTDA 4GCJA 2XZSA 3BLHA 3P78A 3QTXA 4P5ZA 1Y91A 4F09A 5M44A 3DAJA 5LOHA 2G2FA 3R9HA 4DT9A 5GIOE 1H1RA 4GUBA 2OSCA 2PSQA 4XHKB 4DEEA 4G6NA 3UOJA 3G6GA 4XG3A 3ZC5A 4NKSA 1F3MC 4D9UA 4FL1A 2XK6A 5CF5A 2XS0A 4O7RA 4HVIA 5HLWA 2XA4A 1PXNA 5GZ9A 5J9ZA 2BTSA 3P7AA 1Q41A 3P0MA 4L53A 3A4PA 3OCSA 2ZM4A 4MF0A 3F5UA 3UC4A 4FYNA 2YJRA 1CSNA 3HMNA 4HYSA 4V01A 1QL6A 3VO3A 4IWPA 2PUPA 1PMVA 4DA5A 4A9RA 3KXMA 4CLJA 5A54A 4LRMA 3WF9A 3QTSA 3G6HA 5BQ0A 4DBNA 5CZIA 3IW4A 1REKA 4GSBA 2R3MA 2CNQA 3KN5A 3V3VA 4AZEA 3LLAA 1RJBA 2O2UA 3D2IA 4D2TA 2YITA 4FSWA 3ZXZA 3IQ7A 3GFEA 4OTHA 3UIBA 4RIXA 2YERA 3FZPA 5DWRA 4FIFA 3LQ5A 5GZAA 4QNAA 1IR3A 3RAIA 4IB1A 5E9EA 5IA5A 4OGRA 4YTFA 3U8WA 5BYLA 4MAOA 4IX3A 4WG4A 3R1NA 4X21A 5K3YA 3ACJA 3R7UA 3TV6A 2YEXA 3NUYA 4KSPA 3BZ3A 2ZDUA 3ALOA 3D0EA 4FC0A 4K18A 3QUEA 2DUVA 2I40A 4ANQA 3S00A 1M7QA 3AT2A 4JS8A 3VBQA 2J90A 1J1CA 2PZPA 1CMKE 3O96A 4CFFA 5AA8A 1ZOHA 2BKZA 3QTQA 4AT3A 1OKZA 3DQXA 5C8MA 2W5BA 5FXRA 3N4TA 2ZB1A 4FKIA 2G2IA 2GFSA 4M0YA 2HZ4A 3IW7A 1M14A 1W0XC 2E2BA 2J2IB 3WF8A 5K4IA 3UZTA 5IQIA 4AE9A 2CDZA 3QGWA 2XVDA 3MI9A 3N9XA 2YM6A 2XF0A 3V51A 1OPLA 1ZWSA 5CWZA 3BHYA 4RC3A 3FPQA 4GW8A 4UMRA 5AP1A 5L2SA 2ITOA 2FSLX 1JKLA 4EOPA 1XJDA 4ZLZA 2CPKE 5EYMA 1XH9A 3O2MA 5CU4A 3BRBA 4MVFA 3CGOA 4FEQA 2JKKA 4BCQA 4GYGA 4DFLA 4TYGA 2CKOA 1XH4A 3UMXA 3NAXA 3ORTA 4RIWB 1PXJA 1R39A 2CKEA 3QRKA 3VUGA 1LUFA 4RLKA 4E1ZA 4YZDA 1IEPA 3CQEA 4QYYA 5GZ8A 3QC4A 5FP6A 3BELA 3GCVA 3O7LD 2VRXA 1GNGA 3PZHA 3HL7A 3VUDA 2Y4IB 3LFAA 2HW7A 4H3BA 5HESA 4BIEA 3DJ7A 4BWPA 4YR8A 2BHEA 3GFWA 2WMAA 4MXOA 4OTIA 4D55A 5IA4A 1VJYA 3LFNA 4FV8A 3POZA 3FZSA 4FYOA 4ZTLA 4F63A 3ZTXA 4EK5A 2W1GA 4V04A 4IVAA 5IG1A 1JSUA 4I4EA 2Z7LA 4QMZA 3MN3A 2C5YA 3LCDA 3OC1A 5ANOA 5CYIA 3EFKA 1ZMUA 3AC1A 1H8FA 4RRVA 4F0FA 3QD0A 3F3WA 4X2GA 4Q2AA 5HOAA 1APME 4IZ7A 1PMUA 4MD9E 4IH8A 4EK4A 4MXXA 2V55A 4HCTA 5H3QA 1HCLA 1BUHA 1YWVA 2UUEA 2UZUE 3QQFA 4C2WA 4ACMA 4EYMA 4ZSGA 2QR8A 3FYKX 3G9NA 4K8AA 3R28A 4P7EA 4NM7A 5CVHA 4N6YA 4C4IA 3QHWA 2X8DA 5LXMA 3FMDA 4I22A 5FLFA 4QYHA 3VHKA 4MXZA 3H0YA 4ASXA 2C6IA 2PWLA 4AAAA 3GVUA 4QMTA 1OVEA 3FI8A 5JRSA 3KGAA 2UVZA 3S1HA 5AV2A 4FK3A 3DBEA 4JJRA 4NW5A 4IM0A 4L9IA 3CPBA 1YXUA 2BHHA 5D10A 4M8TA 2GHMA 2VTMA 4FL3A 3PXYA 5CQWA 2H96A 2JGZA 4FV9A 1LEWA 1SMHA 4G1WA 4NZWB 1FPUA 3E93A 2PHKA 4RWJA 4JQ7A 3A60A 4X3FB 1EH4A 1W98A 4M69A 4R5SA 5IA3A 4AN9A 4PNKA 3OD6X 3BWJA 3MY0A 3SOCA 4FUYA 3Q9WA 4IDVA 5HICA 3PVGA 3ALNA 1Q8ZA 2JAMA 4AN3A 4MBLA 3RVGA 4ZSEA 5K5XA 4TYHA 3RHXA 5FEEA 5C8KA 2VO0A 4GUEA 4D2VA 3JS2A 5E90A 2C0IA 4IB5A 3EFWA 4FKOA 4CNHA 1MRVA 3ZO4A 1PJKA 4DN5A 1NW1A 4RJ7A 5EHYA 2X2LA 2VGOA 3HRCA 1JKSA 4XV3A 1H28A 4JX7A 1Q3DA 4KA3A 4XLIA 4YO6A 3ZU7A 2GPHA 3IOPA 4RA4A 4ZP5A 4UN0C 2CNVA 3ZMMA 3DAKA 3QRTA 1FQ1B 3C0IA 2WTJA 2YIRA 5EW8A 4BDBA 5F9EA 3SX9A 3DK3A 3BE9A 4ZJJA 5D7AA 2QG5A 3E7OA 5HQ0A 4RVMA 5CAQA 4KINA 4FV4A 4JLCA 3SKCA 3G9LX 4YUQA 2WMXA 3FZRA 2UZLA 3KCFA 3R8LA 4AA0A 4C02A 2JC6A 4F7JA 5K9IA 4GV1A 4EQMA 1M52A 4O38A 4PTGA 3OCTA 5AMNA 1OL7A 3BI6A 4UMPA 3LMGA 3QRUA 3UOKA 2IW6A 3PPKA 2B53A 2XYNA 4NKAA 3KRXA 2W4OA 2XJ1A 3IPHA 5GNKA 4DT8A 3EQDA 2X6EA 1WCCA 4EK3A 1U5RA 4H05A 3TJDA 3HKOA 3QKKA 3QTZA 4XP0A 5ANEA 4P2KA 2C3IB 5JSMA 3R7EA 2XCKA 3KK8A 2BILB 2W1EA 3QRJA 4NFMA 3U55A 4CQEA 2GSFA 4USFA 2ITNA 3QF9A 4RX5A 3DB6A 3ORIA 1RE8A 3LIJA 1SVHA 4FNYA 2OH4A 3MVLA 2RG5A 2F4JA 4XBUA 2R7BA 3TZMA 3VNTA 3L8VA 3E8CA 3UP7A 3NX8A 1OGUA 4ALVA 3UQGA 2R3JA 4U80A 2C30A 4EUUA 3QCQA 4I6QA 4C61A 2J0KA 2ZM1A 4OTWA 3V04A 3LE6A 2YJSA 4YHJA 3VBTA 4BN1A 4E93A 1FGKA 2X7OA 3KB7A 4HZRA 4XRLA 2YM8A 5HG8A 3KXXA 3NW5A 2W1HA 1NY3A 3L9NA 3VUHA 4YZNA 4J99A 3BKBA 3MFUA 3RAKA 2X8IA 4BI1A 5LARA 3RM6A 1P5EA 4XG2A 5IQHA 4ID7A 4B8LA 4IHPA 3IS5A 4BWKA 3AD6A 4FG8A 4TY1A 4XCUA 1CDKA 2PMNX 3UIMA 1FVVA 3PE1A 3RNIA 3UODA 5JH6A 5AAEA 3WIKA 3WYYA 4EWHA 3GU7A 1Y8GA 2BDFA 4RJ6A 1SYKA 2R3IA 3R0TA 5J79A 4M84A 3FZOA 1GIIA 4B9DA 3RALA 4EL9A 3NUNA 3F69A 5IISA 1BMKA 3C4WA 4CZYB 4GVJA 4Y95A 1YW2A 2CHLA 3KY2A 4O7SA 4FKUA 1E1VA 4D4RA 3DV3A 4I20A 2Z7SA 2IZTA 2UZDA 1DM2A 4DLIA 4OBQA 5CEOA 3DDPA 4J8NA 3DTWA 3ZO3A 3W10A 3KC3A 3R2YA 4I24A 2B54A 4CFXA 3NEWA 3H9RA 3HUBA 5JN2A 1KE7A 1SZMA 4EJNA 4D9TA 3ZZWA 1ZYSA 4ONAA 4CVAA 2R64A 5EW9A 4U43A 4C35A 