5HLPA

X-ray crystal structure of gsk3b in complex with brd3937
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
337
Chain Sequence
b'KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPREQIREMNPNFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Inhibitors of Glycogen Synthase Kinase 3 with Exquisite Kinome-Wide Selectivity and Their Functional Effects.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 337
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hlpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hlpA01
3W32A 3C9WA 2C5OA 2W7XA 1JOWB 3SKCA 4UV0A 2BIKB 2YIRA 4RJ5A 3PE1A 3PXYA 3OEFX 5J8IA 4DFLA 5K5NA 4FTIA 4WBOA 5DA3A 2YDIA 4FUYA 3I6UA 4WD5A 3R6XA 2QOIA 3VS5A 3LMHA 4OT6A 5BVOA 5EG3A 1BLXA 3FKLA 4KIQA 5FP6A 3QD4A 2OZAA 4IANA 4X6QC 3ERKA 3OXIA 4KS7A 4DEAA 2BILB 4HNIA 3KL8A 4AE6A 3R8MA 3BYOA 2XS0A 3P0MA 4RC3A 4G6LA 3GFWA 2OI4X 5CF6A 1U5RA 3HUCA 3IO7A 3GQLA 4FL3A 4H3QA 3B2TA 4TYEA 3BPRA 3VAPA 4BGHA 2UZEA 3LFEA 2UZNA 4EWHA 4MD9E 4CTCA 3GVUA 1OBGA 4Y72A 4IB5A 4DG3E 1NT2A 5CXHA 2XNOA 5AV4A 4RQVA 5HE0A 3OW3A 3F2RA 4UXLA 4QMWA 1P4OA 2PE2A 5HVJA 2BRHA 3OUKA 1O6YA 4PPCA 4QPSA 4WUNA 2XMYA 3D5UA 5I4NA 2BFXA 3E7OA 3R7OA 5I9UA 4H36A 4AUAA 4J97A 4ZY5A 4YGAA 3SA0A 2FSOX 3L9NA 3EQPA 3UVRA 3ZM9A 3OROA 4YJNA 4ASXA 4BYJA 2FUMA 3UVPA 1CKJA 2XKFA 1J1BA 4M15A 5D10A 4HVGA 3EQGA 4EOLA 4HVIA 3FC1X 5HKMA 3MI9A 2R2PA 4BN1A 4RA5A 4CMTA 4EUTA 5FWKK 5IH6A 5IA3A 4M3QA 4FR4A 3V5JA 4FKJA 4FTOA 1H8FA 4GRBA 4XH6A 5DR9A 3TNHA 4DITA 3SW7A 2UW3A 2RFEA 4BTFA 4DGGA 5AA9A 4O7RA 1OKZA 2VWWA 2IVTA 5GZAA 4TPTA 4FG7A 3EOCA 4YZMA 3GU8A 2HWOA 4TT7A 3F3VA 3MIYA 5FUTA 4JS8A 4I0RA 3EL8A 5H3QA 2WELA 4X0MA 2XK7A 2V7OA 4OAVB 3QC4A 4X3JA 4F7SA 2H8HA 3FZSA 4TRLA 5M51A 3A61A 3SXSA 3U6IA 3L8SA 5K4IA 4NEUA 2HZNA 3LFFA 2X1NA 3CTHA 5DIAA 3C0HA 5CYIA 3ZUUA 2X2MA 3EN6A 3H0ZA 2ZMCA 2WOUA 2X8EA 5HE2A 4RIYA 3UPZA 3MN3A 1F5QA 4LGDA 5KZ0A 5AR5A 4D55A 1YXSA 2PMNX 5HTCA 3DB8A 3PDTA 1J3HA 2GSFA 3GCSA 2XJ2A 3TT0A 3PY1A 5FXQA 2WGJA 4NJ3A 5C27A 2B0QA 4FKQA 2ITTA 3MWUA 2C69A 4YC8A 4AN2A 4Y5HA 4BCFA 4W4VA 4DTKA 2WKMA 4PMMA 3O0GA 4XRLA 2EUFB 3ZOSA 1R3CA 3AOXA 5LMAA 3GT8A 3HP5A 3MFRA 5M06A 1AGWA 2VTNA 4TWOA 2CGXA 4FV2A 2C5NA 1YWRA 2OJJA 2UW7A 1M2PA 4D2RA 4PPBA 2YFXA 3QTSA 1RE8A 1XHAA 4GFMA 2ITZA 4L8MA 5EYCA 3O8TA 3UNJA 4I6HA 4XRJA 2EXEA 4NWMA 2QD9A 3R7UA 2YN8A 3UOKA 2FGIA 2WTKB 3DXPA 2NNWB 3LLTA 3DFCB 1Y57A 2O63A 2YISA 5HTBA 2GHGA 2VWBA 3DV3A 4KBKA 4KIKA 5J5SA 2NO3A 1AQ1A 4DT8A 1QCFA 3MY5A 3D0EA 3R73A 3VF9A 5DT3A 4UMPA 2PUUA 3EN7A 2XKCA 3CCNA 3GFEA 3O50A 2LAVA 3H9OA 3PVBA 1H1WA 5FXSA 3IOKA 4ZTHA 1ZRZA 4YSJA 5DI1A 4JDIA 2UZUE 2XK8A 2CGUA 3BU5A 3MJ2A 3GNIB 4OLIA 2F2CB 5HIBA 2HXLA 3IG7A 5DGZA 2BKZA 3FE3A 4BVUA 5EDQA 5E8WA 5CI6A 2P55A 2R4BA 3NSZA 3I81A 5CZHA 2XUUA 3N9XA 3I5ZA 1ZYJA 4X2JA 3COMA 3O7LD 5CF4A 5HO7A 5GNKA 4E4NA 4PNKA 4I3ZA 3VUKA 2YJSA 3KVXA 4TTHB 3UZPA 1Q8TA 2J0KA 4B8LA 4DFXE 2QOLA 3CS9A 3U9NA 4L53A 4KSPA 4IE9A 3PIXA 4G3GA 4F7NA 5KNJA 3JR1A 2WMRA 5EW3A 4IJPA 4YC6A 4NYEA 4IDTA 3KRLA 2CMWA 3OXTA 1H00A 4Q2AA 4ANSA 1PRYA 2WD1A 3VUIA 3GC0A 2X9FA 4QYHA 2XYNA 4FNXA 3VUMA 4YMJA 3ALNA 2YERA 3FZPA 4X21A 4IX3A 5EYMA 4E8AA 2QOKA 2XA4A 5DR6A 5HBEA 4E7WA 3E8NA 3KMMA 5A4LA 5HICA 2C0OA 3QA0A 3ZEWA 4RWLA 1GIJA 4MD8E 3G90X 5E92A 1H07A 1E9HA 1U46A 2PVJA 4LM5A 2GDOA 2UVZA 4D2TA 2JFMA 3OOGA 4FL1A 4RJ8A 4KRDA 4P90A 5D7AA 5TR6A 3TJDA 4CV9A 3CEKA 4YJVA 4K6ZA 2G2IA 3KB7A 5KMMA 3DZOA 3AD4A 2W17A 3F7ZA 1AD5A 4EOIA 5CSXA 3QD0A 4XMOA 4DTAA 3UOLA 1PHKA 1UU8A 4JQ8A 2RG6A 3EFKA 4O38A 5LMBA 5GINE 4O2PA 2VWVA 4CNHA 5IUHA 5ANOA 2WNTA 3JY0A 3TCPA 3F6XA 2FH9A 3QTZA 4C0TA 2CJMA 3DXNA 4I5HA 3DLSA 3UOHA 3DKGA 3BLQA 4YSMA 2BTRA 4IAYA 5K5XA 3UG1A 5IA0A 5F95A 5H2UA 4BWXA 1H1SA 3B8QA 1XH6A 3QLFA 3D5XA 2OGVA 5HGIA 4PWNA 5L6OA 3AXWA 5HU9A 2F7ZE 1G8SA 2YIXA 2ITWA 4F4PA 1RW8A 2R3OA 4N6YA 5LCKA 5J7BA 3TUBA 3Q6WA 4L67A 5M4IA 4FT3A 3G2FA 2W5AA 2V5QA 3E93A 1DAYA 1YXTA 3Q32A 4NM0A 3D7TA 5CVHA 4G17A 4ANMA 5AP3A 3BU6A 3LFAA 3U55A 2DS1A 3PPZA 3KMWA 4NL0A 4TN6A 4ZZOA 4FGRA 2QOBA 4KIPA 4RX8A 4IM2A 5JSMA 1ZYSA 3BYSA 3PUPA 3PLAE 3PXQA 2OF4A 4O7TA 3KMUA 4LV8A 1MRYA 1Q4LA 4NIFB 4KA3A 4TYHA 2HW7A 4L46A 4X2KA 4EOKA 3VUHA 4R6VA 3NUUA 3I7BA 4YJPA 4DH8A 3P7CA 4EH3A 2IZTA 2NPQA 2UW5A 4L43A 4K11A 5CWZA 3F66A 2P4IA 3AC3A 4EORA 3QQLA 4Y46A 2QO7A 2QODA 4HW7A 4IWOA 4EEVA 2CKQA 1XBAA 4J95A 2UW9A 3FZOA 3W8LA 3QX2A 4AOJA 4E20A 4ZJJA 4W4XA 4TY1A 2UVXA 3IW4A 4GL9A 2EXCX 4QOXA 5IQGA 4ZMFA 4FV0A 3TIZA 4I4FA 4YLLA 3NEWA 4DINA 3DNEA 2C6DA 5IUIA 3MJ1A 1UWJA 4IW0A 5JT2A 1YXUA 3AQVA 3OCSA 3Q2JA 3FL5A 2WMQA 1XH8A 2QOQA 5AUWA 3QWJA 4C4HA 3C4EA 4R1VA 3VO3A 5J7HA 2HY81 4C34A 2C5XA 3FI2A 3QF9A 5HO6A 1P5EA 4D28A 3OUNB 4G34A 1ERKA 4UALA 4DH7A 4JAIA 1P4FA 3R1NA 4C02A 3S1HA 4DEGA 4L6QA 4ACCA 4C37A 4OTQA 5M4FA 1E1VA 3OCTA 2YAAA 2C1BA 3FC2A 3E88A 5FDPA 2WFYA 2A0CX 4KNBA 4UWYA 3O71A 4O86A 3C4FA 3BHYA 3HV5A 4IB0A 4QP4A 3QBNA 5L2WA 1CSNA 2VWYA 3FLQA 5CLPA 2G01A 4MQ2A 5IA5A 4H1MA 5IQFA 4CYIA 4WIHA 4FNWA 4YHJA 4F09A 4D1SA 4JQEA 4JVGA 5CXZA 5IH4A 5DVRA 2OJ9A 3AT2A 