5HLPA

X-ray crystal structure of gsk3b in complex with brd3937
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
337
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPREQIREMNPNFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title Inhibitors of Glycogen Synthase Kinase 3 with Exquisite Kinome-Wide Selectivity and Their Functional Effects.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 337
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hlpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hlpA01
4CKRA 1OECA 3FZTA 4UY9A 3C4FA 4BDFA 1SYKA 1X8BA 2R3OA 3PVWA 2ZJWA 3K3IA 4IMYA 2X8EA 1ZOHA 2B52A 3EN4A 3KULA 1Y91A 1U54B 4FIIA 3ZU7A 4BZDA 3I5ZA 3EFKA 5CEQA 3TZ7A 5DE2A 5CEOA 5IH6A 2WO6A 4GL9A 4BIDA 4U3ZA 2YFXA 5K3YA 2ITNA 2XM9A 3QHWA 2WMRA 4B8LA 2I0HA 3PLAE 2Y4PA 4PP9A 2O2UA 3QX2A 4NKSA 3TXOA 3ORLA 3Q2MA 5HCYA 4JDJA 4JG6A 3MFSA 5EYKA 3EQRA 2JAVA 3GC8A 2C6EA 4FI1A 3WF8A 5KMJA 3UNKA 1DAYA 2BIKB 3FI4A 1ERKA 4KABA 4DC2A 1ZYLA 2JKQA 3QQJA 4FTLA 4L3PA 5EM7A 2YDKA 4AP7A 3LXPA 5LVMA 2RGPA 2WQEA 4EHVA 4QP4A 4FIGA 2W9FB 3VULA 1KE9A 2ETRA 5K9IA 4RA5A 2Z7SA 3VUIA 2Z60A 3KK9A 2GTNA 2JIUA 3R8LA 3HMNA 3P1AA 4NKAA 5AA9A 1HCKA 2OZOA 3MI9A 5IQAA 4CRLA 2HWOA 4MF0A 4AWIA 2ZDTA 3LVPA 1YXSA 4XRLA 3R2YA 4HYUA 2GFCA 5FDXA 5L2QA 3C13A 3SAYA 3PVUA 4CCBA 3EFWA 4AZEA 2BPMA 1U5QA 3TCPA 4DCAA 3ZO1A 3I6WA 5LMKC 5EOBA 3VO3A 5IEYA 4EI4A 5IG1A 2CJMA 3IW4A 2XK3A 3KVWA 3LM0A 3GC9A 4H39A 4C8BA 5A4QA 2BFXA 1SMHA 4YJTA 3HV3A 2VTOA 5AP2A 2HY0A 3QD0A 4ZTHA 3HP5A 5EFQA 4W4XA 5CASA 3ENMA 1FMOE 1XWSA 2OZAA 1YOMA 3IPHA 4Z9LA 2W1IA 2VTMA 2WOTA 3U87A 4BCOA 5ICPA 1GOLA 5JFSA 1IAJA 3VUGA 1XH6A 1EH4A 3UP7A 1Q5KA 3LJ1A 5H9BA 3RKBA 3Q3BA 4D5KA 4EK5A 2XUUA 1OKVA 1YI4A 2BKZA 4IB1A 2XNNA 4B0GA 2C4GA 3R01A 1PXIA 5L6WL 2RKUA 4FSMA 3WIKA 4EH3A 1H1PA 5BQ0A 3FYJX 3SQQA 2G9XA 4WNPA 4L67A 5AUWA 3NZ0A 1PXMA 5JZNA 1KV2A 3NAYA 3ULZA 1BL7A 4NCTA 4O6LA 4A9SA 4ANOA 1BI7A 4ANMA 4E6AA 2BRMA 3RZBA 3SOCA 3DAEA 4EHEA 4W4VA 4LL0A 4M69B 2A19B 4QNAA 1XO2B 3QRIA 4FKWA 5JZJA 5IQDA 5FG8A 3U55A 3QD4A 1JSTA 5IZFA 2XH5A 4X3FB 4W9WA 2QOIA 4HNIA 2YIWA 3MJ1A 4G6LA 4NM0A 4QD6A 3UTOA 3F69A 3GU8A 3EQGA 1OKYA 3LFSA 2BR1A 5TO8A 3BELA 3SD0A 2I1MA 4YZBA 4QYGA 3MS9A 2E9PA 2PY3A 4PTEA 4F09A 2QLQA 4QO9A 2B9FA 4YBJA 1SZMA 2XCKA 3AT3A 1Q97A 2BHEA 3HV4A 2X2MA 4NYEA 2PZ5A 5I4NA 3EQCA 3PE2A 4QYFA 3HMIA 2XK4A 2YIYA 1U46A 4WRSA 4ZJIA 2G2HA 5EDQA 5J95A 1PYEA 4DEIA 2WMWA 4FOBA 2VTHA 5CENA 2B7AA 2BRBA 1BMKA 4GG5A 4GFGA 4IZ5A 2P2IA 1SNXA 4JS8A 3WZKA 3KF7A 4R77A 4YC3A 3G9NA 3MPTA 5D41A 2BAJA 5CAPA 4O7SA 4CFXA 3FMJA 4LL5A 5CU6A 2EUFB 3I0OA 1W7HA 4ITHA 5L2WA 5HIBA 3T3VA 3TV6A 4G5JA 4IWDA 1WBSA 1H1RA 4RJ7A 5HKMA 3UC4A 4N6ZA 4RT7A 3DOGA 3ZFMA 4BDHA 4GVJA 4Q9ZA 2GS6A 3NNWA 3BEAA 4JR3A 5AX9A 4EH6A 2F2UA 4U8ZA 5CVHA 3F3VA 4I5HA 3TJCA 5B0XA 1ZYSA 3MA6A 2F57A 3Q52A 1KOBA 4BI1A 5CXHA 3ZLYA 3QQUA 3R30A 3C4XA 5IQHA 1YHSA 4OTGA 5F20A 4OLIA 4CT1A 3EQFA 3DB6A 4HZSA 4DEEA 4NJDA 5AP1A 2OJGA 2X81A 5BUIA 1T46A 4RIYB 2X7GA 4FKSA 4YSJA 2GS2A 3GU6A 4IJ9A 3HRFA 4U6RA 1NT2A 4CQGA 2YN8A 3U4WA 2CNUA 4D1SA 2WMXA 3DQWA 1M2QA 4C35A 5EHYA 1CTPE 2FVDA 1PJKA 4DT8A 2I40A 2HXLA 1W98A 2I0EA 2A4LA 4PX6A 5HU3A 3GCVA 2BZHB 2ITVA 4LUEA 5IMXA 4XH6A 4RRVA 5J9ZA 5KNJA 3GOPA 3MY5A 3S4QA 4A4OA 2WMAA 4E93A 4IQ6A 4I6HA 3DK3A 4HOKA 4FTQA 4PDSA 3BLHA 4JOAA 3H9FA 2HZIA 3SC1A 3AGLA 3OXZA 3IW5A 2O0UA 4FYNA 4I4EA 5EKOA 4USEA 2YWVA 3MESA 3MFUA 2E2BA 5E4HA 2QC6A 3DBQA 3HNGA 1PKDA 3GQIA 4FSQA 1PF8A 3COHA 4FTIA 3ZUTA 1YW2A 3NGAA 5CQUA 4CGAA 1MP8A 3NYVA 4ZSEA 2J90A 5CU4A 1H1QA 4GT3A 4IX6A 2UZUE 4Q2AA 4XV3A 5IISA 3L8SA 2WEIA 1JSVA 4FTUA 2JAMA 2WAJA 1UV5A 3KRLA 3FPMA 3HGKA 1Q8UA 4FE2A 1S9IA 3CXWA 3RAWA 3MA3A 4OW8A 2VTTA 1OGUA 3ZDUA 1M7NA 4OTDA 4FTTA 3D15A 3FY2A 4E26A 4I20A 5M53A 3EKKA 1RQQA 3MH0A 4JX7A 1OPJA 4F7NA 2NO3A 3E7VA 3BGQA 5FM3A 2O63A 3Q9WA 5CWZA 2QI8A 3VS4A 3W8LA 2V5QA 4ERKA 4FEWA 2BIYA 4IE9A 5CZHA 5CS6A 5CZIA 4BR3A 4GK4A 3GB2A 5EM5A 5IPJA 4MYGA 4V0GA 4ZTRA 2VX1A 4D2TA 1DS5A 1WAKA 2FGIA 4ZMFA 3OEFX 4J98A 2OIQA 2CSNA 4FKTA 2EXMA 3ZO4A 4ZLOA 3HEGA 4JQ7A 4V01A 4JL9A 4L3JA 4YURA 5FEQA 1FQ1B 2IO6A 5JGDA 3I4BA 3NYOA 3E3PA 5JGAA 2QCSA 2VTAA 3V5TA 1XH7A 4IVAA 4O7RA 4DBXA 1UNHA 4GJ2A 2QOKA 2H8HA 2R3LA 4JRVA 4X21A 3GCPA 4ERWA 3EHAA 5AUUA 3CEKA 5HX6A 3R1SA 3TI1A 2IWIA 3DAJA 4BICA 4OTWA 2GFSA 4E8AA 4NFMA 4I5PA 4U80A 5C4KA 3DKCA 5BX0A 4KIPA 4CRSA 3D0EA 2WQNA 3O0GA 4CZTA 2W4KA 5HBHA 2FB8A 4V05A 3RAIA 2QQ7A 4IFGA 1UWJA 3DFCB 4XG4A 4BIBA 2R5TA 4IWPA 4GH2A 3IONA 3CQWA 3Q04A 2QG5A 2UW0A 5CU3A 1XH9A 5CF6A 4ZSAA 1JWHA 3FMHA 3GFWA 3LFQA 3MIAA 1BLXA 3QYWA 4IANA 4AFJA 1KSWA 3D9VA 2JKKA 2O8YA 3ELJA 3MDYA 4TWCA 2YITA 3MVMA 2IVUA 1AQ1A 4IAKA 4LFIA 1M2PA 3BZ3A 1R39A 2OG8A 3HV5A 1P14A 5HO7A 3LQ8A 1ZOGA 3PIXA 3R1YA 3ZSGA 4DYMA 3NIEA 3A4OX 4O1PA 4UZDA 3MWUA 4O0YA 4L44A 2HW6A 5HLNA 3QLGA 2W4OA 3ZRLA 2AC3A 4IJPA 1GZKA 1H00A 4M15A 3UO4A 1IA9A 3IG7A 3DJ5A 3T9TA 2PE1A 3HKOA 4M0YA 4D2VA 3D5UA 3ERKA 3FQSA 4DF3A 1R0EA 2R7BA 2WQBA 3S1HA 3UZPA 1L3RE 3GQLA 5LMAA 2VTSA 2QG7A 4M97A 3QXPA 1G3NA 2PPQA 