3T8OA 4OLIA 4AZSA 2J0MB 2WGJA 4PDPA 3E63A 4YZ9A 5HBEA 4Q9ZA 4BDHA 4KRDA 4EORA 3PJ1A 3R00A 5AJQA 3HRFA 2ITWA 1ZXEA 3MH2A 4FT7A 3POOA 4GRBA 3KMMA 4YPSA 3DLSA 4FSYA 1OL1A 3RAHA 2B9JA 2BUJA 4ACCA 2QOQA 3IGGA 4KIPA 1Z57A 3R71A 3WZEA 3TTIA 2Q83A 1W82A 2CCHA 4FV0A 3EQGA 2W7XA 4AZWA 3BU5A 3Q4ZA 1GOLA 3PVWA 5IQBA 4JI9A 3QTRA 5DT4A 1CKJA 5KHXA 3RJCA 2Z7RA 4AT4A 3DS6A 4O91A 1CKIA 3EN4A 3QA0A 4O22A 3R7YA 3OROA 5ETCA 4MBJA 3BV3A 3HDMA 4GEOA 1U46A 3FLSA 2W9FB 4ITHA 2X39A 4WNMA 3LJ1A 4I6BA 4C4EA 3IDCA 3C9WA 2FSOX 3K54A 1X8BA 5D9HA 4YJOA 4G5PA 5HE0A 5EQPA 3AD4A 3F2RA 2XEYA 4PL4A 5M4IA 4WA9A 3TDVA 4HGEA 3BYOA 4MNFA 3UVQA 5KMIA 5GJFA 4ARKA 2R3NA 3B8RA 4J53A 4QMWA 3ZRKA 2O3PA 3FQHA 1KWPA 3FLNC 3C0GA 1WAKA 3RPRA 2XJ0A 3HAVA 4XV9A 5CAUA 2WMVA 5I3OA 1MRUA 3KMWA 2GS6A 4TWCA 4DYMA 4WNOA 4X2FA 2VTJA 3ENHA 4LM5A 3DJ6A 3V5QA 4BTMA 2ITXA 4L6QA 5FTOA 2ZMCA 4FKGA 5AR2A 4ZTSA 3R7OA 4ERWA 5IA2A 3ANRA 4DINA 2R0IA 2XNOA 4QRCA 4UV0A 2DS1A 3UVPA 5C8NA 3HV3A 4E20A 1XBCA 3HUCA 5TR6A 3PJ8A 4J8MA 4DEGA 2OZAA 4QP3A 2W1ZA 3L8PA 5H9BA 2R3PA 4C4GA 3QA8A 4BR3A 3FQSA 3MA6A 2BR1A 4CG9A 4V05A 2O8YA 2BCJA 3DOGA 4FZ7A 1F5QA 1KE8A 2FUMA 2HXQA 3O23A 3FMJA 3PXRA 5AV0A 4F7LA 1QPEA 4BF2A 4IAZA 5IEYA 3O17A 4HYUA 3VS6A 5HVKA 4NU1A 4LRJA 4S2ZA 4BDFA 5CEMA 4MXYA 3RCJA 5CF8A 3VUTA 2A19B 4ASDA 3GB2A 4DCAA 3DFAA 3RPSA 4UX9A 1H24A 2OJJA 4LMUA 4GT5A 4APPA 4WO5A 5HO7A 4WIHA 4DGMA 3KVXA 4BCIA 2JFLA 2GTMA 2V7AA 4ZZMA 3BV2A 4CRSA 2PY3A 2JBPA 2DQ7X 2WQOA 4QOXA 4D1ZA 2OH0E 4HVDA 1NVQA 1DI8A 5HVJA 4FIJA 4E6CA 3ZDUA 1JOWB 3FSKA 3W8LA 3EIDA 2W05A 4J96A 2VTNA 4JQ8A 3L9PA 4L7SA 3QQUA 5ETFA 2HELA 3MDYA 3NPCA 3W32A 3UMWA 5KUPA 5BMMA 3FC2A 4PP9A 2VX1A 5HD7A 2HAKA 3VW8A 4N0SA 4BICA 3FSFA 4FTKA 2J5EA 3BYMA 3SXRA 5JZJA 5HNIX 5KE0A 2OLCA 3NW7A 1XBBA 1OIUA 2QG7A 5EYCA 5DIAA 4CFMA 5IKWA 4E6QA 4KIOA 3FHIA 3L8SA 2JEDA 4YGAA 1G8SA 4OBOA 2WHBA 3DNEA 2ZV8A 4RFMA 3U51A 3A2CA 4GU6A 5E91A 4IM2A 2B7AA 2WTIA 2YM3A 3I79A 2VWVA 4F9WA 4IB3A 2OJGA 5CEPA 3OTUA 2HIWA 2WPAA 2X4FA 2GNIA 1OI9A 3ZBXA 2XM8A 3K3IA 2ETRA 5HCXA 4C3FA 4D4SA 4GT4A 3UG1A 3WIGA 3UYTA 4FSZA 2REIA 1QMZA 3NIZA 3RMFA 4JL9A 4C4HA 4F0GA 1ZRZA 2ZM3A 5C4LA 3DB8A 4WD5A 3TTJA 2VWWA 3PG1A 2ZMDA 4G31A 4RFZA 1O6YA 4AW1A 5KZIA 4F6SA 3DBFA 3KL8A 2YDJA 4L52A 4ZY5A 3NRMA 4QYGA 4YC8A 2VNYA 3VC4A 1G3NA 3LM5A 3THBA 4QYEA 3ULZA 5AFVA 5FUTA 4PL3A 5FP5A 5EOLA 3IG7A 3Q4TA 3CY2A 4ZY4A 3H30A 4KKHA 3R8MA 4ANMA 3TEIA 3ZLWA 4FZDB 5DRBA 4BL1A 3ORMA 2PVLA 4FTCA 2QOHA 3SXSA 2VX3A 5TT7A 3RGFA 3VN9A 5F1ZA 3PJ2A 4XRJA 1IAHA 3NYOA 3TM0A 4FT3A 3WOWA 4EZ7A 2R3KA 4NJ3A 4FG7A 4YJRA 5C4KA 4YBKA 4TRLA 4KD1A 4FTNA 3R8UA 4NIFA 5D11A 2EXEA 2R7IA 3VS4A 3DGKA 2VTOA 4X0MA 2W0JA 3KF4A 4YSMA 3W2OA 3FLQA 3AOXA 5JFXA 2WTVA 3JY0A 2ZJWA 3OOMA 4IVDA 4KAOA 2VN9A 4YP8A 5LMAA 4YO4A 2XNGA 5AWMA 2CGWA 4YJNA 3Q53A 5AIRA 4DH5A 3DPKA 4D2RA 3B2TA 5BNJA 2C0TA 2CN8A 5AP2A 4RMZA 4EH5A 4DTBA 2QU5A 4FVPA 3R7VA 3W2QA 3KRLA 3LZBA 1OITA 4ZZNA 4RJ8A 5J5SA 3Q2MA 4BCPA 4GK2A 3E7VA 4OW8A 5BUIA 5CXZA 5FDPA 3ENMA 3NR9A 3NUPA 4RJ5A 4IAIA 4BCGA 3L9MA 4YC6A 3QCXA 4I92A 4D2SA 2UW0A 2PULA 2R3RA 4FIIA 1CKPA 4IJPA 4TWPA 5DG5A 5DOSA 5IUIA 3ZLXA 3B8QA 4CCBA 5CAVA 5IDPA 5E4HA 3QL8A 4C58A 3GC0A 3QQGA 2CSNA 4F6UA 2C5NA 3LPBA 4CFVA 5L8LA 3E62A 5CSXA 3OZ6A 4EOSA 4QPMA 2BZIB 3E8DA 4AT5A 2CLQA 2ONLA 1YI4A 4LOOA 4NW6A 5E8UA 2HZ0A 4BDEA 1OBDA 4BHNA 4AA5A 4Z7HA 2PVJA 2C3JA 4PX6A 1WVYA 4RIXB 1J1BA 4LGHA 4FICA 3UP2A 3R73A 2PZRA 4B8MA 4HYIA 3DNDA 3V6SA 5L2WA 3KK9A 5LVMA 4FT0A 4J7BA 2O5KA 2WTCA 2YM4A 4QP9A 4R1VA 1PXOA 5HNGA 3RINA 4F65A 3A7HA 1AD5A 4CSVA 4DH7A 4F70A 5ETAA 4S31A 4ZK5A 4IMYA 4OBPA 3G0FA 3EOCA 3EN7A 2X2KA 4I1ZA 1H1WA 3Q9ZA 4IBMA 5A14A 5A4LA 2IG7A 4RIYB 3MJ2A 4WHZA 5AP5A 3D5WA 2H9VA 4OT5A 5ANKA 5HU9A 2I1MA 4FG9A 2IVSA 4GS6A 1WBPA 3ORKA 2R4BA 3AT3A 3HLLA 2C6LA 3PA5A 4FV7A 1V0BA 4IIRA 2WELA 3PG3A 5JK3A 4L01A 5AUZA 1W83A 3F82A 1Q8TA 4QPAA 2ZVAA 1K2PA 3R63A 4HJOA 2BVAA 5BVFA 2YM5A 2FH9A 4EOIA 4GKIA 4L8MA 4LQMA 5E1SA 3MPTA 2WZJA 3HV7A 3EYGA 1YQJA 4U79A 4C57A 4DITA 5AV4A 4LMNA 2EB2A 2G9XA 1U54B 4JR7A 1H0WA 4R7BA 4AFEA 4A07A 1YXVA 4FNZA 5M4UA 4EHZA 4X2NA 5CY3A 2EU9A 3F7WA 5HG7A 3NZ0A 4QMVA 4EKLA 1OZ1A 2OXDA 3BYSA 4AZFA 3SG8A 2NNWB 4GYIA 3LCSA 4PF4A 3C4FA 4TNBA 5CVGA 2VTRA 4O0VA 