4J8MA 4IHPA 3RWQA 4CZUA 2WZJA 4YPSA 2VTHA 3E92A 4KB8A 2XNPA 3E63A 3K5UA 3PJ3A 3FQEA 4ZS0A 2ITQA 5E1SA 3A7JA 3C4CA 4ITHA 4N0SA 3TNWA 5GZ9A 2A1AB 3MDYA 3WF9A 4EK3A 2IVSA 4OBOA 4AZEA 4R1YA 4QMYA 2WIHA 4F0GA 1ND4A 3ZUTA 1QPCA 3FMKA 4O0UA 3QWKA 5FEDA 4BHNA 5CU3A 2HELA 3NW7A 3FY0A 2F2UA 4UZHA 3UPXA 3RZBA 2CNQA 4XJ0A 4FG9A 2UZVA 3RZFA 3DFAA 2SRCA 5ITAA 2FSLX 4FKGA 4ZXTA 4M8TA 5AV2A 4EKLA 4A4XA 4B7TA 5A6OA 3ATTA 5A4EA 2OJGA 4QYYA 3CJGA 3R21A 5EFQA 3DBQA 5CX9A 3E3BX 5IMEA 5L2TA 5IQEA 4OAUC 4RG0A 5ACKA 5IA1A 4C38A 1ZY5A 3D5VA 3AMBA 3I0OA 3NPCA 4LRMA 1OKVA 4EZ7A 4FTRA 4N6ZA 5D11A 3RPSA 1M14A 4E6CA 4XCUA 3NAYA 4YHTA 3VS2A 1KUTA 3NR9A 5FTOA 3UZRA 3WZDA 1PXKA 3CKWA 5IG1A 4A9RA 2ZB0A 3DKFA 2ACXA 2W96B 3GENA 3ULIA 4DE4A 1HCKA 2Y7JA 2OK1A 4YTFA 3F3TA 5EOBA 4XP0A 4LV5A 3TNPC 4CTBA 2ZJWA 4QPAA 4AP7A 5HIEA 3JY9A 4ALUA 4IVDA 3RM6A 4PTEA 3MY0A 4USFA 5FQDC 3OCBA 3H10A 4Y85A 3WZJA 4C2WA 2C4GA 2CN8A 1E1XA 3PXZA 4U43A 4MK0A 1Q24A 2A19B 3MBLA 1XR1A 5CAPA 3R9RA 2Z7SA 3IGOA 1Q99A 4FTQA 4X6RA 1YQJA 4JIAA 4RIXB 2WMBA 4CZTA 5AUXA 3EH9A 4NUSA 3R1YA 3VHKA 1BUHA 2WQMA 2YIWA 4FSTA 3SRVA 3TZ8A 3PLSA 3F3ZA 3Q53A 4EC9A 3HV6A 5D7VA 4I5PA 2HCKA 5HTIA 4M7IA 1JNKA 4U42A 4BKZA 1W98A 4UMQA 5H8EA 3EKKA 4ID7A 1YWNA 3RPOA 2PTKA 4F70A 1WBOA 3VBWA 2RFDA 4WNMA 4M68A 4EBVA 5F9EA 3U87A 4GCJA 4XEYA 1UVRA 5AUUA 3GP0A 3W1FA 4B0GA 1FPUA 3BV3A 3TKHA 2R0UA 3Q6UA 4C4EA 2V22A 4TWNA 4KSQA 5AAEA 4D9TA 4R3CA 2J9MA 4KABA 4E73A 3R1QA 3A99A 5EQPA 4IWPA 4OTWA 2W1FA 1A48A 3WE4A 1MP8A 3DDPA 4NH1A 3LQ5A 1OKWA 4J8NA 3V8TA 3OEZA 4CCBA 5A3XA 1OL1A 2WTKC 3UNZA 5L6WL 4OTHA 4YTHA 5AP7A 5ANJA 4M13A 3PP0A 5B7VA 4XOZA 3S4QA 2RFNA 2QNJA 4I20A 4EH4A 5KUPA 3TDWA 4D2PA 1Y6AA 4GEOA 3LKMA 1H28A 3VBVA 5FGKA 5JKGA 1FMOE 4O0RA 3ENMA 3MW1A 3RBWA 2WMXA 4PMPA 4ONAA 2A2AA 5CVFA 2OU7A 2X4FA 2W5BA 4PP9A 5BYZA 2OSCA 2PZIA 3FLSA 3FI4A 1KE6A 3RK9A 4A7CA 4FKOA 3QGWA 2QO9A 5IU2A 4CLJA 4ZY4A 3ALOA 3Q9ZA 2WU7A 5HLWA 3RAWA 2C0TA 5AUVA 4NCTC 4RIOA 2PUIA 4I4EA 1PXOA 4GVJA 5ETAA 4FZFB 2QO2A 5CSHA 5HO8A 2BRNA 3W16A 4Y73A 5HG9A 3OBJA 3HAVA 3NGAA 4WSYA 4YZNA 3MH3A 3PRFA 4PL5A 3UE4A 3P79A 4UZDA 4MWIA 2DWBA 3BHTA 2AC3A 2JC6A 1WBWA 4O1OA 4KD1A 1W7HA 2IVVA 5CU0A 2HIWA 4APCA 2GQRA 1GNGA 4RVMA 2IWIA 2PVKA 3IW7A 5I9VA 1IR3A 3CQUA 3FJQE 3AMAA 1DS5A 4Y83A 3KXZA 4OTRA 4E3CA 2CGWA 4I5CA 4QQCA 4AZSA 4E4MA 3QZHA 3DJ6A 2VTPA 3WARA 1BYGA 1F0QA 4XG7A 4IB3A 5JEBA 3VW6A 3W33A 5JFVA 4DTBA 2UV2A 3VS3A 3WIKA 5CAVA 5I9ZA 2JBOA 1URWA 5HLPA 3V5LA 3ZTXA 4DEDA 4WHZA 5A9UA 2QI8A 2J50A 2GTNA 4JBQA 4F0IA 4IVBA 5I9XA 4EZ5A 2BZKB 2XRWA 3E8DA 4GS6A 1PXJA 3GI3A 2WTWA 4ENXA 4D1XA 5CNOA 2X6EA 4AW1A 3UJGA 2AYPA 4OTIA 3LIJA 3MYGA 4J7BA 4NCTA 5CT7A 4MVFA 3P08A 5H9BA 1TVOA 4U7ZA 5IA4A 5C9CA 4UWCA 5IEYA 4Q9SA 1W84A 2XRUA 4FV4A 4ACDA 3BLRA 4BHZA 4HOKA 4ACHA 4PMSA 5CAUA 5A4CA 3D83A 3RVGA 4YURA 4FOBA 3AC4A 4CXAA 4MAOA 4FKLA 1XH7A 3HZTA 4DEHA 3GEQA 2EU9A 4YTCA 5J1WA 3MS9A 5IISA 3PXFA 4EJ7A 3FI3A 2XZSA 5AX3A 3O7LB 3RAIA 3AD6A 4ZY6A 5BUJA 4OW8A 3HMOA 2PSQA 3LPBA 2O64A 1YI3A 1A9UA 5DEWA 2XBAA 1H1PA 2PHKA 5CENA 4FTLA 5AR2A 3HV3A 3DDQA 4RLKA 2YZAA 1QL6A 4RWIA 5E91A 3ZEPA 1XBCA 2YCFA 5BUIA 4ASDA 4ZTNA 3I0QA 2W1GA 5F4NA 5AUZA 4FA2A 3ACKA 4E5BA 2REIA 4UYNA 4R5SA 2CLQA 2UZDA 3LHJA 3AC8A 3LVPA 2Z7RA 4FTMA 4V01A 4IX4A 5LVPA 3T8OA 4DN5A 3ZBFA 4U97A 2XNMA 5GJGA 5EW9A 4AT4A 1T45A 3PSCA 5AJQA 4UX9A 3ZLYA 4FTAA 5CS6A 4LG4A 3MH2A 4FT9A 3LQ8A 2HZ4A 3G5DA 4F9BA 3V3VA 3A7FA 2PE1A 4XG2A 4E4LA 3BYUA 3ORIA 3OWKA 3ZRKA 3C0GA 5BNJA 4PTCA 4J53A 4BDIA 3ACJA 1ZAOA 5BQ0A 5I0BA 3HGKA 4EH7A 1GZKA 4ACGA 1JPAA 4L7FA 3O8PA 2J0IA 4O81A 2C5VA 3ENHA 4CG8A 2B4SB 4IB1A 1CTPE 1YXXA 3VS1A 2ZV2A 3A62A 3VRYA 3ZM4A 4C57A 1R1WA 4CFWA 5DN3A 3MIAA 4TYGA 2R7IA 1TQIA 3MFUA 3AT3A 3WF8A 3PA4A 3Q3BA 4D2VA 2W1IA 5JZJA 1WBVA 3DK6A 4PDPA 2JLDA 2YIQA 4RX5A 3EIDA 1Y6BA 1F3MC 3THBA 4D5KA 4BFMA 5K3YA 3MVJA 1UU9A 4E5WA 2XJ0A 3GCQA 5AWMA 3QCQA 3G51A 4AN3A 3C50A 4O7LA 4BC6A 2BZHB 3HMIA 1PYEA 4FVPA 4YJQA 4FIIA 2WHBA 3DJ5A 2GNFA 3NUSA 3NZ0A 4TNBA 2VAGA 2Y4IB 3QU0A 1OI9A 5HCXA 4RVTA 4O0WA 3WILA 4B9DA 2YDKA 3QX4A 4DH5A 4YNEA 4FK3A 2ITXA 3CQEA 4RC4A 2YIYA 2UZLA 5AM7A 1YWVA 3GCUA 3DBEA 3JPVA 4KIOA 2QG7A 4GT4A 1RDQE 4IXPA 4MNEB 3SG9A 4HNFA 5AIRA 1Z5MA 3POOA 4EWQA 2GQSA 4QO9A 4AA5A 5DFPA 3WF5A 3QZFA 1JKTA 2ITPA 4NIFA 3PPJA 3BEAA 4BZNA 5BVNA 3K3IA 4I6BA 1S9JA 3N4TA 4JBOA 2Z2WA 2Y0AA 4J52A 2F9GA 4O0YA 3P78A 5AA8A 2Z7QA 3EQCA 3I6WA 4PPAA 4Q5HA 4AT3A 5AIKA 3QC9A 4BBEA 1WVXA 4BIDA 2OICA 4CFNA 3EYHA 3OG7A 3VS4A 5L2IA 3C5IA 4YZBA 2ZM3A 1K3AA 3HUBA 4WO5A 4GU6A 1PF8A 2JIVA 4U0IA 4F9CA 5CF8A 5L4QA 4BCIA 5DT0A 2F7EE 2XB7A 4QYGA 3NW6A 5HVYA 2FA2A 3CTQA 2XEZA 4MTAA 1UU3A 2EB2A 3KC3A 1WFCA 3VS6A 5CEIA 5CQUA 3WI6A 5ANDA 2VO6A 3CR0A 4HJOA 3WZKA 3RTPA 4D4RA 4BDFA 3I79A 4HZRA 4ZAUA 2PVYA 4P5ZA 5JN2A 2J0MB 4FV6A 1JVPP 5JQ8A 1J1CA 4BKYA 2C1AA 3LCDA 4A9UA 2E2BA 2GNGA 1OIYA 2C68A 3ORKA 4G6OA 2X2LA 4WKQA 3R8LA 4XG8A 1NA7A 4LL0A 4EH2A 1VZOA 3V6SA 2XIKA 5B2MA 4QP3A 4BDEA 3Q4CA 4C7TA 4XLIA 3HX4A 2UW4A 1M7NA 4EOSA 2E9UA 5EKOA 3H9RA 4W4WA 2VWZA 3ZBXA 4USEA 5C26A 5AM6A 