2XKFA

Structure of nek2 bound to aminopyrazine compound 2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
250
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSRDLKPANVFLDGKQNVKLGDFFVGTPYYMSPEQMNRSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Aminopyrazine Inhibitors Binding to an Unusual Inactive Conformation of the Mitotic Kinase Nek2: Sar and Structural Characterization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 250
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xkfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xkfA01
3BHUA 1FINA 4QMSA 5FQDC 5LVLA 3MW1A 2IW9A 4GK2A 3SA0A 3GXLA 3G51A 2I0HA 3RZFA 2C47A 4FGBA 3U8WA 4DT8A 1O6LA 1E9HA 5CU3A 3B2WA 2ITOA 4LM5A 3OTUA 2ITZA 4MNEA 1A9UA 5DNRA 5CSHA 3SG8A 1MQBA 5DYJA 5E8XA 4RLKA 1ZY5A 3F5PA 4U81A 3UVRA 4E4MA 3AC2A 3QC4A 5M4FA 4BGGA 2C6IA 2HZNA 3MWUA 4IB3A 3UTOA 5A14A 4W9XA 3C5UA 4W4VA 2F4JA 4M68A 5L6PA 5LOHA 3UZTA 2BAKA 2QVSE 2X6EA 3A7FA 2EWAA 3HGKA 2LAVA 4AW2A 2J0IA 3D94A 5HG9A 4GG7A 3VQHA 1VEBA 1BL7A 4K8AA 2OIBA 3WE8A 1H25A 1DS5A 5M4UA 4J97A 3RAIA 3A7JA 4GS6A 4Y83A 3RNYA 4FKTA 3ZSIA 4YTCA 4QP2A 3S95A 4D5KA 1OPLA 3H30A 3NUNA 5FWKK 4PMSA 2PVKA 4CMOA 3EQRA 3P7CA 2W1ZA 2FB8A 1GIJA 3CD8A 3HLLA 5G1XA 4J71A 3WIGA 3PA3A 4YPDA 3LFSA 3DPKA 5BYZA 2X2MA 2UZOA 2FA2A 3A99A 3ORTA 4HGSA 4QP6A 4Y95A 1WVWA 3I5ZA 3UNKA 3CEKA 1J7LA 1ERKA 4GCJA 4NZWB 3R7EA 5ACKA 3OZ6A 4GYIA 1P5EA 4LOOA 2IVVA 3TN8A 3ZHPC 5ACBC 4BWPA 3ZYAA 4DGGA 5TE0A 2HY0A 4DN5A 3LM5A 2F7EE 2R3RA 1R3CA 2XK9A 4JR7A 4O22A 4D28A 2BHEA 5E8UA 3OT8A 5FDPA 3FQEA 5DT4A 4BDBA 5IMEA 4EH8A 3R83A 5J95A 1HOWA 3T9IA 4MQ1A 4D1XA 3QD4A 3PJCA 4FZ7A 3Q04A 4FV9A 1PJKA 2CNUA 5H8BA 1WZYA 4N57A 2FSMX 4CXAA 2GPHA 4YJPA 3TNIA 2CCIA 3I0OA 3C4CA 3HRBA 4DFXE 5A4CA 4FUXA 4BTMA 1Y57A 4BBEA 3PPJA 4A06A 3MA6A 4CRSA 1PKDA 3NYOA 3LCOA 3LHJA 4OTRA 4Q2AA 5IUIA 2QQ7A 3NIEA 3DLZA 4L3PA 3ORXA 3GB2A 3QTZA 3V5WA 4DH7A 1OVEA 1G8AA 4H05A 3B8QA 4O7YA 4DBXA 2WKMA 4IE9A 1YRPA 4CZUA 4CFXA 3NW5A 1W82A 4AF3A 1IG1A 2CNQA 4BCGA 3N4VA 4C4IA 4XG2A 3IW8A 4LG4A 3Q32A 4UN0C 3CR0A 4X3FC 4FSNA 5E92A 3OCBA 3FEGA 3VRZA 3H10A 3NSZA 4K6ZA 3EKKA 1ZZ2A 4QMUA 5HU3A 3KMMA 2GFSA 2R3FA 1B39A 2RFDA 4CT2A 2BRHA 1GIIA 5FRIA 5J1WA 2GQSA 4KSQA 1R1WA 4O81A 4IJ9A 2R0UA 3I1AA 4U5JA 5EHYA 5KUPA 2RIOA 3BKBA 4YSMA 3D5XA 1PMNA 4RFZA 3OVVA 1QCFA 3VNTA 5J9LA 4B7TA 2ZOQA 1GY3A 3ELJA 2X7OA 3VVHA 4C3RA 4ASEA 5LMBA 3VRYA 5CZHA 3VUMA 3D5WA 5FTGA 3LXPA 3CC6A 4M84A 4RIWB 5M55A 4F9YA 5FM3A 1H27A 3D2KA 4F7JA 2XK6A 3AD5A 5EM5A 2PYWA 3VS2A 4UWBA 2UVXA 3KXXA 4EOLA 1J1BA 2QOIA 2V0DA 2XNMA 4YZMA 2BHHA 5IA4A 3F66A 5ETAA 4BCFA 2J50A 3F2AA 4M69B 5HX8A 3U6JA 5L6WL 4KIKA 2YIYA 4XG6A 4WBBB 3TXOA 2IVUA 2OXXA 3NW6A 3DTWA 3U9NA 4Y8DA 3SV0A 3WZEA 4DE4A 2QCSA 2EXMA 5HNBA 5IISA 4F6UA 2YWVA 1XKKA 2GS2A 3QF9A 3JPVA 4PMMA 3SHEA 3CD3A 3E87A 4ID7A 3RBWA 3AD6A 3PWYA 4G3GA 3MFUA 3R8PA 1A06A 4XMOA 4ASXA 3HMMA 4IB5A 5HLNA 5EHOA 3VBVA 2C1AA 1R0PA 3W2QA 5J5SA 4NK9A 2J5FA 3CJGA 3QQLA 5B2KA 3I79A 4JG6A 3R9RA 5C4KA 4FV5A 4M7IA 4A4OA 1JSUA 4GFGA 4FNWA 1O6KA 3QL8A 2WMAA 5CVHA 4A9RA 5HD4A 3EQCA 3BV2A 4FMQA 2QKRA 3MGYA 4EL9A 2PUIA 5HNIX 1BL6A 2G1TA 1TQPA 5DH3A 4GK4A 4B99A 2WEIA 4X7QA 4BI0A 5C8NA 2UZEA 2UZBA 2JDOA 3I7BA 5LXMA 4YTFA 3CKWA 4ZEGA 1F0QA 3EQBA 4WKQA 1XJDA 2BTSA 5M4IA 4I21A 4NJDA 4FTQA 2J90A 1BLXA 3ZUTA 4I4FA 5EHLA 4LL0A 3L8XA 4Q9ZA 2CCHA 4I4EA 3FYKX 1YHSA 3DCVA 3D9VA 4LUDA 2CJMA 4ZLYA 1UWJA 3IW6A 4CEGA 3RM6A 2F7ZE 2ITUA 4XH6A 2R3JA 4AT4A 3QZIA 3ZLWA 3MFSA 2RGPA 2ITPA 3C4WA 3ZRMA 3BYVA 3PXFA 3RINA 4DGOA 2VTNA 3F3VA 4FTNA 5AAGA 3CQEA 2NPQA 4QMMA 3V8WA 2O8YA 1NW1A 5DEWA 1OPJA 1XHAA 2UW5A 3CE3A 3N51A 5IQDA 5K4JA 3AT3A 1LPUA 4KD1A 3R7GA 2VV9A 4MWIA 5HCZA 4EONA 4QTEA 3D7TA 3TKIA 3DU8A 3HV5A 5HX6A 5AM6A 4O96A 2UW7A 4APCA 3SKCA 5BQ0A 1PXKA 4QMQA 4A4LA 5BNJA 2RG5A 1UVRA 3RAHA 3FZTA 3HX4A 3NMUF 4FIHA 3FMLA 5D9HA 2YLFA 3Q9WA 4QMPA 4I92A 3DAJA 3VHKA 5JN2A 2WTIA 4CRLA 4EZ7A 4NUSA 2RF9A 5EQPA 4D1ZA 3ZO1A 2PMIA 2EXEA 4RVTA 4CKJA 3BPRA 5IUHA 3CCNA 3RPSA 4EH2A 3PY3A 3HECA 2R0IA 3DNEA 4K2RA 4LI5A 4BICA 3FHRA 4EH7A 4X3FA 3FLQA 4D4VA 4ZLZA 3MJ1A 5DMZA 4IM3A 2QG7A 4PL5A 4DTKA 4FT9A 2ITXA 3NAXA 3R63A 3ULZA 3DAEA 1U4DA 4EK6A 4ZTRA 3GFEA 2NP8A 4KINA 3QRUA 3QQGA 4FVRA 4GW8A 4HCVA 4YJTA 3FZOA 3TG1A 3RKBA 3VF8A 2JAVA 3MY0A 4DEBA 4TYIA 3LFNA 3COIA 2XNPA 3FZSA 2YCRA 4TKSA 3UQFA 4F9AA 5CEPA 2O3PA 4XJ0A 4MHAA 3TUCA 3UC4A 2OF2A 2VNWA 4BF2A 2YZAA 2EB3A 3PG1A 1SZMA 3WILA 3AD4A 3IG7A 1KWPA 1KV1A 4EK5A 4FV2A 5IF1A 2HIWA 4QNYA 3SGCA 3MA3A 4UV0A 3UMXA 4RVMA 3M42A 2Q83A 4IWQA 5JGDA 2C6OA 4YJUA 1M17A 5HIEA 1W84A 2HY81 3QQJA 5M07A 2OO8X 2JDRA 2VWWA 4DYMA 4EOKA 2GNIA 4F9CA 4G3EA 1R0EA 4IX6A 4L46A 4LGGA 3KU2A 4ITJA 2HENA 2GQGA 2VWYA 4HOKA 4FNXA 4MF1A 3QUPA 1OUYA 5CNNA 1CKPA 4GMYA 2OIQA 2PVJA 5BMMA 4DCEA 2XK7A 4PDSA 2XB7A 4II5A 5CZIA 2VTQA 4IDTA 2C1BA 5GZAA 4RC4A 3I7CA 1FBNA 1FGIA 4YPSA 5CEMA 4USEA 5AR7A 3GCUA 4GT3A 2I40A 2WTCA 2WQBA 3NVMB 3ZOSA 3KXHA 2HAKA 4FOCA 3A2CA 2UW4A 3PSCA 3SVVA 4HW7A 3VS4A 3NRMA 1DAYA 3E63A 2RG6A 4YC3A 1M2RA 5EFQA 4M3QA 4D2SA 4DH5A 