2WMRA 5AM6A 3PSCA 1VR2A 5T3QA 3GC9A 3R30A 4DFNA 5GINE 2R3QA 3ATSA 1XBAA 2QI8A 2J0JA 5L2TA 3FV8A 2NPQA 3S95A 2V22A 5HX8A 1LEZA 3PIYA 3MPAA 5HU3A 1ZZ2A 5J95A 5A6OA 5HTCA 4HW7A 2WIPA 3BEAA 5FTGA 3TACA 3CS9A 3ACKA 1U5QA 5J7HA 2Q0BA 3WF7A 4A4XA 1B6CB 2PK9A 1Q97A 3GOKA 3GUBA 4A9TA 2XM9A 2CJMA 3F6XA 4DG0E 3HYHA 3BU3A 2I0VA 3LKMA 4K9YA 2Y9QA 4WOVA 1TKIA 4HYHA 4DFZE 4G2FA 4I4FA 3NDMA 3RP9A 3M2WA 3TV7A 5CEKA 4CYIA 2OFVA 2BKKA 3V5TA 4PMTA 4DGGA 3ZS5A 1YOMA 1BX6A 5EM6A 3TG1A 5BPYA 2XKFA 4H58A 2I6LA 4M68A 2BAKA 3CTJA 3G2FA 2FSTX 3NGAA 5ANJA 5TE0A 4FZAB 5KNJA 4FSNA 4BCNA 4RA5A 4Y8DA 4TWOA 3UBDA 2WQNA 3HMOA 3TL8A 3ZRMA 3CBLA 4WG3A 4U8ZA 3SGCA 5HNBA 1ZARA 3ZLSA 3AC8A 2PU8A 5CT0A 2AUHA 2C4GA 3FXXA 4KKGA 3QWJA 4Y46A 3ROCA 4GKHA 3PP0A 3ELJA 4QP2A 4A4OA 4BIBA 2WFYA 3BBWA 2IWIA 4EH2A 3LCOA 5LVPA 4AUAA 4EJ7A 4FSTA 5EDRA 4MCVA 4FIEA 2C6KA 3LFBA 2OI4X 4EHEA 3GC7A 4U6RA 2JKMA 3F3UA 3TKHA 4X3FC 4MEDA 3P23A 3L1SA 2QONA 4PMPA 4CG8A 4FTMA 4O7LA 3JPVA 5EDPA 4XOZA 1YWNA 4CXAA 2VU3A 1PKGA 4N57A 4RLLA 4O7ZA 3FI4A 5A4TA 4NEUA 4NSTA 5J8IA 1BI8A 2VD5A 2YWVA 3VS7A 3R21A 4EH7A 4E5AX 1Z9XA 3TNHA 2ERKA 5FWKK 3GU5A 1R78A 2X81A 3NVMB 2HY0A 2W17A 3OG7A 1WBSA 3C0HA 4KIKB 3W2PA 3QTWA 3SRVA 3KXGA 3RPYA 5AEPA 3A7JA 5C01A 3U9CA 4I23A 4QPSA 1FGIA 2QKWB 2C3KA 2XK7A 1PKDA 4OTPA 3PVBA 2E9UA 5E8VA 3WF6A 4OAUC 1B39A 4O21A 1SNXA 4RX9A 5L8KA 1NXKA 4QP4A 4JG7A 3Q4UA 3R1QA 3VUKA 2W4JA 3SV0A 3WZDA 4FEWA 4LI5A 5IDNA 2W99B 2XK3A 3F5GA 3BE2A 3FHRA 3PY3A 3VRYA 3ATTA 2BZKB 4TL0A 5IQCA 2ZV2A 3QX2A 4AOTA 3FMHA 3TV4A 2RGPA 1QPDA 4CTCA 2UW5A 4FEUA 3ZUVA 1SNUA 1YHWA 4ZTHA 2IN6A 4D1SA 4HGSA 5EYKA 1OIYA 4YZBA 1KUTA 1ZYCA 3FXZA 4L3PA 1CTPE 2PTKA 1UWJA 3QAME 3FJQE 4TNDA 4ZXTA 3WE4A 5HIEA 3VIDA 2C1BA 3FWQA 4ZMFA 4C0TA 3UJGA 2Y6MA 4G5JA 5FXQA 4CMTA 3GI3A 2X8EA 4W4WA 3VS1A 2WD1A 3IDBA 4BCJA 4I21A 5EOBA 3OBJA 4TPTA 3UZRA 5HLPA 4PPAA 2ZV9A 1GIHA 3UQFA 4FZ6A 4BYIA 3PXQA 3U4WA 2CGVA 3W1FA 4IW0A 4UEUA 2EVAA 4AOIA 5L2QA 3D7TA 5M51A 1LPUA 2VTHA 2WKMA 3MW1A 3OT3A 3PFQA 2P4IA 3C50A 3PWDA 4FNWA 3TIYA 4E7WA 4F6WA 5HX6A 4ZMEA 2LAVA 4WT6A 5KZ0A 4TXCA 2B9FA 5ANDA 2G2HA 5HIDA 2OFUA 5AV3A 3DK6A 4EOJA 5EG3A 3QXPA 4XS2A 2PZIA 4E8AA 5DH3A 1FOTA 1L3RE 3VUIA 4G3GA 2BRNA 1H00A 3BCEA 3V8SA 4MK0A 4BDIA 3FEGA 4S34A 3OBGA 3NUAA 4BWXA 3SHEA 5JFVA 5LMKC 3QBNA 2J0LA 5EHOA 4CYJA 3R7GA 4Y83A 4ZOGA 5DA3A 5AR7A 4GFGA 4QQCA 2I7QA 1FMKA 2BIYA 3QCYA 4G9RA 3V5PA 3EQCA 4MH7A 4ANOA 4BDAA 3HP2A 4MBIA 5FDXA 3GT8A 4MHAA 4W4YA 3LHJA 2ERZE 4UYNA 3RZBA 3GQLA 3NNVA 5L6OA 3FLYA 3KRJA 3U4UA 2QOOA 5JQ5A 2IZRA 3PXZA 1ZAOA 4E4XA 3BHTA 1JKTA 5CTPA 5H8BA 2IVVA 3E64A 5HORA 4O2PA 4Q9SA 4RZVA 1J7UA 1ZMVA 4I93A 3DK7A 3DKOA 2B4SB 3QKMA 3CJFA 5CSWA 3SVVA 2WQBA 5J1WA 2QU6A 3ZCLA 3VJOA 4BTKA 5FD2A 2XRUA 4M67A 3GCUA 4K77A 4UALA 3O8PA 2BZJA 2JKOA 1Q5KA 3F88A 4DAWA 2Q0NA 4MNEB 5CU3A 2XBAA 4XX9A 4U45A 2QHMA 2ITZA 2RFDA 3JVSA 1NVSA 3KULB 1BLXA 3MVMA 5HKMA 1H1QA 5ACKA 3WYXA 4CT1A 4IC7A 2VTPA 5HE1A 4AP7A 2AYPA 2HENA 3W2CA 4FEVA 3EN9A 3VF9A 1JQHA 2OIQA 3E88A 4JQEA 3EFJA 4PPCA 3WF5A 4I94A 4AG8A 3LVPA 2O0UA 4FTLA 4E4LA 1J7IA 4CKIA 1P4FA 4D5HA 3LM0A 5CVFA 3C13A 5IA0A 1PYXA 4QT1A 4PL5A 5CT7A 3PSBA 3S0OA 4IJ9A 2PE1A 5KMJA 3C1XA 2WOUA 4S30A 4GIHA 4AW0A 3MTFA 1RDQE 3MY1A 4C62A 1OUYA 2R3LA 5LMBA 2C47A 3COKA 3I7BA 2XMYA 5EM5A 3MFRA 4J97A 1JBPE 2ITQA 5EW3A 3O8TA 4BHZA 5BMSA 3EL7A 5C1QB 1Q62A 5CS6A 3ORNA 2EUFB 5HI2A 4JAJA 4BDKA 3OEZA 4DE4A 2A1AB 4PDSA 4O1PA 3QLGA 4GJ3A 3DKFA 2CGXA 4FV2A 5AP3A 2QOCA 5BVWA 1I09A 1KOAA 3CC6A 2YDIA 4LV8A 2E9OA 4RG0A 2BDJA 3T9TA 3E8EA 3W33A 3UO4A 5IEXA 4TWNA 4MWIA 1YOJA 3FKLA 4PP7A 4RX7A 4EK6A 2RG6A 2IVTA 4UXLA 3FMLA 4XG4A 5D1JA 3OW4A 4F9BA 2R3FA 4FVQA 1OM1A 2YA9A 3A7FA 4ZIMA 4EKKA 2WQEA 3DBDA 4NCTC 3I6UA 4FKTA 2XP2A 4C38A 3U6JA 3D7ZA 4KBAA 5A3XA 4EI4A 4X6RA 2HYYA 3JR1A 4HCVA 1W7HA 2XIRA 4LV5A 5HE3A 4BVUA 5HO8A 4K2RA 3O8UA 3ZFXA 5CU0A 4GL9A 4IX4A 1P2AA 4NM0A 1YWRA 4BDCA 2GDOA 1AQ1A 1REJA 3OOGA 4L7FA 5LVLA 1QPCA 3BX5A 3Q04A 5JGBA 4RIWA 4BIDA 3A8WA 3PVUA 4U5JA 5JKGA 1URCA 2ZYBA 2NRUA 2XRWA 2AC5A 3BGQA 4GFMA 4FK6A 3LAUA 4G3FA 4WUAA 5CZHA 3D14A 4QO9A 5EI2A 2F7XE 4LG4A 4BCOA 3NMUF 5JQ8A 4KWPA 2RFEA 3FY2A 3LFEA 5HEZA 3TNPC 4E4MA 3W8QA 4ACDA 3UDBA 2B0QA 3PP1A 1MQBA 3GU8A 4WRGA 2BRBA 2C3LA 