5DE2A 1H27A 4IX5A 3VBQA 4XV3A 3ZFXA 4AZTA 3Q4ZA 1IRKA 3G0FA 3PYYA 2FYSA 1ZOGA 4FSZA 3VUTA 4EH6A 3ZFMA 1YVJA 2R3FA 3EQHA 4NTTA 1J7UA 3BBTB 1H26A 5KE0A 3DA6A 1R0PA 4O0VA 3VW8A 3I7CA 3QFVA 4PX6A 5M44A 3CE3A 5EYKA 4RJ4A 1WVWA 2JDSA 5L8LA 3FY2A 4DGOA 3A4OX 4LFIA 4PTGA 3FEGA 4FTTA 1B39A 2PK9A 2VD5A 3BX5A 3IDBA 3UIUA 3U9CA 3B2WA 1SYKA 4BI0A 2FVDA 4BIEA 4HYUA 4EKKA 3C1XA 2HZ0A 3TJCA 5BYLA 1UNLA 3LXPA 3TV7A 5DRDA 5AP6A 3VQHA 2QOOA 2QG5A 3C0IA 5HCZA 4ARKA 5FEQA 4ZLZA 4O7ZA 5GJFA 2CNVA 3TKUA 2ZB1A 3MH0A 4R77A 4IJ9A 4FI1A 1JWHA 2OJFE 4YPDA 2R3PA 4FIGA 5E9EA 2IZUA 3G6HA 4IADA 3PJ1A 2R3IA 3Q2MA 5CF5A 4FV9A 4F6UA 5JGAA 4L52A 2BIYA 2W99B 3UZTA 3RWPA 2B52A 3ZS5A 3OF0A 4NM7A 1HCLA 4IVAA 5JMSA 1OECA 5IQHA 1ZZ2A 4HZSA 5KBQA 3SX9A 4ITIA 3NVKI 3SGCA 2H34A 5HCYA 4QMQA 4ZK5A 3E5AA 5C8MA 3G33A 4H3BA 3GCPA 4EH8A 3MTLA 4QPMA 4O7VA 2XNNA 4QD6A 2BR1A 5BVFA 4S33A 2I7QA 3Q9WA 3U4UA 4II5A 3NRMA 5IEXA 3JVRA 5AMNA 4E1ZA 3CGFA 3QUPA 4WG5A 4M69A 4YJUA 3IKAA 3VJNA 3RM7A 4Z55A 3E62A 3ZLXA 1STCE 3V01A 5GHVA 4BR3A 2YABA 4EOOA 4FT7A 3MPTA 2JIUA 4BDBA 4EONA 5DYJA 5IQDA 3F82A 4MCVA 3UDBA 5TF9A 5KCVA 3FAAA 3OVVA 4YZ9A 4FGBA 2KULA 1MRVA 1MQBA 4RIXA 4G9CA 5EOLA 3AC1A 4QRCA 3FZ1A 4QQ5A 3R8ZA 3S00A 3BYVA 2BZIB 1XWSA 2VTIA 3NCZA 4FKIA 3FMNA 4XG4A 4Y95A 4LUDA 5J87A 5LQFA 3R01A 4G3CA 4XV2A 5DRBA 1GZNA 2ONLC 2RG5A 3KRXA 4JOAA 2J5EA 2V62A 3LJ0A 5AR4A 4FTKA 3ZDIA 2VX3A 5AV1A 3VN9A 3MPMA 4X2NA 4AFEA 3DXQA 2BDJA 4BIBA 4C3PA 1W82A 4BL1A 3O17A 4LRJA 2C3JA 1XJDA 4CEGA 4MBLA 3LFNA 3D4QA 4XNEA 4CZYB 3NUXA 1M2RA 2J7TA 2WXVA 4X3FB 4G6NA 1CKIA 2HK5A 2O3PA 4WOVA 3MVLA 1OPKA 3KULB 2YA9A 3UQFA 2Z02A 1S9IA 2R3JA 4JLCA 4LUEA 4CSVA 1Z9XA 4RGJA 4U6RA 1G8AA 2YWPA 3EZRA 5KMIA 3WBLA 3RHXA 3D5WA 1FGIA 4NW5A 3I1AA 1ZMVA 2B54A 4FICA 4M66A 5IQAA 3GCVA 2X9EA 2BMCA 3A60A 3GOKA 2OH0E 3UMXA 2C3IB 2YM5A 4MF1A 3CP9A 4CGAA 4HVSA 2CLXA 4CT1A 4RZVA 5I3OA 3H9FA 5CVGA 4HYHA 4EYJA 5IPJA 2UW0A 4BBMA 2YM3A 2WQOA 3TNQB 2P33A 3QLGA 2QC6A 2C3LA 2R3HA 3BCEA 2B55A 4ENYA 1L3RE 3FPQA 1MRUA 4A4OA 3IK3A 3KA0A 2VZ6A 2W9FB 2ONLA 1M52A 5I9YA 3TKIA 4I94A 4R3PA 3TNIA 1APME 4AGCA 5EW8A 3V8WA 3P7BA 2X7OA 2ETMA 2YCQA 5KKRB 4D2WA 1Y91A 3BYMA 1OL6A 3KGAA 4FF8A 4AZFA 4EC8A 3GU5A 2W1EA 5FDXA 4NKSA 4RZWA 3FZTA 3R22A 4QMZA 4DHFA 2J4ZA 4QYEA 3LOKA 2UW8A 3AT4A 4LOOA 1EH4A 2WOTA 3R02A 3DY7A 4EK4A 4IX6A 2OFVA 3RI1A 3D15A 3E87A 3H0YA 4MXZA 2XK9A 3ID6C 2G15A 3S2PA 4DFUA 5C03A 3GUBA 5IQCA 4Z7GA 4N57A 3KXXA 5IUGA 5JGBA 2Y6MA 2J0JA 3HL7A 1OL2A 4BZDA 4DEEA 4J96A 3A7GA 3FUPA 3LXNA 3QRUA 1ATPE 1SVHA 2PVMA 5J79A 5KMJA 5JZNA 2XNBA 3FMJA 4C2VA 4WNOA 3L8VA 2YWVA 3LLAA 3FLZA 1KSWA 3V5QA 3ZSGA 2O0UA 2QHMA 5TOZA 1KV2A 3OY3A 3RCJA 3QKKA 3OMVA 3VUGA 4C4FA 4CFXA 4GIHA 4WT6A 2PMLX 4NM3A 4GT5A 4Q9ZA 4KS8A 2RGPA 3BZ3A 2PZYA 2GQGA 2R3GA 3GU6A 4FL2A 4RSSA 2RF9A 2PVRA 2IN6A 4V04A 2IW8A 2PL0A 4B4LA 4LL5A 3CPCA 1OIQA 4IQ6A 4OBPA 5BVEA 1PYXA 4AFJA 4B6LA 1WBTA 4YR8A 2YITA 3L9MA 4UWBA 4ZP5A 4AGUA 4GK2A 3R9DA 3HRBA 4LMUA 4CMUA 2R64A 2GNIA 4XOYA 5EI2A 1ZY4A 3FL4A 3NNXA 1YKRA 5LXMA 3D14A 2H9VA 5E90A 3EMGA 3EQBA 3OY1A 3V04A 5HNIX 3IDPA 5FBOA 2UZOA 3PPKA 3OWPA 4YUQA 1WZYA 1YI6A 3ORZA 3ZLSA 3IW5A 1Q3WA 2F4JA 3O8UA 4C8BA 5BVDA 4GJ2A 3NNUA 4MNFA 4USDA 4JT3A 1H1QA 4JIKA 4O96A 4W8DA 3NNVA 4B99A 3ODZX 3DLZA 4RFYA 3PRIA 1REJA 1PMEA 3HEGA 3T3UA 3U8WA 3TM0A 2IZSA 1Y8GA 4QP9A 4UXQA 5B2KA 4UEUA 1ZMWA 4O7NA 3NX8A 4CG9A 3W2PA 2BFYA 4BCPA 4DBXA 3GC8A 3ITZA 3O2MA 3Q96A 1YOLA 4JQ7A 4JXFA 4I41A 1JSVA 3EN9A 3MY1A 4M97A 3TXOA 1HOWA 2C6EA 3SHEA 4EHEA 3P7AA 2WO6A 4YJTA 5HG7A 4RLLA 3HDMA 3FKOA 4O83A 2XK3A 4KBCA 4ZTLA 4R8QA 1H0WA 2WU6A 5AX9A 4BTKA 3TIYA 4EOJA 1IAHA 4DT9A 2VGPA 2YCRA 3L9PA 3PSDA 4W4YA 1NXKA 2UZBA 4NSTA 3CBLA 4LYNA 2VTRA 2WB8A 3HP2A 4FSNA 2G1TA 3D9VA 3NUPA 4GIIA 3HMNA 4JG8A 5CQWA 4QMVA 3UIMA 4BDAA 4F1OA 4R78A 4CQGA 3HDNA 1OM1A 5HBHA 2BTSA 5A14A 1OPLA 2JKOA 5LOHA 1I44A 3QA8A 4WSQA 2XH5A 3C51A 2E9PA 2GPHA 2O8YA 4NKAA 4DFBA 1UWHA 2WMVA 2PPQA 4U45A 4JG7A 3SLSA 3BE2A 4P4CA 3NW5A 5ICPA 3FWQA 5GJDA 4AOTA 4DH1A 4GG5A 2BUJA 4IZAA 2UVYA 4UY9A 1OZ1A 4FOCA 5DNRA 2I40A 4BI2A 5FM3A 1DI8A 3ET7A 4XG6A 3Q9XA 2I1MA 4ANOA 4BDCA 3Q4UA 4C62A 1R78A 4XBUA 5AP5A 3DZQA 1NY3A 3RHKA 4H58A 2IG7A 4ZSAA 3SD0A 1SZMA 4ORKA 3EWHA 3OTUA 4RVKA 4XV9A 4ZTMA 4MNEA 5CTPA 4FZDB 3TEIA 3H30A 5BPYA 4EOPA 2PULA 4ZS4A 3VUDA 4GT3A 4F64A 1OITA 2A27A 3C13A 3K3JA 3DBDA 3R28A 4KKHA 5DPVA 3RKBA 1ZYLA 2W0JA 4BCJA 4XYFA 2BHEA 2R3QA 3PJCA 4XG3A 1MQ4A 5HEZA 3NYXA 5CEQA 1QPDA 2HY0A 4HCUA 2BRGA 3IECA 3OFMA 3NYNA 3UP7A 4D58A 5AV3A 2V55A 1PW2A 2GNLA 1FVRA 3O96A 4QMTA 4BWKA 2C3KA 3Q5IA 4QMMA 2ZV7A 3E7VA 1KE7A 4JDKA 4A9YA 5F1ZA 5EQEA 1WBNA 4IAKA 4FKVA 4FX3A 2QR8A 4YLJA 5IZFA 4L7SA 4FUXA 3HYHA 4I0TA 5IKWA 4QP8A 3FQSA 3BV2A 3ELJA 4PRJA 3QCYA 4XS2A 5IDPA 1BMKA 5DEYA 4BGQA 3G6GA 2IJMA 2GTMA 3KREA 4E6DA 1QMZA 4S32A 5E8UA 3ROCA 5AP0A 3KY2A 3ORPA 3NLBA 1H08A 5FBNC 2JD5A 4R7BA 5E8XA 4AAAA 4GH2A 4P7EA 4EHGA 4BDDA 4CKRA 2VWIA 5HNBA 4OUCA 2P3GX 2C5YA 3ORXA 3CD8A 4X7QA 2GS6A 4BCHA 1KOBA 5KZIA 1GOLA 5IH5A 3KXHA 4G3FA 2V7AA 2P2IA 1JQHA 1M2QA 4PL3A 5ANGA 