3C4EA 2IJMA 2WTKC 2QO9A 1WCCA 2WD1A 4ZTLA 4EC9A 3BCEA 3UG1A 3DLZA 3VUMA 5FGKA 3GU7A 4EZ3A 2B4SB 4Z7GA 3QZHA 2B0QA 2AUHA 3MPAA 2X8IA 3ORZA 4O27B 4PTCA 5AP7A 5HVJA 4CSVA 2RIOA 3NX8A 4YLLA 5CEIA 5M4UA 4FV1A 4JBVA 5F4NA 3R7IA 4YTFA 4EWQA 1H1WA 5AX3A 3HECA 1AGWA 2UZTA 4IADA 3CBLA 2JEDA 4EOOA 2EXEA 3FQHA 2A1AB 3H30A 3OW4A 4UWCA 4WT6A 5E8ZA 5HE0A 4A4LA 5M51A 3FKLA 1O6KA 4FK3A 2P33A 4XS2A 2O64A 4CVAA 3V5LA 4RPVA 2PVKA 3IS5A 4AZWA 3H10A 3RK7A 4C2VA 1Q41A 4HGLA 4FA2A 4J95A 4MD9E 2ZYBA 2OWBA 1BKXA 3FV8A 4ID7A 5T6KA 4BY9E 3FMKA 4F1OA 2QO2A 4OT6A 2NRUA 3E93A 2PMIA 2HELA 3EJ1A 1Y57A 2OH0E 4FKQA 3UVQA 2OLCA 5F95A 4LG4A 3WF7A 1CDKA 2PVMA 2W06A 2X1NA 2X2KA 3F7ZA 4ASEA 4A07A 2HZ4A 4RQKA 1MRVA 3RPSA 2ETKA 1K3AA 2WFYA 4QTCA 1M7QA 4OUCA 3RINA 3ZOSA 2C1AA 3GCUA 4FTCA 4QTDA 3AXWA 4WNKA 4Z55A 5HG9A 2ERKA 5IA0A 4LQMA 3OWLA 3SW7A 2NRYA 4FTNA 3V5QA 4AU8A 5CAUA 5TOZA 3V6SA 5LWMA 4WBBB 2YM5A 2GHMA 2WMUA 4NW5A 4EL9A 4XP3A 3VF8A 1NVSA 2JKMA 2WPAA 3Q4CA 3Q4UA 2WHBA 4ALVA 2VWXA 4Y72A 4U81A 2ZV7A 3FPQA 3NVMB 1WBTA 3V5PA 1J91A 4JXFA 3HZTA 3FY0A 1V0PA 1UNLA 3RWQA 2WQOA 3C4CA 4BC6A 3ORKA 3H4JA 3VRYA 5JFXA 4I93A 5FTOA 4BBMA 2EB2A 3PP1A 4IZYA 2DWBA 4GYIA 2J4ZA 4FOCA 3TV4A 4DEGA 3QUDA 3N4TA 4XG2A 1OL2A 3G90X 5EOLA 3WIGA 4DN5A 4EK3A 5IDNA 4M7IA 2J0KA 5AWMA 3GC7A 2FSLX 3GENA 4L68A 3ZO2A 3TIYA 4JRNA 4EC8A 4QOXA 2JKOA 4RFZA 3CP9A 3HVCA 4CFNA 5LWNA 1RE8A 3G0EA 3MFRA 3DLSA 3JVSA 4FKRA 4L8MA 4QYEA 2R3JA 4BCJA 5F9EA 4FKPA 3KVXA 3KRXA 3M1SA 2J0JA 3FSFA 3S2PA 4KIOA 2HXQA 1F3MC 2PTKA 1E1XA 3DKOA 4RQVA 5DA3A 1SVEA 3QA0A 3BBTB 4FT7A 5M07A 2QVSE 5C8NA 3R6XA 4HVGA 4FSNA 3BE2A 3DJ7A 3F5GA 4S32A 4YO6A 5D7VA 3ZFXA 5KMLA 5KMIA 3A7IA 3KK8A 2QOCA 3E8CA 1A9UA 1J3HA 4N6YA 5JFVA 3ZM9A 1YWRA 1UU9A 2PYWA 3GOKA 3QTZA 4QTBA 4O7TA 2CCIA 5EHLA 2YISA 4KA3A 4E6DA 2VGPA 4BI0A 4P5QA 2C1BA 2GMXA 4RC4A 5DOSA 2GQGA 2XP2A 2HZ0A 4IX5A 5HCZA 3QHRA 2RFDA 4CT2A 5H8EA 5I0BA 2QOFA 1FGIA 4XHKB 5CF8A 4R7IA 1GY3A 3QKMA 2X9EA 2F4JA 1BI8A 1SNUA 3JXWA 4JAJA 5BMMA 3WF6A 2C68A 4G3FA 2XYUA 4C36A 4YMJA 1TVOA 4EH4A 2W1GA 3E92A 4A9YA 4TYGA 3FMMA 4LOPA 2YIRA 4DEHA 2J0LA 4G9CA 4NJ3A 4U45A 4EH2A 2RF9A 4IC7A 4EK4A 4MD7E 4RMZA 2HW7A 1KUTA 4X3JA 5JH6A 3KCFA 4NL0A 1FOTA 1OZ1A 3QAME 3LXKA 3AC1A 1H01A 3W10A 1JQHA 3MTLA 4M68A 1E1VA 3COMA 3GU5A 4PDPA 5KMMA 3M11A 2R0UA 2B9JA 3FBVA 4BGHA 4I5CA 3JUHA 2OKRA 3QWKA 4YZDA 4LRKA 3UPXA 3HLLA 5AM6A 4ZZOA 3ANRA 3KFAA 2IG7A 3NUNA 4DGOA 4Z3VA 3KRJA 4HCVA 4MXXA 3ANQA 3POZA 1WBNA 4WG4A 5EW3A 3N4UA 4O7ZA 2VX3A 5BMSA 2UV2A 2CGUA 3HA8A 3KU2A 4I6BA 4K0YA 4LGGA 3TACA 3TNWA 4FNWA 2XB7A 3QQGA 4BDAA 4GG7A 5AIKA 2JBOA 3UODA 4MEDA 3FHIA 4FT0A 3ZEWA 5CLPA 3A7FA 4EZ5A 3ET7A 4WNMA 3TV7A 3LM5A 1VEBA 4NM7A 4QMTA 1P5EA 4H3PA 2IW9A 4QMQA 4ACGA 5BVDA 4G3CA 4AN3A 5L6OA 4H05A 2R3NA 4DTAA 4U9AA 4EJ7A 4NT4A 3WYXA 3BQRA 3HDMA 4FX3A 4R1VA 2C0OA 3O51A 2BRNA 4DEDA 3DBEA 4M67A 2VWBA 4FTMA 2JIIA 4NTSA 4GT4A 1H27A 1IA8A 4XG9A 3PDTA 1TQIA 4TWOA 2V55A 2ITZA 4BFMA 3VJOA 4YJSA 4NM5A 2YM4A 4D4SA 2R64A 4S33A 2XNEA 3QKLA 2V62A 2WMSA 4D9TA 3OWJA 4C4HA 3AC8A 5C27A 4K8AA 4KSQA 5CU2A 1OL6A 4D2WA 3PA4A 1KE7A 5ACBC 4E6QA 4O82A 4UXLA 2RL5A 3LCTA 4RX7A 4EH8A 2ESMA 2YDIA 3MB7A 3PXZA 1ZMUA 3DTCA 5E7RA 3U6JA 3DTWA 3ZZEA 3QXOA 4XBUA 4LV8A 1NVQA 2VV9A 4TRLA 5HTBA 4ZZMA 5E9EA 3QZFA 4YLKA 2ITTA 4FG7A 3VS0A 4E5BA 5LQFA 3DA6A 4YZNA 2B1PA 3THBA 3EH9A 2E9OA 3A99A 1JKKA 2QLUA 3C0IA 3HA6A 2Y9QA 4RIXB 3ZC5A 3IDPA 4G31A 4DCEA 3UZRA 3D7TA 4ANSA 4LMNA 3O7LD 3GUBA 4PV0A 4ZSGA 5KE0A 3RTPA 4WSYA 5IEXA 4MAOA 4NK9A 4BKJA 2IZRA 2EU9A 3F5UA 4I21A 3R9OA 2F9GA 5IA4A 4Z7HA 3MPMA 3SV0A 4DTBA 3W2PA 2PVJA 4IAFA 5GJGA 4W9XA 3V04A 4FF8A 3VW6A 3G0FA 3ZHPC 5TF9A 2J2IB 4FEQA 3UOJA 3FLWA 2UZEA 2WELA 3NRMA 1WVWA 2UZOA 4FTOA 4BCIA 5EI8A 3EOCA 5AUTA 5EDPA 4EQUA 3FUPA 4AF3A 2JFLA 4BF2A 4NWMA 3PTGA 4O6EA 3BGPA 3CE3A 5E8YA 5BVKA 3GC0A 1H28A 3HRCA 2Y6MA 4LOQA 1WBWA 3VQUA 5FD2A 3OTUA 3ZUUA 1WBPA 2PVRA 5IQEA 5ETAA 2W5BA 3A60A 3R21A 4FT9A 4R3PA 5HCXA 3W2RA 3ZFYA 2FUMA 5HORA 3O7LB 4XOYA 5FXRA 5IUIA 5FXQA 3UIXA 1KV1A 3PSDA 4FNXA 2OJ9A 3T3UA 4FV2A 3ROCA 4Q9SA 3HMPA 4RSSA 3CJFA 4EYJA 4U42A 3DXQA 2XYNA 3LCSA 4HYHA 2VZ6A 3DBDA 4FKOA 5CF5A 4DFBA 3HAVA 3Q4TA 3WE4A 2V7OA 2W5AA 4APPA 4K6ZA 1OIRA 5FLFA 5HD4A 3V3VA 1STCE 2RG5A 5AP4A 2UZNA 3REPA 5ETCA 1UVRA 5C01A 3VUKA 3QBNA 3MH3A 3PIYA 3Q53A 4FVPA 4GK3A 4H1MA 4BWPA 2PVLA 1JOWB 3RGFA 4XOZA 5HD7A 4UEUA 4USDA 4QNYA 4HVSA 1KWPA 4C61A 5GZ9A 4AA5A 1RDQE 1AD5A 3PFQA 4WUAA 1DI8A 3RWPA 3OUNB 4NU1A 3RVGA 3FE3A 4AA0A 4RFYA 2DUVA 4YTHA 3C4ZA 3GP0A 3WI6A 4TY1A 5BPYA 4C4EA 1G8SA 2WTCA 3LMIA 3A7GA 2QKWB 2FH9A 3TNHA 4CMOA 4KNBA 2IVSA 4F6SA 3PZEA 3FMEA 2R9SA 4X2JA 4XV1A 4DFLA 4EOMA 2NNWB 2GNHA 2VN9A 2UVXA 5HZNA 4ORKA 4GS6A 5A4TA 3WOWA 2I6LA 3P23A 3R28A 3KXXA 4G3DA 3FWQA 4KKEA 2YAKA 4F6UA 1W84A 5HIDA 3VBYA 3II5A 1OKWA 4G5PA 4MBLA 2PVNA 4GU6A 3DS6A 3DDPA 3AD5A 1CKIA 4MNEB 1PXPA 5IUGA 5E90A 4DLJA 4AN9A 3ODYX 4EONA 4RLLA 4C58A 4NCTC 4WNOA 4PDYA 2RG6A 2R0IA 3Q6WA 3VS1A 3PXKA 4FTRA 4FV9A 4O22A 5K0XA 5B7VA 2F2CB 1JVPP 2X7OA 3HUCA 2ZAZA 3GCSA 5I3RA 3R8VA 5JN2A 