3FV8A

Jnk3 bound to piperazine amide inhibitor, sr2774.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
346
structure length
331
Chain Sequence
NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDTLKILDFGLARVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAXXXXXDEREHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 10
publication title Synthesis and SAR of piperazine amides as novel c-jun N-terminal kinase (JNK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 331
sequence length 346
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fv8A01
5HG9A 4QP3A 5ACBC 4AZFA 2ZYBA 4MXAA 3NLBA 4PUZA 4QPAA 5BYLA 3BKBA 2YJRA 4FTKA 4PRJA 5DT4A 3RK5A 5AJQA 4BI1A 2HELA 2CLQA 5L2SA 5E90A 4BBMA 4DN5A 1Q24A 2QOCA 3PLSA 4GSBA 2Y9QA 4ZOGA 4F9WA 4QMSA 5EFQA 4ORKA 3HRFA 2E9PA 3OWKA 2EXCX 1K2PA 2NRYA 4DFLA 2Y4IB 4FUYA 5FEDA 5AUXA 2WMQA 4KAOA 5LMBA 5AP4A 3QLGA 2QOKA 3QZGA 4ZZNA 4TYHA 3FXWA 3K3IA 4LL0A 1JLUE 2PZYA 3TJCA 2I40A 3K3JA 3MVLA 3QHRA 4FODA 4ACHA 4FNXA 3W2PA 1YI3A 3ORKA 2OIQA 4ZSJA 5JRSA 3V5WA 4AGUA 3TKUA 1JOWB 2A4LA 2Z7LA 5HVKA 4IHPA 4WG3A 5KX8A 4JX7A 4U8ZA 2YWVA 4CMOA 3RAHA 2J2IB 4XRLA 3TUCA 4NJDA 5HCYA 4C3PA 4I94A 5F4NA 4ACCA 5EQPA 4Z3VA 3SD0A 4MBIA 5DG5A 4I5MA 3PRFA 3TTJA 5JGAA 5LVPA 3PVWA 3LFBA 5DOSA 4O0YA 3GBZA 4QP7A 2E2BA 5DN3A 2RG5A 5KZ0A 4CTBA 4F9YA 2Y0AA 3JUHA 3DY7A 3L1SA 4QPSA 3QRKA 4FL2A 5KBQA 3NYNA 4KKHA 5EHLA 4FTTA 3LOKA 4WRSA 1UNGA 3C4EA 2X2LA 4IJ9A 5C26A 3A4PA 4HVGA 1M52A 4WIHA 5EYKA 3PVGA 5J95A 4DLJA 4OTDA 2Z2WA 2HY81 2BIKB 3OT8A 3RHXA 2XIZA 3D83A 2BROA 2VNWA 3TNWA 1PMVA 3TV4A 1ATPE 2ERZE 3C7QA 2CLXA 3KRJA 4N70A 1NXKA 3Q6UA 4NTSA 4O83A 5FP5A 5AAFA 3EL7A 5AR5A 5FP6A 2QR7A 4FSYA 5JRQA 3U55A 2PL0A 4ALUA 2H96A 3PXRA 3NIZA 2C0IA 3TNHA 2RFEA 4CD0A 5CI7A 3PVBA 2XIYA 4CLIA 2C6MA 2CCHA 3D9VA 4UMQA 3A8XA 3R7GA 2E9OA 4G6LA 4IX4A 4MQ1A 1VJYA 3EIDA 2ZV2A 3LVPA 3UQCA 2G1TA 5HCXA 2ONLA 4O7YA 4HCVA 1LR4A 2YHVA 3R22A 3VS7A 2A2AA 2UZTA 2BMCA 1UU7A 2YABA 4ZTLA 2C6EA 2VD5A 3F7WA 1WVYA 2YM3A 3O17A 3ZO1A 1ZMWA 3SG8A 4ZMFA 2YIYA 3C13A 4OAUC 4HYIA 4A4LA 5E8YA 3BWJA 4L8MA 3MH3A 4QMUA 3S2PA 4RWLA 1M7NA 3PUPA 3G0EA 3AXWA 4EZ7A 4LRJA 4XX9A 2XJ2A 2VTLA 3EKNA 3GU7A 4CLJA 4KABA 3E8DA 3JPVA 3PDTA 4F65A 4XP2A 2YDKA 4KINA 2J5EA 2OJJA 4ZTRA 3G9NA 1J3HA 1GNGA 3LHJA 2W5HA 1TKIA 2QHNA 4HOKA 4WNMA 5CU3A 4BZOA 4F0FA 3GCQA 4AACA 4A07A 3DBDA 4LGDA 4DH1A 3FWQA 4GMYA 3FI2A 4J99A 4GG7A 3F2NA 5CU0A 2XK6A 1FINA 3RGFA 2JIVA 2XRWA 4F08A 4Y5HA 1ZOGA 3BU6A 4L6QA 4RLLA 3R1YA 4TTHB 4AXAA 5B2MA 1PXKA 2WU7A 4FIIA 4QMNA 2OZOA 3D5VA 3NZ0A 5EQYA 3LIJA 2BCJA 2Z7RA 3C9WA 3ZDIA 4A9TA 1QPJA 4CV8A 4FTNA 2JKOA 3BHTA 5AV0A 1W84A 3OWLA 4IAZA 4RVTA 5E92A 4EORA 3PP1A 4XCUA 2HZIA 4FV0A 3MVMA 3OWPA 4FKQA 5H8BA 