3DB6A 5ETFA 4PNIA 1OIRA 3A7IA 4FV1A 2OG8A 4I92A 5K0KA 5DMZA 2XIZA 3NAXA 5FXRA 3LM0A 2IW6A 3V51A 2JBPA 2ITNA 2A4LA 3HV4A 3E8EA 2YM7A 2ZDTA 3DTCA 2QLUA 4FVQA 3DT1A 2YAKA 3NIEA 2I0HA 4FTJA 4K1BA 5EK7A 3AG9A 3R7YA 3BGPA 1M17A 4XLVA 4QTCA 2WQEA 4L9IA 3RGFA 4YTIA 2R0IA 3R71A 5E1EA 3VBXA 4C3RA 2QURA 1BL7A 2WTJA 2JEDA 4EJNA 2QHNA 4XV1A 4U5JA 4OTFA 2OIDA 5CY3A 3QXOA 5EKNA 4Z16A 3OWLA 3D94A 1SNXA 1LP4A 5AUYA 5EQYA 3F5GA 2OJIA 4IBMA 4KKGA 5IF1A 1Q8YA 1H4LA 4PDOA 2X2KA 4RA4A 3TV6A 2VU3A 1H24A 5AP2A 3UC3A 4APPA 2ETRA 3HV7A 1URCA 4FIEA 1FVTA 4HVHA 2VO0A 3KF7A 3PXRA 4EH9A 2OIQA 4UB7A 5J9YA 3CY2A 4HYIA 4IWDA 2RFSA 3KXMA 4UMUA 3ZSIA 4EI4A 4I93A 1JKSA 3EQFA 3OXZA 2ITYA 4QMLA 5DLSA 3BEGA 4NTSA 3L8XA 5KX8A 4X3FC 4U40A 4C61A 2WEIA 3FXXA 3LE6A 5E8VA 4AT5A 3TZ7A 3I5NA 4A9TA 3NS9A 3EJ1A 5B0XA 4JBPA 3LMGA 3BWFA 4OT5A 1JKLA 3K2LA 4F1TA 1U5QA 3FHIA 3IOPA 3RALA 3CGOA 4A9SA 4D4YA 4DG2E 3EZVA 1KE8A 4QTAA 1PXLA 3PG3A 4L68A 3ZHPC 4I0SA 3ULZA 1KOAA 4RVLA 4HPUE 5CI7A 5HNGA 4QNYA 2C6IA 2R3NA 4PDYA 3V5PA 3GGFA 4XP2A 3LFCA 1T46A 4IFGA 2WMSA 4LI5A 4Z9LA 3DGKA 3VRZA 2VWUA 5IQBA 2DUVA 3FXWA 2PMIA 4IAIA 3NDMA 3COHA 1KE9A 3FI8A 2XKEA 2CGVA 3PWYA 4XX9A 1FGKA 4JJRA 3F5UA 3COKA 3R1SA 4RIWB 4BI1A 1PXMA 2XIXA 5CNNA 4I21A 3G9NA 3ZC6A 4MF0A 2XVDA 2XBJA 3SXFA 3I60A 3LQ3A 3FSFA 5K9IA 4YLKA 2OIBA 2AUHA 2WIPA 3BI6A 3QXPA 4YBKA 3GC7A 2ZYBA 3SV0A 1VYWA 2WTCA 3DCVA 2QCSA 1YHWA 3U54A 1Q8ZA 1ZARA 3MVMA 3TZ9A 3ORTA 4CCUA 4EZ3A 3CTJA 4BTJA 5HBJA 4YJOA 2G2HA 4FEVA 4AG8A 3OCGA 3ZZWA 3TACA 1JBPE 4OBQA 1M7QA 4Y8DA 3UYSA 2X39A 4FNZA 5AR3A 4QTBA 4WNPA 4AACA 2GCDA 3R7IA 3N4VA 4X3FA 4MXCA 3Q4TA 2W05A 3MFTA 5L8JA 3IQ7A 3CD3A 1LEWA 3D2IA 3WF7A 1NVQA 2CKEA 5D9HA 2BALA 5EI6A 2YCSA 3QL8A 1SVGA 4O84A 2GFSA 2WTVA 3L9LA 4F08A 3KULA 5LVOA 4DGNA 3V6RA 4PP7A 4QQJA 3PWDA 3RPYA 1FBNA 2WAJA 5BX0A 2QONA 5K0XA 4MBJA 2IW9A 5DR2A 4FTUA 5IEVA 1XH4A 3OBGA 4IDVA 3W2SA 1NW1A 3K54A 1ZOHA 3EHAA 4JRVA 3NMUF 2X7FA 2BVAA 2PZ5A 3C4WA 3QRTA 1J91A 3HKOA 4GFOA 5CALA 4I5MA 4K0YA 3UMWA 2BPMA 2W9ZB 3L8PA 4OGRA 3KCKA 5LMKA 2BHHA 5FRIA 1P2AA 4P5QA 1H25A 4KWPA 4C4IA 4QQTA 1PKDA 1PKGA 3QQUA 4RC2A 5JRSA 3BLHA 4BCKA 3BGQA 4OTGA 3ZDUA 5JK3A 4BKJA 1FOTA 4O2ZA 4F9WA 4AWIA 4ANBA 3KXGA 2WMTA 5LCJA 2E9NA 1G5SA 4IEBA 2VO7A 3PG1A 3LCTA 4LQMA 4TNDA 1YRPA 5CSVA 2EB3A 2FSTX 1WCCA 2JFLA 4QT1A 5A54A 1DAWA 3W18A 3QQFA 4UYAA 3W8QA 3R7EA 4EHZA 2FO0A 2ZMDA 2BDWA 4RJ3A 4BB4A 4DEBA 1K2PA 2QQ7A 4LMNA 4E6QA 2WTIA 1VJYA 4YO4A 5DWRA 3F7WA 4F6WA 1XO2B 3FDNA 4OTDA 1FMKA 4OR5A 4QMOA 3UO5A 3JYAA 1YHSA 2JDOA 3KK9A 4MH7A 2CCIA 3V5WA 2B7AA 1R39A 3IDCA 5EM6A 3RNYA 5FTGA 4KINA 3GOPA 3KFAA 5CSPA 2PMOX 2B9HA 2CN5A 4GG7A 4JG6A 2VTLA 3QYWA 4L3PA 2ZOQA 4MHAA 4K9YA 4S34A 4CMOA 4DEIA 4N4SA 3BQRA 3V5TA 4D4SA 3AC2A 2X8IA 5EH0A 1PMNA 4JX7A 4IVCA 1KE5A 3GU7A 3MV5A 4TXCA 4I6QA 3MGYA 3HRCA 4IZ5A 3VHEA 2J2IB 2QLQA 3W2CA 3PE2A 4D1ZA 3DOGA 3RCDA 4IIRA 4AZVA 4M0ZA 1V1KA 5DBXA 2W1ZA 4S30A 4TYJA 4V05A 3RINA 4CQEA 2OWBA 4O7YA 3T3VA 1UNHA 5I9WA 3UO6A 5HOAA 4F0FA 4WUAA 2GHLA 2OFUA 3R8PA 4AW5A 5L2QA 2C6MA 1WAKA 3VBTA 3CKXA 4Z7HA 5EDRA 1H1RA 4M14A 2IPXA 4BCMA 3QQGA 4RBLA 4EK8A 3PY3A 1VR2A 2WQNA 2ZDUA 5CU4A 3IS5A 5FP5A 1VEBA 3F61A 3FYJX 5D1JA 4LOPA 4ZZMA 2PZPA 4EOMA 4HVDA 4MEDA 4GYIA 2DYLA 3HLLA 4YJSA 4AE9A 3TUDA 1PMVA 4MXAA 1IA9A 3PVWA 4HYSA 4QP6A 4FEWA 3BKBA 2BRMA 4F7JA 3LW0A 1X8BA 4CKIA 4LGGA 2O5KA 4JL9A 4GV1A 3DTWA 3MFSA 4G3DA 4W8EA 1R0EA 1OKYA 3NCGA 1OPJA 3BQCA 3W10A 4FG8A 1YXVA 2Y4PA 3Q52A 4NZWB 4IH8A 4JR7A 4IM0A 3SDJA 3HNGA 4GUEA 1YW2A 4E26A 3QTIA 5HORA 3UP2A 2W06A 3SRVB 4EYMA 1UNGA 3G9LX 4O27B 3TDVA 3FLNC 5T68A 4RJ7A 2Y6OA 5GIPE 2UUEA 4NFMA 4QNAA 2HZIA 4XUFA 1PXIA 5F20A 4AA4A 4CFUA 5J9ZA 3C4ZA 1UA2A 3QALE 4WA9A 3BGZA 4U81A 4FKRA 4PMTA 4O82A 4FSYA 3R04A 2XCKA 4ZJIA 2OO8X 1J7IA 3SVVA 2HOGA 2X0GA 5K4JA 3ATSA 3EN5A 4O6LA 1WBSA 5M57A 4C36A 4FV5A 3TN8A 2WQBA 3IONA 3FBVA 5EDPA 4M0YA 4FV8A 4IAFA 3FMLA 2X7GA 4LRKA 2C30A 1JKKA 3UIBA 1SVEA 4FT5A 4IZ7A 2OXYA 1OUYA 5AADA 4BYIA 2YEXA 1XH9A 2VTSA 4YP8A 4F99A 3Q5ZA 2HAKA 1OBDA 3BHUA 3PIYA 4RX9A 2Z7LA 3KRRA 4GJ3A 4FV7A 3LXKA 3FZRA 3PTGA 2JAMA 4ZSJA 3TZMA 1WMKA 2VTQA 5KHXA 3ZC5A 5H8GA 3HAMA 2B9JA 5JQ5A 3QZIA 3FMHA 3LZBA 3P4KA 4O21A 3E3PA 5M4UA 2OZOA 3TI1A 1DI9A 4PL4A 1CKPA 4YNOA 5HD4A 2QKWB 2JIIA 2WMAA 3P9JA 3LFBA 4FK6A 4QP2A 4AA0A 5BUEA 3HA8A 1O9UA 4QMPA 1ZZLA 3CLYA 5FEEA 2VX1A 4FEXA 4DCAA 5HX8A 1SNUA 3W55A 3R30A 5LVNA 3E8CA 2VTOA 1U54B 5D12A 5AR8A 4BCQA 2PZRA 4WRGA 1NVRA 2ETKA 4DG0E 2VTTA 1V0PA 3Q60A 4B8MA 4Y5QA 4DA5A 2HXQA 1GAGA 3DKCA 4FSWA 4JRNA 3CXWA 3R2BA 4GU9A 4RPVA 5HIDA 4QMNA 4N70A 1JSTA 1U59A 5M53A 4U8ZA 4NM5A 4RT7A 5LVLA 5EHOA 4ASZA 4TL0A 1XKKA 4L3LA 3OTVA 3F5XA 4OTPA 3COIA 1BL6A 4BGGA 3AMYA 2RKUA 3KF4A 3HA6A 3F3WA 4M12A 2WEVA 2CPKE 3PXKA 4L3JA 3TG1A 3QD2B 2BDFA 2YLFA 3ZSHA 2Z60A 3EQIA 3BU3A 5EI8A 5M07A 1ZOEA 3TUCA 3II5A 3QHWA 2YLEA 4IACA 3KK8A 3R2YA 3GBZA 3IW8A 3ZXZA 4ZMEA 5IDNA 3PJ2A 4FIFA 4AGDA 4W9XA 3LCOA 5HG8A 3ZO3A 4MYGA 1XH5A 3CJFA 4X2GA 5DOSA 5IA2A 3DU8A 3T9IA 2GU8A 2R3KA 3DPKA 2VX0A 3LFDA 2VUWA 2JITA 1YOJA 4JBVA 5TKDA 4EQUA 