4CQEA 4EH4A 2BIYA 3PPKA 3QCXA 1PMVA 5HOAA 2VO7A 4E1ZA 1RJBA 3KULB 4HCTA 4JQEA 5DEYA 4EOQA 3R0TA 4L3LA 4X6QC 3WZDA 1YW2A 5E8VA 4X3JA 5E8YA 3EQGA 3LW0A 3QYWA 4YTIA 2UZLA 3C13A 1M2PA 4O1PA 3S2PA 3V5QA 4L7FA 1YWNA 4TWOA 2YAKA 3UJGA 4I23A 3ZM4A 4A4XA 5BX0A 1XBAA 3MH1A 3DBCA 2WELA 3ZRLA 4Y5HA 1OECA 4FKVA 1U59A 4FYOA 4FTOA 5TR6A 3VS1A 3VS3A 4PWNA 5KNJA 4FV4A 4I22A 2JBPA 4ASDA 2Y9QA 3E93A 3FKNA 2VX0A 2W99B 4DTBA 2HCKA 3BU5A 4D55A 1QPCA 3MFRA 1PKGA 1YXTA 5LMAA 5AUXA 3EN5A 3R7IA 5KCVA 4XV2A 4ITHA 4XP0A 1I44A 1KUTA 3VBTA 1ZRZA 3DTCA 3ORMA 4FL2A 1M52A 2GTMA 4H58A 4XG9A 4FTLA 1ZYJA 3EYHA 2F57A 3FDNA 2XYUA 4I0RA 4ERWA 2Z7LA 3HMOA 3E8DA 3ENHA 4GVJA 2QO2A 2UVZA 2RL5A 3W33A 3KKVA 3QGYA 1GZ8A 2VX1A 4EZ5A 2C6KA 1Q99A 4CMUA 3ZRKA 4EH3A 1YKRA 2YM6A 2VTPA 3PXQA 4I94A 2GNHA 5D7AA 5GIPE 4F70A 4J53A 1CDKA 3R7UA 2PK9A 3ORZA 2W5HA 3OY3A 3EWHA 5CQWA 3REPA 3UODA 4DFZE 4QYHA 3FXZA 3H4JA 3E7VA 3R9HA 2C3LA 3ORNA 1EH4A 4DEAA 3R2BA 1XH6A 2YITA 4A9YA 2JIIA 1GZKA 4YZCA 3Q9ZA 4EK8A 3VF9A 4YURA 4KWPA 2VWVA 4ZZNA 3LJ2A 3QHRA 3DAKA 3IW5A 4QMWA 3HYHA 4NWMA 3HEGA 4Z7HA 2OZAA 1K9AA 2VTRA 3EIDA 5E7RA 5J9YA 4E73A 2GQRA 3O8TA 1DM2A 3NEWA 3RGFA 5K0XA 5C27A 4S2ZA 5JKGA 3F7WA 4DT9A 4XLIA 4O1OA 4YZDA 1SM2A 4GG5A 5A3XA 4E8AA 4WT6A 4U3YA 4LGDA 4BBMA 4F99A 1YQJA 2X4FA 3GU4A 5EI6A 5H8GA 2VGOA 3TNWA 1XBCA 3GP0A 3IDBA 2GFCA 3K2LA 4JAIA 3GOKA 4K77A 3UO4A 3KY2A 4A9SA 4FV0A 4ERKA 2YM8A 4NH1A 2PL0A 4LV5A 5IQGA 1ZY4A 4I5CA 2CN5A 2O64A 4JAJA 4M15A 4PTCA 3PXZA 2RFSA 3LE6A 5CEIA 3R8ZA 4M66A 5DLSA 3RPRA 3ZH8A 2JKMA 4HYHA 3QRTA 3QQKA 4EKKA 4DITA 5LMKC 3KREA 2I0EA 4I6BA 4O0XA 3QQHA 5CY3A 3VW6A 1TQIA 5FTQA 4IX4A 2JDSA 4NCTC 2XBAA 3ANRA 5EOBA 4RWJA 4EOPA 2JKKA 5IA1A 4FV8A 5BMSA 4QOXA 5AP0A 4GT5A 2IJMA 4XLVA 4QMOA 5HVYA 5CEQA 2YHVA 4FF8A 4BDGA 1NVQA 4TY1A 4ACMA 4WRSA 3UNZA 1XBBA 3VBWA 3AC5A 4S33A 2YIXA 2XCKA 3TIYA 4J99A 4MBIA 4APPA 2BAQA 4NW5A 4WNPA 5J9ZA 4USFA 5FBOA 3II5A 3AC8A 4I6QA 4G6LA 3HVCA 3KC3A 4ZJIA 3SC1A 2BPMA 4HYUA 1URWA 4ZSJA 3WZUA 2WNTA 3UIXA 4XEYA 4U3ZA 4E5WA 3WF6A 3MV5A 4O2ZA 5D7VA 2QD9A 3E3BX 5IA2A 3BGPA 4AP7A 1OL2A 3BELA 4B8LA 2OJFE 2W0JA 5HTIA 3LFBA 4BZOA 3HRCA 1CMKE 4BDKA 3FLWA 3TZ8A 2JIVA 3BZ3A 4DTAA 2X8IA 3UOJA 4S31A 5AA8A 1GJOA 4N6YA 2BRGA 3UVPA 2OZOA 3IOKA 3GU7A 2BIKB 3QXPA 3AMAA 4FSWA 4BCPA 4YZBA 2QI8A 2BZKB 3F2NA 4R5YA 2O65A 3PA5A 2XMYA 3VAPA 1QPJA 4C62A 5HG8A 4LOPA 4CGAA 5DIAA 3MIYA 1U5RA 2JGZA 3VBXA 3HDNA 3ZFMA 4FTMA 4YJQA 3TUDA 2UZVA 2GNFA 3VQUA 3NUYA 1CTPE 4PTEA 2OI4X 4TYJA 4WSQA 1W8CA 4AGWA 3RPOA 4RIOA 2V5QA 3L8VA 4FV6A 3FQSA 3NPCA 4TNBA 2VWUA 5CAVA 3D0EA 2W1FA 5KZIA 3TDVA 3BEAA 2X4ZA 2R3QA 4FG9A 3NVKI 2XA4A 5DE2A 3BBTB 2YCQA 2WTVA 3FJQE 1PYEA 4FOBA 3VS0A 3A8XA 5BUIA 3LAUA 4EWHA 5L8KA 3OP5A 4QMYA 4JBOA 5A6NA 2X6DA 4GU6A 4OUCA 3HAMA 2ITTA 2CDZA 4EKLA 5M09A 3EYGA 3MJ2A 3BHVA 2VWZA 1SYKA 2GU8A 3ALOA 3CPCA 4FT0A 3K3JA 4QQTA 2FUMA 2UUEA 3LCDA 4MXXA 4LRKA 4U7ZA 4JRNA 2QLUA 1M7NA 2UW3A 2XYNA 4ANMA 5B7VA 3FI2A 2VWBA 2O5KA 3UZPA 4ZSEA 2Z7QA 1WVXA 5I9UA 5JZNA 3R7YA 4EBWA 3FXWA 5H9BA 2VGPA 4P5QA 5GJFA 3CP9A 4RJ5A 4CMTA 2VTHA 3MPAA 2XNEA 2JFMA 3SXSA 3QCYA 2WQOA 1YDSE 4O0VA 3RWQA 3OY1A 4FE2A 4HYSA 4IZYA 4WG3A 2UW9A 2R64A 4BCKA 5C4LA 5C8MA 4F1TA 4XOYA 3D15A 3KCKA 5AA9A 4FG7A 1SVHA 3CQWA 3QCSA 3PDTA 5FUTA 5CU2A 3EQFA 4RG0A 4I5HA 2QHMA 4C3PA 4F0IA 4G3DA 3GCPA 1YOMA 4E3CA 3HZTA 5LMKA 2B53A 2R3HA 4NFMA 5JRQA 3NLBA 4Y72A 3PJ3A 4IWDA 4LMUA 5LVNA 3ZU7A 4AWIA 2GNLA 4RA4A 4NCTA 5KBRA 4YSJA 4MVFA 3NAYA 3HKOA 4K11A 4FYNA 3CGFA 3LJ1A 4R3RA 4O38A 5EW8A 4O7VA 3Q5ZA 4HGTA 4MX9A 4PMTA 4PDYA 5I9VA 5HCXA 1J91A 5D11A 3LXNA 4FTKA 3ODYX 2YJSA 1Q41A 3AXWA 5AR3A 4KUJA 2H6DA 2V55A 3V6RA 4YLJA 2F2CB 4JI9A 5LVOA 3P1AA 3Q4TA 2BRNA 4FC0A 4FBXA 3UIUA 3N9XA 1PXNA 2PY3A 3EJ1A 4RJ6A 4FSMA 4K1BA 4KS7A 4QD6A 4XV1A 3K3IA 5IEVA 3HP2A 3OROA 3R9DA 4C4EA 3HMPA 4JQ8A 4EHGA 5JH6A 2W1GA 2QU5A 2GCDA 3RK5A 4EOIA 2OJGA 1YDTE 4ITIA 5HNGA 4UYNA 4BZNA 5EQEA 4CFUA 4L53A 3DKGA 4MBJA 4AFJA 3QLFA 3UYSA 3CTHA 2OXDA 3EFJA 4TYHB 2J9MA 2UW8A 4DEEA 4E5BA 3G15A 3U9CA 3FMHA 3TJDA 5FXQA 3F61A 2JDTA 4FL1A 3W8QA 2G2IA 4WD5A 3UG1A 3BHHA 4HGEA 2OW3A 4BCNA 3K5VA 3P78A 2R3NA 1BI8A 5ANOA 5HE3A 4YO4A 3EN6A 4R5SA 3SLSA 4O7RA 2QURA 1NVRA 2VRXA 3GBZA 3I6UA 4Q5HA 4QPMA 3QTIA 4UEUA 4WG4A 2BKZA 3WOWA 1YWRA 2C3IB 3OC1A 2C3JA 1YXVA 3EQPA 3VULA 1WCCA 2QO7A 5JQ8A 3GC8A 5AUZA 5CAQA 5T6KA 4UB7A 4YLLA 4L7SA 2BMCA 2C6EA 3DNDA 2XS0A 3CY2A 4YTHA 4C0TA 2C4GA 4FEQA 3SAYA 2B1PA 2QOBA 2VTLA 4RLLA 4O6LA 3ROCA 3SDJA 3ALNA 5IQHA 3IPHA 5DT3A 3VHEA 5L3AA 3UYTA 5AUWA 3ZZWA 4UMRA 3E92A 5K4IA 3G9NA 3AOXA 2CKQA 4F9WA 3OW3A 3ACKA 2Y4IB 4EH5A 3FLSA 4AFEA 3OXTA 5CX9A 4CZTA 4U44A 3ACJA 2UZWE 3R01A 4PDPA 1MRUA 2YCFA 3ZSGA 4BIBA 2Q0NA 2XIXA 5TT7A 4NEUA 4MXCA 4QTCA 3KXGA 5J87A 3SOAA 5HO6A 3PXKA 5D12A 2XNGA 1S9JA 3F9NA 2E2BA 4CSVA 5KE0A 3FKOA 3LFCA 4XCUA 3RI1A 2J51A 4FKPA 2XEZA 2NRYA 5HI2A 1Q8UA 2ZDTA 5CF4A 1KOBA 1TVOA 2CPKE 2J5EA 4ZTSA 1NY3A 2B9IA 3ORPA 1KSWA 5F20A 3RPYA 5DBXA 5FG8A 1YVJA 4FK3A 3GVUA 4E6DA 5IH4A 2ZVAA 2YIRA 1J3HA 4AE9A 3NS9A 4JBQA 4O7NA 3IQ7A 3RAKA 4UMUA 3VIDA 1H1PA 