4MX9A 1GZOA 3E92A 5FBNC 2C0OA 1XWSA 2OKRA 4JDJA 1A48A 5IH5A 4G3DA 3TZ7A 3BIZA 4FSUA 4BCMA 4JDKA 3VBVA 2Y0AA 4LFIA 2GS2A 4ZS0A 1MRYA 3O51A 3QD3A 3RWPA 4EUTA 4KUJA 4LGGA 2XB7A 3TUCA 1PW2A 3R8PA 4DFYA 2WXVA 2V0DA 3Q4CA 3WZJA 4FIHA 1PXLA 5AM7A 3LXKA 2CCIA 4PWNA 1HOWA 1ZY5A 3ULIA 5L4QA 3MY5A 3G90X 4FGBA 2IZUA 3FL5A 5AX3A 3SQQA 1WFCA 2W1IA 3NCGA 1IA8A 3P08A 4R5YA 3DQWA 2UW3A 4GU9A 4R7IA 3P1AA 3ZSGA 2CKQA 3L9LA 3P79A 4I41A 5BVDA 4WNKA 2YISA 4KS7A 5HBHA 3OCBA 5DFPA 3VBWA 1UU9A 1M2RA 4JRNA 4KNBA 4TN6A 4C2VA 3UO6A 4QQ5A 1I44A 2B9IA 3F3VA 3OWPA 4M15A 5DT0A 3CCNA 2RF9A 4HPUE 5M06A 3TXOA 1JVPP 1STCE 4R77A 2W96B 4ITJA 1H0VA 4R7HA 4D0WA 4PMSA 4FR4A 4MTAA 1HCKA 3UVRA 4Z3VA 2A2AA 4ZJIA 5TF9A 4X3FA 4BCKA 5ITAA 4GFOA 4F1TA 4YHTA 4W9XA 4FKRA 3KXNA 3LW0A 4DH1A 3ZXTA 4N4SA 5L6PA 2F2UA 4BZOA 3QZHA 3HMPA 5DGZA 4EBVA 2DYLA 3ZUTA 4U0IA 3HP5A 3P9JA 4L3LA 4ORKA 2HCKA 2RL5A 4G16A 3O71A 4DG3E 1PXMA 2O65A 2WTKC 1Z5MA 4P5QA 5IMEA 3BGPA 5L2IA 3D5UA 2JLDA 2OF2A 4B7TA 5JRQA 1VYWA 1J91A 3R8VA 1GJOA 2H34A 3OEFX 5E8YA 5JMSA 4CMUA 2JDRA 3AGMA 2BFYA 1W8CA 4QMNA 5B2KA 3C4XA 4YC3A 2W06A 1P4OA 2QOLA 5E1EA 3LQ3A 2Z2WA 4L3JA 3ODYX 4FTQA 4W9WA 4LUDA 5J9LA 4MD8E 5D7VA 4DF3A 3HGKA 4M14A 4USDA 3GCPA 4WSQA 1PF8A 3OY1A 5E8WA 3DAEA 2WTWA 3LJ0A 2OG8A 2J6MA 1ZYDA 3F5XA 4FV5A 3K5UA 4FL2A 4Q5EA 3F2AA 5KMNA 3H4JA 3VQUA 5CSHA 3PJ3A 3MB7A 5FM3A 1YDRE 3M11A 4FKSA 4MF1A 5EI6A 2CLXA 3UC3A 4BI2A 4F1OA 4F1MA 2JFMA 1J3HA 2XNMA 4CFUA 4IADA 3CR0A 1YDTE 3R9NA 5IZFA 1UU8A 1NT2A 4DTAA 3NCZA 4PRJA 2VTSA 3DXNA 3EQHA 4M12A 4GMYA 3FMEA 1O6LA 4E5WA 5CU6A 1R1WA 3AGLA 4F9CA 1XH5A 2F9GA 3KN6A 4BKJA 1UKHA 2X1NA 1F0QA 4W4VA 1Q24A 4RPVA 4QMSA 1ZY4A 3F9NA 4ZTQA 4AZVA 5I9YA 3OVVA 4K11A 3U6IA 3OUKA 3KKVA 5J1VA 2IPXA 3NYVA 3MH3A 4FV1A 5I0BA 2R3GA 4FMQA 4GK3A 4NWMA 4EOQA 4XP3A 4AOJA 4CQGA 2X0GA 3DKCA 3TZ9A 5D41A 4OTQA 4DG2E 4ANSA 4ALUA 5CF6A 5HVYA 2Z7QA 4Z55A 4B4LA 2QLQA 3ZONA 4L67A 4YZCA 3HVCA 1YDSE 2B52A 4U81A 1G8AA 4WNPA 3UNZA 3TZ8A 2WU6A 3FQEA 4IAKA 4R1YA 3OUNB 5M56A 1E9HA 5CEIA 2OXXA 3CTHA 3R9DA 1GAGA 5E7RA 4FUXA 4D58A 2WO6A 3EQRA 2YAAA 4C59A 3I0QA 3LJ2A 4C8BA 3AC4A 4L43A 4XG6A 3TDWA 3U9NA 3ZOSA 4M3QA 2OWBA 3CD3A 3DZOA 3GCSA 3E3PA 3PJCA 3PLAE 4FKVA 4IE9A 4M0ZA 4RIOA 1J7LA 4L46A 1FVTA 4FZFB 1VEBA 4YTIA 2C5OA 3K5VA 4H3PA 3H0ZA 3R04A 4FGRA 2FO0A 3R1YA 3EN5A 4FIGA 3FKNA 3ITZA 2GCDA 2UW7A 3LOKA 3GGFA 4H36A 5AUTA 5AA9A 4Z9LA 1YXSA 4ZTNA 4IM3A 4L45A 5CAPA 2NO3A 2WMBA 3AT4A 3HV5A 4PV0A 4I5CA 5JGAA 2PZ5A 3WARA 2ETKA 4M7IA 4QTEA 3C4EA 5CASA 3F7ZA 3N4UA 2WTKB 1A06A 3KMUA 4J52A 3DU8A 3HEGA 2Y8OA 4JDHA 5CF4A 5DEWA 3QYZA 3RAWA 2JDSA 3QQJA 5AAGA 1H27A 2FA2A 3V5WA 3LXLA 3AQVA 4HNIA 4MWHA 3UIXA 3W18A 2JIVA 3PY1A 4F08A 5AUXA 3I5NA 3G5DA 3R2BA 4QYFA 4LUEA 3AMYA 3IW5A 3UNJA 4YZMA 4Z7GA 5M4CA 3CP9A 4RVLA 5E8ZA 4C4FA 5E8TA 3QD4A 2OZOA 4XG9A 3R83A 2EXMA 4Q5HA 3CEKA 5EYDA 2CGUA 3P5KA 5JT2A 5KHWA 3WILA 4JVGA 2E9NA 1IASA 3A7GA 3EB0A 2JIUA 3FI3A 4PTCA 3JUHA 3DT1A 3E3BX 4FKLA 4GVAA 4EK8A 1OB3A 2QOBA 3NUUA 3HDNA 4FV6A 4D1XA 4O2ZA 3Q5ZA 3SW7A 5B2MA 2G1TA 2UV2A 3LXNA 4DFBA 2BRGA 1BKXA 2WMUA 3V5JA 4F7SA 4USEA 1L8TA 5EI8A 4Y73A 5EM7A 2QOKA 2HZIA 3QZFA 5HIBA 2X9EA 1WZYA 4LOPA 4ZSJA 3CQWA 4O7TA 2HOGA 3TWJA 1U59A 4I6HA 2FB8A 3ZM4A 3AC2A 3S3IA 5CALA 4UWYA 5HCZA 2QHNA 4AGUA 1Q8UA 3NUSA 2PUIA 5CXHA 5DEYA 1JNKA 4NTSA 3KXZA 5FRIA 3D83A 2BRMA 2W1FA 3IW8A 3M42A 1MP8A 2J7TA 4PMMA 3OWLA 5LVNA 2OU7A 2IVUA 4OT6A 5DR2A 1XKKA 1AGWA 3KRWA 4UB7A 4FEXA 5FEQA 1PXPA 4O0RA 2WAJA 4EHVA 5HHWA 2YFXA 1GZKA 3DZQA 5IQEA 3ID6C 4Y85A 3GNIB 4G6OA 5CSPA 3MVJA 2RFNA 4MXAA 3BU6A 4RFYA 1SVGA 5BUJA 3HMIA 3OHTA 2VO7A 2IW9A 4I5MA 2GFCA 1WBTA 3EQFA 3GQIA 3I0OA 1M2PA 3BYUA 4IC8A 2VTTA 3GP0A 3OS3A 5LJJA 1OMWA 4FTRA 3Q5IA 2NP8A 2XIZA 1PXIA 2BDWA 3QD2B 3N4VA 2QCSA 1YKRA 2Z60A 4WG5A 3UIUA 4BKZA 5AAFA 4DC2A 5K0XA 3R9RA 3C5UA 2Y4PA 2YDKA 2P3GX 3NNUA 3I6WA 4YBJA 4XNEA 3ZO2A 3LMHA 3U6HA 3FPMA 4APCA 4EEVA 3BHUA 1WBWA 2HWOA 1TQMA 2BPMA 4LOQA 2H8HA 1UWHA 3ZFYA 3RK9A 2PYWA 3JVRA 3AD5A 1P14A 1YHVA 3NS9A 4KBKA 3V8TA 5JEBA 4PDYA 3OP5A 4RSSA 4XV2A 4A9SA 1DAWA 3EMGA 5LWNA 3G15A 4D4YA 4WKQA 4I0SA 4PPBA 2IW8A 3VJNA 4C4JA 1JPAA 3IECA 4BTFA 4V0GA 5KMMA 2WQMA 5I3RA 2C1AA 1FINA 2WOTA 1TVOA 4XP2A 2X4ZA 1T46A 3FY0A 4NH1A 5L3AA 3V5LA 4QMUA 