5KHWA 5H8BA 2ZV8A 4TZRA 3W2QA 4A06A 2KTYA 4ITJA 4XHKB 1FINA 1B6CB 4IC7A 3BHVA 3UGCA 2W4JA 3MA3A 4K8AA 4AN9A 1NVSA 3FMEA 4H1JA 3R9HA 1ZXEA 5E8SA 4ZEGA 2EXMA 1OL7A 3OC1A 4PDSA 3UIXA 4BCOA 3LCKA 4G5JA 4CFVA 3CY3A 3EQDA 4DF3A 3NYVA 4A07A 1YOMA 2XM9A 4QYFA 4CFMA 1V0BA 2BAJA 2IVUA 2PVLA 3BHHA 2YZLA 4QMUA 3ZO2A 4ANNA 4QTEA 2UZWE 4D2SA 4UMTA 5A6NA 3LFQA 5KMOA 5EM5A 3REPA 4GFGA 2XIYA 1GY3A 1OGUA 4CVAA 3SQQA 3WF6A 3VVHA 1O6LA 4V0GB 3UYTA 3ZO4A 2XNEA 3G0EA 2ERZE 2ITUA 5CT0A 4ERKA 3SOCA 4D4VA 1A06A 2R7BA 4BF2A 2VTJA 3NNWA 4MX9A 4FKTA 4PY1A 3DAKA 5I5ZA 2W1DA 1QPEA 2WTDA 3C5UA 5BYYA 4FIJA 1BI7A 1Q8UA 4FZAB 5LVMA 3GQIA 4E4XA 4FBXA 4CRSA 2QOHA 4R3RA 1IEPA 1W83A 4E93A 3B8RA 2OXXA 1REKA 3F5PA 5CEMA 4GUBA 3CSVA 1OIUA 4H3PA 4EBWA 1LPUA 1U4DA 3R83A 3F88A 1DM2A 3ZZEA 5BMMA 2E9VA 3FSKA 4F9AA 5A4QA 4BWPA 3HRFA 4HGSA 5J5TA 4RX7A 4U80A 2I6LA 2ZM1A 3VQUA 3F2AA 3NIZA 4FYOA 3RJCA 3S95A 4FVRA 2C6OA 2J6MA 2G2FA 4Q5EA 3VIDA 4FYNA 2B9FA 4JI9A 1WVYA 2EVAA 1RQQA 2XYUA 4FEQA 4DBNA 3JVSA 3QTRA 3QUEA 1J7LA 3FXZA 5M56A 3OP5A 3G15A 3QKLA 4YU2A 3PY0A 3E64A 3R7GA 2OH4A 4ACMA 1K9AA 4BDKA 1GZ8A 2PVFA 3F2NA 4TW9A 4EL9A 5L3AA 1PXNA 5KMKA 2JAVA 2X81A 4O1PA 4ANQA 1CMKE 4JX3A 5BVWA 1XQZA 4UN0C 3VWAA 4C3FA 4F1MA 4G31A 4GYGA 4J99A 2C6TA 1YDSE 2VGOA 2YJRA 3EFJA 4I22A 4PUZA 3ZH8A 5M4CA 3R8UA 1LUFA 1GIIA 3OHTA 3QRJA 4FKWA 3UOJA 3DAEA 3WYXA 1BI8A 5ETCA 4C4GA 5AAGA 3VNTA 2WPAA 3RMFA 3ROYA 5HHWA 1Q3DA 5HE3A 2YM4A 2I0VA 4ZTRA 4U3YA 4ANLA 1PXPA 2V0DA 2OF2A 4QP1A 3N51A 5C4LA 5EYDA 4CRLA 2QU6A 3QTWA 3KXNA 1Q8WA 4RIWA 4RMZA 5C01A 3R9OA 3C4XA 4ALVA 4EK5A 2PYWA 3A4PA 2C6LA 2X4ZA 3FHRA 3VF8A 1Q5KA 1KV1A 3OWJA 3QGYA 4ZSLA 4F65A 2HYYA 4AF3A 4AS0A 3FV8A 3UO4A 5CASA 5T3QA 1ZYCA 2O2UA 3V8SA 2PE0A 4DFNA 5EM7A 3SXRA 4JAJA 1ZLTA 2QOCA 4D9UA 3BWJA 4NT4A 4PF4A 1BKXA 3JUHA 4EQCA 4NJDA 1TQMA 4EHVA 1ZYDA 5AV0A 5JFSA 4DYMA 1GJOA 3WZUA 5HVKA 2OZAB 1Q62A 1L8TA 2BKKA 4DLJA 2XP2A 3RAKA 5M55A 1H01A 3M2WA 4RJ6A 4GSBA 1MUOA 4I24A 4FC0A 2Y4IC 4E5AX 2P2HA 3GC9A 5ANIA 3R9NA 2IO6A 4GW8A 3A7HA 2G9XA 2J51A 5C8NA 5LJJA 4PV0A 4GKHA 3QCSA 5FTQA 3EL7A 2RSVA 2ERKA 3QKMA 3DAJA 3QRKA 3AC5A 4P2KA 3DBCA 3IGGA 4G9RA 2YDJA 2JKKA 5E8TA 1CDKA 3UTOA 4FKSA 1O6KA 4WNKA 4XBRA 4CLIA 1Q97A 2GNJA 2OXDA 1V0OA 2XK6A 3BIZA 4FTCA 3PZHA 3MVHA 2QKRA 2VO3A 4X2FA 3VS7A 4ZLOA 4ZLYA 3HMPA 3UBDA 3VC4A 4GKIA 2C47A 4WBBB 5KO1A 5HG5A 2XJ1A 2ZM4A 2OW3A 3UODA 3QYZA 3T9TA 3QQKA 4ZTSA 2FSMX 5KMNA 3Q9YA 1FVVA 3KEXA 4CKJA 4IAAA 5HQ0A 3MH1A 4DC2A 2PUNA 4MXOA 4J1RA 3ZU7A 2C6KA 3PA5A 4ZOGA 2H96A 2UW6A 3PJ8A 4R7HA 5HU3A 4L01A 2RIOA 4D5HA 3AGMA 5HE1A 4G16A 3NUAA 4LOQA 3WOWA 2PU8A 2IZRA 4KUJA 3A8WA 3ORNA 4IMYA 1JSUA 2GS2A 2X6DA 5FLFA 3DS6A 3DKOA 3QQHA 5AP1A 2BAQA 2DQ7X 3PFQA 5G1XA 1PY5A 4IM3A 3QTQA 5CEOA 3EFLA 3OT8A 1Q61A 3ODYX 4GVAA 4MXXA 3GB2A 3KRWA 5IMXA 3DBFA 3MESA 1GZOA 2XKDA 3RK7A 2QR7A 4BY9E 3D2KA 1OB3A 1OVEA 2BROA 3KN6A 5KKRC 2XK4A 5DH3A 3QZGA 5CEPA 3RAHA 3ZO1A 5DT4A 1SM2A 2CCHA 1WBPA 4U9AA 4K18A 4RIYB 1LR4A 5KMLA 5L2SA 4NK9A 3HMMA 4YZDA 5D41A 4AZWA 3ZMMA 4I6FA 3OD6X 1ZWSA 4R7IA 2CKOA 1UKHA 3C7QA 4J98A 1YDRE 3CC6A 1TQPA 4RWKA 5HESA 3W2RA 2OBJA 3GXLA 3LM5A 4ZJVA 4U3ZA 2OLCA 5B2LA 2J0LA 2BZJA 5FD2A 3N4UA 4YZCA 1JAMA 4EQMA 4EH5A 2JDTA 4K33A 3M1SA 3TTIA 2GNHA 4JDHA 4ZIMA 3U51A 4EK6A 5C1QB 5LARA 3UG2A 4FIHA 3RP9A 2VNYA 2R3RA 4YO6A 3U6HA 4DGLC 2CHLA 4HGLA 4WRSA 4FV3A 2R3MA 2R9SA 3DQXA 1OUKA 3Q04A 2NRUA 5TT7A 2ITVA 4TKSA 3P23A 4IZYA 2XM8A 5DHJA 3QRIA 3MSSA 5M08A 5HZNA 4F7LA 5L6PA 4GK4A 2AC5A 2ESMA 3OT3A 5GIOE 4RFMA 2QU5A 2XIRA 3U6JA 1RJBA 4KIKB 3NYOA 4FMQA 4YBJA 4C59A 5AUTA 5CEKA 1B38A 2CNUA 4M69B 3EYGA 2VN9A 5HLNA 3W2OA 2WMWA 3FQHA 4QMXA 5JH6A 4U79A 3IPHA 3EKNA 4CT2A 4FODA 3NUYA 4NU1A 4G1WA 3LFSA 4FSQA 3FLYA 3UVQA 4F6SA 3QCXA 3UQGA 4FEUA 3KN5A 4L45A 4ZSEA 4U41A 1PJKA 3MA6A 4JNWA 5E7RA 3JS2A 4KAOA 5TE0A 2HWPA 5LWMA 3FPMA 2PVHA 3DK7A 1IASA 3FMMA 4MD7E 5JFWA 4M67A 5BMSA 4FT0A 4DFYA 2W1HA 4ZSGA 1UKIA 2NRYA 3TWJA 4JDJA 4BTMA 4CFFA 2E9OA 4I1ZA 4AOIA 4CD0A 1IAJA 3R8VA 5E4HA 1I09A 5A4TA 4ALWA 1H0VA 3OZ6A 2CSNA 4C4JA 3QAME 3NVMB 5L8KA 2JKQA 4NFNA 5E8YA 1Q41A 4ERWA 4FTNA 4FSMA 5CU6A 4MWHA 3QQJA 2HW6A 2C0IA 2PVNA 2FB8A 3BE9A 4AGWA 3P1AA 2Q0NA 3F9NA 2BRBA 4H05A 4H39A 1UU7A 2OKRA 2VRXA 4FKPA 4O0TA 3SOAA 4FZ7A 4BZOA 2QOFA 4A4LA 4BCNA 4S31A 4DGMA 3RPVA 2ZV9A 2Q0BA 3LJ1A 3OS3A 2F7XE 2VNWA 3QUDA 2XF0A 2UZTA 3OW4A 4YHFA 5HX6A 3EB0A 1KWPA 2W1CA 3FKNA 1QPJA 3U4WA 1W0XC 3QTXA 2HENA 1VYZA 2R5TA 4AW0A 4UMRA 4MXYA 4G2FA 4BICA 3SAYA 3L1SA 3ORMA 1IA8A 3DNDA 5LWNA 3VS0A 4K77A 3RK5A 2CKPA 2ITOA 1XBBA 4BDJA 2P0CA 3ZCLA 4CV8A 3RPRA 3WYYA 2B9IA 1JLUE 5AR7A 3FYKX 3F3UA 3QHRA 4ASEA 3ZONA 4IWQA 5ETIA 3LXLA 2R3LA 4L00A 3DQWA 1U54A 2JDVA 2XEYA 3BRBA 5AP4A 3KU2A 3PA3A 5T6KA 4K2RA 2CDZA 2RL5A 4Z3VA 3O51A 2GMXA 3ZXTA 4O0SA 2J90A 3K5VA 3R7VA 4AW2A 4E6AA 4BDGA 4G5PA 5C8KA 4ZZNA 4DH3A 3MB6A 3MPAA 5FM2A 3EN4A 2Z8CA 5ANKA 5AAFA 5LMKC 3D7TB 3ZRLA 3LJ2A 3ZFYA 2PUPA 4HCTA 3TV4A 4YJRA 5EHLA 5M09A 1IG1A 5A46A 2QVSE 2GHMA 4IC8A 5BVKA 5C4KA 2YACA 3S3IA 2EWAA 4HGEA 2O65A 2YHVA 4MQ1A 5IQIA 4JR3A 5JFXA 3NWWA 