2ITUA 3L8VA 3W1FA 4BKZA 4FVRA 4BI2A 4C37A 3C4WA 2XNOA 4ASDA 2UW7A 3JYAA 1ZYDA 4CFUA 3R71A 5E92A 4FSZA 4IM0A 3E8NA 3VBTA 4WA9A 3ROYA 3PXRA 2X6DA 3RJCA 2BUJA 3R7UA 3UIMA 5A6NA 3QD2B 5IQIA 2ACXA 4DAWA 5GHVA 1ZOEA 3SRVA 2XJ2A 4RWKA 1WFCA 4E73A 2H9VA 4H3BA 3R2BA 2YZLA 3WBLA 2WTDA 1FVRA 3BYMA 3MB6A 3F5XA 3R8ZA 5AP0A 1A06A 3UMXA 3JPVA 4RZVA 2G2IA 2IW6A 3LFCA 4FR4A 3Q9ZA 4QMPA 4WG5A 5KMKA 3KCKA 4RJ5A 4QMMA 4FV0A 5M08A 4G9RA 1YOLA 4XRJA 4L52A 5C8KA 3DBCA 3NS9A 4ZZNA 3RI1A 1Q62A 1LP4A 3O50A 4MVFA 3Q96A 2UUEA 3TEIA 4ZJJA 3K2LA 2PK9A 3A2CA 4ACMA 5KBRA 2LAVA 3CD8A 4O2ZA 3DZQA 2GHLA 3NYNA 4L9IA 4YJRA 5AADA 3W8QA 4C0TA 3EL8A 4AT5A 4G34A 4MHAA 4YP8A 4BKYA 4O7NA 4HVHA 5HO8A 3FMLA 3UQFA 4FEVA 3F7WA 4K11A 2GS7A 3VC4A 4O7LA 4TWPA 4FKVA 5AP6A 3NIZA 3EFLA 1H4LA 1VYWA 4J99A 2IZUA 3E7OA 4EOPA 4L3LA 2ERZE 2BRHA 3W32A 3PYYA 3IOPA 3EQBA 4N57A 2WTVA 2YACA 4W4YA 3V5WA 2OF4A 1YDSE 5A46A 4MCVA 5CNOA 2GQRA 2VTLA 4KB8A 3R8UA 4R1YA 4RX9A 4C62A 3FZ1A 5E1EA 4XLVA 4QPMA 3LE6A 5AUZA 4DFZE 4OBQA 2R4BA 3TWJA 5JSMA 3CPCA 2WEVA 2RFEA 2C3LA 4M13A 4TN6A 4YPDA 3W18A 5J7HA 4Y85A 5EG3A 2XJ1A 4C34A 4E4LA 4YJPA 3BHTA 4LGDA 2H96A 3LJ0A 3S00A 5C1QB 4NIFB 3NMUF 4RWIA 4XMOA 1ND4A 4XEYA 4NZWB 5M09A 3DQXA 4U3YA 4IAYA 3JY9A 4FGBA 3QKKA 3Q5IA 3WZEA 2GPHA 4OAVB 4TKSA 4X7QA 1XBCA 3I5NA 3P9JA 4EH7A 5H3QA 1O6YA 3DK7A 5GJFA 1U54A 5A6OA 2E9VA 5TT7A 3WYYA 4CTBA 2XIRA 3FMDA 4PMMA 3RAHA 4WBOA 3EZVA 4U5JA 4F4PA 3C5UA 3OY1A 5M4FA 3PY0A 4APCA 5L8JA 4OAUC 3FMNA 3O8TA 1REKA 2VTJA 3QRTA 5DBXA 2OXDA 5FTQA 5D11A 5JK3A 3G6GA 2C6MA 3PJ8A 4IM3A 3R9DA 5J1WA 2X4FA 3NYXA 5JRSA 4F1MA 2VWYA 1U59A 5D9HA 2PUIA 3RAKA 3MVHA 4UYNA 5EH0A 1GIHA 2F7XE 2OF2A 5A3XA 4TW9A 5DT3A 3VWAA 3ZLSA 5KX8A 2BCJA 3OP5A 3OUKA 3R9NA 3CTQA 4RJ8A 3BU6A 2H34A 3CGOA 3I7BA 3NCZA 5I3OA 5ANKA 5LARA 3FJQE 1P4OA 4GRBA 4JAIA 4R6VA 2OO8X 1J1CA 1W8CA 1KE5A 5FRIA 5AIRA 5D12A 2NPQA 3BYVA 5HO6A 4ASZA 2C69A 4BYIA 4R78A 2KULA 2ITXA 3ENHA 3UIUA 4IFCA 4YJQA 3S95A 4CKJA 2PVHA 4C2WA 5AM7A 4I94A 5CSPA 3FXXA 4MK0A 2BZIB 4UXQA 4MQ2A 2XCHA 3LPBA 5LMBA 3VS5A 3ETAA 4CFFA 1DM2A 4XV9A 4KSPA 5FP5A 4YBKA 2WTKB 2GTMA 3ALOA 4J96A 3VN9A 4N70A 3VS6A 2AYPA 3UPZA 4GSBA 4ALUA 3O8UA 2BHHA 3PXQA 3SA0A 4KRDA 3C50A 2XNBA 2A27A 2XNGA 4JG8A 4IWOA 2GNLA 2ITWA 3FZOA 5CT0A 3T9IA 4IVBA 1O6LA 3D5XA 4EQCA 4K33A 4YO4A 4QMXA 2JDOA 3E5AA 1LPUA 4U44A 4ASXA 4YTCA 5E8TA 2R3IA 2OXXA 3F3WA 3O8PA 3LXLA 2C6KA 2VU3A 2O5KA 5DT4A 4EOJA 4GVAA 4O7VA 2CGWA 3BI6A 3PA3A 3I79A 2UZBA 2C0IA 3RZFA 4CZYB 1J7LA 5K5NA 4GV1A 4BTKA 4IH8A 2Y8OA 2W1CA 4DH5A 5C8MA 4ZMEA 4WSQA 4C59A 4JDIA 4KUJA 5L8LA 3AMAA 4MBJA 2UW9A 2V22A 4FKGA 3DGKA 3DY7A 4EBVA 4WHZA 1APME 3NW6A 3FKOA 4OTFA 1JAMA 1OM1A 4IZ7A 4IHPA 5HQ0A 3R63A 5KKRC 3OTVA 4XG6A 4BCKA 3MTFA 4O2PA 3VUHA 4AW5A 4GT5A 4PDOA 3R0TA 5M57A 4M69A 5HTCA 4JVGA 3TJDA 3L9PA 2JGZA 3AGMA 3QTRA 4C4JA 4PWNA 4J7BA 2KTYA 3BX5A 2BZJA 3PXYA 4X3FA 4BCPA 1JKLA 3RBWA 4D5HA 2QKRA 5KUPA 1WBOA 2DS1A 2HCKA 2JIVA 4UX9A 4FTKA 1Q3DA 4IM2A 1PMNA 4YUQA 5FTGA 4DFNA 3U6IA 3U9CA 3LFAA 4O0WA 3CD3A 4ZTMA 2PZPA 1H26A 2WTJA 3PZHA 4Y46A 3KC3A 1QL6A 4JBQA 4C3FA 2SRCA 2XBAA 3OCGA 2YM6A 3D14A 4FL3A 5DN3A 3TTJA 3SOAA 4AZVA 4YHTA 2ETMA 3UOKA 2FSOX 5CAOA 2YJRA 5AAFA 2PZRA 3OZ6A 5KMOA 3H9RA 1XBAA 3AC5A 5IF1A 1NVRA 3D4QA 4G16A 3PJ2A 3NUPA 3POOA 4RA4A 4BTMA 3ZBXA 1L8TA 5EW9A 4USFA 2BDJA 2HOGA 4K1BA 5EM6A 2Y4IC 4BDEA 3ID6C 3BWJA 5A4CA 4DH7A 3F6XA 5E91A 4FZDB 2GNFA 4MF1A 4XV2A 4D0WA 1E9HA 2IZTA 4FG8A 2FSTX 4PP7A 3NUAA 3LCKA 4W8DA 4L7SA 4G6NA 2UZVA 3OG7A 3H9OA 2BMCA 4WOVA 4DGLC 3FEGA 3QTXA 5A9UA 4R3CA 5E8VA 3NNUA 5DI1A 3I0QA 2C3JA 3LFNA 3PSBA 4X2KA 2HENA 3DU8A 3F66A 4GEOA 4KS8A 4KIKB 5JKGA 2BALA 4FSTA 4C3PA 3DCVA 3IDBA 4YJVA 5CAQA 4BN1A 2WMQA 2J6MA 4RIWB 4EJNA 1JSUA 3D5WA 5L2IA 1UKIA 1YOJA 1J7IA 4FL1A 1M14A 2WU7A 4Q5EA 2CKEA 4UALA 5G1XA 4I41A 4J97A 4L6QA 4JJRA 3VVHA 4DGGA 1YXUA 2XK9A 3KL8A 4L7FA 4LI5A 4CLJA 2BROA 1WBVA 3BV3A 4GFMA 5FEEA 3TUBA 3CKWA 3QGYA 4FV6A 3RK9A 1I09A 1W82A 3KXHA 1OKZA 4D1ZA 4RIYA 5DHJA 5HVYA 1UKHA 2GU8A 3RCDA 4XG7A 2AC5A 2YJSA 3DPKA 5JGBA 4AOJA 4G3GA 2VO7A 4S2ZA 1JLUE 2BAKA 1B38A 3A7JA 5HI2A 1Y6AA 3B2TA 1FPUA 3SG9A 4MXAA 3UOLA 4B9DA 1WMKA 3FXWA 4TYIA 4WRGA 4PL5A 4X2NA 4UV0A 1ZYCA 4QMUA 4YNEA 3QTWA 2C47A 4WUNA 5IDPA 3H3CA 1V0BA 4E4MA 5EQEA 5CEMA 4BL1A 5L3AA 5DT0A 2X39A 2PUNA 3R1QA 4ACCA 3BHVA 3FLYA 3F2AA 3VAPA 2UW5A 3KXMA 3VRZA 4AW1A 4AZSA 3TDVA 4AT3A 1DI9A 2W05A 4XX9A 4Y83A 3DJ6A 4GW8A 3L8XA 4ZY6A 4HPTE 3ODZX 4F0GA 4KKHA 3L1SA 4IB5A 5HE1A 5AV1A 4ENYA 5F94A 2Q0NA 2ZMCA 1OBDA 3VIDA 3F82A 4FSRA 5CI6A 3FL5A 1BUHA 3SDJA 3CTJA 4D4VA 4W4WA 1MRUA 2VO3A 4A06A 4CEGA 3D5VA 2BVAA 3OT8A 3VUTA 5JT2A 5L8KA 4MKCA 2O3PA 4F9YA 2Q83A 3QGWA 5AAGA 4PNKA 3E8DA 1ZLTA 2Z7QA 4M0ZA 4O84A 4DE4A 3QRUA 4TXCA 4QMLA 2OH4A 4YGAA 1XH8A 4IAAA 4Y5HA 4IVCA 4ZXTA 3C9WA 3BYSA 5HNIX 4RWLA 3IOKA 3ZLWA 4GFOA 5HNBA 4BDBA 2FO0A 5DPVA 3DZOA 2J0MB 3QZGA 3LLTA 3QUPA 4GKHA 3PY3A 2QU6A 3MSSA 3QCSA 5EM8A 1CMKE 3NCGA 4PRJA 1FVTA 4UB7A 4EOLA 2Z02A 4FZFB 1M52A 1Q99A 2WMBA 4LRJA 4AA4A 4J8NA 2XKCA 3AQVA 3QUEA 1OL7A 5C26A 3KKVA 3BHYA 4I22A 