5CNNA 2H6DA 1XH6A 5IPJA 1XH8A 2B1PA 4Y72A 4EQCA 3PWYA 2YCFA 4IDTA 4IB0A 4FNXA 2C5VA 4EBWA 4DEHA 4F4PA 4P90A 1U4DA 3ZSHA 5M09A 2W5AA 1IA9A 4BZNA 2YLFA 5H8GA 4E6DA 2C68A 2J50A 5IUGA 1IRKA 1OIRA 1URWA 3GBZA 2HW6A 3QWKA 3Q9YA 4U41A 4CFWA 4EC9A 1OIQA 3CIKA 3DLZA 1CM8A 1MUOA 3MH0A 5KMOA 2HY81 4TKSA 4CRLA 4EWQA 2GS7A 1JAMA 3GXLA 3VBXA 4RVKA 3FXWA 5IQDA 2WEIA 1H25A 3FL4A 5IQFA 3FMNA 3PXKA 2ITUA 5FBOA 3MSSA 4O0TA 2VWXA 3I81A 2GNFA 4B6LA 4JOAA 5JFSA 1OECA 4C7TA 4H1JA 5AUWA 3SC1A 4XV1A 2QODA 1GIJA 4OR5A 4XMOA 2JITA 5I9UA 3TNIA 2QKRA 2C6DA 2X2MA 4L44A 5HBJA 3CJGA 1M2QA 4IVCA 3LFQA 4D2PA 5JGDA 5JZNA 2QLUA 4R78A 3A62A 2C6OA 4E26A 1JWHA 2IZSA 4PNIA 3ZSIA 4ACHA 2QO7A 4EZ5A 3AXWA 3Q9XA 3C5IA 5HZNA 4R3RA 4KIQA 5E8XA 4N6ZA 4A7CA 3RNYA 1UNHA 5K5NA 1S9JA 2OIBA 3QTIA 3PRFA 3NW6A 1BL7A 2EXCX 4HCUA 4XLVA 4GK4A 2JBOA 5HG5A 3VBYA 4IACA 4IXPA 4M69B 3TCPA 2F49A 3OMVA 4NFNA 4RQKA 2ACXA 3H10A 4ALWA 5BVOA 3KEXA 4FKPA 5L8JA 3R6XA 3RKBA 1V1KA 4PTEA 3ZO1A 1VZOA 3Q6WA 3Q96A 4BDDA 5C26A 2CKPA 2UZOA 3IGOA 4QTDA 4TYHB 2VV9A 4DGOA 3CTQA 2XNNA 2Y7JA 5M07A 3RZFA 2C6MA 1JLUE 2ITYA 1OKVA 5ETIA 4BBEA 3VAPA 5I9WA 3DXPA 5IUHA 3I60A 3KXHA 3QLFA 3QQHA 5IF1A 5KO1A 4DFXE 3IK3A 4MQ2A 3Q3BA 1QPJA 5JFWA 1BYGA 5I5ZA 2ZB0A 2C5XA 4UWCA 4EZ3A 2P0CA 1WBNA 2P2IA 4U44A 1KV2A 4N70A 3GCQA 4IQ6A 2J51A 3ETAA 4H1MA 4RVTA 1OKWA 5FXSA 5T6KA 4O7YA 5IQGA 4D2WA 1R0PA 2DWBA 3EKKA 5KKRC 3VW6A 3MFSA 4DEBA 2X6DA 3SA0A 3PIXA 4YNOA 3FDNA 1VYZA 5CX9A 5FGKA 3CKWA 3Q60A 4C3PA 5IH4A 3UO5A 5DVRA 3SXFA 1UNLA 1WMKA 4FSRA 2BFXA 2C6EA 3JYAA 4O96A 4QTBA 4BDJA 3NWWA 4JT3A 4HGLA 2C6TA 3P7BA 5I4NA 1Y6BA 2W4KA 2PMOX 5A4EA 2GQSA 4P4CA 3CQUA 4R8QA 4C33A 1K9AA 3AC3A 1PMEA 3LLTA 5FM2A 3DA6A 4WBOA 2XBJA 3PPJA 3UYSA 3BQRA 1B38A 1JKKA 3NNWA 5CENA 3RCDA 4ANLA 1OPKA 4RGJA 4FOCA 2YCSA 2QQ7A 1YRPA 4FTIA 4RIYA 3PUPA 5AX9A 3BYVA 2YHVA 5HLNA 5EQYA 3PZEA 4CFNA 4JNWA 4DEAA 4HGTA 2QO2A 4D28A 5H8EA 3BEGA 3ZRLA 3TKIA 2VTAA 4KBCA 4U7ZA 4YPDA 3TI1A 3QX4A 1ZLTA 2ITPA 4MXCA 2VO3A 5CANA 5C03A 5M4FA 3NUXA 4K0YA 5AP0A 4JBVA 2PVFA 3HX4A 4WSYA 4BGHA 3MVHA 2RFSA 5F94A 2PMIA 1PHKA 2KULA 2QO9A 3Q6UA 1ZOEA 1U54A 2OBJA 3GEQA 4RJ4A 4NL0A 2VUWA 1UU7A 4ZTMA 4GG7A 3S4QA 2VWUA 4FBXA 4GJ2A 4C37A 3D5XA 4XG7A 4QMQA 4QTCA 3DKGA 2UZBA 3MTLA 5EK7A 4DCEA 3KA0A 2O63A 3FUPA 4JBQA 4LRKA 2X7FA 2XKCA 2XKDA 4DBXA 5AP4A 5DMZA 1O9UA 4M13A 3FLWA 3WZUA 1UNGA 3D5VA 5EDQA 3ANQA 2FYSA 5CSVA 3UOHA 3ET7A 3CXWA 1GY3A 5AR5A 2UZVA 5HO6A 4S33A 3W2RA 3IONA 3O50A 4UZHA 4O0YA 2QVSE 1ND4A 4TYIA 1A9UA 4RWLA 3OFMA 3PY0A 4LL5A 2YAKA 3R22A 5DLSA 3EJ1A 3OXIA 3REPA 5FG8A 4BFMA 5EFQA 4O0SA 4JXFA 4CMOA 4O82A 2GHLA 1XQZA 3AG9A 4YJSA 3V01A 5I9XA 3EFLA 3ZC6A 3EH9A 3IDPA 5BVKA 4AE6A 4ERKA 4RWKA 4H3QA 5AR4A 3BHHA 4CLIA 5M08A 3ORLA 3ZH8A 2YN8A 3DJ5A 1YXTA 2UZEA 5KMKA 1Y57A 2A0CX 4CCUA 5AP6A 3F3TA 4M97A 3GOPA 5BUEA 4KS8A 1GZ8A 3RHKA 5KKRB 5M55A 3TJCA 4U42A 1KE5A 1KV1A 4HOKA 5F95A 3KFAA 4WBBB 4TT7A 2VO6A 4BGGA 3R8ZA 4AWIA 4BBFA 2R3OA 1H26A 2E9PA 3NAYA 5DPVA 3WZKA 3IOKA 4AGWA 2JD5A 4FA2A 3FMKA 4UMUA 1PYEA 2RSVA 3KRRA 4G34A 4QMLA 4II5A 4AF3A 4B0GA 4YU2A 3SD0A 3MV5A 2PMLX 3QALE 4EONA 1LR4A 5CEQA 4G6LA 2GHGA 3C4CA 3EL8A 2Y6OA 4PUZA 4OAVB 2R9SA 4JBPA 4IWQA 4A9UA 1WVXA 4CZTA 1G5SA 4BC6A 2FSMX 3QC9A 3EWHA 2OXYA 5AR3A 4PY1A 3V6RA 3ORPA 2ITTA 2UW4A
chains in the Genus database with same CATH superfamily
3NIEA 3QTUA 4ZTRA 3CKXA 3UG2A 1FBNA 3MPMA 5A6NA 4HVSA 5KBQA 3BLRA 3OCGA 3S2PA 1ZMWA 4AZTA 4JG6A 3WI6A 3D94A 4O7VA 1BL6A 5M57A 4DH8A 3EYHA 3PSDA 3NSZA 3FKOA 3EKNA 3CD8A 4KIKA 1Q8WA 4QP8A 2JDOA 2RKUA 4FOBA 2QOFA 3RK5A 2YACA 2X0QA 3O0GA 5HE2A 2J4ZA 3PPZA 4BGQA 2XNEA 3QXOA 2OJ9A 1PXKA 5IMXA 4R3CA 5J7BA 2XK8A 3FYJX 3ZFMA 4IVBA 4DFUA 4RT7A 1ZZLA 1SM2A 3G0EA 1DS5A 4M66A 3ORXA 4ANBA 4ITIA 4IZAA 5AP7A 2RIOA 5KMLA 4ZLOA 3LQ8A 4QEBA 4HVHA 5GHVA 3HAMA 2KTYA 5FTQA 2WIHA 2XNBA 3RBWA 5AIKA 3LMIA 1XO2B 3VRZA 2OZAB 3W2SA 2XYUA 3VWAA 3HZTA 1YOLA 1RW8A 3OW3A 5E92A 2JIIA 3GU6A 4EH9A 3FZTA 4G9CA 2PVNA 2CNUA 5B0XA 5EM8A 4RJ3A 4IWDA 3DXQA 3P4KA 5DNRA 2EB3A 3SAYA 2QD9A 4J71A 3EZVA 2YCRA 2PE2A 2YIYA 3WE8A 2G01A 3A8XA 5CNOA 2P55A 5FEDA 5DYJA 2WB8A 2P2HA 4BZDA 3TUDA 2NRYA 2ETMA 3OF0A 5C9CA 4KKEA 4RX8A 4ZSLA 3R1SA 2UZTA 3G51A 1WBVA 4X2KA 1KE6A 1V0PA 3EZRA 3A99A 4G17A 