4AX8A 3ANQA 2GS7A 3UNKA 2J5FA 1G3NA 1Z57A 4IFCA 3OOMA 4EUUA 4C33A 4R5YA 3KVWA 4TYHB 5ACBC 3P5KA 1ZMUA 4DFZE 5J9LA 3H3CA 4C35A 4RFZA 4O0XA 3EFWA 4UBAA 5CZIA 3ZYAA 5DG5A 3H4JA 3LAUA 3CPBA 4QP7A 3A2CA 3R0TA 3SW4A 3ZUVA 2Y9QA 4D0XA 5KBRA 2X8DA 1BX6A 3QTUA 1TKIA 3PZEA 5ANEA 5EM8A 3WIGA 2JKMA 4AQCA 3P86A 5F94A 4IAZA 1FQ1B 4FZ6A 5E8ZA 1UV5A 5TO8A 3LCSA 4M84A 2JDRA 4EOQA 4RWJA 4HPTE 3EQRA 3LMIA 2XCHA 3PVUA 4GK3A 4KBAA 2PY3A 4RQKA 3FLWA 4FE2A 3SG8A 2W5HA 3IW6A 4FKUA 3ORLA 5FG8A 1YHVA 4L42A 4O91A 2B1PA 4YC3A 4V0GA 3ZRMA 5JGDA 2Y8OA 3CQWA 4W9WA 1YDTE 3BELA 3HVCA 3UQCA 5CAQA 3TTJA 2PWLA 2ZAZA 3WE8A 1CM8A 3PP1A 5EHYA 4DLIA 4U44A 4XP3A 3BBWA 4BCGA 2Q83A 4I23A 3R63A 5CSWA 3FMDA 4TYIA 5CU2A 4MKCA 4QMSA 2VTAA 4WG3A 3JXWA 3D7ZA 3UC4A 4J71A 4MBIA 1OL5A 4AXAA 3TL8A 5J95A 3VBYA 5GZ8A 3I4BA 3M11A 4XG9A 3KKVA 5J1VA 2B53A 3AGLA 4HGTA 1PMUA 3VJOA 3ETAA 3PIZA 3WZEA 3CIKA 2JGZA 4FSUA 1LEZA 2ZVAA 1GIHA 3PVGA 3R00A 3POZA 4F9YA 3KCFA 1YI4A 2F49A 2H6DA 2YM6A 4S2ZA 2VTMA 4NW6A 2XNGA 4RRVA 4LGHA 3F69A 4D0WA 4FSRA 3VULA 1W8CA 4O7SA 2I0YA 4QTDA 3RNIA 5I3RA 4DCEA 4CYJA 2W4OA 3KQ7A 5AFVA 3AD5A 2F57A 4HCVA 3DJ7A 3PSBA 4O7WA 5AEPA 4BBFA 3S0OA 4C58A 5CAOA 5CANA 3A8XA 3NUNA 3MTFA 5HI2A 4AU8A 4BDHA 2YM8A 1Y8YA 4L44A 5JRQA 5HD7A 3ZLWA 4F63A 4G3EA 1P14A 1OMWA 1SMHA 2VWXA 2I0EA 3HECA 2LGCA 2VV9A 2W4KA 4KRCA 4O6EA 3MB7A 3GU4A 4WG4A 3QD3A 4FNYA 3ANRA 3SC1A 3O23A 2NP8A 4PQNA 4KKEA 5G6VA 2BAKA 2BCJA 2GFCA 4O22A 4TWCA 4ZTQA 3M42A 4TWPA 3KRJA 4DAWA 4BRXA 2WMUA 4GMYA 3DK3A
chains in the Genus database with same CATH superfamily
3W32A 3C9WA 2C5OA 2W7XA 1JOWB 3SKCA 4UV0A 2BIKB 2YIRA 4RJ5A 3PE1A 3PXYA 3OEFX 5J8IA 4DFLA 5K5NA 4FTIA 4WBOA 5DA3A 2YDIA 4FUYA 3I6UA 4WD5A 3R6XA 2QOIA 3VS5A 3LMHA 4OT6A 5BVOA 5EG3A 1BLXA 3FKLA 4AAYA 4KIQA 5FP6A 3QD4A 2OZAA 4IANA 4X6QC 3ERKA 3OXIA 4KS7A 4DEAA 4I6LA 2BILB 4HNIA 3KL8A 4AE6A 3R8MA 3BYOA 2XS0A 3P0MA 4RC3A 4G6LA 3GFWA 2OI4X 5CF6A 1U5RA 3HUCA 3IO7A 3GQLA 4FL3A 4H3QA 3B2TA 4TYEA 3BPRA 3VAPA 4BGHA 2UZEA 3LFEA 2UZNA 4EWHA 4MD9E 4CTCA 3GVUA 1OBGA 4Y72A 4IB5A 4DG3E 2A98A 1NT2A 5CXHA 2XNOA 5AV4A 4RQVA 5HE0A 3OW3A 3F2RA 4UXLA 4QMWA 1P4OA 2PE2A 5HVJA 2BRHA 3OUKA 1O6YA 4PPCA 4QPSA 4WUNA 2XMYA 3D5UA 5I4NA 2BFXA 3E7OA 3R7OA 5I9UA 4H36A 4AUAA 4J97A 4ZY5A 4YGAA 3W0MA 3SA0A 2FSOX 3L9NA 3EQPA 3UVRA 3ZM9A 3OROA 4YJNA 4ASXA 4BYJA 2FUMA 3UVPA 1CKJA 2XKFA 1J1BA 4M15A 5D10A 4HVGA 3EQGA 4EOLA 4HVIA 3FC1X 5HKMA 3MI9A 2R2PA 4BN1A 4RA5A 4CMTA 4EUTA 5FWKK 5IH6A 5IA3A 4M3QA 4FR4A 3V5JA 4FKJA 4FTOA 1H8FA 4GRBA 4XH6A 5DR9A 3TNHA 4DITA 3SW7A 2UW3A 2RFEA 4BTFA 4DGGA 3UDSA 5AA9A 4O7RA 1OKZA 2VWWA 2IVTA 5GZAA 4TPTA 4FG7A 3EOCA 4YZMA 3GU8A 2HWOA 4TT7A 3F3VA 3MIYA 5FUTA 4JS8A 4I0RA 3EL8A 5H3QA 2WELA 4X0MA 2XK7A 2V7OA 4OAVB 3QC4A 4X3JA 4F7SA 2H8HA 3FZSA 4TRLA 5M51A 3A61A 3SXSA 3U6IA 3L8SA 5K4IA 4NEUA 2HZNA 3LFFA 2X1NA 3CTHA 5DIAA 3C0HA 5CYIA 3ZUUA 2X2MA 3EN6A 3H0ZA 2ZMCA 2WOUA 2X8EA 5HE2A 4RIYA 3UPZA 3MN3A 1F5QA 4LGDA 5KZ0A 5AR5A 4D55A 1YXSA 2PMNX 5HTCA 3DB8A 3PDTA 1J3HA 2GSFA 3GCSA 2XJ2A 3TT0A 3PY1A 5FXQA 2WGJA 4NJ3A 5C27A 2B0QA 4FKQA 2ITTA 3MWUA 2C69A 4YC8A 4AN2A 4Y5HA 4BCFA 4W4VA 4DTKA 3W0OA 2WKMA 4PMMA 3O0GA 4XRLA 2EUFB 3ZOSA 4QDEA 1R3CA 3AOXA 5LMAA 3GT8A 3HP5A 3MFRA 5M06A 1AGWA 2VTNA 4TWOA 2CGXA 4FV2A 2C5NA 1YWRA 2OJJA 2UW7A 4DHJA 1M2PA 4D2RA 4PPBA 2YFXA 3QTSA 1RE8A 1XHAA 4GFMA 2ITZA 4L8MA 5EYCA 3O8TA 3UNJA 4I6HA 4XRJA 2EXEA 4NWMA 2QD9A 3R7UA 2YN8A 3UOKA 2FGIA 2WTKB 3DXPA 4DHZA 2NNWB 3LLTA 3DFCB 1Y57A 2O63A 2YISA 5HTBA 2GHGA 2VWBA 3DV3A 4KBKA 4KIKA 5J5SA 5BV3A 2NO3A 1AQ1A 4DT8A 1QCFA 3MY5A 3D0EA 3R73A 3VF9A 5DT3A 4UMPA 2PUUA 3EN7A 2XKCA 3CCNA 3GFEA 3O50A 2LAVA 3H9OA 3PVBA 1H1WA 5FXSA 3IOKA 4ZTHA 1ZRZA 4YSJA 5DI1A 4JDIA 2IF8A 2UZUE 2XK8A 2CGUA 3BU5A 3MJ2A 3GNIB 4OLIA 2F2CB 5HIBA 2HXLA 3IG7A 5DGZA 2BKZA 3FE3A 4BVUA 5EDQA 5E8WA 5CI6A 2P55A 2R4BA 3NSZA 3I81A 5CZHA 2XUUA 3N9XA 3I5ZA 1ZYJA 4X2JA 3COMA 3O7LD 5CF4A 5HO7A 5GNKA 4E4NA 4PNKA 4I3ZA 3VUKA 2YJSA 3KVXA 4TTHB 3UZPA 1Q8TA 2J0KA 4B8LA 4DFXE 2QOLA 3CS9A 3U9NA 4L53A 4KSPA 4IE9A 3PIXA 4G3GA 4F7NA 5KNJA 3JR1A 2WMRA 5EW3A 4IJPA 4YC6A 4NYEA 4IDTA 3KRLA 2CMWA 3OXTA 1H00A 4Q2AA 4ANSA 1PRYA 2WD1A 3VUIA 3GC0A 2X9FA 4QYHA 2XYNA 4FNXA 3VUMA 4YMJA 3ALNA 2YERA 3FZPA 4X21A 4IX3A 5EYMA 4E8AA 2QOKA 2XA4A 5DR6A 5HBEA 4E7WA 3E8NA 3KMMA 5A4LA 5HICA 2C0OA 3QA0A 3ZEWA 4RWLA 1GIJA 4MD8E 3G90X 5E92A 1H07A 1E9HA 1U46A 2PVJA 4LM5A 2GDOA 2UVZA 4D2TA 2JFMA 3OOGA 4FL1A 4RJ8A 4KRDA 4P90A 5D7AA 5TR6A 3TJDA 4CV9A 4O4CA 3CEKA 4YJVA 4K6ZA 2G2IA 3KB7A 5KMMA 3DZOA 3AD4A 2W17A 3F7ZA 1AD5A 4EOIA 5CSXA 3QD0A 4XMOA 4DTAA 3UOLA 1PHKA 1UU8A 4JQ8A 2RG6A 3EFKA 4O38A 5LMBA 3TMOA 5GINE 4O2PA 2VWVA 4CNHA 5IUHA 5ANOA 2WNTA 3JY0A 3TCPA 3F6XA 2FH9A 3QTZA 4C0TA 2CJMA 3DXNA 4I5HA 3DLSA 3UOHA 3DKGA 3BLQA 4YSMA 2BTRA 4IAYA 5K5XA 3UG1A 5IA0A 5F95A 5H2UA 4BWXA 1H1SA 3B8QA 1XH6A 3QLFA 3D5XA 2OGVA 5HGIA 4PWNA 5L6OA 3AXWA 5HU9A 2F7ZE 1G8SA 2YIXA 2ITWA 4F4PA 3TYKA 1RW8A 2R3OA 4N6YA 5LCKA 5J7BA 3TUBA 3Q6WA 4L67A 5M4IA 4FT3A 3G2FA 2W5AA 2V5QA 3E93A 1DAYA 1YXTA 3Q32A 4NM0A 3D7TA 5CVHA 