5K5XA 5IQEA 1Z9XA 2XJ0A 4AACA 2QNJA 3COHA 3M2WA 3DBEA 5TOZA 2H96A 4AOJA 5L8JA 4R78A 3ZO4A 5G6VA 1V0PA 3ZLYA 4B0GA 4P7EA 4OTWA 3AT4A 4ZP5A 2WMVA 3OUKA 3P7BA 4LFIA 4O6EA 4HPTE 3EQHA 2QOCA 3VC4A 2C68A 3DB8A 3PRFA 3OEFX 3VUHA 2ONLC 3E3PA 4YZNA 4FSRA 3V5JA 4YJNA 4F7LA 4MQ2A 5HLWA 4PPBA 2PVFA 1Q8TA 4DC2A 5AR4A 3EL7A 5HLPA 3FMMA 4FKRA 4EHZA 4HNIA 4KKEA 1WBSA 4OGRA 1OL7A 4C34A 4WIHA 3FI4A 2R3PA 3NNVA 2CNVA 4V0GB 3DBFA 3QRIA 1GZOA 4RWIA 3RJCA 4CVAA 2R3IA 4RIXA 4R7IA 4RMZA 3BE2A 1YDRE 4FIFA 2A1AB 1U46A 5FDXA 4DGNA 3F5XA 5HO7A 4RIYA 4ZMEA 4M8TA 4X2NA 4JS8A 3ZDUA 5BYLA 3MH3A 5AJQA 2BROA 5E8TA 5EOLA 2F49A 3FSFA 4O0YA 5FXRA 2FSOX 4UZDA 2ZDUA 4CKIA 2WQEA 1PF8A 3FY2A 3JVSA 3MBLA 2C5OA 4RVLA 3EZRA 2B9JA 3OWPA 5EM6A 4OBOA 3VWAA 1YI4A 4FZAB 3FZRA 2DUVA 5FEQA 2YDKA 2V62A 3W2CA 3GQLA 3HP5A 3KRJA 3GCSA 4RZWA 4ZK5A 4CYJA 2NRUA 3VS6A 3L1SA 4FTRA 1TQMA 5A4TA 3OT3A 4I41A 1BMKA 1E1XA 2PZIA 2YA9A 3LOKA 5DFPA 3WZJA 5FEEA 3QA8A 3PVUA 2ETKA 5J5TA 4JX3A 4TYEA 1XH7A 4F7SA 4FKQA 3R1YA 4JVGA 4X2KA 2G2FA 5EYCA 3F7ZA 2IZUA 3I60A 3LQ8A 3L9PA 5B2LA 4FV3A 4ENYA 5L4QA 3OXZA 4BCHA 3HAVA 2OH4A 3RK9A 3ZUUA 1OB3A 4Y85A 4F9BA 3JUHA 1O6YA 4A07A 4DG2E 4ENXA 3VS7A 1UU9A 2ZJWA 2IW6A 4F09A 5KO1A 1XQZA 5KMOA 2QOKA 3DBDA 3G5DA 1REJA 5EW9A 5HD7A 3FI3A 4I3ZA 4CV8A 4DGMA 2C30A 4IVCA 5L2TA 4DEHA 4CKRA 1ZOGA 3LPBA 3RALA 3R73A 2YABA 3GGFA 2PVRA 4BHNA 4BN1A 4O7LA 1I09A 3L8SA 5FEDA 3TL8A 2B7AA 4QTBA 3AMYA 3O51A 5LARA 5IQAA 5GZ9A 4DCAA 3FYJX 3OW4A 2QOHA 4GKIA 3BYMA 3V51A 4I0SA 4RX9A 3V5PA 4AT3A 4MXAA 4KKGA 1U54B 3EHAA 4I1ZA 4H3PA 5HVJA 1UU3A 1M7QA 4TZRA 3M11A 3NDMA 4FSQA 1L8TA 3WARA 4GFMA 5GJDA 3GC0A 3SOCA 4D0XA 4CCUA 2YM7A 3PE1A 3IECA 3DGKA 3UOLA 1JOWB 4ACHA 4S30A 5M4CA 3D7ZA 1SMHA 4NM0A 3N4TA 2CKOA 4H1JA 4C4FA 4RVKA 1Q24A 3F5GA 3KN5A 4PF4A 4CYIA 3QKKA 5EG3A 4WNMA 3W16A 2BFYA 4IFGA 4J8MA 3V3VA 5EW3A 2PUPA 3RP9A 4YUQA 2C5YA 4IAKA 1IA8A 2HZIA 1QL6A 3QLGA 5CLPA 3Q2MA 4AU8A 1YI6A 1Y6BA 4Q5EA 4BDAA 2PE0A 3THBA 5ITAA 1UKIA 2ONLA 4YBJA 3JYAA 1RW8A 4UALA 3DV3A 4FKJA 4IVBA 3SD0A 3ULIA 3U6IA 3ATTA 2ITQA 4ZOGA 3FBVA 4ZTQA 3Q96A 2XVDA 4IADA 4MNEB 3W2SA 4FT3A 1KE9A 3WZKA 4BKJA 1P2AA 4FKUA 4XX9A 2RFNA 4W4YA 3IO7A 4YO6A 3P7AA 3PJ8A 2XKEA 4G31A 4G5PA 4NIFA 3VUGA 3F2RA 5CU6A 4DFBA 2Y7JA 3OWJA 3BQCA 2FO0A 2I0VA 3QUEA 4E4XA 1V0BA 3KRLA 2SRCA 3QKLA 2GTNA 3BGQA 3LFEA 4ZZOA 4IFCA 3DZQA 4DLJA 5C03A 4EOJA 2PE1A 3KMUA 2C5VA 3Q2JA 4RGJA 3NUSA 4L01A 4Z9LA 2R3GA 2ETRA 2W9ZB 4O0TA 4R1YA 4RJ7A 4UMPA 1NT2A 2J0KA 5E91A 5GINE 3OOMA 3QKMA 2X9EA 3HV7A 2X7GA 2YM3A 3OF0A 4FSYA 3I6WA 1WBPA 2F7XE 2OBJA 3D4QA 3MVLA 4GKHA 1KE5A 4NW6A 3COMA 4KIOA 4ANSA 3FMJA 4OBQA 3BWJA 3R02A 1QMZA 5AFVA 3G0EA 1OI9A 3BU6A 3ITZA 3QTSA 3SRVA 4GK3A 3ZFXA 2ZM4A 4F4PA 2WHBA 4M0YA 3MVHA 3W1FA 1OITA 1LUFA 4OBPA 4BY9E 2CKEA 3AQVA 3BX5A 2XIZA 3KF7A 3VUDA 3A60A 1JSTA 1U5QA 1URCA 2CN8A 4R7HA 1LR4A 2E9OA 3GEQA 4ZIMA 5EYDA 3Q5IA 4C4JA 4QP3A 5AV0A 2HK5A 2Q0BA 5DI1A 3DKCA 3H9FA 5EM7A 1OIRA 4RC2A 4A7CA 5CQUA 3UBDA 5B0XA 2OG8A 4EHEA 3MH2A 1VZOA 2PVMA 3R8LA 2BTRA 5CANA 4FVPA 4CTBA 5CAOA 4I0TA 2YM4A 5AR5A 5BVEA 2UZNA 5CTPA 4AUAA 5AV1A 3EQIA 3SX9A 4E93A 1H1RA 2XKCA 3MVJA 5HG7A 3RPVA 4G6OA 4IWPA 1H1SA 4D2WA 1F5QA 5JEBA 3VBQA 1XH5A 4NL0A 3R30A 2P0CA 5T3QA 3Q4CA 1RQQA 3LMGA 1W83A 3LFAA 4TYGA 2GS6A 3D5UA 3E64A 5AIKA 5CF6A 5IEYA 4U9AA 3H0ZA 4YC6A 2WTKC 2YJRA 2VWIA 3Q4UA 1FVTA 3N4UA 4ZTNA 5KKRB 1MP8A 4I6FA 2RKUA 4MEDA 4RWLA 4W8EA 3GQIA 3KVWA 3RAWA 3NIZA 4D2RA 1JKSA 4FR4A 2EVAA 2PVNA 3DFCB 5IH5A 3C4ZA 3F5UA 2VTIA 3LKMA 3FL4A 3BHTA 5E1EA 1XH9A 3QWJA 2XUUA 4KB8A 1GNGA 4R1VA 5HKMA 4N70A 3BIZA 2VTSA 2ETMA 3DZOA 4JDHA 1JKLA 5AP7A 2W5AA 2GS7A 3QZHA 4AN2A 4IAFA 4AE6A 1H1QA 4L43A 4L00A 3DJ5A 3FUPA 4J52A 4PDOA 5JSMA 5AV3A 2DWBA 2QLQA 1UNLA 5A46A 1J7UA 4JLCA 3BCEA 3QC9A 4GYGA 4KIKB 5TO8A 4WO5A 4RQKA 4XBRA 5C26A 3ZLXA 2WIPA 3R71A 1RDQE 4H39A 2CHLA 3I5NA 1ZYSA 4FA2A 5L6OA 4QQ5A 5KMMA 1OGUA 3KRWA 4AW5A 1AQ1A 3UGCA 3P0MA 3CTJA 4FV7A 4UWCA 5E1SA 4IVDA 3CQUA 2QOOA 2QR7A 4OTPA 2PUNA 4QTDA 1FVRA 5A4QA 4XG7A 2WAJA 5T68A 3R1QA 4LRMA 1H4LA 3QAME 4QYFA 1IEPA 5AMNA 4GL9A 3FLZA 2QOLA 3TNPC 3E7OA 4FKIA 4DEGA 3QYZA 4X2GA 1IRKA 2XZSA 5FLFA 2XKFA 2G01A 2JIUA 2X1NA 4FI1A 5FD2A 3V6SA 3NUXA 4C57A 3RMFA 3EKNA 4J1RA 4RC3A 4D1SA 3C0IA 4MXOA 1A48A 2XH5A 4AGUA 4FTJA 1SNUA 4UWYA 2G9XA 4J98A 2VUWA 2Z7RA 3O71A 3RCDA 4HGLA 3IW4A 3E8EA 4W4XA 3CBLA 2C0TA 5LVMA 4KSPA 4YZ9A 4MD9E 4ALUA 5IPJA 3FXXA 5HVKA 2CSNA 3C4FA 4KIPA 4TXCA 1JWHA 4YJRA 5IQCA 3ETAA 5HO8A 3D14A 1Q3DA 3Q6WA 4GEOA 2WMWA 3DDPA 3PZEA 4EORA 4PRJA 3RNIA 4CFWA 3HDMA 4FUYA 3IDPA 4BI2A 4FTUA 4E6CA 4AGCA 5CVGA 2A19B 2WXVA 5GZ8A 3BBWA 4DINA 3PLSA 4MH7A 4WRGA 5M56A 3ID6C 2XIYA 4GT4A 2W4JA 2X2KA 4R3PA 5FXSA 2CLXA 3OTVA 3VUIA 4R7BA 5DR9A 3D7TB 3LCSA 4G5JA 4J7BA 1OBGA 1JKKA 1YXUA 4L52A 5LCKA 4AX8A 1J7IA 1UU7A 3TNQB 1KOAA 4FTIA 4Y73A 3TM0A 4OR5A 4G9CA 4XV9A 3JS2A 3ZUVA 5I3OA 3L9LA 4NM7A 3V8SA 2GHGA 2J7TA 3VBYA 4J8NA 4WBOA 4AT5A 2WIHA 2V7OA 3AC1A 3DKFA 4TTHB 3LLAA 5CI7A 3NCGA 3TKUA 5AP2A 2JEDA 5IDPA 4X2FA 4X3FB 1XH8A 3ZS5A 1PMEA 3A7IA 2GMXA 2WTJA 3KVXA 3BV3A 3E8NA 