4USDA 3QZFA 1K9AA 2IO6A 3COIA 3MB7A 4I6FA 1A06A 4J8MA 2C68A 4FTMA 3WE4A 4BCOA 3GFEA 4LYNA 1S9JA 5E4HA 4EOLA 1YI4A 3R8PA 2G2IA 4X3JA 4WNOA 3VAPA 2VTNA 1APME 4MWIA 3DBQA 3L8SA 3R30A 3ZFMA 3AC8A 3QCSA 4OTHA 4XUFA 1U5RA 2G01A 3GOKA 5FEEA 3W8QA 5IISA 1YWRA 2UZWE 3ZYAA 5L6WL 3S0OA 4TY1A 4YLKA 4YJOA 5E8WA 1OBGA 3ZSIA 4LM5A 5AAEA 4IVBA 3BLHA 4JLCA 1ERKA 1TQMA 4QYYA 4BTJA 4ZTSA 4EWHA 4GV1A 5HX6A 1Q8WA 3FDNA 1XBAA 3QTXA 2X8DA 3RZFA 3HLLA 4M0ZA 4IVDA 2HW6A 3EYHA 3FKLA 5CEPA 2XM8A 3EMGA 4DG3E 4KWPA 3NW6A 4S2ZA 4EH2A 1J7UA 5I9UA 4ZZMA 2PVMA 2W1FA 4RIWA 3NIEA 1OL5A 1KWPA 4E5WA 4GG5A 2G15A 1GOLA 3JVSA 3ZDUA 4G9CA 3Q60A 4FOBA 4PWNA 3LXNA 5TF9A 3FZTA 1PXIA 3HUBA 3VUIA 3OFMA 2WMXA 4X2NA 4BBFA 3OF0A 2C47A 3I60A 5CVGA 3PSBA 5AR8A 5BYZA 3U4UA 1Q62A 5AV1A 3IDCA 5D41A 5KKRC 3KRXA 1PYXA 2C3IB 4FKOA 5DT3A 1W82A 4QYEA 4CXAA 4DH5A 4AW5A 4L01A 2UVXA 3F3ZA 4H3PA 4O38A 4QMYA 3ZLSA 2JDTA 3LCTA 4IWPA 2B52A 3D0EA 4HGTA 3W10A 1H1WA 5CVFA 4FSNA 5GNKA 2C5OA 2BR1A 1PXLA 5FBOA 4TYEA 4IWDA 4GK4A 1FMOE 4AW2A 4CEGA 3R7EA 5M4FA 5IA4A 2O65A 4FZFB 1PF8A 4MQ2A 4IFCA 3RI1A 2ITQA 4QYGA 4FT7A 4EHEA 4DT9A 4ASDA 3QQGA 3F3VA 1LPUA 2EWAA 4PTCA 4RJ7A 4D2SA 4AA0A 2PE0A 1B38A 3H10A 3IOKA 3ORTA 4YZBA 5E8XA 4I41A 3MA3A 4GK2A 3JYAA 2CHLA 4FL3A 4U3ZA 1WCCA 4Q5HA 3FMKA 2ETKA 1YKRA 4J52A 5DIAA 4CVAA 3LMHA 3BCEA 4E7WA 4GUBA 4D4SA 4TWNA 1R0PA 3KGAA 4FG7A 3AOXA 2OFVA 5HO8A 4QMPA 3SOCA 3NGAA 3UG2A 2RGPA 5KNJA 4L46A 4BYIA 4GH2A 5JZJA 4IX5A 4YTHA 2PUNA 1YXXA 3LJ1A 3KB7A 5EDRA 4E4XA 4IX3A 1YW2A 3R6XA 1XH7A 3UVQA 2R64A 4BDAA 3AT3A 3DK3A 3HAMA 3WIKA 4ITHA 4FSQA 2HWOA 3MPMA 4QTCA 1WBPA 2WU6A 3FPQA 2ZM1A 1S9IA 4WSYA 4QMZA 3TZ9A 2ERKA 3H3CA 3NR9A 4EOQA 5KMKA 4BDBA 3BLRA 2UZVA 3EFJA 2X7FA 4MTAA 5DR6A 5G1XA 4ZY4A 3KMUA 3DOGA 3CPCA 4EOIA 4MXYA 4BHNA 5KMLA 2I7QA 4PP9A 4H1JA 4BC6A 3CLYA 4L52A 5L6PA 2YACA 3PWYA 5CVHA 5FGKA 2QHMA 1Q3WA 3VUHA 5I3OA 4JDJA 3ZRKA 2B1PA 2I0EA 4NUSA 2WFYA 2XKDA 3VS5A 4JT3A 3I7BA 4E93A 2W96B 2ITVA 3VBXA 4D1ZA 2OLCA 1JQHA 5LCKA 3WE8A 5HU3A 2R3NA 1KV2A 1PRYA 3B8QA 2P4IA 3OD6X 3HV5A 3QTRA 3R7OA 5IA0A 4E5BA 5F9EA 2WEIA 3NYVA 3EB0A 3TZMA 5CAPA 4ZTHA 4G3DA 1Z57A 4D0XA 3KREA 5FM2A 4UWBA 4CRLA 1JKTA 4JIKA 4DF3A 2Z8CA 5HKMA 3ZFYA 1NVRA 4R6VA 2RFDA 3M42A 3D5UA 3O8UA 5C8MA 4BDJA 1KSWA 2HWPA 3WZJA 5CU4A 5J8IA 2PVJA 1Y6BA 4MXOA 4GU9A 3G9LX 1U5QA 4JQ8A 4CMUA 4IFGA 3ORXA 3OTVA 4L3LA 2V7OA 3ZU7A 5IQGA 4F1OA 4I93A 2CN5A 3DKOA 3JXWA 2F2UA 3DFCB 2YA9A 1FPUA 5CYIA 3SXSA 3VS1A 4D2TA 3DFAA 5I5ZA 1GZNA 5JFSA 4D2PA 4FKTA 1OL7A 4FG8A 3WF9A 2ESMA 4FTJA 5TE0A 3IS5A 4AE9A 3G90X 3ZUUA 4I3ZA 5CSXA 5E9EA 2JDVA 4V0GA 4D4YA 3CTJA 4IVCA 5HESA 4BN1A 2I6LA 4YZCA 1Q41A 4W9XA 3DAKA 3OROA 2Q83A 2BRNA 5KMNA 1LEZA 4FK6A 4NK9A 3CC6A 2VTSA 5D12A 3CP9A 5IUHA 3LFQA 