5K5XA 4EUUA 2OBJA 2HK5A 3EZRA 2QO7A 2YWPA 2ZB0A 3EN5A 4FIFA 5DVRA 1CM8A 1YI3A 2GHGA 5D10A 5AMNA 3QCXA 1P2AA 4KAOA 3NUSA 4JT3A 4C57A 4GUEA 5HX8A 1YWVA 3LFFA 4CLIA 1OL5A 1JPAA 1PW2A 3Q60A 3VBWA 4BYJA 1TKIA 2R3QA 5ANOA 3HP2A 4CYIA 5I9VA 3K5UA 3HL7A 4FVQA 3RP9A 2VTPA 3LMGA 3TT0A 4FTJA 2Y0AA 4ONAA 1V0OA 2VO0A 3FC2A 2W1EA 3EL7A 2XM8A 4YHJA 5KHXA 4EBWA 2J5FA 2XIXA 4ITIA 1SVHA 3QQKA 4NM3A 4O0TA 4D2PA 4DFUA 5GINE 4B99A 1OPLA 3ZXTA 1XR1A 4ALWA 1G5SA 3G15A 4B8MA 3L9NA 3KMMA 2IVVA 5AV0A 4UMUA 1RW8A 3NR9A 4IZAA 3VHEA 4OR5A 4YPSA 2XIYA 1H8FA 4LMUA 3SXFA 2W5HA 5BUEA 4D2RA 1GNGA 1ZZLA 4QT1A 5BVWA 3V51A 3VUDA 3KULB 4F9WA 3HDNA 4IDVA 2HAKA 3IK3A 5FWKK 2XIZA 3NW7A 4U97A 3PJCA 3QTUA 4YHFA 5H8BA 4KS7A 3SVVA 3Q4ZA 4KIKA 2OJJA 5BYLA 2CLQA 3QZIA 5IQFA 2E9NA 3P7BA 5HEZA 2J0IA 1XKKA 2C6DA 2VO6A 4JBPA 3OOMA 4GMYA 1R1WA 4M14A 3UP2A 4AGWA 4EOIA 3KF4A 1BL6A 4J71A 3TKHA 1GIIA 4EYMA 5FM2A 5M06A 5K4IA 4KBKA 3TL8A 4BIEA 3E87A 3D83A 3LFDA 1I44A 3P0MA 4S34A 4UYAA 3D7ZA 4X6RA 3UJGA 3DT1A 4CFWA 5AFVA 4HVDA 5HU9A 4NEUA 4FV5A 5DRBA 2JBPA 3EB0A 5C4LA 4J52A 3B8RA 4DITA 1OUYA 4PUZA 5LVNA 3WARA 4HPUE 5KHWA 3G33A 3KXNA 3MH1A 4GK2A 4A9UA 1V1KA 3E64A 1YXXA 3ORPA 1Z9XA 3FAAA 4RG0A 3BU5A 4IB0A 2WMTA 2X6EA 3QCQA 3UYSA 4PMPA 4PMSA 5C9CA 1MQBA 4U0IA 3B8QA 4FEUA 3V01A 5J9YA 2P3GX 4EOQA 4XUFA 2CNVA 5BVEA 4FKUA 4BDGA 4N0SA 3OXTA 5CY3A 1OIYA 4FTAA 4ZOGA 2OFVA 3WF5A 3KXGA 2QOQA 2VD5A 4EK8A 2I0VA 1PXOA 2OICA 2HY81 3PA5A 4EK6A 3ZSIA 4QMYA 3KGAA 3ACJA 1IRKA 2QOOA 4UZHA 5J7BA 4DHFA 5DNRA 3ULIA 2OZAB 5CT7A 2XK8A 4F7SA 1FBNA 2W99B 3Q5ZA 4H58A 4PTGA 5TE0A 4A9RA 4E4NA 4TZRA 4ZTSA 4I92A 3BEGA 3OFMA 1Y8GA 2R3PA 4AZFA 4C02A 4DEBA 4DGMA 1O9UA 2UW3A 4EORA 4UN0C 3PVBA 3TZ8A 3R7VA 2VWUA 2JD5A 3N9XA 2UVZA 3R02A 3RPYA 5CXZA 4AXAA 5HGIA 4BCNA 3O71A 4LV5A 4BCFA 2GDOA 4K77A 1OBGA 5ANDA 3N4VA 5CEKA 3BWFA 3H0ZA 4BWKA 5EW8A 3CR0A 2VGOA 5KO1A 4FUXA 2P0CA 1GAGA 4WKQA 4UMPA 3C1XA 3HYHA 2VRXA 5HNGA 5A4LA 1J7UA 2PUUA 3VW8A 4BTJA 3HMOA 5AUXA 4OTQA 4HNFA 4KKGA 5LCKA 4DH1A 2HIWA 3FKNA 4FL2A 2ONLC 3KA0A 3UDBA 3PE1A 5KMNA 3ORXA 4ZSJA 2IW8A 2UZLA 3U54A 2OK1A 4TNDA 3T8OA 4Y8DA 5M44A 4X2GA 1OPKA 5DWRA 5B2LA 5EKNA 2UW6A 2QD9A 5CVFA 2R3MA 2VTNA 4PNIA 5LVPA 5D7AA 4F65A 3R22A 5CAVA 4PY1A 4NFNA 3CTHA 5AUVA 3EFJA 3K3JA 1SM2A 3BKBA 3CQEA 1M17A 1YQJA 3IDCA 3R73A 1YXVA 4RIOA 4TTHB 2YAAA 3DB8A 2WTIA 3QTSA 4J53A 5DR9A 4U43A 3W2CA 4C4FA 5AV4A 2OW3A 4M3QA 3PVGA 3PXFA 4XP0A 4F9AA 4TNBA 4O96A 2CN5A 2WMVA 3OEZA 4E4XA 4WG3A 5AEPA 5GIOE 3OF0A 5AR8A 4U41A 3VS3A 4JIAA 5C03A 4QP9A 4NTTA 3UQCA 1VR2A 3V6RA 3H0YA 4U7ZA 2ONLA 1H0WA 5IA2A 4M8TA 4Z16A 3VBXA 4KWPA 4PMTA 3UG2A 4BRXA 4EHZA 3QU0A 4ZTQA 4E5WA 5HLWA 4AGDA 2YCSA 3NUYA 3AG9A 2QONA 2YIXA 3ITZA 3AT4A 5AJQA 1OIUA 4ZIMA 4CD0A 2YHVA 5IQGA 5KZ0A 3E62A 2VNWA 2R3RA 4YTIA 3G2FA 2YLEA 3WF9A 1ZMVA 3FC1X 4LM5A 2PU8A 2VUWA 2R2PA 1XBBA 3BLRA 3IGGA 3TIZA 2IVTA 3WE8A 4O81A 4GU9A 2XIKA 4UWYA 4ZK5A 3WILA 5ANEA 4BDCA 2CMWA 2YIQA 4FMQA 1H08A 4QQ5A 3FI8A 3CS9A 3RNYA 5HLPA 4CV9A 4D9UA 4M12A 3P86A 2RFNA 3MGYA 4I6QA 4E3CA 1YRPA 3HMMA 3F9NA 4QYYA 4P2KA 4Q5HA 4QMWA 4NSTA 3FLQA 4CMTA 2QNJA 2X9FA 4FBXA 1FINA 5E8WA 2V0DA 1T45A 3PRFA 2CLXA 3R04A 4GIIA 1OB3A 3QTQA 4OGRA 4P5ZA 4ZTNA 2C3KA 2W9ZB 3EYGA 4RJ6A 3OMVA 3FZRA 3R8PA 5DG5A 5I5ZA 3OCSA 3F61A 4FYOA 4YJOA 4YSMA 4TYJA 4U40A 4O0RA 3GU4A 4EOKA 1PMEA 2PUPA 3CJGA 3OCBA 4XJ0A 4YR8A 4B6LA 3EMGA 2C5VA 3B2WA 4I1ZA 5GZAA 4QPAA 5CANA 3KB7A 3NUXA 3TG1A 3HRBA 3UC3A 3VBQA 3RPOA 4C4GA 4FEXA 3BU3A 4K9YA 3TUDA 3TM0A 1Q4LA 3ORMA 3PPJA 1Q8TA 4IWQA 5HG8A 1WVXA 2CHLA 4HGTA 2GNIA 3BRBA 3U9NA 4IVDA 1FGKA 3F88A 2PWLA 4FZ6A 4I3ZA 3PSCA 4DG0E 3HX4A 4P4CA 3KEXA 4QQTA 1XQZA 5IA5A 4I24A 5FBOA 4F7LA 3PY1A 4AW2A 3DBFA 5CU0A 1F5QA 1K2PA 5AAEA 3VJNA 1H25A 3FLNC 4C4IA 1HCLA 4FKIA 2OIBA 1ZARA 3FDNA 4GUBA 1MUOA 3TTIA 2IPXA 1Z57A 2OIDA 3L9MA 4GJ3A 2UW4A 4RVLA 2VWZA 5CSVA 3LJ2A 4BBFA 4F9CA 4M84A 5AR2A 5CSXA 3OW3A 3WZUA 5DEYA 5CF4A 5B2MA 4L43A 1FVVA 3F2NA 4ANLA 4E7WA 1ATPE 4Y95A 5DLSA 5JMSA 2VTRA 1VZOA 2BRGA 4AQCA 3EKNA 2VTQA 5L2SA 2ZM4A 4DLIA 5HESA 2Z2WA 3E88A 4G6OA 1TQPA 3MFTA 4EQMA 3BBWA 3DKFA 5BYYA 3LKMA 4GKIA 2ZM3A 3KXZA 2CKPA 2PVYA 3UIBA 2OGVA 3I7CA 4RIXA 3MVJA 4V0GB 3LAUA 4YZ9A 4PQNA 4YJNA 5BYZA 4OTRA 4EHGA 4YLJA 3QWJA 2BKKA 1M2RA 5EYDA 5EQYA 2XS0A 3QRJA 5LMKA 3FLSA 2WKMA 5LXMA 4FUYA 2E9UA 5L4QA 3W2SA 4D1XA 2GNJA 2WXVA 5DGZA 5I9UA 4JDHA 5J9LA 2W1HA 3CY3A 3D2IA 3NAXA 4I4FA 4XP2A 4ZAUA 2PULA 4YU2A 4AN2A 5I9XA 4FZ7A 2W1ZA 4RX8A 4CV8A 2WGJA 3COKA 2A0CX 4QP8A 2HWPA 1URCA 4P7EA 4DT9A 3AOXA 5HVKA 3TN8A 4BDKA 1W83A 1PXNA 4QQCA 1CKPA 2J50A 5ITAA 1H24A 1PXLA 4CG8A 3JR1A 3OC1A 4O7WA 3KRRA 3PUPA 5HBJA 3A7HA 2YM7A 3LOKA 4ENXA 4CNHA 3KMWA 3DFAA 2B9HA 4BHZA 3LW0A 4EWHA 3G51A 4MXCA 3ZSHA 2YCFA 4IDTA 5CSWA 5H2UA 5CEPA 4GCJA 3ZC6A 4X0MA 2FYSA 4I0RA 4OTHA 4CXAA 4RBLA 3ZRMA 4DFYA 3OD6X 5F1ZA 4AGUA 1YHVA 4QP6A 4XBRA 3RHXA 3ZXZA 5CI7A 5KKRB 3RALA 5J79A 5M4IA 4BB4A 2QOHA 4MBIA 3BPRA 2WU6A 4QPSA 3Q9XA 3VF9A 2A2AA 2VWVA 2RFSA 4AZTA 4EOSA 5M56A 2VX0A 1ZWSA 3OBGA 5AP3A 4BCGA 1LR4A 2QHNA 1PMVA 3NEWA 2VTIA 3W33A 2B54A 