4ACGA 5G6VA 3QUDA 4D0XA 3UDTA 3SOAA 4O86A 4FTJA 3SG9A 4IAAA 3PTGA 2XIYA 3W0QA 2GNLA 4KRCA 2YIWA 4G3CA 4O83A 2O64A 2BALA 2IO6A 3QFVA 4ZJVA 3W16A 2WMQA 2ONLC 4NT4A 4F9AA 3TN8A 4O27B 3ORZA 2XNPA 4IX6A 3MJ1A 4O0WA 3PE2A 1OUKA 4I5HA 3UPXA 2PVMA 4DHFA 2OICA 2W5HA 4FSQA 4ASEA 3FLZA 5BYZA 1ZYLA 1PRYA 3I5ZA 4XUFA 2A27A 4O84A 3MB6A 4JRVA 3VQHA 2WMSA 5GJGA 4QMXA 3F66A 5AUUA 2ZDTA 3M1SA 3D4QA 4C34A 4CD0A 4QNYA 3DFCB 4UXQA 3U54A 3F3ZA 5ANIA 4E4NA 1UA2A 3VF8A 1W2DA 4WUNA 3R7IA 4QP1A 4ZY6A 4X7QA 3RPVA 4OTDA 4F7NA 1GZNA 3VS5A 4HZSA 4CV9A 2HXLA 2OGVA 4XOYA 3N51A 5LCKA 1WBOA 4ANNA 3LXPA 4YNEA 3O7LB 2UZWE 4I6FA 4OTFA 4FI1A 3E5AA 2OW3A 2OIDA 4TW9A 4MNEA 3EHAA 1ZOGA 3MH1A 4AGCA 2B55A 2YCQA 5A9UA 5H2UA 5TKDA 2J9MA 1KOBA 1YI3A 3KULA 4I0TA 1H1PA 1Q4LA 4QD6A 4NK9A 4W8EA 2UVXA 4F64A 4TZRA 5I9VA 4QQJA 3VS3A 4U3ZA 2GMXA 4HVGA 1SVEA 4QMMA 3SW4A 2WMTA 2HK5A 4DEIA 3UE4A 3I4BA 4PDOA 3UNKA 3CY3A 4CKRA 1YHSA 4UZDA 4I6LA 3W0PA 4R3PA 5ACBC 4JDIA 4O81A 4OTGA 4CKJA 2VGPA 1XMMA 3VUMA 5A4QA 3FE3A 2R3HA 4ZSAA 4JMQA 4HNFA 2XIXA 2QNJA 3HA8A 4F78A 2BIKB 3QUPA 3CGFA 3I1AA 4NIFB 2JAVA 3E87A 4QP6A 3TKUA 4J1RA 2VTQA 2GU8A 3AMBA 3WBLA 2I0EA 4AA4A 4IZ5A 3RI1A 4KABA 3TT0A 4J98A 3PA4A 4KSQA 3NYNA 2UW9A 4J95A 4EHGA 1NA7A 5M53A 4A4LA 2B9HA 1R0EA 2PUUA 2XEZA 3E8NA 3IW6A 4BRXA 2GTNA 2VWYA 4G3EA 3RM7A 1UVRA 1O6KA 4YLLA 5F20A 2XKEA 1Y6AA 2YM7A 3UZPA 3ZZEA 5KBRA 2XJ2A 3CSVA 1V0OA 4OTRA 2PL0A 3KVWA 5CLPA 4AX8A 4EH8A 4IZYA 3ZLYA 4QP7A 1ZYJA 3LFSA 3QU0A 4IX5A 3MWUA 4GT3A 5BYYA 4O4EA 3QRIA 3D2KA 4XG8A 4CZUA 4IANA 4AGDA 4JX3A 3PRIA 2W1CA 3FI2A 3UPZA 2BRHA 2EWAA 4JAIA 1UKIA 2BAJA 3QYWA 3BBTB 4CV8A 4O6LA 2G15A 3GENA 2YZAA 4O7WA 1LP4A 1MQ4A 4PQNA 3ZUUA 4EOOA 2BMCA 4YURA 3HNGA 2ITVA 3UTOA 5HTBA 4YLJA 4YTHA 3FC1X 5GIPE 4YJUA 2PVHA 3W0RA 4FTOA 2WMWA 4R6VA 4O7NA 2I0HA 5AUVA 4MD7E 5CI7A 3LFFA 3NFFB 3BPRA 5ANGA 4NYEA 4FVRA 4BTJA 2VWBA 2F7EE 2XUUA 2PVRA 4IEBA 3AC5A 5LMKA 4DGLC 2QOIA 4W8DA 4L42A 4JBOA 3JXWA 4RZWA 4FF8A 3MESA 3A7IA 5T68A 3OXTA 5CU2A 2HZNA 2PE0A 5BVEA 2PUNA 3P86A 4UYAA 1YXXA 1UU3A 5HG9A 3ERKA 2OJFE 5A4CA 5AUYA 4A9YA 3A4OX 3C4ZA 3DDQA 1ATPE 3F2NA 2VX0A 3ZBFA 4B99A 4NUSA 4L00A 3KQ7A 2VNWA 4E6AA 4FKWA 5B7VA 2YIQA 3AMAA 4GH2A 5IQAA 5J5TA 3HV6A 1E1XA 3DBCA 2IJMA 2OO8X 2YABA 4QMPA 3T3VA 4YMJA 3OTVA 2QURA 2OF4A 1H07A 3ROYA 2GQGA 3ZEPA 3F61A 4NJDA 1FVRA 5AR8A 3U87A 5B2LA 5F4NA 1ERKA 5EKOA 5HTIA 2CN5A 3FAAA 4LYNA 2Z8CA 4X6QC 5LCJA 3ZEWA 3G33A 4UMTA 4MKCA 5CAOA 3MA3A 3PLSA 2W9ZB 1QCFA 2BZHB 4K1BA 5L6WL 5I9ZA 3QZIA 4AXAA 5K0KA 4V0GB 2OJIA 2J5FA 4BDGA 2X9FA 4W4XA 1Q3WA 1Q8YA 4NM3A 3QCSA 1K3AA 4FE2A 3LFDA 2WU7A 3FBVA 2C69A 1OL5A 1XHAA 3BQCA 3QKLA 3NNXA 4BCHA 3VULA 5IEVA 2QR7A 1XR1A 3MFTA 3TIZA 4KB8A 4UWBA 4CGAA 3BWFA 2F57A 3VS2A 4D5KA 1S9IA 3TNWA 4EOLA 3GU4A 4LGDA 5GJDA 5KCVA 3Q52A 5KX8A 3EQBA 3PXFA 4UBAA 4IFCA 3VVHA 3II5A 1M17A 5E8SA 4ZEGA 3MIAA 2PPQA 5DR6A 4S32A 3OT8A 4XJ0A 2WEVA 3QQLA 5DE2A 3OXZA 3P7CA 1YI6A 3LFCA 4I0RA 4X2JA 4GIIA 2ZAZA 2V5QA 3DY7A 4Y5QA 1H1SA 4EH4A 4XH6A 1PMNA 3EN6A 4FRFA 1IG1A 3MIYA 1OL2A 4CT2A 4FKQA 3QZGA 4Z16A 2PVYA 2UW6A 4RC2A 1FMOE 2PVKA 2WNTA 1TQIA 3COMA 3QGYA 3RK7A 4ENXA 5BVNA 2VWZA 1M7NA 2HWPA 3IO7A 4JR3A 3H9FA 4BB4A 4E3CA 4MUQA 2XH5A 4AFJA 4AQKA 2V7OA 4YJQA 2ZV7A 1NVRA 3LCTA 3HRBA 1Y8YA 4RQVA 2FGIA 5D12A 3L8XA 4CTBA 4K6ZA 3MS9A 4DTKA 4QQTA 3MGYA 1W84A 4NCTA 2BROA 3W55A 2YIXA 4YLKA 3HMMA 3DTCA 4O0XA 3KREA 1PY5A 1UV5A 4BYJA 4O0UA 4EC8A 5EQEA 3PA3A 3UQCA 1JSTA 2QC6A 1IAJA 3PYYA 1KE9A 4H39A 4U3YA 1OL6A 3H9OA 2UZNA 5DT3A 3A61A 4BBMA 4F9YA 5ICPA 4MQ1A 4AW5A 2J0IA 5LVOA 2R5TA 4YTCA 3H3CA 5IH6A 3VONA 4L68A 4BCFA 1H4LA 3CE3A 4EOMA 5BX0A 3QHRA 3MBLA 5HGIA 4EYJA 3JY9A 2SRCA 2XIKA 2YLEA 5AV1A 5HD4A 2GNJA 2VZ6A 4U97A 1DI9A 4TYEA 3KCKA 3PIZA 3FZ1A 5J87A 3SDJA 3K3JA 3MYGA 3BLQA 1XH7A 3NLBA 5EHLA 4TTHB 2JDVA 1RQQA 4AU8A 5EKNA 4FKJA 5J9YA 2PZYA 2LGCA 4U40A 1DAYA 4DHJA 4D4VA 5CI6A 1H01A 4FODA 2GNHA 4F99A 3DBQA 2Z02A 2BTRA 2F7ZE 1T45A 4X3JA 5DN3A 4YJTA 2W1DA 3T9IA 2JDTA 4ZAUA 4IWOA 4XYFA 3F5PA 5DBXA 3SRVB 3T3UA 3K2LA 2R0UA 4ASZA 3PDTA 3Q2JA 3HA6A 3V8WA 5IA1A 4AW2A 4BI0A 3RTPA 1YVJA 4UMQA 4EH3A 4LV7A 4E73A 3C7QA 4YJPA 4NTTA 3FMMA 3COIA 4RWIA 2R2PA 4YSJA 4IAFA 4F0IA 5DHJA 4U9AA 3D15A 2VAGA 3ZYAA 1H08A 4C3RA 1BI7A 2ESMA 