3TCPA 5M44A 4MBJA 5AP6A 5HVJA 3ET7A 5KMOA 4EBVA 1F0QA 1W7HA 3TDVA 2VTQA 1WAKA 4O21A 5DT0A 2PK9A 4FTAA 5G6VA 5I9ZA 3QC9A 4ERKA 3SDJA 4EK8A 1P5EA 4ZJJA 2WEVA 4CKJA 3R8LA 4M69B 1ZLTA 5CXHA 3DLZA 4AN2A 1REJA 3KXMA 3VW8A 4D4RA 4J96A 5BUIA 4TYIA 4YJNA 2B0QA 3FPMA 4NWMA 2QOOA 4CG9A 2W05A 4FEVA 2VUWA 5EQEA 2AUHA 1YHSA 2PMOX 4GYIA 5CAVA 3I0OA 5HE0A 1BI7A 3DGKA 3P7BA 4GRBA 5HG5A 4M12A 1QPEA 1M7QA 3C5IA 3DK7A 3QD3A 4Z16A 4E4MA 3GENA 4QMTA 5CS6A 1NW1A 4UWYA 3IO7A 5DR2A 2X8IA 1YOMA 3L9MA 5DGZA 2J0IA 2ZV8A 5E1SA 3BIZA 3I4BA 2V62A 3UPXA 4JR7A 5AA8A 3FMEA 5DA3A 3ZO3A 3KCFA 5H3QA 3TNIA 2PULA 4IIRA 4TN6A 5DPVA 3H30A 2P33A 3BYMA 4I0SA 4KBCA 4MBLA 4QP8A 5CQWA 3K2LA 3PIZA 4GW8A 4C2VA 4G3GA 1ZY4A 4I20A 3Q5ZA 2GQRA 1FGKA 1OIYA 3ZBXA 4W4VA 4L7FA 5A54A 1XWSA 5AP5A 3KULA 3PXQA 3PE1A 4IAKA 1AQ1A 5HE1A 3CD8A 4EHZA 1DAWA 4J8NA 2Z60A 3ZONA 4ANMA 3R71A 4BIBA 3Q4TA 5AV4A 4H05A 4FSZA 2XKCA 3OHTA 2BRBA 2G2HA 3R73A 4C8BA 3BE2A 4DE4A 3NMUF 4FNYA 5GINE 1ZYLA 3ZLWA 3LFNA 3BQRA 5HHWA 2Y7JA 3WARA 5GZAA 3QYZA 4PF4A 1L8TA 4YJTA 3ETAA 5HNGA 4EH6A 1MRVA 2BIYA 3V04A 5GZ8A 1OIRA 5DRDA 3RPYA 4CV9A 3U6HA 1XHAA 4DG0E 4O86A 1TVOA 3G15A 3ZSGA 3OW4A 4EH3A 4D1XA 3PXYA 5C8KA 5EI8A 1W83A 1URWA 3ANRA 3C0IA 3QZHA 1HOWA 2DUVA 4KNBA 2XBJA 3Q6WA 4FT3A 4RJ4A 3ROYA 3ZS5A 4PDYA 4FMQA 3NCZA 1SZMA 2O5KA 2JLDA 2VWIA 5C03A 4PMSA 3DBEA 4P2KA 2F4JA 3W2SA 4CFXA 4HZSA 3WIGA 5CF8A 2GMXA 5BPYA 5BYYA 2C6IA 3OEZA 5TKDA 5KMMA 3PG1A 2A0CX 4BDHA 1WVXA 3UO5A 1PHKA 1OL6A 2FSTX 4LMUA 4RZWA 4IACA 3QZIA 2FB8A 4O0XA 2OF4A 1UVRA 4NFNA 2R3LA 5FDPA 2HCKA 4F9CA 3ORMA 2PVHA 5DE2A 4EOMA 4USEA 5HD4A 5L6OA 3FC2A 4GIHA 1Q61A 4OBQA 4ZTNA 5L8LA 3HAVA 2HAKA 4MD8E 1GY3A 3FBVA 3O2MA 3HV6A 3OTUA 3C51A 4FV2A 1CKJA 2VO0A 1M2PA 4KBKA 4A9YA 3LM0A 5LWMA 4CFMA 4RX8A 4WRGA 4D5KA 3GC0A 3UYTA 2YIXA 3PXFA 4O0TA 2QQ7A 3E62A 4JBQA 3EHAA 5HTBA 1O6LA 4M3QA 4YGAA 5AUZA 3ZM9A 5BUJA 5A3XA 3R7YA 1Z9XA 3F7ZA 4X21A 4EOKA 2WZJA 2JIIA 4JR3A 4FIFA 2V0DA 5AP0A 4F9BA 3OBGA 5K4IA 4GU6A 2GS2A 4UZDA 4RQVA 1UU8A 1FVRA 2ZV9A 4JS8A 2IJMA 3F61A 4TYHB 3TL8A 1Q8YA 3II5A 4G6OA 4TRLA 3QQFA 4PMMA 5IH6A 3VQHA 3QTSA 3HECA 2ZOQA 3A99A 3NAYA 1IAHA 5DEWA 2XRUA 1XH9A 2FO0A 2HK5A 1BX6A 5E8ZA 4TKSA 2OSCA 4ANNA 4QT1A 5B7VA 4UV0A 4YTFA 4RIXB 4NCTA 3P08A 3O96A 2XIRA 1OKZA 3K54A 4M66A 3MWUA 3BI6A 4Y72A 4S32A 4EZ3A 4DBXA 3FMHA 3FZOA 3Q3BA 5GJDA 5HG7A 4J95A 5CEMA 3UTOA 3QKKA 4C4FA 3CIKA 2OIBA 3PZEA 4ZMEA 1FMKA 2QONA 2W1EA 4ACGA 3A7JA 3POOA 3MTLA 4P4CA 4LUEA 4UYAA 2X1NA 2AC5A 3BEGA 3RHKA 5IQCA 2YM5A 3ULZA 4HGSA 2R7IA 3MJ1A 3C1XA 3ENHA 4OBOA 3UOKA 4E1ZA 2CGUA 5AUYA 5AP2A 3EN4A 1OI9A 3R02A 2W7XA 4ANBA 4X3FC 2P55A 4II5A 3QA0A 2XIXA 3IPHA 3MFTA 1UNHA 4AN9A 2GSFA 3IECA 4A7CA 4GVJA 3FL4A 5LVNA 3E63A 3ODZX 1YRPA 3FI8A 