4U79A 4XP2A 2PHKA 3SG9A 3GU5A 4ZS0A 2C3KA 4C3FA 4CT1A 2QOQA 3R22A 2ZV9A 4U97A 3P9JA 1H26A 2DQ7X 4YJOA 5AM7A 3I0QA 4DEDA 3JR1A 2X7FA 4ZAUA 4FTCA 2C6LA 3PZHA 5CSWA 4CFNA 3BU3A 2YCSA 3RHKA 2ERZE 1LEZA 4AG8A 5ANJA 5CT0A 5J7BA 2NNWB 3UOKA 1OKYA 4IM2A 2P2IA 4AN9A 4OTHA 4MYGA 1JQHA 4F08A 1PMUA 3LCKA 4ORKA 2PE2A 4RJ3A 2B4SB 4U41A 5IQIA 2CGVA 3LFFA 3DJ6A 3PTGA 3NCZA 2BFXA 3H0YA 3FWQA 5HU9A 4LL5A 2PMNX 2QHNA 1R78A 2E9NA 2PTKA 4ZSLA 4YP8A 3UP2A 2B9HA 2XCHA 5LQFA 4H1MA 3S00A 1IA9A 4XHKB 4ASZA 3C1XA 3JXWA 4GFOA 2C6DA 3BYSA 4BCOA 1XWSA 4FICA 4MNFA 4RT7A 5E8SA 3W55A 3MIAA 4QT1A 5KBQA 2PWLA 4IBMA 4RX5A 4QO9A 3R7VA 3V01A 4XNEA 4D9UA 1H24A 2WO6A 2X8DA 5D1JA 2ZV2A 3AC4A 4OTDA 4EI4A 3KB7A 4O7ZA 4EUUA 4BBFA 1GIHA 2O2UA 3RWPA 3KRRA 4NM5A 4IW0A 5CXZA 3ZXZA 2PMOX 3CJFA 4FZFB 5AEPA 2JKQA 3MN3A 4C2VA 3LM0A 3UQCA 4FEXA 1V0OA 1ZLTA 1Y91A 2PVHA 3JY9A 3MY1A 2QU6A 4WG5A 3BI6A 3Q3BA 4O91A 4AW1A 3ET7A 3FPQA 3P08A 1QPEA 2R3OA 4AZEA 2OSCA 4IJPA 4H36A 5KHXA 5JRSA 2EU9A 3EN7A 4LV8A 3R00A 4LYNA 4E6AA 3DB6A 2C0IA 1PY5A 2OKRA 3GU8A 4K0YA 3KK8A 3MTLA 5K5NA 1PW2A 4PP7A 2IVSA 2B54A 2QG5A 4I24A 4FTAA 4L9IA 4QYEA 3OXIA 1ZMUA 3POZA 5CXHA 5A4EA 4ZXTA 4XG3A 3U54A 3CIKA 3EFWA 3R8MA 4DLIA 3HA8A 5DT0A 5KMIA 1PXJA 4EC9A 5EQYA 3O0GA 4JR3A 1YWVA 4PX6A 4EH9A 3BLQA 2X9FA 3M1SA 3G6GA 1H00A 3TT0A 5IDNA 2P3GX 3PXYA 2WMQA 5GHVA 2RFEA 4YJVA 2OJJA 2Z02A 3BE9A 4IANA 3TTJA 5I4NA 1OZ1A 3UDBA 5IA3A 3O50A 3ERKA 3KN6A 4YR8A 4V04A 1JAMA 2VTAA 5AR8A 4ARKA 4L44A 3TJCA 3UO5A 2R3LA 3FC1X 4L68A 4Z55A 1IR3A 3BYUA 5CSVA 1WBWA 3RCJA 3C7QA 2BRBA 2WEVA 3NZ0A 3VW8A 1OKWA 2W9FB 1XO2B 4EJ7A 4M0ZA 4P5ZA 5KMNA 4QNAA 4ZSAA 2J0MB 4ANLA 2J2IB 4EK4A 3MTFA 2XF0A 4FNYA 3TZ9A 4E20A 5HGIA 4IC7A 3TZMA 1HCLA 3QQUA 5CF8A 1OL5A 1OPKA 4MWHA 2OJIA 3F6XA 1G8SA 1Y8GA 4UXQA 4BCJA 4DBNA 3PP0A 2XM9A 5K3YA 2HYYA 1G3NA 2IN6A 3E88A 3K54A 2OGVA 2FYSA 3MB7A 4QMXA 4V05A 4KBKA 5BVOA 3L9NA 1OM1A 4ZMFA 5CALA 5HE1A 3MSSA 4EHVA 2X81A 3KFAA 3OCGA 4QP7A 1VJYA 4TT7A 4C33A 5FTOA 4F1MA 4E4LA 3D2IA 5AP5A 5DHJA 3HV6A 4FGRA 4BTKA 2W7XA 4CG8A 4FL3A 1Z57A 4YJSA 5DR2A 1H28A 4D4RA 4C37A 2OZAB 3F69A 4QMVA 4QMLA 4OTQA 5IU2A 5AIRA 1YI3A 1PHKA 5HZNA 2PSQA 4M69A 1E1VA 1ZAOA 4CG9A 2ZM1A 4EH6A 3TUBA 2XM8A 4EYJA 1STCE 2QO9A 4UX9A 5EDQA 1Q4LA 3PIYA 1LP4A 2WMRA 4FV1A 4NFNA 4PP9A 4FKGA 4FKWA 4FT7A 1IAJA 3TTIA 1UNGA 2E9VA 5AUYA 3HUCA 3QZGA 3QALE 4JL9A 3ENMA 4IHPA 5DWRA 2HXQA 2YERA 2AUHA 4ZY5A 5E9EA 1ND4A 3NYVA 2WMTA 1NA7A 3T3VA 2PZ5A 1FPUA 3A7HA 2HWPA 2H8HA 3UIBA 4GJ2A 4B9DA 4BTJA 4FZ6A 3FZ1A 3F3WA 4C2WA 3Q6UA 1S9IA 3IGOA 3C0GA 4O0SA 3PUPA 4CNHA 5LCJA 4GIHA 2ZB1A 2YISA 3DK3A 5F94A 4H3BA 4L3JA 3FE3A 4HVIA 2IG7A 2XIRA 4QP9A 3WF7A 4HNFA 5CSXA 4CQGA 5LWNA 4HPUE 2W1CA 3LLTA 4MCVA 4BVUA 1R39A 3OD6X 3A4PA 4JT3A 5JGBA 5IEXA 5KMJA 4U80A 2YM5A 2A2AA 3QA0A 2BDWA 4CTCA 3PSDA 2WU6A 4XRLA 3ZEWA 3QZFA 2PPQA 1PXMA 5EM8A 5BPYA 3DQWA 2W4OA 3KK9A 5ANEA 5E90A 1MRVA 2PMLX 1BYGA 4L42A 2GSFA 1UNHA 3W8LA 2OICA 1JVPP 4QP4A 4JDJA 5CNOA 2J4ZA 5E8ZA 5HHWA 3WF8A 4BFMA 4BI1A 4BIDA 1OL1A 4WNKA 5AX9A 5KZ0A 2YIQA 4BIEA 2VX3A 3FY0A 3W10A 3R1SA 2FSLX 1JNKA 4IEBA 4JDKA 5DPVA 1UV5A 4KA3A 4KABA 1JSVA 3RHXA 1ZOEA 1M2QA 4A9TA 4XG4A 5IUGA 1OBDA 3ZO2A 5ANIA 3AC3A 4F64A 3E8CA 4DFNA 3HNGA 5DR6A 1BI7A 3C0HA 2BZHB 4XRJA 4U42A 2PZPA 4YNEA 4YBKA 2X2LA 4O0RA 2Z60A 3R21A 5H8EA 3K5UA 1ZMVA 4FSZA 3TV7A 3ZONA 4XG8A 3WI6A 4BDFA 1LEWA 5A6OA 4WUAA 2YDJA 4QYGA 5JFVA 3H9RA 3Q52A 4TRLA 2V22A 3IS5A 1KE7A 3TKHA 4B4LA 4IQ6A 2ZMCA 5ETIA 2C5XA 3QD0A 3ZC5A 4ZSGA 3P5KA 3ZM9A 2REIA 3BYOA 5M51A 3LMHA 4RA5A 3MPMA 2J6MA 3VJNA 4AZVA 2IZTA 1B38A 5CAUA 3EB0A 2W17A 5BVDA 2PVYA 5JFWA 3QXOA 4WUNA 5KMLA 4BDCA 3G33A 2X39A 3GFWA 4IXPA 4OT5A 3W2PA 3P79A 4XBUA 3KXNA 4R77A 5JGAA 4PUZA 5CU4A 1DI9A 3B2TA 3W18A 1FOTA 2HZ0A 3CY3A 5BUEA 2ZB0A 5HBHA 2OFUA 3TACA 3MI9A 1DAWA 3FMNA 1P4OA 4KBAA 4ACGA 2OK1A 4G1WA 2BZIB 4D58A 4L6QA 2C6TA 4MK0A 1PXPA 4PPAA 2P55A 2G15A 3MB6A 3PVWA 1H0VA 4CD0A 3KRXA 4U40A 2BCJA 4GVAA 4ANNA 4Z16A 4H3QA 2A4LA 1O9UA 5IH6A 4BB4A 1OIQA 4J95A 4NKSA 1OIUA 4G6NA 3EN9A 2HWOA 3G2FA 5FM2A 5JQ5A 4W8DA 4FKLA 4FVQA 5GNKA 3KL8A 2E9PA 3OUNB 3OBGA 1FVVA 3F3UA 3ORKA 1CKJA 2VO3A 4ZJVA 3FLNC 3O8UA 3QTUA 1ZMWA 1Q5KA 4XYFA 2PULA 1P4FA 4IH8A 3UPXA 3QGWA 5M44A 3RK7A 2YEXA 3R1NA 4G9RA 1W0XC 2IO6A 3COKA 2VZ6A 3Q60A 3EFKA 4RSSA 4U6RA 1OKVA 3DLSA 3FAAA 4TW9A 4M12A 4UBAA 3O7LD 5L2WA 3R9OA 1FMKA 4KIQA 3MY5A 2W06A 2ITVA 2JDVA 2B55A 4DGLC 4OAUC 5AP6A 5M08A 3OCSA 4UXLA 4V01A 1WAKA 1WFCA 2JD5A 5BVKA 2YIWA 5EDRA 4U8ZA 2W1IA 4FIIA 3DDQA 4O84A 3RTPA 2BDFA 3KULA 4P2KA 3LQ5A 4AN3A 5J1VA 5DOSA 5J79A 4GUEA 3KXMA 4FKSA 1VYZA 4IZ5A 1L3RE 2VU3A 2R5TA 4ZY6A 3DKOA 2I6LA 4QP8A 4GJ3A 4M14A 5I0BA 4DEIA 2P33A 4CLIA 2Y0AA 3DA6A 4AXAA 2GDOA 3PVBA 4QPSA 5CSPA 3O8PA 5TF9A 3V04A 5HIBA 2GHMA 2BAJA 1WMKA 3AG9A 3UE4A 3UOHA 4FG8A 3PIXA 5B2MA 1H01A 4C59A 4HVSA 5JK3A 1NXKA 5CU0A 3OWKA 4AA0A 2ESMA 3ZSHA 1WBVA 4F63A 4UZHA 1QPDA 4AOIA 3UMWA 4O83A 3P86A 4AA4A 4BKZA 4EBVA 3FL5A 3W2OA 2BALA 1ZARA 2EB2A 5J8IA 2IZRA 3R9NA 5CVFA 1BUHA 4FT5A 1H0WA 2HZ4A 2BVAA 4QQJA 4AA5A 2EXCX 4AOTA 4WHZA 4N4SA 