3U6HA 4F70A 4KINA 4IX3A 4ACHA 2ZM1A 4IXPA 4BDDA 1Q24A 3FYKX 5AR7A 5E8UA 2LGCA 3QFVA 1QPJA 3AC4A 1UU3A 5IKWA 4C33A 3EQIA 5L6PA 2ZV9A 5TKDA 1IG1A 3QRKA 3NPCA 3QYZA 4RVKA 4A9TA 4S30A 4DG2E 2QHMA 3PG3A 3OWKA 2EXCX 5CQWA 1R0PA 3F3ZA 4PPCA 4BDIA 3KREA 3FI2A 5J8IA 3LQ3A 3MYGA 4RJ3A 2C5OA 3BHHA 3EN6A 2UZWE 4LUDA 3UZTA 4JBOA 5EI2A 5EK7A 1QMZA 4TYHB 3WZJA 3ZYAA 3MBLA 1WZYA 4HGEA 4ARKA 3LLAA 3GI3A 2REIA 3QQLA 4XNEA 4UWBA 3Q6UA 3C51A 3IW7A 4YJUA 3R83A 2Y4IB 1ZXEA 3OCTA 3NWWA 3NNXA 3W2OA 4HVIA 4KD1A 5HIEA 3LMHA 3D2KA 2W4JA 4HCTA 4FKJA 5JFWA 3MVLA 3FSKA 1YDTE 2W0JA 3C7QA 3AT2A 2ZB1A 2W96B 4AOIA 3PJ3A 2YDJA 4MD8E 5DIAA 3QLFA 4MNEA 2QU5A 2DYLA 2WNTA 4FT3A 2X4ZA 3BGZA 2XKEA 4UMQA 3MW1A 4F9BA 3OHTA 4NH1A 3P78A 3QA8A 3I60A 4ITJA 4BBEA 4PF4A 1XJDA 4ZP5A 2HZNA 2YM3A 4QRCA 1CSNA 3FLZA 5IQBA 2C6TA 3TZ9A 1URWA 4D4RA 4QMSA 5I9WA 4MH7A 1CKJA 4F64A 3C0HA 4FIHA 4CTCA 3GFEA 2YCQA 1UU8A 1ZY4A 4X3FC 4AX8A 3C5IA 3O17A 3PWDA 4IEBA 3RMFA 5DH3A 4RC3A 3ZONA 4DINA 2Z8CA 4GIHA 4AW0A 4F99A 1MRYA 5I9ZA 5AR5A 4F6WA 4BGGA 5IU2A 2EWAA 5I9YA 2PE2A 5GNKA 5CALA 2XF0A 4RZWA 3FI3A 5M55A 4DTKA 4LGHA 1SVGA 1WVYA 4L01A 4D2SA 3LIJA 4FV7A 2CDZA 4HGSA 4YC6A 1OIQA 2XK7A 4CZUA 4F63A 3F5PA 4GYGA 2Y6OA 2I0YA 1XH4A 3S0OA 5E8SA 3NDMA 3F2RA 1OMWA 3BQCA 3QQFA 3RHKA 2ZDUA 5ANGA 2JLDA 4D0XA 1VJYA 4ZY4A 4ANBA 3CCNA 2EB3A 5DR6A 3W2QA 1QPCA 4FZAB 1F0QA 5DYJA 1ZZ2A 3RPVA 3LZBA 3OBJA 2ZOQA 4RC2A 4EEVA 2XNMA 1PKGA 4EH9A 1NA7A 3BLQA 5JQ8A 3ZUVA 3EIDA 5T68A 2ITQA 2C6LA 3EQDA 3ZDIA 4O91A 4J1RA 3DKGA 4PL4A 4RVMA 3I81A 1OL1A 2ZV8A 3I6UA 1ZAOA 4QP7A 1ZRZA 4JR7A 4R3RA 4V04A 5E1SA 2JDVA 3FQEA 5G6VA 5HHWA 3FXZA 2BTSA 1U5RA 1K9AA 2JDSA 3R7YA 4FGRA 4MX9A 4JDKA 5M4CA 4ANQA 3VNTA 2VAGA 3HV6A 1KOAA 3LCDA 4P90A 5AV3A 4WD5A 3R7GA 3G6HA 1UU7A 1Y6BA 2CKQA 3R8MA 3UVPA 2GQSA 2YEXA 1P4FA 1PY5A 3OT3A 4B7TA 5BUJA 3JS2A 4HZRA 2OXYA 3UNZA 5EI6A 1H1SA 3HV7A 4BHNA 4ZLYA 4L45A 4TT7A 5L2TA 2BDWA 3QTIA 4BCQA 5LVOA 3HUBA 3QQHA 4TYEA 3ATTA 4NUSA 2CCHA 3NW5A 2QR7A 4MXYA 5JEBA 5DEWA 2G2FA 2J51A 1ZY5A 3DDQA 5K0KA 4BTFA 4FSUA 4PPBA 2VWWA 4I0SA 3VHKA 1OITA 2PZYA 1FMKA 3A8WA 2C5NA 3AC3A 4ZY5A 3O23A 4LOOA 4NIFA 3SHEA 3CIKA 2W1FA 2P55A 4IAZA 4AG8A 3DNEA 4FK6A 2P2HA 2F7ZE 4CG9A 5H8GA 1RJBA 5K4JA 3O2MA 3PIZA 3UMWA 4JLCA 4QP3A 2X2LA 3U4UA 3R9RA 5IQCA 3VQHA 1MQ4A 2UVYA 1Y8YA 3MH2A 4ACDA 2Z7LA 1HOWA 5ANJA 3ZM4A 4ANNA 3W55A 3K54A 3PWYA 2GNGA 4XG8A 4RLKA 4YC8A 2QR8A 1B39A 4HYSA 1R3CA 3UBDA 3KN5A 3UO5A 3WZDA 3TDWA 4QMNA 3LFBA 4FT5A 5CVGA 3DV3A 5GIPE 3NSZA 4D28A 3ALNA 4K18A 2WB8A 3RK5A 4HJOA 2YERA 4O0SA 3O96A 1IR3A 2G01A 1PRYA 2W7XA 2W1DA 3A61A 4MXZA 5EHOA 4E5AX 2QURA 5E8XA 5HG7A 5A54A 2PMLX 3Q9YA 5A14A 3IW8A 3QF9A 4QMOA 1GZ8A 5FXSA 2YA9A 5AUYA 2H6DA 1Q8WA 4TYHA 2PMOX 2R3GA 4JQEA 1YI6A 3IO7A 4FV3A 3TNPC 2WIHA 3R1NA 1Q8YA 2R3FA 3P08A 3SGCA 4MNFA 2Y7JA 3IQ7A 5JRQA 3GT8A 5IA1A 4QYHA 3CKXA 1NY3A 3SKCA 5DR2A 3ACKA 4FSWA 2C0TA 3QC9A 3E63A 3EN7A 3IKAA 1PMUA 2R7IA 5AR4A 3RM7A 3MV5A 4FSYA 3GNIB 2QOLA 5A4EA 2ZVAA 2OU7A 4NW6A 2JDRA 5KZIA 4AAAA 2HYYA 4FKLA 4EUTA 2C5YA 3BHUA 5ETIA 4LRMA 4BZNA 4J8MA 4KRCA 3UNJA 4IB3A 3QCYA 4AS0A 4RGJA 1JKSA 3AD4A 3JVRA 4FV8A 3EWHA 5IEVA 4Y73A 1GZOA 4BCHA 3I1AA 5LVLA 5LJJA 5D1JA 2GCDA 5FP6A 1YDRE 3NUUA 3OVVA 4FG9A 5HE3A 3EQPA 5ETFA 1GJOA 3IW6A 1PHKA 4O38A 3KMUA 2XNPA 2ITOA 2YABA 3W16A 3NVKI 2YCRA 4QP1A 4WO5A 1DAWA 1Z5MA 3PLSA 4TPTA 3ZS5A 3ZTXA 4MTAA 2UW8A 4L53A 3UE4A 4EKLA 3SG8A 5AA8A 4RVTA 5KBQA 4A7CA 4FICA 1G8AA 2BZKB 2XRUA 2G15A 3KY2A 4ZSLA 3TKUA 4CFVA 5FDPA 5J5TA 2C3IB 4L42A 3FHRA 4OT5A 3RNIA 4BVUA 3LCOA 4KBCA 3TNIA 3V5JA 2BFYA 5DMZA 5IH5A 4E1ZA 4R8QA 2J7TA 4R7BA 4A4XA 5EQPA 1IASA 4O0UA 3D7TB 1OI9A 2PE0A 5HOAA 2OJIA 5IUHA 5EYCA 2O65A 2PMNX 3N51A 4OTPA 4DGNA 2FSMX 3UYTA 2PL0A 3F3UA 3G9LX 2B55A 1Q8ZA 3ORNA 5J1VA 3ATSA 5CX9A 4JQ8A 1PXKA 4MQ1A 4TWNA 3AMYA 5LCJA 4YNOA 2CGVA 2WTWA 3OY3A 1Q3WA 4L00A 1BX6A 3BYUA 2FA2A 4BZOA 4QTAA 3EYHA 2YLFA 5FUTA 3GVUA 4IX4A 4MWIA 5AV2A 4G1WA 4WIHA 3RPRA 2NP8A 2C6IA 3OWPA 3AC2A 3FZPA 4DA5A 1R78A 2C30A 4H1JA 3CPBA 3ZCLA 1NXKA 5IMEA 1UA2A 2QOBA 2R3HA 4OBOA 2C6OA 2XEZA 1GZNA 4XLIA 4LYNA 4PL3A 1IEPA 4DFXE 3K5VA 4O0XA 3QD3A 1UWHA 1YXTA 3P7AA 4JIKA 4XCUA 5ACKA 4EKKA 3DXNA 1QPEA 3UOHA 3U8WA 4RJ4A 5CSHA 4BGQA 4IACA 3A62A 3R9HA 4G17A 4DEAA 4FIJA 3P79A 4ZLZA 5BVNA 2F49A 3R7OA 3JY0A 5AP5A 4QTEA 3ZH8A 4F0FA 2PHKA 3CQUA 3P4KA 2VWIA 1QCFA 1XHAA 3GEQA 3LHJA 3GBZA 4FV4A 4E20A 5FEDA 3VS2A 1Q61A 3GXLA 5BVOA 4O21A 2OJFE 2BILB 3MJ2A 3RM6A 3DK6A 5B2KA 1YKRA 4AT4A 3BV2A 3QL8A 3DAKA 3SX9A 3OROA 3OOGA 2DQ7X 5FQDC 3CY2A 1BYGA 2XRWA 3DNDA 4HCUA 4QP2A 1H0VA 2VNYA 2ZV2A 3L8PA 3UO6A 1ZYJA 1U4DA 3ZO3A 5J5SA 4YZMA 2BAQA 3SXSA 3E8EA 4I6FA 2CNQA 3EQHA 3QC4A 4PPAA 3PRIA 4RIWA 4U79A 4JX3A 4CFMA 4FNYA 2PVFA 3GCQA 4QMVA 5IA3A 3MY1A 3TKIA 1NW1A 3ZEPA 4D58A 1GIJA 3A4PA 3CLYA 1UNGA 2XZSA 3TNQB 4H3QA 2JC6A 3D94A 5HICA 3ZBFA 5EYMA 4MWHA 3PPKA 4II5A 5DFPA 3ORIA 3PPZA 3PJ1A 4D55A 2J9MA 4UBAA 3AD6A 2X7FA 3IECA 4CYJA 5BNJA 4RWJA 1YWNA 2WIPA 4HYIA 3MIYA 1OUKA 5LOHA 3KQ7A 4C3RA 4L46A 4R5SA 4G2FA 4S31A 4AE9A 4QMZA 3TZMA 1J1BA 4FNZA 4RFMA 