3OWJA 5HNIX 2XYUA 3UZRA 4R7HA 4E4NA 2YAAA 5CSVA 2UUEA 2UW5A 3GOPA 4G5PA 3QTZA 4ZZOA 4BYJA 4W8EA 3NYOA 3QTUA 4FV4A 4YSMA 3AG9A 2IZRA 4U97A 3LQ5A 3O8TA 2Z02A 4FIJA 5M56A 3PA5A 4YPDA 4DITA 4XNEA 1OKWA 3RWQA 2VX0A 2C1AA 4Y46A 1UKIA 3QC4A 3HP5A 3PIYA 5ITAA 4NJ3A 4HCTA 3ZC5A 3UC3A 1KOBA 3CQEA 1SMHA 3EN7A 4USFA 1L3RE 3FLYA 4G2FA 4HGLA 1OPKA 2W5AA 3P86A 4YLLA 3ZBFA 3KXZA 2R0UA 4U79A 4O7WA 2PVFA 4XV1A 3P0MA 1H1RA 3PYYA 4X6QC 3SXRA 4PDPA 3R63A 3V3VA 3R7IA 1J91A 1Q3DA 4NSTA 3C50A 4BZNA 1KV1A 2YCQA 5IDNA 5AIKA 4XYFA 5CZIA 3H0YA 4WNPA 3C4WA 3FAAA 2VWYA 5DR9A 5HBJA 3ALNA 4YHJA 3NUAA 3QGWA 4B0GA 3ZC6A 4U3YA 3QF9A 2KTYA 4F7SA 4LOPA 4DFZE 3BYOA 4XG8A 4BCJA 2UZUE 2RFSA 2QODA 3E8NA 4BRXA 5JMSA 5B2LA 4P5QA 1IRKA 1OMWA 4ZXTA 4BCQA 3CKXA 4UXQA 1YDTE 4R77A 4FKLA 2XNBA 2Q0NA 5K4JA 5HVYA 5IKWA 3VF8A 1KE8A 3KQ7A 5L8JA 4GVAA 5FQDC 4YNEA 3EKKA 4D4VA 4GJ2A 3MV5A 4OR5A 4BDIA 4FEXA 3P7AA 2J0JA 2BRHA 2IZSA 3E7VA 4AN3A 2BAJA 2YAKA 1QCFA 1F5QA 4C37A 2BVAA 1VZOA 4JJRA 3UIBA 3WBLA 1ZY5A 4FT0A 4X0MA 4XG6A 4MD7E 3PLAE 1CDKA 2VO3A 3PG3A 4F1TA 3AMYA 3C5UA 2WO6A 3ORZA 2QR8A 5CQUA 1OBDA 2I0VA 2RFNA 4LQMA 3P79A 4IWOA 3BGPA 4XEYA 4CZYB 4RVKA 1RE8A 2VAGA 3RNIA 2UZLA 4Q9SA 3KVWA 2E9UA 2XUUA 3U9CA 3HX4A 2I0HA 4E26A 4W4WA 3BBTB 2BDWA 3KL8A 4U45A 5AADA 5CAQA 4AZSA 3OY1A 2UW9A 2FVDA 4MD9E 2P2HA 5JFXA 2WMBA 2R3PA 4YBJA 5IF1A 1IR3A 3EFLA 4JBVA 2PMIA 1WVWA 3GU8A 4NU1A 1YXUA 4PL4A 5CNNA 2YLFA 2W4OA 3FLWA 5ANGA 5E8SA 4MCVA 4XG7A 3UOLA 3LFFA 3ALOA 3DDPA 4BTKA 3TN8A 4FTCA 5M09A 4JVGA 5IA5A 3DXNA 1OL2A 3GXLA 4FSWA 2NNWB 4RIWB 1VYZA 4DCEA 3OCGA 4XG4A 2R9SA 4FYOA 2QOQA 3F3TA 4TWOA 4RBLA 1OIQA 4G34A 3FZ1A 4FTUA 3CXWA 4RX9A 1W0XC 2X7GA 3B2WA 3IW6A 1IASA 1P4OA 4K9YA 2JFLA 4RIXA 1PKGA 2IZTA 3FMLA 3RZBA 4PTGA 3NWWA 5A4EA 3DXPA 5FUTA 3H9RA 3ZHPC 4EOOA 4L7SA 1HCLA 2YCSA 3Q9WA 3DKCA 4LG4A 3UQFA 3JY0A 4MXXA 1Y8GA 1G8SA 1ZXEA 2C6OA 4DGNA 3Q4ZA 2V7AA 3ZZWA 1V0OA 4YO4A 3BX5A 3JVRA 4R3CA 2VX1A 4JL9A 1IG1A 2QU6A 3M2WA 4I0RA 4LFIA 4RIYA 5HTIA 2QLQA 2R3RA 1R1WA 3I6UA 4IZYA 4O0RA 4BKZA 4RJ8A 4U80A 2XK4A 2H8HA 1GIIA 2WTWA 5F1ZA 1LUFA 4O84A 3EQHA 3KXGA 3VN9A 3W2RA 2VWXA 4FNZA 5AX9A 1XH4A 3CY3A 3QKLA 4G9RA 2EXMA 4QP4A 4U0IA 1H1QA 3EZRA 4K18A 3AC4A 3RVGA 4ZY6A 4RX5A 1WBWA 2Y4IC 3VBVA 2JKMA 3VBQA 4RVMA 4C2WA 1XKKA 2GQSA 2FSOX 2O64A 2X81A 4BR3A 3ORNA 3POZA 5CTPA 5FDXA 4M97A 4X2GA 3OCSA 3RM7A 4C3RA 2XA4A 4IM2A 2YISA 3FI4A 2GQGA 3E3BX 4DEIA 2IWIA 3FHIA 5LVOA 4CKIA 4U42A 3LFCA 3H9FA 3LCKA 4AU8A 5BMMA 2F7XE 4J53A 1UNLA 5TO8A 3SOAA 4UXLA 2FA2A 3UNZA 2IW6A 5IQDA 1H1PA 2W17A 4I5CA 5H8GA 1GZ8A 2WMUA 4UWCA 3W18A 5IQFA 3OXTA 2J0KA 3CBLA 4F7NA 1JKKA 1WBOA 2J50A 5C1QB 2XH5A 3LFEA 5AIRA 3U9NA 2O63A 3FL5A 5IU2A 4DINA 1Q97A 4O1OA 2QC6A 2BTSA 3R83A 4J71A 4C33A 4E6DA 