4WNOA 2JC6A 4RPVA 5ANGA 4KKHA 4ONAA 5JFXA 3T8OA 3OFMA 4D5HA 1K3AA 4KNBA 3ATSA 3QX4A 3V5TA 2ITYA 4ZTHA 1AD5A 5A54A 2VO0A 5HE2A 5JFSA 2W96B 4AS0A 4D4YA 4QRCA 3GC9A 3C9WA 5C9CA 5EKNA 2ERKA 4FTTA 4R8QA 5AUVA 3CKXA 1G5SA 4BDDA 3U6HA 5CI6A 3DOGA 3G0FA 2AC3A 1KE6A 5HESA 3OBJA 4Z3VA 4IWOA 2UVYA 2WZJA 2XRWA 2DYLA 4PY1A 4BCQA 4JX7A 4ALWA 2W1EA 3A4OX 3FMDA 4YMJA 2XK8A 5A9UA 4IAYA 4OTIA 4ZTLA 4YHJA 4MAOA 3S3IA 4C4HA 3NUPA 4BGHA 3LFQA 4TNDA 4FSUA 3FV8A 2NO3A 3BLRA 2VTTA 1WBTA 3PPZA 4YU2A 4OTFA 3JY0A 2IVTA 4GRBA 3L8PA 3KQ7A 3IK3A 2WOTA 3EZVA 3LCTA 2XJ1A 4QPAA 4EJNA 3VO3A 4D4SA 2O0UA 4FIGA 3DXPA 5CENA 5IZFA 3D5VA 5I9ZA 2WMUA 4WA9A 2C6MA 4IAAA 2WTWA 3QCQA 4IDVA 4DFYA 5BUJA 3UZRA 1Q62A 1IASA 3U87A 1PRYA 4LGHA 4X21A 2CGWA 4U43A 2BKKA 5I9YA 3ZFYA 3QU0A 4OT6A 4P4CA 2G2HA 5EYKA 5DRBA 5HIDA 2W1DA 3CPBA 3IKAA 3BRBA 5EI8A 4IZ7A 2C0OA 4G2FA 3ZMMA 3PLAE 2UZDA 2Y4PA 3UPZA 1YXSA 4F0FA 3KXZA 3TZ7A 4EQUA 2GNGA 3TDWA 2IPXA 4NTTA 4LOQA 2ITNA 3MS9A 3UNJA 5JZJA 3KEXA 5H3QA 2O63A 1MRYA 3QFVA 3NNWA 4X6RA 3AMBA 4BTFA 2C5NA 3UO6A 5CF5A 4O27B 3G90X 2I7QA 4JOAA 2PVLA 5AX3A 3WYYA 4QMTA 4BDJA 3ROYA 3EQDA 4R3CA 4UMQA 3MFTA 3HMNA 2W4KA 2JFLA 4BRXA 2WOUA 3OG7A 3P23A 1ZZLA 3QTRA 5ANDA 5FBNC 5A4LA 1YHWA 5AP3A 3OS3A 2UW6A 5EKOA 4G16A 5J7HA 5F4NA 4EUTA 3P4KA 4PQNA 1PXLA 4HYIA 3EL8A 3HV4A 3NR9A 5CS6A 3ZLSA 3A8WA 2KULA 1FMOE 4MBLA 3WIKA 4AZSA 3LZBA 4M97A 4DFLA 5HORA 2IWIA 3E62A 3NUAA 4HVDA 3FKLA 4C61A 1KE8A 3PJ1A 3QTXA 4RIXB 4ZY4A 3GUBA 3R7OA 4RIYB 5AUTA 4YLKA 2YFXA 4F6SA 3DT1A 2BZJA 1OKZA 3FC2A 1GOLA 2HOGA 4BZDA 4IB1A 2UZUE 4C4GA 3QRJA 3R2YA 3G9LX 4GUBA 5ICPA 3KF4A 3I4BA 3ODZX 1XH4A 4ZZMA 4DH8A 2BUJA 4TWPA 2AYPA 2HW6A 2QC6A 4OTGA 4RJ4A 2ZV7A 3DJ7A 4PMPA 2QR8A 5DN3A 1Q8YA 1TKIA 5DVRA 2VAGA 3U51A 4EC8A 2OFVA 1HCKA 2FVDA 3BHYA 4MTAA 4BYIA 1SVGA 1M14A 2R3MA 3HA6A 4KS8A 4QP1A 4PL3A 4QTAA 5DA3A 4HJOA 5AP1A 4C35A 3NX8A 3A62A 4O21A 5E8WA 4B8MA 4PNKA 4W9WA 1MQ4A 2CKPA 3KCFA 4ANOA 4RQVA 5EYMA 4DG3E 3U4UA 4BL1A 3ZTXA 4GH2A 4PPCA 5HCYA 3IGGA 5D41A 4DA5A 1H8FA 5AV2A 4D9TA 3VJOA 4PTGA 4F6WA 4JRVA 3SW7A 1WVYA 4HCUA 3VUKA 2HELA 3GCQA 4TN6A 4F7NA 3F82A 3BLHA 4G3CA 1JLUE 5DG5A 1AGWA 1T46A 4FIJA 4JDIA 2WU7A 3FHIA 5CAPA 3QUDA 4BHZA 5AV4A 4FEWA 5M53A 2FSTX 3UP7A 3O23A 2PU8A 4X0MA 2BILB 1YHVA 3CS9A 3TV6A 3L9MA 2YWPA 2EUFB 2Z8CA 3FMKA 4JG7A 4NTSA 2OIDA 3PJ2A 3NGAA 4RRVA 3O17A 4FODA 4MXZA 5LVPA 4FEVA 4QYYA 1OMWA 2LGCA 2JITA 2GHLA 2WD1A 1ZYDA 4BYJA 2Y4IC 4O0UA 5EK7A 5IQBA 4ZS4A 2W5BA 1K2PA 2R2PA 2J0JA 3ANQA 4I5PA 4N6ZA 4OAVB 4JBVA 2PUUA 3DBQA 3QQFA 4G34A 5JT2A 2C69A 1F3MC 2ZYBA 3R04A 1WBOA 4HZSA 2HXLA 1ATPE 3IONA 2WTDA 3C51A 3PSBA 4EOOA 1DI8A 4XUFA 3ORIA 1GZNA 5FP5A 3LVPA 3PG3A 5AAEA 3IOPA 2R9SA 5AWMA 3C5IA 3CLYA 4C38A 3PRIA 5I3RA 4JNWA 4KRCA 5I9WA 4LRJA 5LWMA 1YXXA 1NVSA 1ZXEA 2R3KA 2BR1A 5TKDA 4CV9A 2P4IA 4EOSA 4S32A 4TL0A 4MF0A 4DAWA 4ACCA 3S0OA 2WMSA 3IDCA 4C7TA 5CASA 5IG1A 4JBPA 3IW7A 4Y46A 4F0GA 3FQHA 3NWWA 3LMIA 4C36A 2P2HA 4GV1A 4BCIA 3PVGA 1Q97A 3PYYA 2KTYA 5C01A 3F88A 2CGXA 5CWZA 4JXFA 4MD8E 4DHFA 1JKTA 2XEYA 3SQQA 4GU9A 3SW4A 1W7HA 2BRMA 4U0IA 2ITWA 3U55A 4K18A 5M06A 3QX2A 1W98A 4Q9SA 4CCBA 4E26A 2XJ2A 4ZLOA 5BVNA 3ORLA 1B6CB 5CEOA 2ACXA 3I81A 1MUOA 3GCVA 4IMYA 1P14A 3R8VA 5L2IA 3AT2A 5C1QB 4NIFB 4PV0A 1YOLA 4B6LA 3PWDA 2GNJA 4QMNA 5HICA 4HVGA 1JBPE 1ZYCA 3QTWA 4K9YA 2HW7A 4CLJA 3OOGA 3PIZA 3Q4ZA 5DGZA 3WE4A 3EH9A 3VN9A 3LQ3A 5GIOE 2OWBA 1UU8A 3KA0A 4D0WA 2XNNA 3OWLA 3UQGA 4M13A 3WF5A 3RZBA 3KGAA 4IAZA 1JPAA 3DFAA 4RX7A 5F9EA 4YGAA 3UVQA 4BR3A 5HE0A 3H9OA 3ZC6A 1BKXA 5IA5A 2B0QA 4FNZA 2WQNA 1H07A 4S34A 5AR2A 3ZDIA 2VTOA 3NUUA 1Q61A 3PXRA 2WPAA 2YACA 4YHTA 4TYHA 4Z7GA 1PXIA 3LJ0A 3ZCLA 2FGIA 3HL7A 3LXKA 3QTQA 1IAHA 4UY9A 3ZXTA 5I9XA 3TNHA 4MKCA 2V7AA 4MD7E 2QONA 2WB8A 3EOCA 3GC7A 5F95A 3FI8A 4RX8A 3UC3A 2JAMA 4LMNA 3LFDA 5HEZA 3SRVB 4F1OA 3EMGA 1FGKA 3Q53A 4ZTMA 3E5AA 2A27A 2XK4A 4X2JA 4WSYA 5HBEA 5EH0A 1GAGA 2A0CX 3NYNA 2XP2A 4AQCA 4FEUA 1BX6A 3MDYA 1H08A 4LUEA 3ZZEA 4FKOA 3DXQA 1APME 1OUKA 2F9GA 4YC8A 3CTQA 5K0KA 3W32A 2WGJA 4KRDA 3TI1A 4A9UA 2WQMA 4RFMA 2UZTA 2B52A 5CEKA 3R8UA 4YNOA 2JBOA 2QODA 2Z2WA 2UW0A 3FZPA 3Q9YA 5M57A 3C4XA 1Y6AA 4EYMA 5IMXA 1FQ1B 3DQXA 3W2RA 5D10A 2VO6A 2OXYA 3QBNA 1X8BA 1H1WA 2VNYA 3GU6A 4W4WA 1Z5MA 4NSTA 2YN8A 3SXRA 5IKWA 3TEIA 3UG2A 3FLYA 4EZ3A 1ZOHA 4GSBA 4CFMA 3NW7A 3FSKA 1Y8YA 3A7GA 3BQRA 3EN4A 4OLIA 4BWXA 3HMIA 2Z7SA 5CYIA 4EOMA 3WYXA 4XOZA 4AZFA 3GT8A 4J96A 3BWFA 4M67A 2F2UA 4F65A 3HRFA 5HTBA 4NKAA 4ALVA 2AC5A 4IAIA 2VTMA 1YOJA 2OU7A 2Y6MA 3T3UA 1VYWA 4NJ3A 4BKYA 4FK6A 4O0WA 3ZO3A 1Q8WA 2PZYA 3BGZA 4XS2A 4PNIA 5CT7A 5FGKA 4QMZA 3HV3A 3LIJA 3O2MA 4D2VA 4L45A 4O2PA 5JMSA 3F3ZA 3S1HA 2XKDA 3TIZA 2J0LA 2VD5A 5K9IA 1V1KA 5GJGA 3TWJA 4USDA 3DK6A 4NYEA 3QD2B 3RVGA 2CGUA 5EI2A 1PXOA 2WFYA 4BDHA 3CXWA 4RFYA 4O82A 4DG0E 4IM0A 3FMEA 2FH9A 3CSVA 2UV2A 3D83A 2YAAA 3EFLA 2ZM3A 3GI3A 5KX8A 2B9FA 2PZRA 1CKIA 1ZYLA 5I5ZA 3POOA 4E6QA 2ZV8A 4L8MA 3PFQA 1KV2A 1Q3WA 4AW0A 4FX3A 3B8RA 4JG8A 3ZEPA 1OIYA 4RWKA 5IQFA 4NM3A 2XNOA 3NYXA 4XP3A 1CSNA 3OCTA 4EQMA 3RM7A 2BDJA 4GIIA 1SVEA 