4G17A 4ANMA 5AP3A 3BU6A 3LFAA 3U55A 2DS1A 3PPZA 3KMWA 4NL0A 4TN6A 4ZZOA 4FGRA 2QOBA 4KIPA 4RX8A 4IM2A 5JSMA 1ZYSA 3BYSA 3PUPA 3PLAE 3PXQA 2OF4A 4O7TA 4AXEA 3KMUA 4DDIA 4LV8A 1MRYA 1Q4LA 4NIFB 4KA3A 4TYHA 2HW7A 4L46A 4X2KA 4EOKA 3VUHA 4R6VA 3NUUA 3I7BA 4YJPA 4DH8A 3P7CA 4EH3A 2IZTA 2NPQA 2UW5A 4L43A 4K11A 5CWZA 3F66A 2P4IA 3AC3A 1W2FA 3QQLA 4EORA 4Y46A 2QO7A 2QODA 4HW7A 4IWOA 4EEVA 2CKQA 1XBAA 4J95A 2UW9A 3FZOA 3W8LA 3QX2A 4AOJA 4E20A 4ZJJA 4W4XA 4TY1A 2UVXA 3IW4A 4GL9A 2EXCX 4QOXA 5IQGA 4ZMFA 4FV0A 3TIZA 4I4FA 4YLLA 3NEWA 4DINA 3DNEA 2C6DA 5IUIA 3MJ1A 1UWJA 4IW0A 5JT2A 1YXUA 3AQVA 3OCSA 4FRFA 3FL5A 3Q2JA 2WMQA 1XH8A 2QOQA 3NFGB 5AUWA 3QWJA 4C4HA 3C4EA 4R1VA 3VO3A 5J7HA 2HY81 4C34A 2C5XA 2ZFYA 3FI2A 3QF9A 5HO6A 1P5EA 4D28A 3OUNB 4G34A 1ERKA 4UALA 4DH7A 4JAIA 1P4FA 3R1NA 4C02A 3S1HA 4DEGA 4L6QA 4ACCA 4C37A 4OTQA 5M4FA 1E1VA 3OCTA 2YAAA 2C1BA 3FC2A 3E88A 5FDPA 2WFYA 2A0CX 4KNBA 4UWYA 3O71A 4O86A 3C4FA 3BHYA 3HV5A 4IB0A 4QP4A 3QBNA 5L2WA 1CSNA 2VWYA 3FLQA 5CLPA 2G01A 4MQ2A 5IA5A 4H1MA 5IQFA 4CYIA 4WIHA 4FNWA 4YHJA 4F09A 4D1SA 4JQEA 4JVGA 5CXZA 5IH4A 5DVRA 2OJ9A 3AT2A 4J8MA 4IHPA 3RWQA 4CZUA 2WZJA 4YPSA 2VTHA 3E92A 4KB8A 2XNPA 3E63A 3K5UA 3PJ3A 3FQEA 4ZS0A 2ITQA 5E1SA 3A7JA 3C4CA 4ITHA 4N0SA 3TNWA 5GZ9A 2A1AB 3MDYA 3WF9A 4EK3A 2IVSA 4OBOA 4AZEA 4R1YA 4QMYA 2WIHA 4F0GA 1ND4A 3ZUTA 1QPCA 3FMKA 4O0UA 3QWKA 5FEDA 4BHNA 5CU3A 2HELA 3NW7A 3FY0A 2F2UA 4UZHA 3UPXA 3RZBA 2CNQA 4XJ0A 4FG9A 2UZVA 3RZFA 3DFAA 2SRCA 5ITAA 2FSLX 4FKGA 4ZXTA 4M8TA 5AV2A 4EKLA 4A4XA 4B7TA 5A6OA 3ATTA 5A4EA 2OJGA 4QYYA 3CJGA 3R21A 5EFQA 3DBQA 5CX9A 3E3BX 5IMEA 5L2TA 5IQEA 4OAUC 4RG0A 5ACKA 5IA1A 1W2CA 4C38A 3BLAA 1ZY5A 3D5VA 3AMBA 3I0OA 3NPCA 4LRMA 1OKVA 4EZ7A 4FTRA 4N6ZA 5D11A 3RPSA 1M14A 4E6CA 4XCUA 3NAYA 4YHTA 3VS2A 1KUTA 3NR9A 5FTOA 3UZRA 2IEWA 1PXKA 3CKWA 3WZDA 4A9RA 5IG1A 2ZB0A 3DKFA 2ACXA 2W96B 3GENA 3ULIA 4DE4A 1HCKA 2Y7JA 2OK1A 4YTFA 3F3TA 5EOBA 4XP0A 4LV5A 3TNPC 4CTBA 2ZJWA 4QPAA 4AP7A 5HIEA 3JY9A 4ALUA 4IVDA 3RM6A 4PTEA 3MY0A 4USFA 5FQDC 3OCBA 3H10A 4Y85A 3WZJA 4C2WA 2C4GA 2CN8A 1E1XA 3PXZA 4U43A 4MK0A 1Q24A 2A19B 3MBLA 1XR1A 5CAPA 3R9RA 2Z7SA 3IGOA 1Q99A 4FTQA 4X6RA 1YQJA 4JIAA 4RIXB 2WMBA 4CZTA 5AUXA 3EH9A 4NUSA 3R1YA 3VHKA 1BUHA 2WQMA 2YIWA 4FSTA 3SRVA 3TZ8A 3PLSA 3F3ZA 3Q53A 4EC9A 3HV6A 5D7VA 4I5PA 2HCKA 5HTIA 4M7IA 1JNKA 4U42A 4BKZA 1W98A 4UMQA 5H8EA 3EKKA 4ID7A 1YWNA 3RPOA 2PTKA 4F70A 1WBOA 3VBWA 2RFDA 4WNMA 4M68A 4EBVA 5F9EA 3U87A 4GCJA 4XEYA 1UVRA 5AUUA 4AQKA 3GP0A 3W1FA 4B0GA 1FPUA 3BV3A 3TKHA 2R0UA 3Q6UA 4C4EA 2V22A 4TWNA 4KSQA 5AAEA 4D9TA 4R3CA 2J9MA 4KABA 4E73A 3R1QA 3A99A 5EQPA 4IWPA 4OTWA 2W1FA 1A48A 3WE4A 1MP8A 3DDPA 4NH1A 3LQ5A 1OKWA 4J8NA 3V8TA 3OEZA 4CCBA 5A3XA 1OL1A 2WTKC 3UNZA 5L6WL 4OTHA 4YTHA 5AP7A 5ANJA 4M13A 3PP0A 5B7VA 4XOZA 3S4QA 2RFNA 2QNJA 4I20A 4EH4A 5KUPA 4FJVA 4D2PA 1Y6AA 4GEOA 3LKMA 1H28A 3VBVA 5FGKA 5JKGA 1FMOE 4O0RA 3ENMA 3MW1A 3RBWA 2WMXA 4PMPA 4ONAA 2A2AA 5CVFA 2OU7A 2X4FA 2W5BA 4PP9A 5BYZA 2OSCA 2PZIA 3FLSA 3FI4A 1KE6A 3RK9A 4A7CA 4FKOA 3QGWA 2QO9A 5IU2A 4CLJA 4QEBA 4ZY4A 3ALOA 3Q9ZA 2WU7A 5HLWA 3RAWA 2C0TA 5AUVA 4NCTC 4RIOA 2PUIA 4I4EA 1PXOA 4GVJA 5ETAA 4FZFB 2QO2A 5CSHA 5HO8A 2BRNA 3W16A 4Y73A 5HG9A 3OBJA 3HAVA 3NGAA 4WSYA 4YZNA 3MH3A 3PRFA 4PL5A 3UE4A 3P79A 4UZDA 4MWIA 2DWBA 3BHTA 2AC3A 2JC6A 1WBWA 4O1OA 4KD1A 1W7HA 2IVVA 5CU0A 2HIWA 4APCA 2GQRA 1GNGA 4RVMA 2IWIA 2PVKA 3IW7A 5I9VA 1IR3A 3CQUA 3FJQE 3AMAA 1DS5A 4Y83A 3KXZA 4OTRA 4E3CA 2CGWA 4I5CA 4QQCA 4AZSA 4E4MA 3QZHA 3DJ6A 2VTPA 3WARA 1BYGA 1F0QA 4XG7A 4IB3A 5JEBA 3VW6A 3W33A 5JFVA 4DTBA 2UV2A 3VS3A 3WIKA 5CAVA 5I9ZA 2JBOA 1URWA 5HLPA 3V5LA 3ZTXA 4DEDA 4WHZA 5A9UA 2QI8A 2J50A 2GTNA 4JBQA 4F0IA 4IVBA 5I9XA 4EZ5A 2BZKB 2XRWA 3E8DA 4GS6A 1PXJA 4JMQA 3GI3A 2WTWA 4ENXA 4D1XA 5CNOA 2X6EA 4AW1A 3UJGA 2AYPA 4OTIA 3LIJA 3MYGA 4J7BA 4NCTA 4DHIB 5CT7A 4MVFA 3P08A 5H9BA 1TVOA 4U7ZA 5IA4A 5C9CA 4UWCA 5IEYA 4Q9SA 1W84A 2XRUA 4FV4A 4ACDA 3BLRA 4BHZA 4HOKA 4ACHA 4PMSA 5CAUA 5A4CA 3D83A 3RVGA 4YURA 4FOBA 3AC4A 4CXAA 4MAOA 4FKLA 1XH7A 3HZTA 4DEHA 3GEQA 2EU9A 4YTCA 5J1WA 3MS9A 5IISA 3PXFA 4EJ7A 3FI3A 2XZSA 5AX3A 3O7LB 3RAIA 3AD6A 4ZY6A 5BUJA 4OW8A 3HMOA 2PSQA 3LPBA 2O64A 1YI3A 1A9UA 5DEWA 2XBAA 1H1PA 2PHKA 5CENA 4FTLA 5AR2A 3HV3A 3DDQA 4RLKA 2YZAA 1QL6A 4RWIA 5E91A 3ZEPA 1XBCA 2YCFA 5BUIA 4ASDA 4ZTNA 3I0QA 2W1GA 5F4NA 5AUZA 4FA2A 3ACKA 4E5BA 2REIA 4UYNA 4R5SA 2CLQA 2UZDA 3LHJA 3AC8A 3LVPA 2Z7RA 4FTMA 4V01A 4IX4A 5LVPA 3T8OA 4DN5A 3ZBFA 4U97A 2XNMA 5GJGA 5EW9A 4AT4A 1T45A 3PSCA 5AJQA 4UX9A 3ZLYA 4FTAA 5CS6A 4LG4A 3MH2A 4FT9A 3LQ8A 2HZ4A 3G5DA 4F9BA 3V3VA 3A7FA 2PE1A 4XG2A 4E4LA 3BYUA 3ORIA 3OWKA 3ZRKA 3C0GA 5BNJA 4PTCA 4J53A 4BDIA 3ACJA 1ZAOA 5BQ0A 5I0BA 3HGKA 4EH7A 1GZKA 4ACGA 1JPAA 4L7FA 3O8PA 2J0IA 4O81A 2C5VA 3ENHA 4CG8A 2B4SB 4IB1A 1CTPE 1YXXA 3VS1A 2ZV2A 3A62A 3VRYA 3ZM4A 4C57A 1R1WA 1TFFA 4CFWA 5DN3A 3MIAA 4TYGA 2R7IA 1TQIA 3MFUA 3AT3A 3WF8A 3PA4A 3Q3BA 4D2VA 2W1IA 5JZJA 1WBVA 3DK6A 4PDPA 2JLDA 2YIQA 4RX5A 3EIDA 1Y6BA 1F3MC 3THBA 4D5KA 4BFMA 5K3YA 3MVJA 1UU9A 4E5WA 2XJ0A 