3HEGA 2UVYA 3TACA 4M67A 5ANJA 1A48A 1PYEA 4Z7GA 2GTNA 4FV1A 5J9ZA 4I4EA 3ZXZA 3UGCA 3V5PA 4W9WA 5HD7A 3F6XA 3HZTA 2X4FA 4FIEA 5GJFA 3R2BA 5AUTA 5AA9A 3TZ8A 5I9VA 1UWJA 2W1IA 1WBVA 4GFMA 5FEQA 5HIBA 3MY1A 3Q4CA 2QKWB 4WT6A 4IB5A 1UA2A 2JKKA 2CCIA 4U9AA 5DH3A 3L8XA 5EK7A 4R3RA 4FK3A 4YP8A 5HLPA 3FE3A 4F6UA 4UMPA 4C62A 4FTIA 4YZMA 4ALWA 4AP7A 4XV3A 4ANSA 2W1GA 4B7TA 2A1AB 1KUTA 1ZZLA 2IVTA 3VWAA 2BDJA 3E92A 5H9BA 3BYVA 4K6ZA 1OKVA 2YJSA 3U51A 1ZZ2A 4I24A 3DS6A 1KOAA 4FA2A 2BFYA 2PVLA 3QX4A 3HV4A 5IA1A 4BGQA 2R0IA 4M0YA 2ITYA 2HYYA 1H07A 3ORIA 4G3CA 2VWBA 5FG8A 2BILB 4KBAA 2GFSA 3C4ZA 3EN6A 4BDDA 5A4LA 3TTIA 2AC3A 5KHXA 4GT4A 4PPCA 2GNLA 2AYPA 3R7VA 3U6JA 2XZSA 4V0GB 2W99B 4WHZA 2QOIA 3NAXA 5LMAA 5TOZA 3KN6A 4HVIA 2C0OA 1OITA 3F3WA 2XKFA 4FTRA 4F7LA 3TUDA 4IAFA 4I6HA 5CSWA 4O7TA 3R9HA 3PIXA 3DJ6A 1GJOA 3NNVA 3A8WA 3ZOSA 2UW8A 4I0TA 3TXOA 4UB7A 2C69A 2B9FA 5IUGA 5D7VA 3LFAA 3U8WA 2JDRA 4BZDA 4F9AA 3QTWA 3BE9A 3ZH8A 3TWJA 3ZLXA 4RMZA 3ULIA 3MJ2A 3MVHA 4YPSA 2XCHA 2ZB0A 1CKPA 3ZTXA 3D5XA 4C61A 4ZAUA 4M14A 3CJFA 4BCMA 1Y91A 4HPTE 5HOAA 2YN8A 2BAKA 4FKVA 4I1ZA 5EG3A 3M1SA 1YXSA 1QPCA 3RWPA 3A7FA 2JKQA 3ZXTA 4WOVA 1RQQA 1DM2A 4YJSA 1T46A 2QURA 3Q5IA 3WOWA 4B99A 4RG0A 5JEBA 4FKGA 2XNEA 2WTDA 3LQ8A 4CZTA 5EW8A 2XJ0A 4LV8A 4OBPA 2WTKB 2CGVA 2ZDTA 4QQTA 3K5UA 3W16A 5IZFA 3LMIA 2BZKB 4JG6A 4P7EA 4IVAA 4ZP5A 4BF2A 4C38A 3AD6A 3FLZA 4ASZA 5LVMA 4KRDA 2CKPA 2W9FB 4TT7A 3TDWA 2YIQA 3UO4A 3LPBA 5CENA 3GEQA 5K0XA 4O6EA 3RAKA 2WQEA 3EFKA 3OVVA 2XEYA 4JX3A 3T3VA 3MGYA 5CY3A 3TZ7A 3P78A 4CKRA 1SVEA 2W1CA 3EN9A 4Y73A 5DFPA 3R8VA 1SNXA 4XH6A 4ASEA 3KFAA 1BUHA 3ZZEA 3V5TA 3GQLA 4BCPA 3KULB 4QMQA 2F57A 3E5AA 4PNIA 3DTCA 3SC1A 4QQCA 4ZEGA 3N4UA 1KE5A 4DFUA 4FNWA 2R3FA 4G3FA 2F9GA 4OTQA 5FWKK 3ERKA 3UG1A 3OP5A 4K77A 2R5TA 2ZV7A 4G16A 4YMJA 4D2VA 3PA3A 1GIHA 5CZHA 4RA4A 5D1JA 1XBCA 4QRCA 3QALE 4FT9A 3VQUA 3A60A 4PPAA 4DEDA 1OVEA 1PKDA 4TW9A 4FBXA 3FC1X 2VWZA 4ZTMA 5I3RA 4GT5A 5BVOA 4FV9A 2OWBA 3GQIA 2BRGA 3E8CA 1H01A 1DS5A 2QI8A 3MBLA 5BQ0A 2BDFA 4ASXA 5AMNA 2YCRA 5EM5A 5F94A 1O6YA 2ZDUA 3T8OA 2VWUA 3N9XA 4A06A 3VS0A 3KN5A 1R39A 5IH5A 3FYJX 4AW1A 4WNKA 4JNWA 2VTOA 3ZRLA 4TNBA 1K3AA 3ZCLA 1QPDA 4IM0A 4O27B 4UMUA 3LCOA 4QMWA 5EDQA 2QG5A 2XNPA 1R0EA 3DQXA 3R8ZA 3R9NA 1PW2A 5FXSA 4ZLYA 5JQ5A 5E8UA 4E3CA 5L3AA 4L9IA 3ID6C 3I6WA 3LXPA 4BICA 4EK6A 2XNGA 3TEIA 3VJNA 3QA8A 2W9ZB 2GU8A 3UODA 4Y8DA 3TUBA 4KIOA 2GTMA 4MKCA 1JKLA 4IWQA 4V05A 3GCSA 3RAIA 4R7IA 2R3MA 4QTEA 4I4FA 2UW7A 2HXQA 3JY9A 5CAUA 4CG8A 3AQVA 3FXXA 3TV7A 2E9VA 3G2FA 2Y6OA 4AOTA 3Q2JA 3CS9A 3IOPA 3NS9A 1W98A 4OT6A 2WTIA 4QOXA 3NUNA 4BCHA 2WTVA 3PSDA 1U54B 2ETRA 2VTTA 3NUPA 2PZRA 5JGDA 3UMXA 2XVDA 3OOGA 4H36A 1M17A 3IDBA 1FGIA 3C4CA 3PRIA 