4I3ZA 1Q61A 3EQIA 5C27A 4FT5A 5A46A 2VTLA 3COHA 3ZM9A 3Q32A 4LL0A 2GQRA 5FQDC 4C36A 3RWQA 3B2WA 4JIKA 4BY9E 2YWPA 4K33A 3HV4A 4TYJA 2IEWA 2P33A 3OY3A 5HCYA 4FX3A 3LCKA 2JKQA 5CQUA 4ZZOA 4ZLYA 4I5PA 4RBLA 3SLSA 3TUBA 3KU2A 3GC8A 2V62A 3TNQB 1R3CA 4IAYA 3OWJA 1OBGA 5TO8A 3ODZX 4FTUA 3NVKI 5DRDA 4Y5HA 3UGCA 5K4JA 5DR9A 5EH0A 3C51A 3UDSA 4FV3A 5G1XA 4AACA 4UY9A 2XK9A 5DI1A 2X0OA 3VHEA 4DEDA 3ZDIA 3HECA 3ZHPC 3BGZA 4O6EA 3D7TB 4OUCA 3IKAA 2UW8A 1OPJA 3R02A 3EQPA 3DCVA 4HPTE 3VS0A 2XK4A 1JSVA 4QTAA 4QMOA 3RPOA 2AC3A 2X7GA 5LWMA 3CLYA 3OWKA 2CMWA 3R01A 3CPCA 4FTAA 2XCHA 4IFGA 4XEYA 2GNGA 4E5BA 1OKYA 4WRSA 3I7CA 2UVYA 5TOZA 4GG5A 4FSMA 5IU2A 3NYXA 4BKYA 1WVWA 4JIAA 5LQFA 2A4LA 2E9VA 4YHFA 4AQCA 3QQKA 4ZS4A 4EQUA 3D9VA 4JG8A 4DH3A 4MYGA 3AKLA 4EH6A 1Q99A 3KF7A 4FT9A 3R9OA 4NM5A 4XBRA 4DLJA 3UOLA 2ZOQA 5AADA 2Y4IC 1TQPA 4YJVA 3BHVA 2BAQA 4CEGA 1KSWA 2OK1A 2VTIA 2I0YA 4QMYA 4ENYA 4DGNA 4O1OA 4EOKA 2VWIA 4AN2A 4RC4A 2YZLA 4AS0A 3AKKA 4A06A 2F2CB 2FVDA 4FTTA 2WTDA 4GCJA 2XZSA 3BLHA 3P78A 3QTXA 4P5ZA 1Y91A 4F09A 5M44A 3DAJA 5LOHA 2G2FA 3R9HA 4DT9A 5GIOE 1H1RA 4GUBA 2OSCA 2PSQA 4XHKB 4DEEA 4G6NA 3UOJA 3G6GA 4XG3A 3ZC5A 4NKSA 1F3MC 4D9UA 4FL1A 2XK6A 5CF5A 4BJJB 2XS0A 4O7RA 4HVIA 5HLWA 2XA4A 1PXNA 5GZ9A 5J9ZA 2BTSA 3P7AA 1Q41A 3P0MA 4L53A 3A4PA 3OCSA 2ZM4A 4MF0A 3F5UA 3UC4A 4FYNA 2YJRA 1CSNA 3HMNA 4HYSA 4V01A 1QL6A 3VO3A 4IWPA 2PUPA 1PMVA 4DA5A 4A9RA 3KXMA 4CLJA 5A54A 4LRMA 3WF9A 3QTSA 3G6HA 5BQ0A 4DBNA 5CZIA 3IW4A 1REKA 4GSBA 2R3MA 2CNQA 3KN5A 3V3VA 4AZEA 3LLAA 1RJBA 2O2UA 3D2IA 4D2TA 2YITA 4FSWA 3ZXZA 3IQ7A 3GFEA 4OTHA 3UIBA 4RIXA 2YERA 3FZPA 5DWRA 4FIFA 3LQ5A 5GZAA 4QNAA 1IR3A 3RAIA 4IB1A 5E9EA 5IA5A 4OGRA 4YTFA 3U8WA 5BYLA 4MAOA 4IX3A 4WG4A 3R1NA 4X21A 5K3YA 3ACJA 3R7UA 3TV6A 2YEXA 4DDIA 3NUYA 4KSPA 3BZ3A 2ZDUA 3ALOA 3D0EA 4FC0A 4K18A 3QUEA 2DUVA 2I40A 4ANQA 3S00A 1M7QA 3AT2A 4JS8A 3VBQA 2J90A 1J1CA 2PZPA 1CMKE 3O96A 4CFFA 5AA8A 1ZOHA 2BKZA 3QTQA 4AT3A 1OKZA 3DQXA 5C8MA 2W5BA 5FXRA 3N4TA 2ZB1A 4FKIA 2G2IA 2GFSA 4M0YA 2HZ4A 3IW7A 1M14A 1W0XC 2E2BA 2J2IB 3WF8A 5K4IA 3UZTA 5IQIA 4AE9A 2CDZA 3QGWA 2XVDA 3MI9A 3N9XA 2YM6A 2XF0A 3V51A 1OPLA 1ZWSA 5CWZA 3BHYA 4RC3A 3FPQA 4GW8A 4UMRA 5AP1A 5L2SA 2ITOA 2FSLX 1JKLA 4EOPA 1XJDA 4ZLZA 2CPKE 5EYMA 1XH9A 3O2MA 5CU4A 3BRBA 4MVFA 3CGOA 4FEQA 2JKKA 4BCQA 4GYGA 4DFLA 4TYGA 2CKOA 1XH4A 3UMXA 3NAXA 3ORTA 4RIWB 1PXJA 1R39A 2CKEA 3QRKA 3VUGA 1LUFA 4RLKA 4E1ZA 4YZDA 1IEPA 3CQEA 4QYYA 5GZ8A 3QC4A 5FP6A 3BELA 3GCVA 3O7LD 2VRXA 1GNGA 3PZHA 3HL7A 3VUDA 2Y4IB 3LFAA 2HW7A 4H3BA 5HESA 4BIEA 3DJ7A 4BWPA 4YR8A 2BHEA 3GFWA 2WMAA 4MXOA 4OTIA 4D55A 5IA4A 1VJYA 3LFNA 4FV8A 3POZA 3FZSA 4FYOA 4ZTLA 4F63A 3ZTXA 4EK5A 2W1GA 4V04A 4IVAA 5IG1A 1JSUA 4I4EA 2Z7LA 4QMZA 3TYKA 3MN3A 2C5YA 3LCDA 3OC1A 5ANOA 5CYIA 3EFKA 1ZMUA 3AC1A 1H8FA 4RRVA 4F0FA 3QD0A 3F3WA 4X2GA 4Q2AA 5HOAA 1APME 4IZ7A 1PMUA 4MD9E 4IH8A 4EK4A 4MXXA 2V55A 4HCTA 5H3QA 1HCLA 1BUHA 1YWVA 2UUEA 2UZUE 3QQFA 4C2WA 4ACMA 4EYMA 4ZSGA 2QR8A 3FYKX 3G9NA 4K8AA 3R28A 4P7EA 4NM7A 5CVHA 4N6YA 4C4IA 3QHWA 2X8DA 5LXMA 3FMDA 4I22A 5FLFA 4QYHA 3VHKA 4MXZA 3H0YA 4ASXA 2C6IA 2PWLA 4AAAA 3GVUA 4QMTA 1OVEA 3FI8A 5JRSA 3KGAA 2UVZA 3S1HA 5AV2A 4FK3A 3DBEA 4JJRA 4NW5A 4IM0A 4L9IA 3CPBA 1YXUA 2BHHA 2X0PA 5D10A 4M8TA 2GHMA 2VTMA 4FL3A 3PXYA 5CQWA 2H96A 2JGZA 4FV9A 1LEWA 1SMHA 4G1WA 4NZWB 1FPUA 3E93A 2PHKA 4RWJA 4JQ7A 3A60A 4X3FB 1EH4A 1W98A 4M69A 4R5SA 5IA3A 4AN9A 4PNKA 3OD6X 3BWJA 3MY0A 3SOCA 4FUYA 3Q9WA 4IDVA 5HICA 3PVGA 3ALNA 1Q8ZA 2JAMA 4AN3A 4MBLA 3RVGA 4ZSEA 5K5XA 4TYHA 3RHXA 5FEEA 5C8KA 2XAMA 2VO0A 4GUEA 4D2VA 3JS2A 5E90A 2C0IA 4IB5A 3EFWA 4FKOA 4CNHA 1MRVA 3ZO4A 1PJKA 4DN5A 1NW1A 4RJ7A 5EHYA 2X2LA 2VGOA 3HRCA 1JKSA 4XV3A 1H28A 4JX7A 1Q3DA 4KA3A 4XLIA 4YO6A 3ZU7A 2GPHA 3IOPA 4RA4A 4ZP5A 4UN0C 2CNVA 3ZMMA 3DAKA 3QRTA 1FQ1B 3C0IA 2WTJA 2YIRA 5EW8A 4BDBA 5F9EA 3SX9A 3DK3A 3BE9A 4ZJJA 5D7AA 2QG5A 3E7OA 5HQ0A 4RVMA 5CAQA 4KINA 4FV4A 4JLCA 3SKCA 3G9LX 4YUQA 2WMXA 3FZRA 2UZLA 3KCFA 3R8LA 4AA0A 4C02A 2JC6A 4F7JA 4O4BB 4GV1A 5K9IA 4EQMA 1M52A 4O38A 4PTGA 3OCTA 5AMNA 1OL7A 3BI6A 4UMPA 3LMGA 3QRUA 3UOKA 2IW6A 3PPKA 2B53A 2XYNA 4NKAA 3KRXA 2W4OA 2XJ1A 3IPHA 5GNKA 4DT8A 3EQDA 4O4DA 2X6EA 1WCCA 4EK3A 1U5RA 4H05A 3TJDA 3HKOA 3QKKA 