4XG3A 3E3BX 3UVRA 1YHWA 3V8TA 4BCMA 2OSCA 2P4IA 4MXOA 3R00A 2XEYA 5CYIA 4IBMA 2JITA 2B9IA 3CC6A 4HW7A 2WQMA 5CTPA 4RX5A 3DXPA 2QODA 2X0GA 2ITYA 1H07A 1REJA 2W17A 4QQJA 3PP0A 3SXRA 3HAMA 2ZMDA 2X8DA 2XJ0A 4CMUA 3AMBA 4DH3A 3S3IA 4ZS0A 1VYZA 4KBAA 2CPKE 3M42A 4N4SA 5HG5A 4DH8A 1XH5A 4C7TA 2CKOA 3QX4A 1B6CB 1LEZA 4R7HA 3FL4A 4JG7A 4FIEA 4UMTA 3FZSA 4I5MA 3Q32A 2BTRA 3A8XA 4OTIA 3BYOA 2XBJA 4G3EA 4X2FA 2JFMA 3SLSA 4CCUA 2OFUA 3SRVB 2UZDA 4XYFA 3SW4A 3VS7A 4BWXA 3IGOA 1W0XC 4IC8A 1YVJA 3BE9A 4M66A 3VBVA 4AGCA 4C38A 5KCVA 4O83A 2IZSA 3P5KA 3R7EA 4DG3E 4F7JA 4E6CA 2B53A 3U51A 5GZ8A 2Z7RA 4AFEA 3OXIA 5TR6A 3V8SA 4FC0A 3ZZWA 5GJDA 3NNVA 2J5EA 3G5DA 4X6QC 4AACA 1JNKA 2CGXA 5IH4A 2OI4X 3Q2JA 2JDTA 4AE6A 4W8EA 1KE6A 2Q0BA 2IN6A 2C5XA 3EN9A 1JKTA 1LUFA 2CN8A 1JBPE 3MY0A 3UGCA 2BDFA 5BVFA 4CKIA 2XKFA 4IW0A 2PSQA 2RSVA 4CQEA 3L9LA 4R5YA 3RCJA 3V8WA 3QALE 4O0VA 4D4YA 1TQMA 3C0GA 4O1OA 2YZAA 1QPDA 1S9JA 3M2WA 3P7CA 2XK6A 3CGFA 4O86A 3LXNA 1LEWA 2WZJA 3KRWA 3ORTA 4K2RA 3CSVA 1PXJA 3TUCA 4B4LA 4BDJA 4AOTA 4KIQA 4ZS4A 2V7AA 4UMRA 5EDRA 4TL0A 3LFEA 4F0IA 2EVAA 4H36A 5CNNA 4YZCA 3OS3A 4FODA 4ZEGA 4Y5QA 3GGFA 5J87A 3UQGA 3F3TA 4I0TA 2I7QA 4AUAA 5ANIA 3ZRKA 2XVDA 5AR3A 4I23A 4EZ7A 4IIRA 2YM8A 5HE2A 1ZMWA 2F7EE 4JI9A 5JQ5A 3LQ5A 2GSFA 4DBNA 4O7YA 5DRDA 5HTIA 3MN3A 1A48A 5T3QA 1OVEA 3ZLXA 4F1TA 4ZJVA 4IAIA 3ZMMA 2PZIA 4OBPA 5HBEA 3KN6A 2WOUA 2XA4A 2G1TA 5FBNC 1PYXA 3NLBA 2ITPA 4F08A 1IAHA 3COIA 2R3KA 2XKDA 2XMYA 3PG1A 3BIZA 1KE8A 4JNWA 4EH5A
chains in the Genus database with same CATH superfamily
4CKRA 1OECA 3FZTA 4UY9A 3C4FA 4BDFA 1SYKA 1X8BA 2R3OA 3PVWA 2ZJWA 3K3IA 4IMYA 2X8EA 1ZOHA 2B52A 3EN4A 3KULA 1Y91A 1U54B 4FIIA 3ZU7A 4BZDA 3I5ZA 3EFKA 5CEQA 3TZ7A 5DE2A 5CEOA 5IH6A 2WO6A 4GL9A 4BIDA 4U3ZA 2YFXA 5K3YA 2ITNA 2XM9A 3QHWA 2WMRA 4B8LA 2I0HA 3PLAE 2Y4PA 4PP9A 2O2UA 3QX2A 4NKSA 3TXOA 3ORLA 3Q2MA 5HCYA 4JDJA 4JG6A 3MFSA 5EYKA 3EQRA 2JAVA 3GC8A 2C6EA 4FI1A 3WF8A 5KMJA 3UNKA 1DAYA 2BIKB 3FI4A 1ERKA 4KABA 4DC2A 1ZYLA 2JKQA 3QQJA 4FTLA 4L3PA 5EM7A 2YDKA 4AP7A 3LXPA 5LVMA 2RGPA 2WQEA 4EHVA 4QP4A 4FIGA 2W9FB 3VULA 1KE9A 2ETRA 5K9IA 4RA5A 2Z7SA 3VUIA 2Z60A 3KK9A 2GTNA 2JIUA 3R8LA 3HMNA 3P1AA 4NKAA 5AA9A 1HCKA 2OZOA 3MI9A 5IQAA 4CRLA 2HWOA 4MF0A 4AWIA 2ZDTA 3LVPA 1YXSA 4XRLA 3R2YA 4HYUA 2GFCA 5FDXA 5L2QA 3C13A 1VLRA 3SAYA 3PVUA 4CCBA 4QDVA 3EFWA 4AZEA 2BPMA 1U5QA 3TCPA 4DCAA 3ZO1A 3I6WA 5LMKC 5EOBA 3VO3A 5IEYA 4EI4A 5IG1A 2CJMA 3IW4A 2XK3A 3KVWA 3LM0A 3GC9A 4H39A 4C8BA 5A4QA 2BFXA 1SMHA 4YJTA 2IF8A 3HV3A 2VTOA 5AP2A 2HY0A 3QD0A 4ZTHA 3HP5A 5EFQA 4W4XA 5CASA 3ENMA 1FMOE 1XWSA 2OZAA 1YOMA 3IPHA 4Z9LA 2W1IA 2VTMA 2WOTA 3U87A 4BCOA 5ICPA 1GOLA 5JFSA 1IAJA 3VUGA 1XH6A 1EH4A 3UP7A 1Q5KA 3LJ1A 5H9BA 3RKBA 3Q3BA 4D5KA 4EK5A 2XUUA 1OKVA 1YI4A 2BKZA 4IB1A 2XNNA 4B0GA 2C4GA 3R01A 1PXIA 5L6WL 2RKUA 4FSMA 3WIKA 4EH3A 1H1PA 5BQ0A 3FYJX 3SQQA 2G9XA 4WNPA 4L67A 5AUWA 3NZ0A 1PXMA 5JZNA 1KV2A 3NAYA 3ULZA 1BL7A 4NCTA 4O6LA 4A9SA 4ANOA 1BI7A 4ANMA 3UDTA 4E6AA 2BRMA 3RZBA 3SOCA 3DAEA 4EHEA 4W4VA 4LL0A 4M69B 2A19B 4QNAA 1XO2B 3QRIA 4FKWA 5JZJA 5IQDA 5FG8A 3U55A 3QD4A 1JSTA 5IZFA 2XH5A 4X3FB 4W9WA 2QOIA 4HNIA 2YIWA 3MJ1A 4G6LA 4NM0A 4QD6A 3UTOA 3F69A 3GU8A 3EQGA 1OKYA 3LFSA 2BR1A 5TO8A 3BELA 3SD0A 2I1MA 4YZBA 4QYGA 4O4CA 3MS9A 2E9PA 2PY3A 4PTEA 4F09A 2QLQA 4QO9A 2B9FA 4YBJA 1SZMA 2XCKA 3AT3A 1Q97A 2BHEA 3HV4A 2X2MA 4NYEA 2PZ5A 5I4NA 3EQCA 3PE2A 4QYFA 3HMIA 2XK4A 2YIYA 1U46A 4WRSA 4ZJIA 2G2HA 5EDQA 5J95A 1PYEA 4DEIA 2WMWA 4FOBA 2VTHA 5CENA 2B7AA 2BRBA 1BMKA 4GG5A 4GFGA 4IZ5A 2P2IA 1SNXA 4JS8A 3WZKA 3KF7A 4R77A 4DDGA 4YC3A 3G9NA 3MPTA 5D41A 2BAJA 5CAPA 4O7SA 4CFXA 3FMJA 4LL5A 5CU6A 2EUFB 3I0OA 1W7HA 4ITHA 5L2WA 5HIBA 3T3VA 3TV6A 4G5JA 4IWDA 1WBSA 1H1RA 4RJ7A 5HKMA 3UC4A 4N6ZA 4RT7A 3DOGA 3ZFMA 4BDHA 4GVJA 4Q9ZA 2GS6A 3NNWA 3AKJA 3BEAA 4JR3A 5AX9A 4EH6A 2F2UA 4U8ZA 5CVHA 3F3VA 4I5HA 3TJCA 5B0XA 1ZYSA 3MA6A 2F57A 3Q52A 1KOBA 4BI1A 5CXHA 3ZLYA 3QQUA 3R30A 3C4XA 5IQHA 1YHSA 4MUQA 4OTGA 5F20A 4OLIA 4CT1A 3EQFA 3DB6A 4HZSA 4DEEA 4NJDA 5AP1A 2OJGA 2X81A 5BUIA 1T46A 3ML1A 4RIYB 2X7GA 4FKSA 4YSJA 3AKKA 2GS2A 3GU6A 4IJ9A 3HRFA 4U6RA 1NT2A 4CQGA 2YN8A 3U4WA 2CNUA 4D1SA 2WMXA 3DQWA 1M2QA 4C35A 5EHYA 1CTPE 2FVDA 1PJKA 4DT8A 2I40A 2HXLA 1W98A 2I0EA 2A4LA 4PX6A 5HU3A 3GCVA 2BZHB 2ITVA 4LUEA 5IMXA 4XH6A 4RRVA 5J9ZA 5KNJA 3GOPA 3MY5A 3S4QA 4A4OA 2WMAA 4E93A 4IQ6A 4I6HA 3DK3A 4HOKA 4FTQA 4PDSA 3BLHA 4JOAA 3H9FA 2HZIA 3SC1A 3AGLA 3OXZA 3IW5A 2O0UA 4FYNA 4I4EA 5EKOA 4USEA 2YWVA 3MESA 3MFUA 2E2BA 5E4HA 2QC6A 3DBQA 3HNGA 1PKDA 3GQIA 4FSQA 1PF8A 3COHA 4FTIA 3ZUTA 1YW2A 3NGAA 5CQUA 4CGAA 1MP8A 3NYVA 4ZSEA 2J90A 5CU4A 1H1QA 4GT3A 4IX6A 2UZUE 4Q2AA 4XV3A 5IISA 3L8SA 2WEIA 1JSVA 4FTUA 2JAMA 2WAJA 1UV5A 3KRLA 3FPMA 3HGKA 1Q8UA 4FE2A 1S9IA 3CXWA 3RAWA 3MA3A 4OW8A 2VTTA 1OGUA 3ZDUA 1M7NA 4OTDA 4FTTA 3D15A 3FY2A 4E26A 4I20A 5M53A 3EKKA 1RQQA 3MH0A 4JX7A 1OPJA 4F7NA 2NO3A 3E7VA 3BGQA 5FM3A 2O63A 3Q9WA 5CWZA 2QI8A 3VS4A 3W8LA 2V5QA 4ERKA 4FEWA 2BIYA 4IE9A 5CZHA 5CS6A 5CZIA 4BR3A 2NYAA 4GK4A 3GB2A 5EM5A 5IPJA 