4R5SA 1ZOEA 5HLNA 4RGJA 3G51A 3EL8A 4RVLA 5GJGA 2GNJA 3QL8A 4EJNA 5CX9A 4AZVA 4QMMA 2CKQA 1JWHA 4O91A 4BCIA 3DPKA 4LOOA 4TXCA 3WF8A 2C6TA 3QWKA 3UOHA 1O6KA 3BELA 5L2IA 3KVXA 1U59A 1Y57A 2RKUA 5BVEA 3F2AA 4D2WA 5ETCA 4OTWA 3TJDA 2XK3A 4FTQA 3EFWA 4U81A 2WOUA 3DAJA 1OUKA 4FKIA 2HENA 1G3NA 4E73A 2X2KA 5AUWA 1B39A 3P1AA 4LV5A 1BYGA 3LFSA 5E91A 3VUKA 4D0WA 5JSMA 3KK9A 1XBBA 3KXHA 1YWVA 5IG1A 3LLAA 4NM0A 4ENYA 4IEBA 4AG8A 1VEBA 3BLQA 3FYKX 4U40A 4GL9A 3CQWA 3QBNA 3R9OA 2BKKA 3COHA 3W1FA 4DBNA 3I0QA 2WQOA 3BPRA 3NYXA 4APCA 5A6OA 3OUKA 4ANOA 1JVPP 5HGIA 3JS2A 4RIOA 3F5XA 5GHVA 3MB6A 1X8BA 2JD5A 2OJGA 3ORLA 1JAMA 1NVQA 4FR4A 5K5XA 3F9NA 4DGLC 3FZRA 3NVKI 3A2CA 2C30A 1OUYA 4DA5A 2VTHA 5AM7A 4DEBA 4ZLOA 3TKHA 1WZYA 4DFYA 3VO3A 5L2TA 2PE1A 4O7VA 5LMKC 4EK3A 4PPBA 5CT7A 5CWZA 5BX0A 1I44A 2WAJA 4EL9A 2QOLA 1YWNA 1H24A 5AR7A 2CGXA 3Q04A 3MH0A 3COMA 2UW4A 3LLTA 4A4XA 3R0TA 3GCVA 5A9UA 4U5JA 3DV3A 2FGIA 3LE6A 2YERA 4C3FA 3FI3A 3LFDA 3MW1A 4IAAA 5AP3A 4AOIA 3REPA 3L8PA 4MX9A 5D10A 3FEGA 5DMZA 4XV9A 5ANOA 4RJ5A 3UOJA 4I5HA 4QQJA 4BDKA 4FVQA 2W5BA 5HCZA 2WB8A 2UW3A 3BYSA 5IUIA 5BVFA 3DU8A 4KRCA 4M8TA 3F5UA 3OXZA 5E7RA 4ZS0A 3VF9A 2HXLA 1G8AA 5CEQA 2PUIA 4O7RA 4OTPA 4QP6A 4R1YA 4EH9A 2OZAA 4OGRA 4UMTA 4KUJA 1ND4A 4AT3A 4I92A 4FEUA 2WMRA 3MA6A 5ETAA 3VW6A 2W4KA 3AD4A 3DT1A 2HZ0A 4YTCA 5K9IA 2GPHA 3CCNA 1RJBA 4EOSA 1H28A 4CRSA 4Q2AA 4RX7A 4LUDA 3HV7A 3IQ7A 4PQNA 3W2OA 3ACJA 3BGZA 4JDKA 5KZIA 4HVHA 2HZ4A 5JKGA 4FICA 3PPKA 3T9TA 2BALA 2JAMA 4LGGA 3RJCA 4DH8A 3E88A 2GS6A 5EHYA 2VTIA 1RDQE 5FXRA 3SGCA 4JDIA 2WQNA 1UWHA 3UJGA 4A4OA 2PVRA 2QLUA 2JGZA 3AGMA 3A4OX 3UBDA 3HMNA 5JFVA 4O81A 2IW8A 3DNEA 4BDEA 5ANKA 1QL6A 4DH7A 4N57A 4XBUA 2F49A 5GZ9A 3R1QA 2YM8A 1JPAA 3E8EA 1GAGA 4AS0A 3D7ZA 4BIEA 4YSJA 4L68A 4J97A 3VRZA 1MRUA 2XYNA 4DGMA 3R01A 3RNYA 2FUMA 3NCGA 3OXIA 1CMKE 4HYHA 4GIIA 4MNEB 2WMWA 3AC5A 5EH0A 3TV6A 5I9XA 2ITZA 1KE9A 1XQZA 4DC2A 3BEAA 4TL0A 1OECA 4XP0A 5KCVA 4EI4A 2GS7A 1KE7A 3I81A 4OTRA 3UVPA 3R9DA 4S34A 4AGCA 4CSVA 3FSFA 2PVYA 5HNBA 2XIKA 5KUPA 4LRKA 4YJRA 3UP7A 1YI6A 2B55A 3HGKA 4FUXA 4EK4A 3I1AA 2XF0A 4G5JA 4V01A 1U54A 3VJOA 3NSZA 2PZ5A 4GT3A 4KIKA 4X6RA 2R4BA 2SRCA 2PHKA 5IMXA 3HV3A 2X39A 1WBNA 4BWPA 4Q9ZA 4KS8A 4ZSAA 3BHUA 2F7ZE 4C02A 5FXQA 4XJ0A 3SHEA 4O2PA 1UU9A 1DAYA 3IW5A 3DJ7A 5CSPA 3OOMA 5DVRA 2VN9A 5L2QA 1J1CA 1YHVA 2XM9A 3AC2A 3BBWA 5TR6A 4BL1A 3FQSA 1E9HA 3RP9A 4F99A 3I79A 2CSNA 3G6GA 2YM6A 2YDJA 5BVDA 2QNJA 3DZQA 2E9NA 4QO9A 4TZRA 5L4QA 3E93A 4R78A 3H4JA 4EYJA 2C4GA 4V04A 1EH4A 4WG5A 3V51A 2VRXA 1H00A 5AR2A 4RIYB 4CFUA 5EYMA 2QCSA 4E5AX 4YURA 2PU8A 4NKAA 4ALVA 4GKIA 2YM4A 2QU5A 3D14A 4JAJA 3KXXA 2OIDA 3FJQE 4IH8A 3S4QA 3PE2A 4LGHA 4E6CA 4FVRA 5IA3A 4MXZA 2OKRA 4CMTA 4AFEA 