3QTZA 4XP0A 5ANEA 4P2KA 2C3IB 5JSMA 3R7EA 2XCKA 3KK8A 2BILB 2W1EA 3QRJA 4NFMA 3U55A 4CQEA 2GSFA 4USFA 2ITNA 3QF9A 4RX5A 3DB6A 3ORIA 1RE8A 3LIJA 1SVHA 4FNYA 2OH4A 3MVLA 2RG5A 2F4JA 4XBUA 2R7BA 3TZMA 3VNTA 3L8VA 3E8CA 3UP7A 3NX8A 1OGUA 4ALVA 3UQGA 2R3JA 4U80A 2C30A 4EUUA 3QCQA 4I6QA 4C61A 2J0KA 2ZM1A 4OTWA 3V04A 3LE6A 2YJSA 4YHJA 3VBTA 4BN1A 4E93A 1FGKA 2X7OA 3KB7A 4HZRA 4XRLA 2YM8A 5HG8A 3KXXA 3NW5A 2W1HA 1NY3A 3L9NA 3VUHA 4YZNA 4J99A 3BKBA 3MFUA 3RAKA 2X8IA 4BI1A 5LARA 1G8KA 3RM6A 1P5EA 4XG2A 5IQHA 4ID7A 4B8LA 4IHPA 3IS5A 4BWKA 3AD6A 4FG8A 4TY1A 4XCUA 1CDKA 4AXDA 2PMNX 3UIMA 1FVVA 3PE1A 3RNIA 3UODA 5JH6A 5AAEA 3WIKA 3WYYA 4EWHA 3GU7A 1Y8GA 2BDFA 4RJ6A 1SYKA 2R3IA 3R0TA 5J79A 4M84A 3FZOA 1GIIA 4B9DA 3RALA 4EL9A 3NUNA 3F69A 5IISA 1BMKA 3C4WA 4CZYB 4GVJA 4Y95A 1YW2A 2CHLA 3KY2A 4O7SA 4FKUA 1E1VA 4D4RA 3DV3A 4I20A 2Z7SA 2IZTA 2UZDA 1DM2A 4DLIA 4OBQA 5CEOA 3DDPA 4J8NA 3DTWA 3ZO3A 3W10A 3KC3A 3R2YA 4I24A 2B54A 4CFXA 3NEWA 3H9RA 3HUBA 5JN2A 1KE7A 1SZMA 4EJNA 1ST4A 4D9TA 3ZZWA 1ZYSA 4ONAA 4CVAA 2R64A 5EW9A 4U43A 4C35A 3T8OA 4OLIA 4AZSA 2J0MB 2WGJA 4PDPA 3E63A 4YZ9A 5HBEA 4Q9ZA 4BDHA 4KRDA 4EORA 3PJ1A 3R00A 5AJQA 3HRFA 2ITWA 1ZXEA 3MH2A 4FT7A 3POOA 4GRBA 3KMMA 4YPSA 3DLSA 4FSYA 1OL1A 3RAHA 2B9JA 2BUJA 4ACCA 2QOQA 3IGGA 4KIPA 1Z57A 3R71A 3WZEA 3TTIA 2Q83A 1W82A 2CCHA 4FV0A 3EQGA 2W7XA 4AZWA 3BU5A 3Q4ZA 1GOLA 3PVWA 5IQBA 4JI9A 3QTRA 5DT4A 1CKJA 5KHXA 3RJCA 2Z7RA 4AT4A 3DS6A 4O91A 1CKIA 3EN4A 3QA0A 4O22A 3R7YA 3OROA 5ETCA 4MBJA 3BV3A 3HDMA 4GEOA 1U46A 3FLSA 2W9FB 4ITHA 2X39A 4WNMA 3LJ1A 4I6BA 4C4EA 3IDCA 3C9WA 2FSOX 3K54A 1X8BA 5D9HA 4YJOA 4G5PA 5HE0A 5EQPA 3AD4A 3F2RA 2XEYA 4PL4A 5M4IA 4WA9A 3TDVA 4HGEA 3BYOA 4MNFA 3UVQA 5KMIA 5GJFA 4ARKA 2R3NA 3B8RA 4J53A 4QMWA 3ZRKA 2O3PA 3FQHA 1KWPA 3FLNC 3C0GA 1WAKA 3RPRA 2XJ0A 3HAVA 4XV9A 5CAUA 2WMVA 5I3OA 1MRUA 3KMWA 2GS6A 4TWCA 4DYMA 4WNOA 4X2FA 2VTJA 3ENHA 4LM5A 3DJ6A 3V5QA 4BTMA 2ITXA 4L6QA 5FTOA 2ZMCA 4FKGA 5AR2A 4ZTSA 3R7OA 4ERWA 5IA2A 2NYAA 3ANRA 4DINA 2R0IA 2XNOA 3BL7A 4QRCA 4UV0A 2DS1A 3UVPA 5C8NA 3HV3A 4E20A 1XBCA 3HUCA 5TR6A 2XARA 3PJ8A 4J8MA 4DEGA 2OZAA 4QP3A 2W1ZA 3L8PA 5H9BA 2R3PA 4C4GA 3QA8A 4BR3A 3FQSA 3MA6A 2BR1A 4CG9A 4V05A 2O8YA 2BCJA 3DOGA 3NFGB 4FZ7A 1F5QA 1KE8A 2FUMA 2HXQA 3O23A 3FMJA 3PXRA 5AV0A 4F7LA 1QPEA 4BF2A 4IAZA 5IEYA 3O17A 4HYUA 3VS6A 5HVKA 4NU1A 4LRJA 4S2ZA 4BDFA 5CEMA 2AEGA 4MXYA 3RCJA 4O4CA 5CF8A 3VUTA 2A19B 4ASDA 3GB2A 4DCAA 3DFAA 3RPSA 4UX9A 1H24A 2OJJA 4LMUA 4GT5A 4APPA 4WO5A 5HO7A 4WIHA 4DGMA 3KVXA 4BCIA 2JFLA 2GTMA 2V7AA 4ZZMA 3BV2A 4CRSA 2PY3A 2JBPA 2DQ7X 2WQOA 4QOXA 4D1ZA 2OH0E 4HVDA 3P5JC 1NVQA 1DI8A 5HVJA 4FIJA 1W2FA 4E6CA 3ZDUA 1JOWB 3FSKA 3W8LA 3EIDA 2W05A 4J96A 2VTNA 4JQ8A 3L9PA 4L7SA 3QQUA 5ETFA 2HELA 3MDYA 3NPCA 3W32A 3UMWA 5KUPA 5BMMA 3FC2A 4PP9A 2VX1A 5HD7A 2HAKA 3VW8A 4N0SA 4BICA 3FSFA 4FTKA 2J5EA 3BYMA 3SXRA 5JZJA 5HNIX 5KE0A 2OLCA 3NW7A 1XBBA 1OIUA 2QG7A 5EYCA 5DIAA 4CFMA 5IKWA 4E6QA 4KIOA 3FHIA 3L8SA 2JEDA 4YGAA 1G8SA 4OBOA 2WHBA 3DNEA 2ZV8A 4RFMA 3U51A 3A2CA 4GU6A 2XALA 5E91A 4IM2A 2B7AA 2WTIA 2YM3A 3I79A 2VWVA 4F9WA 4IB3A 2OJGA 5CEPA 3OTUA 2HIWA 2WPAA 2X4FA 2GNIA 1OI9A 3ZBXA 2XM8A 3K3IA 2ETRA 5HCXA 4C3FA 4D4SA 4GT4A 3UG1A 3WIGA 3UYTA 4FSZA 2REIA 1QMZA 3NIZA 3RMFA 4JL9A 4C4HA 4F0GA 1ZRZA 2ZM3A 5C4LA 3DB8A 4WD5A 3TTJA 2VWWA 3PG1A 2ZMDA 4G31A 4RFZA 1O6YA 4AW1A 5KZIA 4F6SA 3DBFA 3KL8A 2YDJA 4L52A 4ZY5A 3NRMA 4QYGA 4YC8A 2VNYA 3VC4A 1G3NA 3LM5A 3THBA 4QYEA 3ULZA 5AFVA 5FUTA 4PL3A 5FP5A 5EOLA 3IG7A 3Q4TA 3CY2A 4ZY4A 3H30A 4KKHA 3R8MA 4ANMA 3TEIA 3ZLWA 4FZDB 5DRBA 4BL1A 3ORMA 2PVLA 4FTCA 2QOHA 3SXSA 2IF8A 2VX3A 5TT7A 3RGFA 3VN9A 5F1ZA 3PJ2A 4XRJA 1IAHA 3NYOA 3TM0A 4FT3A 3WOWA 4EZ7A 2R3KA 4NJ3A 4FG7A 4YJRA 5C4KA 4YBKA 4TRLA 4KD1A 4FTNA 3R8UA 4NIFA 5D11A 2EXEA 2R7IA 3VS4A 3DGKA 2VTOA 4X0MA 2W0JA 3KF4A 4YSMA 3W2OA 3FLQA 3AOXA 5JFXA 2WTVA 3JY0A 2ZJWA 3OOMA 4IVDA 4KAOA 2VN9A 4YP8A 5LMAA 4YO4A 2XNGA 5AWMA 2CGWA 4YJNA 3Q53A 5AIRA 4DH5A 3DPKA 4D2RA 3B2TA 5BNJA 2C0TA 2CN8A 5AP2A 4RMZA 4EH5A 4DTBA 2QU5A 4FVPA 3R7VA 3W2QA 3KRLA 3LZBA 1OITA 4ZZNA 4RJ8A 5J5SA 3Q2MA 4BCPA 4GK2A 3E7VA 4OW8A 5BUIA 5CXZA 5FDPA 3ENMA 3NR9A 3NUPA 4RJ5A 4IAIA 4BCGA 3L9MA 4YC6A 3QCXA 4I92A 4D2SA 2UW0A 1XMLA 2R3RA 4FIIA 1CKPA