4HZRA 2CMWA 5AAFA 5FP6A 3QHWA 3NNUA 4XV3A 2CLQA 4V0GA 5ANKA 4EQCA 4I20A 3U4WA 5HQ0A 3O7LB 4BCMA 4LQMA 2IW8A 1UA2A 3FPMA 4IACA 4BC6A 5AUUA 1UWHA 5ETCA 2R7IA 3PY0A 3Q9XA 4DH1A 1ZWSA 4JIAA 4CFVA 4FZDB 4O7TA 2X0GA 2XRUA 4BDIA 1OL6A 4FSTA 5AADA 1WBNA 4G3FA 3DS6A 4G17A 1VR2A 2XK3A 3WF9A 2I1MA 3PE2A 2VWXA 4N0SA 2VN9A 3F3TA 5ETFA 4JQ7A 4BWKA 4MXYA 2JLDA 2VTJA 3S4QA 4K33A 3SXFA 4EWQA 2E9UA 2WMXA 4IIRA 3MESA 3V5LA 4NU1A 5HBJA 1CM8A 2QOFA 3R28A 5AP4A 4ANBA 4AZWA 3HUBA 3ZBFA 2OLCA 4TWNA 2W05A 4E4NA 5F1ZA 2I0YA 2R7BA 4KBCA 3WBLA 4ZJJA 3PY1A 4ANQA 4KAOA 4RIWA 3UIMA 3PP1A 4DH3A 4JIKA 4IX3A 3BEGA 4NT4A 4WOVA 3VS5A 3JVRA 2OH0E 1UKHA 4I5MA 2XNBA 3GOPA 3QD3A 4YHFA 3QWKA 5L2QA 1REKA 4PL4A 4JJRA 4O7SA 4DF3A 4TWCA 3KMWA 4DFUA 4OW8A 1J1CA 3C4EA 4IZAA 4D2TA 5E4HA 4AGDA 4BDEA 4HVHA 5BYYA 2YLEA 5KMKA 4CZYB 5EDPA 2Y8OA 1XR1A 2H34A 4ACDA 3OEZA 4IB0A 2DS1A 3O96A 4UYAA 3GENA 4Y5QA 5BVWA 2Y6OA 4E5AX 5H2UA 5LJJA 2H9VA 3TCPA 4D2PA 3PA4A 2JKOA 2OJ9A 1Q8ZA 3OHTA 2WMBA 5BVFA 2IZSA 5HTCA 3R6XA 3ZBXA 3DK7A 1U54A 3AGMA 4O86A 1T45A 1SNXA 4AAAA 2OF4A 2XBJA 3LXLA 2YDIA 4IC8A 4I93A 4I6HA 2QKWB 5L8LA 4AZTA 2RSVA 5KHWA 3MPTA 2WTKB 4TPTA 4C58A 3H3CA 3G6HA 3QRKA 4L67A 4BGQA 3MH0A 2W1HA 2R4BA 5KKRC 4IX5A 4RZVA 4EK3A 3GNIB 4IVAA 4C02A 4C8BA 3NNXA 4P90A 4U45A 5C8KA 4RBLA 5DRDA 3OMVA 4UMTA 3DY7A 4EEVA 2ZAZA 3A61A 2ZMDA 2YZLA 4FIEA 4QQCA 4E7WA 3MYGA 5HG5A 4R6VA 1PYXA 1RE8A 3V8TA 5IA0A 3VUTA 3C50A 3DXNA 5L2SA 4O7WA 2X8EA 3AGLA 3T9TA 2XIKA 4RJ8A 3TV4A 3CGOA 4CFFA 3MVMA
chains in the Genus database with same CATH superfamily
3BHUA 1FINA 4QMSA 5FQDC 5LVLA 3MW1A 2IW9A 4GK2A 3SA0A 3GXLA 3G51A 4AXFA 2I0HA 3RZFA 2C47A 4FGBA 3U8WA 4DT8A 1O6LA 1E9HA 5CU3A 3B2WA 2ITOA 4LM5A 3OTUA 2ITZA 4MNEA 1A9UA 4O4FA 5DNRA 3O5AA 5CSHA 3SG8A 1MQBA 4FJVA 5E8XA 4RLKA 5DYJA 1ZY5A 3F5PA 4U81A 3UVRA 4E4MA 3AC2A 3QC4A 5M4FA 4BGGA 2C6IA 2HZNA 3MWUA 4IB3A 3UTOA 5A14A 4W9XA 3C5UA 4W4VA 2F4JA 4M68A 5L6PA 5LOHA 3UZTA 2BAKA 2QVSE 2X6EA 3A7FA 2EWAA 3HGKA 2LAVA 4AW2A 2J0IA 3D94A 5HG9A 4GG7A 3VQHA 1VEBA 1BL7A 4K8AA 2OIBA 3WE8A 1H25A 1DS5A 5M4UA 4J97A 3RAIA 3A7JA 4GS6A 4Y83A 3RNYA 4FKTA 3ZSIA 4YTCA 4QP2A 3S95A 4D5KA 1OPLA 3H30A 3NUNA 5FWKK 4PMSA 2PVKA 4CMOA 3EQRA 3P7CA 2W1ZA 2FB8A 1GIJA 3CD8A 3HLLA 5G1XA 4J71A 3WIGA 3PA3A 4YPDA 3LFSA 3DPKA 5BYZA 2X2MA 2UZOA 2FA2A 3A99A 3ORTA 4HGSA 4QP6A 4Y95A 1WVWA 3I5ZA 3UNKA 3CEKA 1J7LA 1ERKA 4GCJA 4NZWB 3R7EA 5ACKA 3OZ6A 4GYIA 1P5EA 4LOOA 2IVVA 3TN8A 3ZHPC 5ACBC 4BWPA 3ZYAA 4DGGA 5TE0A 2HY0A 4DN5A 3LM5A 2F7EE 2R3RA 1R3CA 2XK9A 4JR7A 4O22A 4D28A 2BHEA 5E8UA 3OT8A 5FDPA 3FQEA 5DT4A 4BDBA 5IMEA 4EH8A 3R83A 5J95A 1HOWA 3T9IA 4MQ1A 4D1XA 3QD4A 3PJCA 4FZ7A 3Q04A 4FV9A 1PJKA 2CNUA 5H8BA 1WZYA 4N57A 2FSMX 4CXAA 2GPHA 4YJPA 3TNIA 2CCIA 3I0OA 3C4CA 3HRBA 4DFXE 5A4CA 4FUXA 4BTMA 1Y57A 4BBEA 3PPJA 4A06A 3MA6A 4CRSA 1PKDA 3NYOA 3LCOA 3LHJA 4OTRA 4Q2AA 5IUIA 2QQ7A 3NIEA 3DLZA 4L3PA 3ORXA 3GB2A 3QTZA 3V5WA 4DH7A 1OVEA 1G8AA 4H05A 3B8QA 4O7YA 4DBXA 2WKMA 4IE9A 1YRPA 4CZUA 4CFXA 3NW5A 1W82A 4AF3A 1IG1A 2CNQA 4BCGA 3N4VA 4C4IA 4XG2A 3IW8A 4LG4A 3Q32A 4UN0C 3CR0A 4X3FC 4FSNA 5E92A 3OCBA 3FEGA 3VRZA 3H10A 3NSZA 4K6ZA 3EKKA 1ZZ2A 4QMUA 5HU3A 3KMMA 2GFSA 2R3FA 1B39A 2RFDA 4CT2A 2BRHA 1GIIA 5FRIA 5J1WA 2GQSA 4KSQA 4AQKA 1R1WA 4O81A 4IJ9A 2R0UA 3I1AA 4U5JA 5EHYA 5KUPA 2RIOA 3BKBA 4YSMA 3D5XA 3KIOC 1PMNA 4RFZA 3OVVA 1QCFA 3VNTA 5J9LA 4B7TA 2ZOQA 1GY3A 3ELJA 2X7OA 3VVHA 4C3RA 4ASEA 5LMBA 3VRYA 5CZHA 3VUMA 3D5WA 5FTGA 3LXPA 3CC6A 4M84A 4RIWB 5M55A 4F9YA 5FM3A 1H27A 3D2KA 4F7JA 2XK6A 3AD5A 5EM5A 2PYWA 3VS2A 4UWBA 2UVXA 3KXXA 4EOLA 1J1BA 2QOIA 2V0DA 2XNMA 4YZMA 2BHHA 5IA4A 3F66A 5ETAA 4BCFA 2J50A 3F2AA 4M69B 5HX8A 3U6JA 5L6WL 4KIKA 3TYKA 2YIYA 4XG6A 4WBBB 3TXOA 2IVUA 1XMLA 2OXXA 3NW6A 3DTWA 3U9NA 4Y8DA 3SV0A 3WZEA 3W0PA 4DE4A 2QCSA 2EXMA 5HNBA 5IISA 4F6UA 2YWVA 1XKKA 2GS2A 3QF9A 3JPVA 4PMMA 3SHEA 3CD3A 3E87A 4ID7A 3RBWA 3AD6A 3PWYA 4G3GA 3MFUA 3R8PA 1A06A 4XMOA 4ASXA 3HMMA 4IB5A 5HLNA 5EHOA 3VBVA 2C1AA 1R0PA 3W2QA 5J5SA 4NK9A 2J5FA 3CJGA 3QQLA 5B2KA 3I79A 4JG6A 3R9RA 5C4KA 4FV5A 4M7IA 4A4OA 1JSUA 4GFGA 4FNWA 1O6KA 3QL8A 2WMAA 5CVHA 4A9RA 5HD4A 3EQCA 3BV2A 4FMQA 2QKRA 3MGYA 4EL9A 2PUIA 5HNIX 1BL6A 2G1TA 1TQPA 5DH3A 4GK4A 4B99A 2WEIA 4X7QA 4BI0A 5C8NA 2UZEA 2UZBA 2JDOA 3I7BA 5LXMA 4YTFA 3CKWA 4ZEGA 1F0QA 3EQBA 4WKQA 1XJDA 2BTSA 5M4IA 4I21A 4NJDA 4FTQA 2J90A 1BLXA 3ZUTA 4I4FA 5EHLA 4LL0A 3L8XA 4Q9ZA 2CCHA 4I4EA 3FYKX 1YHSA 3DCVA 3D9VA 4LUDA 2CJMA 4ZLYA 1UWJA 3IW6A 4CEGA 3RM6A 2F7ZE 2ITUA 4XH6A 2R3JA 4AT4A 3QZIA 3ZLWA 3MFSA 2RGPA 2ITPA 3C4WA 3ZRMA 3BYVA 3PXFA 3RINA 4DGOA 2VTNA 3F3VA 4FTNA 5AAGA 3CQEA 2NPQA 4QMMA 3V8WA 2O8YA 1NW1A 5DEWA 1OPJA 1XHAA 2UW5A 3CE3A 3N51A 5IQDA 5K4JA 3AT3A 1LPUA 4KD1A 3R7GA 2VV9A 4MWIA 5HCZA 4EONA 4QTEA 3D7TA 3TKIA 3DU8A 3HV5A 5HX6A 5AM6A 4O96A 2UW7A 4APCA 3SKCA 5BQ0A 1PXKA 4QMQA 4A4LA 5BNJA 2RG5A 1UVRA 3RAHA 3FZTA 3HX4A 3NMUF 4FIHA 3FMLA 5D9HA 2YLFA 3Q9WA 4QMPA 4I92A 3DAJA 3VHKA 5JN2A 3VONA 2WTIA 4CRLA 4EZ7A 4NUSA 2RF9A 5EQPA 4D1ZA 3ZO1A 2PMIA 2EXEA 4RVTA 4CKJA 3BPRA 5IUHA 3CCNA 3RPSA 4EH2A 