4BCGA 2J51A 3CE3A 1PMNA 3QD4A 4H58A 4DAWA 1ZYDA 1FBNA 3KU2A 4IXPA 4KKEA 3B2TA 3TT0A 2ITPA 4AGDA 4BBEA 5JGBA 5FD2A 3S00A 3FKNA 5CU2A 4N4SA 4M68A 3FLQA 4QQ5A 4DLIA 4FZDB 2XNNA 3CGFA 4BGGA 2X2MA 4BI0A 4EQCA 3SG9A 4A9SA 4K0YA 3SKCA 2VU3A 1U46A 3PJCA 4BIDA 3NNXA 4QYFA 4JI9A 4MVFA 3HA6A 4TYGA 3D15A 5EW3A 2JBPA 1NY3A 2A19B 5HG8A 3SQQA 2UVZA 4DGOA 2VGOA 4YJVA 4WUAA 3A61A 2IVUA 1UU3A 1BKXA 2X7OA 4O0UA 2GHMA 4XS2A 3UE4A 1YXVA 4N6ZA 3VVHA 1R3CA 4EBWA 4FV3A 4HNIA 2OJIA 4FIHA 2R7BA 2Y6MA 4NT4A 2X9EA 3EQRA 3TIYA 1CM8A 2HW7A 3SX9A 4LI5A 5CU6A 1CTPE 1H25A 3PJ1A 3MDYA 4IDTA 3KKVA 5D7AA 2OXXA 3EN5A 5CEIA 4F0IA 3W2CA 2OU7A 3UYSA 1P14A 5DRBA 3LZBA 5AEPA 3MY5A 1IA9A 5HO7A 2VTRA 4IQ6A 1H4LA 3OZ6A 3RALA 4FI1A 3VRYA 1GZKA 2UV2A 4BHZA 4BY9E 3NW5A 2O2UA 4FGBA 3F66A 3QCXA 2XBAA 1H27A 2RG6A 3IG7A 4FZAB 4UY9A 5AFVA 2QKRA 5EM7A 5JZNA 4BDFA 2ZJWA 1V1KA 4YUQA 1FQ1B 3OG7A 1JBPE 4GUEA 4IB0A 1SVHA 1H0VA 4S31A 4EJ7A 2YZLA 4FL1A 3L9PA 4CZUA 1JSTA 2UW6A 2Y8OA 3HNGA 4ZTQA 4IX6A 5AR3A 2EUFB 3BHHA 3PY0A 4FEQA 4IMYA 2B7AA 5HBHA 3DXQA 5DI1A 4B4LA 4HPUE 2ONLC 2QO2A 1H0WA 2WMVA 2WQBA 3D7TB 3QQJA 3R28A 3A7GA 3DKFA 2ITOA 3IW7A 2R3IA 4S33A 4QYHA 3NW7A 3UO6A 4FT5A 5JH6A 1OPLA 3I5ZA 4X2JA 3DK6A 3MFSA 4JQEA 5AP7A 5F20A 3GU6A 3GP0A 4MNEA 3MH1A 3ZO2A 2B9IA 5E1EA 4CT2A 1P2AA 3K5VA 3R2YA 2WGJA 4ONAA 2QOBA 4MAOA 4RQKA 2X6DA 2VTMA 2XEZA 4YTIA 3RPRA 3WYYA 5LOHA 1ZWSA 3CTQA 3OCTA 3FQHA 4BDCA 3QCYA 3BZ3A 4RFYA 2W4JA 2LGCA 3PXZA 3BWFA 4O1PA 3VBYA 2CMWA 5IQAA 3MI9A 5HLWA 2H9VA 3QQUA 4ZY5A 4H1MA 4KSPA 3ZM4A 2WTCA 3VC4A 3ZUVA 5KHWA 4OAVB 3RPVA 4EUTA 5KMJA 4K2RA 4TWPA 5ANEA 4HVSA 1U4DA 4HZRA 3DQWA 4RWKA 1PY5A 4KIQA 4FV8A 2P3GX 1SM2A 3TG1A 4C36A 5A4TA 2PY3A 5A6NA 4O96A 1FVTA 4X3FA 4E20A 2C0TA 3HDMA 1H1SA 2XKEA 3AMBA 3BV2A 4OLIA 2O0UA 2RL5A 3RAWA 5H2UA 3W32A 3D2KA 5C27A 3N4VA 2R3JA 4S30A 4MF0A 4DG2E 2EVAA 3HA8A 5CI6A 2OI4X 3DJ5A 4E8AA 5CASA 4DEGA 4R1VA 3FLSA 4M7IA 3S3IA 1WBTA 4FSUA 3CPBA 1REKA 4BTMA 4F09A 2BKZA 4YZDA 1H08A 4FYNA 1PMEA 3PJ8A 4EKLA 3WYXA 1ZOHA 3PTGA 4C4GA 3KMWA 4MH7A 4LOQA 3U6IA 3ACKA 3UZTA 4WBOA 2H6DA 1B6CB 4C0TA 4O6LA 1SNUA 3F88A 4YNOA 2WIPA 5HTCA 5C9CA 3SW4A 2ZM3A 3P9JA 2R3QA 1JSUA 2WTJA 3MFUA 5CXZA 4BKJA 3N4TA 3MESA 4I22A 4NL0A 3FZSA 2OG8A 4NM5A 5TT7A 2WOTA 5M08A 2J5FA 5CT0A 4CTCA 4D2RA 3EOCA 3RCJA 4HVDA 3BU5A 2BZIB 2JFMA 4N0SA 3LCSA 3EJ1A 4EUUA 4J98A 4O22A 3O7LB 2J4ZA 4RLKA 4X2KA 5J7HA 2ITTA 3R1NA 4IBMA 4XOYA 4BB4A 3IDPA 4ZLZA 1M14A 2XCKA 4CQEA 2REIA 4BWKA 3QD0A 3OCBA 3FSKA 3CJGA 4CFVA 4PL3A 4EYMA 3QQLA 3MFRA 4B9DA 4BFMA 2GCDA 4A9UA 4AUAA 1PXMA 1Y6AA 2GDOA 4QP2A 1WBSA 2BUJA 2CPKE 4NM3A 3NPCA 3UC4A 1E1VA 2W1ZA 5CEKA 4D28A 3EQGA 3MIYA 4JOAA 4MHAA 4J7BA 4EOJA 3WILA 3VS3A 4FSMA 4F64A 3SLSA 5CAOA 3FY0A 3QGYA 4W4XA 