4MYGA 4V0GA 4ZTRA 2VX1A 4D2TA 1DS5A 1WAKA 2FGIA 4ZMFA 3OEFX 4J98A 2OIQA 2CSNA 4FKTA 2EXMA 3ZO4A 4ZLOA 3HEGA 5BV3A 4JQ7A 4V01A 4JL9A 4L3JA 4YURA 5FEQA 1FQ1B 2IO6A 5JGDA 3I4BA 3NYOA 3E3PA 5JGAA 2QCSA 2VTAA 3V5TA 1XH7A 4IVAA 4O7RA 4DBXA 1UNHA 4GJ2A 2QOKA 2H8HA 2R3LA 4JRVA 4X21A 3GCPA 4ERWA 3EHAA 5AUUA 3CEKA 5HX6A 3R1SA 3TI1A 2IWIA 3DAJA 4BICA 4OTWA 2GFSA 4E8AA 4NFMA 4I5PA 4U80A 5C4KA 3DKCA 5BX0A 4KIPA 4CRSA 3D0EA 2WQNA 3O0GA 4CZTA 2W4KA 5HBHA 2FB8A 4V05A 3RAIA 2QQ7A 4IFGA 1UWJA 3DFCB 4XG4A 4BIBA 2R5TA 4IWPA 4GH2A 3IONA 3CQWA 3Q04A 2QG5A 2UW0A 5CU3A 1XH9A 5CF6A 4ZSAA 1JWHA 3FMHA 3GFWA 3LFQA 3MIAA 1BLXA 3QYWA 4IANA 4AFJA 1KSWA 3D9VA 2JKKA 2O8YA 3ELJA 3MDYA 4TWCA 2YITA 3MVMA 2IVUA 1AQ1A 4IAKA 4LFIA 1M2PA 3BZ3A 1R39A 2OG8A 3HV5A 1P14A 5HO7A 3LQ8A 1ZOGA 3PIXA 3R1YA 3ZSGA 4DYMA 2AQXA 3A4OX 3NIEA 4O1PA 4UZDA 3MWUA 4O0YA 4L44A 2HW6A 5HLNA 3QLGA 2W4OA 3ZRLA 2AC3A 4IJPA 1GZKA 1H00A 4M15A 3UO4A 1IA9A 3IG7A 3DJ5A 3T9TA 2PE1A 3HKOA 4M0YA 4D2VA 3D5UA 3ERKA 3FQSA 4DF3A 1R0EA 2R7BA 2WQBA 3S1HA 3UZPA 1L3RE 3GQLA 5LMAA 2VTSA 2QG7A 4M97A 3QXPA 1G3NA 2PPQA 3C4EA 2IJMA 2WTKC 2QO9A 1WCCA 2WD1A 4ZTLA 4EC9A 3BCEA 3UG1A 3DLZA 3VUMA 5FGKA 3GU7A 4EZ3A 3TYKA 2B4SB 4Z7GA 3QZHA 2B0QA 2AUHA 3MPAA 2X8IA 3ORZA 4O27B 4PTCA 5AP7A 5HVJA 4CSVA 2RIOA 3NX8A 4YLLA 5CEIA 5M4UA 4FV1A 4JBVA 5F4NA 3R7IA 4YTFA 4EWQA 1H1WA 5AX3A 1ST4A 3HECA 1AGWA 2UZTA 4IADA 3CBLA 2JEDA 4EOOA 2EXEA 3FQHA 2A1AB 3H30A 3OW4A 4UWCA 4WT6A 5E8ZA 5HE0A 4A4LA 5M51A 3FKLA 1O6KA 4FK3A 2P33A 4XS2A 2O64A 4CVAA 3V5LA 4RPVA 2PVKA 3IS5A 4AZWA 3H10A 3RK7A 4C2VA 1Q41A 4HGLA 4FA2A 4J95A 4MD9E 2ZYBA 2OWBA 1BKXA 3FV8A 4ID7A 5T6KA 4BY9E 3FMKA 4F1OA 2QO2A 4OT6A 2NRUA 3E93A 2PMIA 2HELA 3EJ1A 1Y57A 2OH0E 4FKQA 3UVQA 2OLCA 5F95A 4LG4A 3WF7A 1CDKA 2PVMA 2W06A 2X1NA 2X2KA 3F7ZA 4ASEA 4A07A 2HZ4A 4RQKA 1MRVA 3RPSA 2ETKA 1K3AA 2WFYA 4QTCA 1M7QA 4OUCA 3RINA 3ZOSA 2C1AA 3GCUA 4FTCA 4QTDA 3AXWA 4WNKA 4Z55A 5HG9A 2ERKA 5IA0A 4LQMA 3OWLA 3SW7A 2NRYA 4FTNA 3V5QA 4AU8A 5CAUA 5TOZA 3V6SA 5LWMA 4WBBB 2YM5A 2GHMA 2WMUA 4NW5A 4EL9A 4XP3A 3VF8A 1NVSA 2JKMA 2WPAA 3Q4CA 3Q4UA 2WHBA 4ALVA 2VWXA 4Y72A 4U81A 2ZV7A 3FPQA 3NVMB 1WBTA 3V5PA 1J91A 4JXFA 3LQ3A 3HZTA 3FY0A 1V0PA 1UNLA 3RWQA 2WQOA 3C4CA 4BC6A 3ORKA 3H4JA 3VRYA 5JFXA 4I93A 5FTOA 4BBMA 2EB2A 3PP1A 4IZYA 2DWBA 4GYIA 2J4ZA 4FOCA 3TV4A 4DEGA 3QUDA 3N4TA 4XG2A 1OL2A 3G90X 5EOLA 3WIGA 4DN5A 4EK3A 5IDNA 4M7IA 2J0KA 5AWMA 3GC7A 2FSLX 3GENA 4L68A 3ZO2A 3TIYA 4JRNA 4EC8A 4QOXA 2AEGA 2JKOA 4RFZA 3CP9A 3HVCA 4CFNA 5LWNA 1RE8A 3G0EA 3MFRA 3DLSA 3JVSA 4FKRA 4L8MA 4QYEA 2R3JA 4BCJA 5F9EA 4FKPA 3KVXA 3KRXA 3M1SA 2J0JA 3FSFA 3S2PA 4KIOA 2HXQA 1F3MC 2PTKA 1E1XA 3DKOA 4RQVA 5DA3A 1SVEA 3QA0A 3BBTB 4FT7A 5M07A 2QVSE 5C8NA 3R6XA 4HVGA 4FSNA 3BE2A 3DJ7A 3F5GA 4S32A 4YO6A 5D7VA 3ZFXA 5KMLA 5KMIA 3A7IA 3KK8A 2QOCA 3E8CA 1A9UA 1J3HA 4N6YA 5JFVA 3NFGB 3ZM9A 1YWRA 1UU9A 2PYWA 3GOKA 3QTZA 4QTBA 4O7TA 2CCIA 5EHLA 2YISA 4KA3A 4E6DA 2VGPA 4BI0A 4P5QA 1XMMA 3AKLA 2C1BA 2GMXA 4RC4A 5DOSA 2GQGA 2XP2A 2HZ0A 4IX5A 5HCZA 3QHRA 2RFDA 4CT2A 5H8EA 5I0BA 2QOFA 1FGIA 4XHKB 5CF8A 4R7IA 1GY3A 3QKMA 2X9EA 2F4JA 1BI8A 1SNUA 3JXWA 4JAJA 5BMMA 3WF6A 2C68A 4G3FA 2XYUA 4C36A 4YMJA 1TVOA 4EH4A 2W1GA 3E92A 4A9YA 4TYGA 3FMMA 4LOPA 2YIRA 4DEHA 3W0NA 2J0LA 4G9CA 4NJ3A 4U45A 4EH2A 2RF9A 4IC7A 4EK4A 4MD7E 4RMZA 2HW7A 1KUTA 4X3JA 5JH6A 3KCFA 4NL0A 1FOTA 1OZ1A 3QAME 3LXKA 3AC1A 1H01A 3W10A 1JQHA 3MTLA 4M68A 1E1VA 3COMA 3GU5A 4PDPA 5KMMA 3M11A 2R0UA 2B9JA 3FBVA 4BGHA 4I5CA 3JUHA 2OKRA 3QWKA 4YZDA 4LRKA 3UPXA 3HLLA 5AM6A 4ZZOA 3ANRA 3KFAA 2IG7A 3NUNA 4DGOA 4Z3VA 3KRJA 4HCVA 4MXXA 3ANQA 3POZA 1WBNA 4WG4A 5EW3A 3N4UA 4O7ZA 2VX3A 5BMSA 2UV2A 2CGUA 3HA8A 3KU2A 4I6BA 4K0YA 4LGGA 3TACA 3TNWA 4FNWA 2XB7A 3QQGA 4BDAA 4GG7A 5AIKA 2JBOA 3UODA 4MEDA 3FHIA 4FT0A 3ZEWA 5CLPA 3A7FA 4EZ5A 3ET7A 4WNMA 3TV7A 3LM5A 1VEBA 4NM7A 4QMTA 1P5EA 4H3PA 2IW9A 4QMQA 4ACGA 5BVDA 4G3CA 4AN3A 5L6OA 4H05A 2R3NA 4DTAA 4U9AA 4EJ7A 4NT4A 3WYXA 3BQRA 3HDMA 4FX3A 4R1VA 2C0OA 3O51A 2BRNA 4DEDA 3DBEA 4M67A 2VWBA 4FTMA 2JIIA 4NTSA 4GT4A 2XANA 1H27A 1IA8A 4XG9A 3PDTA 1TQIA 4TWOA 2V55A 2ITZA 4BFMA 3VJOA 4YJSA 4NM5A 2YM4A 4D4SA 2R64A 4S33A 2XNEA 3QKLA 2V62A 2WMSA 4D9TA 3OWJA 4C4HA 3AC8A 5C27A 4K8AA 4KSQA 5CU2A 1OL6A 4D2WA 3PA4A 1KE7A 5ACBC 4E6QA 4O82A 4UXLA 2RL5A 3LCTA 4RX7A 4EH8A 2ESMA 2YDIA 3MB7A 3PXZA 1ZMUA 3DTCA 5E7RA 3U6JA 3DTWA 3ZZEA 4AAYA 3QXOA 4XBUA 4LV8A 1NVQA 2VV9A 4TRLA 5HTBA 4ZZMA 5E9EA 3QZFA 4YLKA 2ITTA 4FG7A 3VS0A 4E5BA 5LQFA 2IEWA 3DA6A 4YZNA 2B1PA 3THBA 3EH9A 2E9OA 3A99A 1JKKA 2QLUA 3C0IA 3HA6A 2Y9QA 4RIXB 3ZC5A 3IDPA 4G31A 4DCEA 3UZRA 2X0OA 3D7TA 4LMNA 4ANSA 3O7LD 3GUBA 4PV0A 4ZSGA 5KE0A 3RTPA 4WSYA 5IEXA 4MAOA 4NK9A 4BKJA 2IZRA 2EU9A 3F5UA 4I21A 3R9OA 2F9GA 5IA4A 4Z7HA 3MPMA 4AXEA 3SV0A 4DTBA 3W2PA 2PVJA 4IAFA 5GJGA 4W9XA 3V04A 4FF8A 3VW6A 3G0FA 3ZHPC 5TF9A 2J2IB 4FEQA 3UOJA 3FLWA 2UZEA 2WELA 3NRMA 1WVWA 2UZOA 4FTOA 4BCIA 5EI8A 4O4EA 3EOCA 5AUTA 5EDPA 4EQUA 3FUPA 4AF3A 2JFLA 4BF2A 4NWMA 3PTGA 4O6EA 3BGPA 3CE3A 5E8YA 5BVKA 3GC0A 1H28A 3HRCA 2Y6MA 4LOQA 1WBWA 