3PY3A 3HECA 2R0IA 3DNEA 4K2RA 4LI5A 4BICA 3FHRA 4EH7A 4X3FA 3FLQA 4D4VA 4ZLZA 3MJ1A 5DMZA 4IM3A 2QG7A 4PL5A 4DTKA 4FT9A 2ITXA 3NAXA 3R63A 3ULZA 3DAEA 1U4DA 4EK6A 4ZTRA 3GFEA 2NP8A 3UDZA 4KINA 3QRUA 3QQGA 4FVRA 4GW8A 4HCVA 4YJTA 3FZOA 3TG1A 3RKBA 3VF8A 2JAVA 3MY0A 4DEBA 4TYIA 3LFNA 3COIA 2XNPA 3FZSA 2YCRA 4TKSA 3UQFA 4F9AA 5CEPA 2O3PA 4XJ0A 4MHAA 3TUCA 3UC4A 2OF2A 2VNWA 4BF2A 2YZAA 2EB3A 3PG1A 1SZMA 3WILA 3AD4A 3IG7A 1KWPA 1KV1A 4EK5A 4FV2A 5IF1A 2HIWA 4QNYA 3SGCA 3MA3A 4UV0A 3UMXA 4RVMA 3M42A 2Q83A 4I6LA 4IWQA 5JGDA 2C6OA 4YJUA 1M17A 5HIEA 1W84A 2HY81 3QQJA 5M07A 2OO8X 2JDRA 2VWWA 4DYMA 4EOKA 2GNIA 4F9CA 4G3EA 1R0EA 4IX6A 4L46A 4LGGA 3KU2A 4ITJA 2HENA 2GQGA 2VWYA 4HOKA 4FNXA 4MF1A 3QUPA 1OUYA 5CNNA 1CKPA 4GMYA 2OIQA 2PVJA 5BMMA 4DCEA 2XK7A 4PDSA 2XB7A 4II5A 5CZIA 2VTQA 4IDTA 2C1BA 5GZAA 4RC4A 3I7CA 4DHZA 1FBNA 1FGIA 4YPSA 5CEMA 4USEA 5AR7A 3GCUA 3BL7A 4GT3A 2I40A 2WTCA 2WQBA 3NVMB 3ZOSA 3KXHA 2HAKA 4FOCA 3A2CA 2UW4A 3PSCA 3SVVA 4HW7A 3VS4A 3NRMA 1DAYA 3E63A 2RG6A 4YC3A 1M2RA 5EFQA 4M3QA 4D2SA 4DH5A 4CQEA 4EH4A 2BIYA 3PPKA 3QCXA 1PMVA 5HOAA 4BJJB 2VO7A 4E1ZA 1RJBA 3KULB 4HCTA 4JQEA 5DEYA 4EOQA 3R0TA 4L3LA 4X6QC 3WZDA 1YW2A 5E8VA 4X3JA 5E8YA 3EQGA 3LW0A 3QYWA 4YTIA 2UZLA 3C13A 1M2PA 4O1PA 3S2PA 3V5QA 4L7FA 1YWNA 4TWOA 2YAKA 3UJGA 4I23A 3ZM4A 4A4XA 4FRFA 5BX0A 1XBAA 3MH1A 3DBCA 2WELA 3ZRLA 4Y5HA 1OECA 4FKVA 1U59A 4FYOA 4FTOA 5TR6A 3VS1A 3VS3A 4PWNA 5KNJA 4FV4A 4I22A 2JBPA 4ASDA 2Y9QA 3E93A 3FKNA 2VX0A 2W99B 4DTBA 2HCKA 3BU5A 4D55A 1QPCA 3MFRA 1PKGA 1YXTA 5LMAA 5AUXA 3EN5A 3R7IA 5KCVA 4XV2A 4ITHA 3W0RA 4XP0A 1I44A 1KUTA 3VBTA 1ZRZA 3DTCA 3ORMA 4FL2A 1M52A 2GTMA 4H58A 4XG9A 4FTLA 1ZYJA 3EYHA 2F57A 3FDNA 2XYUA 4I0RA 4ERWA 2Z7LA 3HMOA 4AXDA 3E8DA 3ENHA 4GVJA 2QO2A 2UVZA 2RL5A 3W33A 3KKVA 3QGYA 1GZ8A 2VX1A 4EZ5A 2C6KA 1Q99A 4CMUA 3ZRKA 4EH3A 1YKRA 2YM6A 2VTPA 3PXQA 4I94A 2GNHA 5D7AA 5GIPE 4F70A 4J53A 1CDKA 3R7UA 2PK9A 3ORZA 2W5HA 3OY3A 3EWHA 5CQWA 3REPA 3UODA 4DFZE 4DHJA 4QYHA 3FXZA 3H4JA 3E7VA 3R9HA 2C3LA 3ORNA 1EH4A 4DEAA 3NFGB 3R2BA 1XH6A 2YITA 4A9YA 2JIIA 1GZKA 4YZCA 3Q9ZA 4EK8A 3VF9A 4YURA 4KWPA 2VWVA 4ZZNA 3LJ2A 3QHRA 3DAKA 3IW5A 4QMWA 3HYHA 4NWMA 3HEGA 4Z7HA 2OZAA 1K9AA 2VTRA 3EIDA 5E7RA 5J9YA 4E73A 2GQRA 3O8TA 1DM2A 3NEWA 3RGFA 5K0XA 5C27A 4S2ZA 5JKGA 3F7WA 4DT9A 4XLIA 4O1OA 4YZDA 1SM2A 4GG5A 5A3XA 4E8AA 4WT6A 4U3YA 4LGDA 4BBMA 4F99A 1YQJA 2X4FA 3GU4A 5EI6A 5H8GA 2VGOA 3TNWA 1XBCA 3GP0A 3IDBA 2GFCA 3K2LA 4JAIA 3GOKA 4K77A 3UO4A 3KY2A 4A9SA 4FV0A 4ERKA 2YM8A 4NH1A 2PL0A 4LV5A 5IQGA 1ZY4A 4I5CA 2CN5A 2O64A 4JAJA 4M15A 4PTCA 3PXZA 2RFSA 3LE6A 5CEIA 3R8ZA 4M66A 5DLSA 3RPRA 3ZH8A 2JKMA 4HYHA 3QRTA 3QQKA 4EKKA 4DITA 5LMKC 3KREA 2I0EA 4O4BB 4I6BA 4O0XA 3QQHA 5CY3A 3VW6A 1TQIA 5FTQA 4IX4A 2JDSA 4NCTC 2XBAA 3ANRA 5EOBA 4RWJA 4EOPA 2JKKA 5IA1A 4FV8A 5BMSA 4QOXA 5AP0A 4GT5A 2IJMA 4XLVA 4QMOA 5HVYA 5CEQA 2YHVA 4FF8A 4BDGA 1NVQA 4TY1A 4ACMA 4WRSA 3UNZA 1XBBA 3VBWA 3AC5A 4S33A 2YIXA 2XCKA 3TIYA 4J99A 4MBIA 4APPA 2BAQA 4NW5A 4WNPA 5J9ZA 4USFA 5FBOA 3II5A 3AC8A 4I6QA 4G6LA 3HVCA 3KC3A 4ZJIA 3SC1A 2BPMA 4HYUA 1URWA 4ZSJA 3WZUA 2WNTA 3UIXA 4XEYA 4U3ZA 4E5WA 3WF6A 3MV5A 4O2ZA 5D7VA 2QD9A 3E3BX 5IA2A 3BGPA 4AP7A 1OL2A 3BELA 4B8LA 2OJFE 2W0JA 5HTIA 3LFBA 4BZOA 3HRCA 1CMKE 4BDKA 3FLWA 3TZ8A 2JIVA 3BZ3A 2XALA 4DTAA 2X8IA 3UOJA 4S31A 5AA8A 1GJOA 4N6YA 2BRGA 3UVPA 2OZOA 3IOKA 3GU7A 2BIKB 3QXPA 3AMAA 4FSWA 4BCPA 4YZBA 2QI8A 2BZKB 3F2NA 4R5YA 2O65A 3PA5A 2XMYA 3VAPA 1QPJA 4C62A 5HG8A 4LOPA 4CGAA 5DIAA 3MIYA 1U5RA 2JGZA 3VBXA 3HDNA 3ZFMA 4FTMA 4YJQA 3TUDA 2UZVA 2GNFA 3VQUA 3NUYA 1CTPE 4PTEA 2OI4X 4TYJA 4WSQA 1W8CA 4AGWA 3RPOA 4RIOA 2V5QA 3L8VA 4FV6A 3FQSA 3NPCA 4TNBA 2VWUA 5CAVA 3D0EA 2W1FA 5KZIA 3TDVA 3BEAA 2X4ZA 2R3QA 4FG9A 3NVKI 2XA4A 5DE2A 3BBTB 2YCQA 2WTVA 3FJQE 1PYEA 4FOBA 3VS0A 3A8XA 5BUIA 3LAUA 4EWHA 5L8KA 3OP5A 4QMYA 4JBOA 5A6NA 2X6DA 4GU6A 4OUCA 3HAMA 2ITTA 2CDZA 4EKLA 5M09A 3EYGA 3MJ2A 3BHVA 2VWZA 1SYKA 2GU8A 3ALOA 3CPCA 4FT0A 3K3JA 4QQTA 2FUMA 2UUEA 3LCDA 4MXXA 4LRKA 4U7ZA 4JRNA 2QLUA 1M7NA 2UW3A 2XYNA 4ANMA 5B7VA 3FI2A 2VWBA 2O5KA 3UZPA 4ZSEA 2Z7QA 1WVXA 5I9UA 5JZNA 3R7YA 4EBWA 3FXWA 5H9BA 2VGPA 4P5QA 5GJFA 3CP9A 4RJ5A 4CMTA 2VTHA 3MPAA 2XNEA 2JFMA 3SXSA 3QCYA 2WQOA 1YDSE 4O0VA 3RWQA 3OY1A 4FE2A 4HYSA 4IZYA 4WG3A 2UW9A 2R64A 4BCKA 5C4LA 5C8MA 4F1TA 4XOYA 3D15A 3KCKA 5AA9A 4FG7A 1SVHA 3CQWA 3QCSA 3PDTA 5FUTA 5CU2A 3EQFA 4RG0A 4I5HA 2QHMA 4C3PA 4F0IA 4G3DA 3GCPA 1YOMA 4E3CA 3HZTA 5LMKA 2B53A 2R3HA 4NFMA 5JRQA 3NLBA 4Y72A 3PJ3A 4IWDA 4LMUA 5LVNA 3ZU7A 4AWIA 2GNLA 4RA4A 4NCTA 5KBRA 4YSJA 4MVFA 3NAYA 3HKOA 3AKLA 4K11A 4FYNA 3CGFA 3LJ1A 4R3RA 4O38A 5EW8A 4O7VA 3Q5ZA 4HGTA 4MX9A 4PMTA 4PDYA 5I9VA 5HCXA 1J91A 5D11A 3LXNA 4FTKA 3ODYX 2YJSA 1Q41A 3AXWA 5AR3A 4KUJA 4F78A 2H6DA 2V55A 3V6RA 4YLJA 2F2CB 4JI9A 5LVOA 3P1AA 3Q4TA 2BRNA 4FC0A 4FBXA 3UIUA 3N9XA 1PXNA 2PY3A 3EJ1A 4RJ6A 4FSMA 4K1BA 4KS7A 4QD6A 4XV1A 3K3IA 5IEVA 3HP2A 3OROA 3R9DA 4C4EA 3HMPA 4JQ8A 4EHGA 5JH6A 2W1GA 2QU5A 2GCDA 3RK5A 4EOIA 2OJGA 1YDTE 4ITIA 5HNGA 4UYNA 4BZNA 5EQEA 4CFUA 4L53A 3DKGA 