3GCQA 5AWMA 3QCQA 3G51A 4AN3A 3C50A 4O7LA 4BC6A 2BZHB 3HMIA 1PYEA 4FVPA 4YJQA 4FIIA 2WHBA 3DJ5A 2GNFA 3NUSA 3NZ0A 4TNBA 2VAGA 2Y4IB 3QU0A 1OI9A 5HCXA 4RVTA 4O0WA 3WILA 4B9DA 2YDKA 3QX4A 4DH5A 4YNEA 4FK3A 2ITXA 3CQEA 4RC4A 2YIYA 2UZLA 5AM7A 1YWVA 3GCUA 3DBEA 3JPVA 4KIOA 2QG7A 4GT4A 1RDQE 4IXPA 4MNEB 3SG9A 4HNFA 5AIRA 1Z5MA 3POOA 4EWQA 2GQSA 4QO9A 4AA5A 5DFPA 3WF5A 3QZFA 1JKTA 2ITPA 4NIFA 3PPJA 3BEAA 4BZNA 5BVNA 3K3IA 4I6BA 1S9JA 3N4TA 4JBOA 2Z2WA 2Y0AA 4J52A 2F9GA 4O0YA 3P78A 5AA8A 2Z7QA 3EQCA 3I6WA 4PPAA 4Q5HA 4AT3A 5AIKA 3QC9A 4BBEA 1WVXA 4BIDA 2OICA 4CFNA 3EYHA 3OG7A 3VS4A 5L2IA 3C5IA 4YZBA 1W2DA 2ZM3A 1K3AA 3HUBA 4WO5A 4GU6A 1PF8A 2JIVA 4U0IA 4F9CA 5CF8A 5L4QA 4BCIA 5DT0A 2F7EE 2XB7A 4QYGA 3NW6A 5HVYA 2FA2A 2XEZA 3CTQA 4MTAA 1UU3A 2EB2A 3KC3A 1WFCA 3VS6A 5CEIA 5CQUA 3WI6A 5ANDA 2VO6A 3CR0A 4HJOA 3WZKA 3RTPA 4D4RA 4BDFA 3I79A 4HZRA 4ZAUA 2PVYA 4P5ZA 5JN2A 2J0MB 4FV6A 1JVPP 5JQ8A 1J1CA 4BKYA 2C1AA 3LCDA 4A9UA 2E2BA 2GNGA 1OIYA 2C68A 3ORKA 4G6OA 2X2LA 4WKQA 3R8LA 4XG8A 1NA7A 4LL0A 4EH2A 3AKJA 1VZOA 3V6SA 2XIKA 5B2MA 4QP3A 4BDEA 3Q4CA 4C7TA 4XLIA 3HX4A 2UW4A 1M7NA 4EOSA 2E9UA 5EKOA 3H9RA 4W4WA 2VWZA 3ZBXA 4USEA 5C26A 5AM6A 5DE2A 1H27A 4IX5A 3VBQA 4XV3A 3ZFXA 4AZTA 3Q4ZA 1IRKA 3G0FA 3PYYA 2FYSA 1ZOGA 4FSZA 3VUTA 4EH6A 3ZFMA 1YVJA 2R3FA 3EQHA 4NTTA 1J7UA 3BBTB 1H26A 5KE0A 3DA6A 1R0PA 4O0VA 3VW8A 3I7CA 3QFVA 4PX6A 5M44A 4AXCA 3CE3A 5EYKA 4RJ4A 1WVWA 2JDSA 5L8LA 3FY2A 4DGOA 3A4OX 4LFIA 4PTGA 3FEGA 4FTTA 1B39A 2PK9A 2VD5A 3BX5A 3IDBA 3UIUA 3U9CA 3B2WA 1SYKA 4BI0A 2FVDA 4BIEA 4HYUA 4EKKA 3C1XA 2HZ0A 3TJCA 3KIOC 4DDGA 5BYLA 1UNLA 3LXPA 3TV7A 5DRDA 5AP6A 3VQHA 2QOOA 2QG5A 3C0IA 5HCZA 4ARKA 5FEQA 4ZLZA 4O7ZA 5GJFA 2CNVA 3TKUA 2ZB1A 3MH0A 4R77A 4IJ9A 4FI1A 1JWHA 2OJFE 4YPDA 2R3PA 4FIGA 5E9EA 2IZUA 3G6HA 4IADA 3PJ1A 2R3IA 3Q2MA 5CF5A 4FV9A 4F6UA 5JGAA 4L52A 2BIYA 2W99B 3UZTA 3RWPA 2B52A 3ZS5A 3OF0A 4NM7A 1HCLA 4IVAA 5JMSA 1OECA 5IQHA 1ZZ2A 4HZSA 5KBQA 3SX9A 4ITIA 3NVKI 3SGCA 2H34A 5HCYA 4QMQA 4ZK5A 3E5AA 5C8MA 3G33A 4H3BA 3GCPA 4EH8A 3MTLA 4QPMA 4O7VA 2XNNA 4QD6A 2BR1A 5BVFA 4S33A 2I7QA 3Q9WA 3U4UA 4II5A 3NRMA 5IEXA 3JVRA 5AMNA 4E1ZA 3CGFA 3QUPA 4WG5A 4M69A 4YJUA 3IKAA 3VJNA 3RM7A 4Z55A 3E62A 3ZLXA 1STCE 3V01A 5GHVA 4BR3A 2YABA 4EOOA 4FT7A 3MPTA 2JIUA 4BDBA 4EONA 5DYJA 5IQDA 3F82A 4MCVA 3UDBA 5TF9A 5KCVA 3FAAA 3OVVA 4YZ9A 4FGBA 2KULA 1MRVA 1MQBA 4RIXA 4G9CA 5EOLA 3AC1A 4QRCA 3FZ1A 4QQ5A 3R8ZA 3S00A 3BYVA 2BZIB 1XWSA 2VTIA 3NCZA 4FKIA 3FMNA 4XG4A 4Y95A 4LUDA 5J87A 5LQFA 3R01A 4G3CA 4XV2A 5DRBA 1GZNA 2ONLC 2RG5A 3KRXA 4JOAA 2J5EA 2V62A 3LJ0A 5AR4A 3W0NA 4FTKA 3ZDIA 2VX3A 5AV1A 3VN9A 3MPMA 4X2NA 4AFEA 3DXQA 2BDJA 4BIBA 4C3PA 1W82A 4DBXA 4BL1A 3O17A 4LRJA 2C3JA 1XJDA 4CEGA 4MBLA 3LFNA 3D4QA 4XNEA 4CZYB 3NUXA 1M2RA 2J7TA 2WXVA 4X3FB 4F78A 4G6NA 1CKIA 2XARA 2HK5A 2O3PA 4WOVA 3MVLA 1OPKA 3KULB 2YA9A 3UQFA 2Z02A 1S9IA 2R3JA 4JLCA 4LUEA 4CSVA 1Z9XA 4RGJA 4U6RA 1G8AA 2YWPA 3EZRA 5KMIA 3WBLA 3RHXA 3D5WA 1FGIA 4NW5A 3I1AA 1ZMVA 2B54A 4FICA 4M66A 5IQAA 3GCVA 2X9EA 2BMCA 3A60A 3GOKA 2AQXA 2OH0E 3UMXA 2C3IB 2YM5A 4MF1A 3CP9A 4CGAA 4HVSA 2CLXA 4CT1A 4RZVA 5I3OA 3H9FA 5CVGA 4HYHA 4EYJA 5IPJA 2UW0A 4BBMA 2YM3A 2WQOA 3TNQB 2P33A 3QLGA 2QC6A 2C3LA 2R3HA 3BCEA 2B55A 4ENYA 1L3RE 3FPQA 1MRUA 4A4OA 3IK3A 3KA0A 2VZ6A 2W9FB 2ONLA 1M52A 5I9YA 3TKIA 4I94A 4R3PA 3TNIA 1APME 4AGCA 5EW8A 3V8WA 3P7BA 2X7OA 2ETMA 2YCQA 5KKRB 4D2WA 1Y91A 3BYMA 1OL6A 3KGAA 4FF8A 4AZFA 4EC8A 3GU5A 2W1EA 5FDXA 4NKSA 4RZWA 3FZTA 3R22A 4QMZA 4DHFA 2J4ZA 4QYEA 3LOKA 2UW8A 3AT4A 4LOOA 1EH4A 2WOTA 3R02A 3DY7A 4EK4A 4IX6A 2OFVA 3RI1A 3D15A 3E87A 3H0YA 4MXZA 2XK9A 4O4BB 2G15A 3S2PA 3ID6C 5C03A 4DFUA 3GUBA 5IQCA 4Z7GA 4N57A 3KXXA 5IUGA 5JGBA 3W0PA 2Y6MA 2J0JA 1TZDA 3HL7A 1OL2A 4BZDA 4DEEA 4J96A 3A7GA 3FUPA 3LXNA 3QRUA 1ATPE 1SVHA 2PVMA 5J79A 5KMJA 5JZNA 2XNBA 3FMJA 4C2VA 4WNOA 3L8VA 2YWVA 3LLAA 3FLZA 1KSWA 3V5QA 3ZSGA 2O0UA 2QHMA 5TOZA 1KV2A 3OY3A 3RCJA 3QKKA 3OMVA 3VUGA 4C4FA 4CFXA 4GIHA 4WT6A 2PMLX 4NM3A 4GT5A 4Q9ZA 4KS8A 2RGPA 3BZ3A 2PZYA 2GQGA 2R3GA 3GU6A 4FL2A 4RSSA 2RF9A 2PVRA 2IN6A 4V04A 2IW8A 2PL0A 4B4LA 4LL5A 3CPCA 1OIQA 4IQ6A 4OBPA 5BVEA 1PYXA 4AFJA 4B6LA 1WBTA 4YR8A 2YITA 3L9MA 4UWBA 4ZP5A 4AGUA 4GK2A 3R9DA 3HRBA 4LMUA 4CMUA 2R64A 2GNIA 4XOYA 5EI2A 1ZY4A 3FL4A 3NNXA 1YKRA 5LXMA 3D14A 2H9VA 5E90A 3PUFC 3EMGA 3EQBA 3OY1A 3V04A 5HNIX 3IDPA 5FBOA 2UZOA 3PPKA 3OWPA 4YUQA 1WZYA 1YI6A 3ORZA 3ZLSA 3IW5A 1Q3WA 2F4JA 3O8UA 4C8BA 5BVDA 4GJ2A 3NNUA 4MNFA 4USDA 4JT3A 1H1QA 4JIKA 4O96A 4W8DA 3NNVA 4B99A 3ODZX 3DLZA 4RFYA 3PRIA 1REJA 1PMEA 3HEGA 3T3UA 3U8WA 3TM0A 2IZSA 1Y8GA 4QP9A 4UXQA 5B2KA 4UEUA 1ZMWA 2XAOA 4O7NA 4BJJA 3NX8A 4CG9A 3W2PA 2BFYA 4BCPA 2XANA 3GC8A 3ITZA 3O2MA 3Q96A 1YOLA 4JQ7A 4JXFA 4I41A 1JSVA 3EN9A 3MY1A 4M97A 3TXOA 1HOWA 2C6EA 3SHEA 4EHEA 3P7AA 2WO6A 4YJTA 5HG7A 4RLLA 3HDMA 3FKOA 4O83A 2XK3A 4KBCA 4ZTLA 4R8QA 1H0WA 2WU6A 5AX9A 4BTKA 3W0SA 3TIYA 4EOJA 1IAHA 4DT9A 2VGPA 2YCRA 3L9PA 3PSDA 4W4YA 1NXKA 2UZBA 4NSTA 3CBLA 4LYNA 2VTRA 2WB8A 3HP2A 4FSNA 2G1TA 3D9VA 3NUPA 4GIIA 3HMNA 4JG8A