3VQUA 5FD2A 3OTUA 3ZUUA 1WBPA 2PVRA 5IQEA 5ETAA 2W5BA 3A60A 3R21A 4FT9A 4R3PA 5HCXA 3W2RA 3ZFYA 2FUMA 5HORA 3O7LB 4XOYA 5FXRA 5IUIA 5FXQA 3UIXA 1KV1A 3PSDA 4FNXA 2OJ9A 3T3UA 4BJJB 4FV2A 3ROCA 4Q9SA 3HMPA 4RSSA 3CJFA 4EYJA 4U42A 3DXQA 2XYNA 3LCSA 4HYHA 2VZ6A 3DBDA 4FKOA 5CF5A 4DFBA 3HAVA 3Q4TA 3WE4A 2V7OA 2W5AA 4APPA 4K6ZA 1OIRA 5FLFA 5HD4A 3V3VA 1STCE 2RG5A 4AXCA 5AP4A 2UZNA 3REPA 5ETCA 1UVRA 4QDEA 5C01A 3VUKA 3QBNA 3MH3A 3PIYA 3Q53A 4FVPA 4GK3A 4H1MA 4BWPA 2PVLA 3UDZA 1JOWB 3RGFA 4XOZA 5HD7A 4UEUA 4USDA 4QNYA 4HVSA 1KWPA 4C61A 5GZ9A 4AA5A 1RDQE 1AD5A 3PFQA 4WUAA 1DI8A 3RWPA 3OUNB 4NU1A 3RVGA 3FE3A 4AA0A 4RFYA 2DUVA 4YTHA 3C4ZA 3GP0A 3WI6A 4TY1A 5BPYA 4C4EA 1G8SA 2WTCA 3LMIA 3A7GA 2QKWB 2FH9A 3TNHA 4CMOA 4KNBA 2IVSA 4F6SA 3PZEA 3FMEA 2R9SA 4X2JA 4XV1A 4DFLA 4EOMA 2NNWB 2GNHA 2VN9A 2UVXA 5HZNA 4ORKA 4GS6A 5A4TA 3WOWA 2I6LA 3P23A 3R28A 3KXXA 4G3DA 3FWQA 4KKEA 2YAKA 4F6UA 1W84A 5HIDA 3VBYA 3II5A 1OKWA 4G5PA 4MBLA 2PVNA 4F78A 4GU6A 3DS6A 3DDPA 3AD5A 1CKIA 4MNEB 1PXPA 5IUGA 5E90A 4DLJA 4AN9A 3ODYX 4EONA 4RLLA 4C58A 4NCTC 4WNOA 4PDYA 2RG6A 2R0IA 3Q6WA 3VS1A 3PXKA 4FTRA 4FV9A 4O22A 1TFFA 5K0XA 5B7VA 2F2CB 1JVPP 2X7OA 3HUCA 2ZAZA 3GCSA 5I3RA 3R8VA 5JN2A 2ITUA 3L8VA 3W1FA 4BKZA 4FVRA 4BI2A 4C37A 3C4WA 2XNOA 4ASDA 2UW7A 3JYAA 1ZYDA 4CFUA 3R71A 5E92A 4FSZA 4IM0A 3E8NA 3VBTA 4WA9A 3ROYA 3PXRA 2X6DA 3RJCA 2BUJA 3R7UA 3UIMA 5A6NA 3QD2B 5IQIA 2ACXA 4DAWA 5GHVA 1ZOEA 3SRVA 2XJ2A 4RWKA 1WFCA 4E73A 2H9VA 4H3BA 3R2BA 2YZLA 3WBLA 2WTDA 1FVRA 3BYMA 3MB6A 3F5XA 3R8ZA 5AP0A 1A06A 3UMXA 3JPVA 4RZVA 2G2IA 2IW6A 3LFCA 4FR4A 3Q9ZA 4QMPA 4WG5A 5KMKA 3KCKA 4RJ5A 4QMMA 4FV0A 5M08A 4G9RA 1YOLA 4XRJA 4L52A 5C8KA 3DBCA 3NS9A 4ZZNA 3RI1A 1Q62A 1LP4A 3O50A 4MVFA 3Q96A 2UUEA 3TEIA 4ZJJA 3K2LA 2PK9A 3A2CA 4ACMA 5KBRA 2LAVA 3CD8A 4O2ZA 3DZQA 2GHLA 3NYNA 4L9IA 4YJRA 5AADA 3W8QA 4C0TA 3EL8A 4AT5A 4G34A 4MHAA 4YP8A 4BKYA 4O7NA 4HVHA 5HO8A 3FMLA 3UQFA 4FEVA 3F7WA 4K11A 2GS7A 3VC4A 4O7LA 4TWPA 4FKVA 5AP6A 3NIZA 3EFLA 1H4LA 1VYWA 4J99A 2IZUA 3E7OA 4EOPA 4L3LA 2ERZE 2BRHA 3W32A 3PYYA 3IOPA 3EQBA 4N57A 2WTVA 2YACA 4W4YA 3V5WA 2OF4A 1YDSE 5A46A 4MCVA 5CNOA 2GQRA 2VTLA 4KB8A 3R8UA 4R1YA 4RX9A 4C62A 3FZ1A 5E1EA 4XLVA 4QPMA 3LE6A 5AUZA 4DFZE 4OBQA 2R4BA 3TWJA 5JSMA 3CPCA 2WEVA 2RFEA 2C3LA 4M13A 4TN6A 4YPDA 3W18A 5J7HA 4Y85A 5EG3A 2XJ1A 4C34A 4E4LA 4YJPA 3BHTA 4LGDA 2H96A 3LJ0A 3S00A 5C1QB 4NIFB 3NMUF 4RWIA 4XMOA 1ND4A 4XEYA 4NZWB 5M09A 3DQXA 4U3YA 4IAYA 3JY9A 4FGBA 3QKKA 3Q5IA 3WZEA 2GPHA 4OAVB 4TKSA 4X7QA 1XBCA 3I5NA 3P9JA 4EH7A 5H3QA 1O6YA 3DK7A 5GJFA 1U54A 5A6OA 2E9VA 5TT7A 3WYYA 4CTBA 2XIRA 3FMDA 4PMMA 3RAHA 4WBOA 3EZVA 4U5JA 4F4PA 3C5UA 3OY1A 5M4FA 3PY0A 4APCA 4FJVA 5L8JA 4OAUC 3FMNA 3O8TA 1REKA 2VTJA 3QRTA 5DBXA 2OXDA 5FTQA 5D11A 5JK3A 3G6GA 2C6MA 3PJ8A 4IM3A 3R9DA 5J1WA 2X4FA 3NYXA 5JRSA 4F1MA 2VWYA 1U59A 5D9HA 2PUIA 3RAKA 3MVHA 4UYNA 5EH0A 1GIHA 2F7XE 2OF2A 5A3XA 4TW9A 5DT3A 3VWAA 3ZLSA 5KX8A 2BCJA 3OP5A 3OUKA 3R9NA 3CTQA 4RJ8A 3BU6A 2H34A 3CGOA 3I7BA 3NCZA 5I3OA 5ANKA 5LARA 3P5JC 3FJQE 1P4OA 4GRBA 4JAIA 4R6VA 2OO8X 1J1CA 1W8CA 1KE5A 5FRIA 5AIRA 5D12A 2NPQA 3BYVA 5HO6A 4ASZA 2C69A 4BYIA 4R78A 2KULA 2ITXA 3ENHA 3UIUA 4IFCA 4YJQA 3S95A 4CKJA 2PVHA 4C2WA 5AM7A 4I94A 5CSPA 3FXXA 4MK0A 2BZIB 4UXQA 4MQ2A 2XCHA 3LPBA 5LMBA 3VS5A 3ETAA 4CFFA 1DM2A 4XV9A 4KSPA 5FP5A 4YBKA 2WTKB 2GTMA 3ALOA 4J96A 3VN9A 4N70A 3VS6A 2AYPA 3UPZA 4GSBA 4ALUA 3O8UA 2BHHA 3PXQA 3SA0A 4KRDA 3C50A 2XNBA 2A27A 2XNGA 4JG8A 4O4BB 4IWOA 2GNLA 2ITWA 3FZOA 5CT0A 3T9IA 4IVBA 1O6LA 3D5XA 4EQCA 4K33A 4YO4A 4QMXA 2JDOA 3E5AA 1LPUA 4U44A 4ASXA 4YTCA 5E8TA 2R3IA 2OXXA 3F3WA 3KIOC 3O8PA 3LXLA 2C6KA 2VU3A 2O5KA 5DT4A 4EOJA 4GVAA 4O7VA 2CGWA 3BI6A 3PA3A 3I79A 1W2CA 2UZBA 2C0IA 3RZFA 4CZYB 1J7LA 5K5NA 4GV1A 4BTKA 4IH8A 2Y8OA 2W1CA 4DH5A 5C8MA 4ZMEA 4WSQA 4C59A 4JDIA 4KUJA 5L8LA 3AMAA 4MBJA 2UW9A 2V22A 4FKGA 3DGKA 3DY7A 4EBVA 4WHZA 1APME 3NW6A 3FKOA 4OTFA 1JAMA 1OM1A 4IZ7A 4IHPA 5HQ0A 3R63A 5KKRC 3OTVA 4XG6A 4BCKA 3MTFA 4O2PA 3VUHA 4AW5A 4GT5A 4PDOA 3R0TA 5M57A 3TMOA 4M69A 5HTCA 4JVGA 3TJDA 3L9PA 2JGZA 3AGMA 3QTRA 4C4JA 4PWNA 4J7BA 2KTYA 3BX5A 2BZJA 3PXYA 4X3FA 4BCPA 1JKLA 3RBWA 4D5HA 2QKRA 5KUPA 1WBOA 2DS1A 2HCKA 2JIVA 4UX9A 4FTKA 1Q3DA 4IM2A 1PMNA 4YUQA 5FTGA 4DFNA 3U6IA 3U9CA 3LFAA 4O0WA 3CD3A 4ZTMA 2PZPA 1H26A 2WTJA 3PZHA 4Y46A 3KC3A 1QL6A 4JBQA 4C3FA 2SRCA 2XBAA 3OCGA 2YM6A 3D14A 4FL3A 5DN3A 3TTJA 3SOAA 4AZVA 4YHTA 2ETMA 3UOKA 2FSOX 5CAOA 2YJRA 5AAFA 2PZRA 3OZ6A 5KMOA 3H9RA 1XBAA 3AC5A 5IF1A 1NVRA 3D4QA 4G16A 3PJ2A 3NUPA 3POOA 4RA4A 4BTMA 3ZBXA 1L8TA 5EW9A 4USFA 2BDJA 2HOGA 4K1BA 5EM6A 2Y4IC 4BDEA 3ID6C 3BWJA 5A4CA 4DH7A 3F6XA 5E91A 4FZDB 2GNFA 4MF1A 4XV2A 4D0WA 1E9HA 2IZTA 4FG8A 2FSTX 4PP7A 3NUAA 3LCKA 4W8DA 4L7SA 4G6NA 2UZVA 3OG7A 3H9OA 2BMCA 4WOVA 4DGLC 3FEGA 3QTXA 5A9UA 4R3CA 5E8VA 3NNUA 5DI1A 3I0QA 2C3JA 3LFNA 3PSBA 4X2KA 2HENA 3DU8A 3F66A 4GEOA 4KS8A 4KIKB 5JKGA 2BALA 4FSTA 4C3PA 3DCVA 3IDBA 4YJVA 5CAQA 4BN1A 2WMQA 2J6MA 4RIWB 4EJNA 1JSUA 3D5WA 5L2IA 1UKIA 1YOJA 1J7IA 4FL1A 1M14A 2WU7A 4Q5EA 2CKEA 4UALA