4MBJA 4AFJA 3QLFA 3UYSA 3CTHA 2OXDA 3EFJA 4TYHB 2J9MA 2UW8A 4DEEA 4E5BA 3G15A 3U9CA 3FMHA 3TJDA 5FXQA 5BV3A 3F61A 2JDTA 4FL1A 3W8QA 2G2IA 4WD5A 3UG1A 3BHHA 4HGEA 2OW3A 4BCNA 3K5VA 3P78A 2R3NA 1BI8A 5ANOA 5HE3A 4YO4A 3EN6A 4R5SA 3SLSA 4O7RA 2QURA 1NVRA 2VRXA 3GBZA 3I6UA 4Q5HA 4QPMA 3QTIA 4UEUA 4WG4A 2BKZA 3WOWA 1YWRA 2C3IB 3OC1A 2C3JA 1YXVA 3EQPA 3VULA 1WCCA 2QO7A 5JQ8A 3GC8A 5AUZA 2X0OA 5T6KA 5CAQA 4UB7A 4YLLA 4L7SA 2BMCA 2C6EA 3DNDA 2XS0A 3CY2A 4YTHA 4C0TA 2C4GA 4FEQA 3SAYA 2B1PA 2QOBA 2VTLA 4RLLA 4O6LA 3ROCA 3SDJA 3ALNA 5IQHA 3IPHA 5DT3A 3VHEA 5L3AA 3UYTA 5AUWA 3ZZWA 4UMRA 3E92A 5K4IA 3G9NA 3AOXA 2CKQA 4F9WA 3OW3A 3ACKA 2XAMA 3TMOA 2Y4IB 4EH5A 3FLSA 4AFEA 3OXTA 5CX9A 4CZTA 4U44A 3ACJA 2UZWE 3R01A 4PDPA 1MRUA 2YCFA 3ZSGA 4BIBA 2Q0NA 2XIXA 5TT7A 4NEUA 4MXCA 4QTCA 3KXGA 5J87A 3SOAA 5HO6A 3PXKA 5D12A 2XNGA 1S9JA 3F9NA 2E2BA 4CSVA 5KE0A 3FKOA 4AAYA 3LFCA 4XCUA 3RI1A 2J51A 4FKPA 2XEZA 2NRYA 5HI2A 1Q8UA 2ZDTA 5CF4A 1KOBA 1TVOA 2CPKE 2J5EA 4ZTSA 1NY3A 2B9IA 3ORPA 1KSWA 5F20A 3RPYA 5DBXA 5FG8A 1YVJA 4FK3A 3GVUA 4E6DA 5IH4A 2ZVAA 2YIRA 1J3HA 4AE9A 3NS9A 4JBQA 2XANA 3BLAA 4O7NA 3IQ7A 3RAKA 4UMUA 3VIDA 1H1PA 5K5XA 5IQEA 1Z9XA 2XJ0A 4AACA 2QNJA 3COHA 3M2WA 3DBEA 5TOZA 2H96A 4AOJA 5L8JA 4R78A 3ZO4A 5G6VA 1V0PA 3ZLYA 4B0GA 4P7EA 4OTWA 3AT4A 4ZP5A 2WMVA 3OUKA 3P7BA 4LFIA 4O6EA 4HPTE 3EQHA 2QOCA 3VC4A 2C68A 3DB8A 3PRFA 3OEFX 3VUHA 2ONLC 3E3PA 4YZNA 4FSRA 3V5JA 4YJNA 4F7LA 4MQ2A 5HLWA 4PPBA 2PVFA 1Q8TA 4DC2A 5AR4A 3EL7A 5HLPA 3FMMA 4FKRA 4EHZA 4HNIA 4KKEA 1WBSA 4OGRA 1OL7A 4C34A 4WIHA 3FI4A 2R3PA 3NNVA 2CNVA 4V0GB 3DBFA 3QRIA 1GZOA 4RWIA 3RJCA 4CVAA 2R3IA 4RIXA 4R7IA 4RMZA 3BE2A 1YDRE 4FIFA 2A1AB 1U46A 5FDXA 4DGNA 3F5XA 5HO7A 4RIYA 4AXEA 4ZMEA 4M8TA 4X2NA 4JS8A 3ZDUA 5BYLA 3MH3A 5AJQA 2BROA 5E8TA 5EOLA 2F49A 3FSFA 4O0YA 5FXRA 2FSOX 4UZDA 2ZDUA 4CKIA 2WQEA 1PF8A 3FY2A 3JVSA 3MBLA 2C5OA 4RVLA 3EZRA 2B9JA 3OWPA 5EM6A 4OBOA 3VWAA 1YI4A 4FZAB 3FZRA 2DUVA 5FEQA 2YDKA 2V62A 3W2CA 3GQLA 3HP5A 3KRJA 3GCSA 4RZWA 4ZK5A 4CYJA 2NRUA 3VS6A 3L1SA 4FTRA 1TQMA 5A4TA 3OT3A 4I41A 1BMKA 1E1XA 2PZIA 2YA9A 3LOKA 5DFPA 3WZJA 5FEEA 3QA8A 3PVUA 2ETKA 5J5TA 4JX3A 4TYEA 1XH7A 4F7SA 4FKQA 3R1YA 4JVGA 4X2KA 2G2FA 5EYCA 3F7ZA 2IZUA 3I60A 3LQ8A 3L9PA 5B2LA 4FV3A 4ENYA 5L4QA 3OXZA 4BCHA 3HAVA 2OH4A 3RK9A 3ZUUA 1OB3A 4Y85A 4F9BA 3JUHA 1O6YA 4A07A 4DG2E 4ENXA 3VS7A 1TFFA 1UU9A 2ZJWA 2IW6A 4F09A 5KO1A 1XQZA 5KMOA 2QOKA 3DBDA 3G5DA 1REJA 5EW9A 5HD7A 3FI3A 2X0PA 4I3ZA 4CV8A 2C30A 4IVCA 4DGMA 4DEHA 4CKRA 5L2TA 1ZOGA 3LPBA 3RALA 3R73A 2YABA 3GGFA 2PVRA 4BHNA 4BN1A 4O7LA 1I09A 3L8SA 5FEDA 3TL8A 2B7AA 4QTBA 3AMYA 3O51A 5LARA 5IQAA 5GZ9A 4DCAA 3FYJX 3OW4A 2QOHA 4GKIA 3BYMA 3V51A 4I0SA 4RX9A 3V5PA 4AT3A 4MXAA 4KKGA 4LV7A 1U54B 3EHAA 4I1ZA 4H3PA 5HVJA 1UU3A 1TZDA 1M7QA 4TZRA 3M11A 3NDMA 4FSQA 1L8TA 3WARA 4GFMA 5GJDA 4LDTA 3W0OA 3GC0A 3SOCA 4D0XA 4CCUA 2YM7A 3PE1A 3IECA 3DGKA 3UOLA 1JOWB 4ACHA 4S30A 5M4CA 3D7ZA 1SMHA 4NM0A 3N4TA 2CKOA 4H1JA 4C4FA 4RVKA 1Q24A 3F5GA 3KN5A 4PF4A 4CYIA 3QKKA 5EG3A 4WNMA 3W16A 2BFYA 4IFGA 4J8MA 3V3VA 5EW3A 2PUPA 3RP9A 4YUQA 2C5YA 4IAKA 1IA8A 2HZIA 1QL6A 3QLGA 5CLPA 3Q2MA 4AU8A 1YI6A 1Y6BA 4Q5EA 4BDAA 2PE0A 3THBA 5ITAA 1UKIA 2ONLA 4YBJA 3JYAA 1RW8A 4UALA 3DV3A 4FKJA 4IVBA 3SD0A 3ULIA 3U6IA 3ATTA 2ITQA 4ZOGA 3FBVA 4ZTQA 3Q96A 2XVDA 4IADA 4MNEB 3W2SA 4FT3A 1KE9A 3WZKA 4BKJA 1P2AA 4FKUA 4XX9A 2RFNA 4W4YA 3IO7A 4YO6A 3P7AA 3PJ8A 2XKEA 4G31A 4G5PA 4NIFA 3VUGA 3F2RA 5CU6A 4DFBA 2Y7JA 3OWJA 3BQCA 2FO0A 2I0VA 3QUEA 4E4XA 1V0BA 3KRLA 2SRCA 3QKLA 2GTNA 3BGQA 3LFEA 4ZZOA 4IFCA 3DZQA 4DLJA 5C03A 4EOJA 2PE1A 3KMUA 2C5VA 1ST4A 3Q2JA 4RGJA 3NUSA 4L01A 4Z9LA 2R3GA 2ETRA 2W9ZB 4O0TA 4R1YA 4O4EA 4RJ7A 4UMPA 2J0KA 5E91A 1NT2A 5GINE 3OOMA 3QKMA 2X9EA 3HV7A 2X7GA 2YM3A 3OF0A 4FSYA 3I6WA 1WBPA 2F7XE 2OBJA 3D4QA 3MVLA 4GKHA 1KE5A 4NW6A 3COMA 4KIOA 4ANSA 3FMJA 4OBQA 3BWJA 3R02A 1QMZA 5AFVA 3G0EA 1OI9A 3BU6A 3ITZA 3QTSA 3SRVA 4GK3A 3ZFXA 2ZM4A 4F4PA 2WHBA 4M0YA 3MVHA 3W1FA 1OITA 1LUFA 4OBPA 4QEBA 4BY9E 2CKEA 3AQVA 3BX5A 2XIZA 3KF7A 3VUDA 3A60A 1JSTA 1U5QA 1URCA 2CN8A 4R7HA 1LR4A 2E9OA 3GEQA 4ZIMA 5EYDA 3Q5IA 4C4JA 4JMQA 4QP3A 5AV0A 2HK5A 2Q0BA 3UDSA 5DI1A 3DKCA 3H9FA 5EM7A 1OIRA 4RC2A 4A7CA 5CQUA 3UBDA 5B0XA 2OG8A 4EHEA 3MH2A 1VZOA 2PVMA 3R8LA 2BTRA 5CANA 4FVPA 4CTBA 5CAOA 4I0TA 2YM4A 5AR5A 5BVEA 2UZNA 5CTPA 4AUAA 5AV1A 3EQIA 3SX9A 4E93A 1H1RA 2XKCA 3MVJA 5HG7A 3RPVA 4G6OA 4IWPA 1H1SA 4D2WA 1F5QA 5JEBA 3VBQA 1XH5A 4NL0A 3R30A 2P0CA 5T3QA 3Q4CA 1RQQA 3LMGA 1W83A 3LFAA 4TYGA 2GS6A 3D5UA 3E64A 5AIKA 5CF6A 5IEYA 4U9AA 3H0ZA 4YC6A 2WTKC 2YJRA 2VWIA 3Q4UA 1FVTA 3N4UA 4ZTNA 5KKRB 1MP8A 4I6FA 2RKUA 4MEDA 4RWLA 4W8EA 3GQIA 3KVWA 3RAWA 3NIZA 4D2RA 1JKSA 4FR4A 2EVAA 2PVNA 3DFCB 5IH5A 3C4ZA 3F5UA 2VTIA 3LKMA 3FL4A 3BHTA 5E1EA 1XH9A 3QWJA 2XUUA 4KB8A 1GNGA 4R1VA 5HKMA 4N70A 3BIZA 2VTSA 2ETMA 3DZOA 4JDHA 1JKLA 5AP7A 2W5AA 2GS7A 3QZHA 4AN2A 4IAFA 4AE6A 1H1QA 4L43A 4L00A 3DJ5A 3FUPA 4J52A 4PDOA 5JSMA 5AV3A 2DWBA 2QLQA 1UNLA 5A46A 1J7UA 4JLCA 3BCEA 3QC9A 4GYGA 4KIKB 5TO8A 4WO5A 4RQKA 4XBRA 5C26A 3ZLXA