1Q99A 4AA5A 3L9NA 2QVSE 3OT3A 5CEOA 2JDOA 2F7EE 4CFFA 5HEZA 4CCUA 4PNKA 3Q9YA 5ETFA 5J87A 3FUPA 4NIFA 4YLJA 3LJ2A 2VWVA 3AT4A 3PJ3A 3CKWA 4AZEA 2ETMA 4AOJA 2XB7A 3PPZA 4NW6A 3CD3A 4J1RA 2JAVA 3PZHA 2WHBA 3DLSA 2YCFA 4LRMA 2G2FA 1JSVA 2X8EA 4B6LA 1OPJA 1YOLA 3LKMA 4ANLA 2OXYA 5IH4A 1A9UA 4QP9A 3QD2B 4U6RA 4EH7A 2EXEA 3MN3A 4WSQA 3ZUTA 4YC6A 3WI6A 3HRCA 2Q0BA 4NM7A 3D7TA 4WG4A 1OM1A 3QRTA 2GFCA 2J7TA 3KEXA 2BTRA 2JEDA 3IGGA 4QP1A 3VHKA 5LJJA 3EQBA 4NW5A 3NVMB 3V5JA 2QG7A 1XO2B 5M53A 3UPZA 4ZSLA 4O7LA 3AD5A 5DBXA 3MPAA 1OGUA 4ACDA 4ZK5A 3LXLA 3L8VA 1MUOA 4D55A 4EZ5A 4PP7A 2RSVA 4CGAA 4DCAA 3GUBA 3UZPA 3VUMA 1LP4A 4IC7A 1AGWA 4XG2A 5KKRB 5M07A 1LEWA 3E7OA 4YHFA 5AR4A 4AA4A 4EH8A 3MPTA 4N6YA 4ITJA 2ITXA 4FIGA 4IZ7A 3C4FA 4MNFA 2PZIA 4CYIA 2OH0E 4BTFA 3BU3A 4Z7HA 1YQJA 4QTAA 1M2RA 1BL7A 3DBCA 3GC7A 4L43A 3A62A 4AX8A 5CSHA 4EOPA 2O3PA 4BCFA 4GCJA 5CF4A 5IQIA 4G1WA 5K5NA 2PMNX 3IGOA 2VTPA 4WA9A 5LXMA 4FKUA 3GCPA 2IZUA 3GC9A 4GJ3A 5IEXA 3ELJA 4GFGA 3F5PA 5C4KA 3PA4A 4IAYA 4ITIA 4K33A 3P7CA 3VBTA 5I0BA 5IPJA 1O9UA 4KSQA 5AV2A 3O71A 4I5PA 3VNTA 4RJ6A 3DA6A 2OGVA 4XRJA 2ITNA 4FF8A 4R3PA 4KD1A 3DDQA 2EU9A 4OTFA 4O0WA 2NRUA 4DYMA 3Q2MA 2WPAA 4UEUA 4EEVA 4NFMA 5HI2A 3W8LA 1J7IA 3PJ2A 5H8EA 2WXVA 3LJ0A 3A7HA 5HZNA 3OMVA 3P5KA 2QD9A 3R8UA 4IZAA 4K1BA 1URCA 4F63A 2X4ZA 2X9FA 3QLFA 4HYSA 4EQMA 1Q8UA 1SVGA 3Q32A 2IPXA 5JT2A 4Y83A 3UQGA 2OK1A 4YBKA 5D11A 3EWHA 2JC6A 3MVJA 4JG7A 5J5SA 3HMMA 4QMVA 3RBWA 4D58A 3TM0A 4C57A 3VUDA 1DI8A 1F3MC 5EOBA 2Z7QA 5IMEA 2OW3A 3RPSA 4QMLA 3BGQA 4MXCA 3S1HA 5JFWA 3ATSA 5FTGA 2A27A 5A4CA 4RWIA 3EH9A 5IA2A 2P2IA 4UZHA 5HIEA 3ZEPA 2UZBA 1QMZA 1XJDA 2YDIA 4EQUA 4MWHA 4IB3A 5AAGA 2I0YA 4HCUA 2RIOA 1WMKA 2PVKA 5FTOA 2PPQA 2V5QA 3BHVA 2JITA 2XK8A 1UKHA 3DCVA 3PVUA 5HBEA 1AD5A 5CLPA 2XNOA 1ZRZA 4FKSA 4I21A 4OW8A 4PDSA 4RC3A 3ZFXA 2XK9A 3I5NA 3UIUA 4EONA 2YITA 4ZJVA 3V6RA 3PFQA 5JN2A 4C35A 4BGHA 2OZAB 5HX8A 2J90A 2GHLA 3E87A 2UZOA 3HL7A 3Q96A 4FC0A 4ZSGA 5T3QA 2ZAZA 2QO9A 5KE0A 1PXOA 1UV5A 4QMOA 4GEOA 4EWQA 3Q9XA 1ZARA 5FBNC 1MRYA 3FLNC 3LMGA 2X0GA 3OBJA 5AV3A 4JQ7A 2WD1A 4JRVA 4EC9A 4F70A 4APPA 4EK5A 4QTDA 3PSCA 4PX6A 4AZTA 4M15A 1NA7A 4PY1A 1GZOA 5E8VA 4CQGA 4EHGA 2W1HA 3TKIA 3OS3A 1ZYJA 3O7LD 2YWPA 3QU0A 3GT8A 4PV0A 4TYJA 3NDMA 4NTTA 3ITZA 3W33A 1OL1A 3DZOA 4O2ZA 4Z55A 4K8AA 3QX2A 2WTKC 4GS6A 2PE2A 5M55A 3OC1A 5J9LA 1XR1A 2FH9A 5IDPA 5HE3A 3OEFX 4BVUA 1E1XA 2JIUA 3F3UA 4Y95A 4ENXA 5M4IA 5DYJA 1IAJA 3FZPA 2UZNA 5ANIA 1YOJA 2RF9A 2ZMDA 2QOHA 3D4QA 3CSVA 3KCKA 5HIDA 4I6QA 3R9RA 3GNIB 2C5NA 4O0VA 4DTKA 5GIPE 3OW3A 3TNQB 3BQCA 3UNKA 3ODYX 4GYGA 4JRNA 2C3JA 2CGWA 2Z7SA 2HIWA 3F69A 4Q5EA 5FRIA 1Z5MA 4BWXA 5HE2A 2VV9A 5HQ0A 1YDSE 3KA0A 2XS0A 3QTQA 4AQCA 3HYHA 3R21A 4QNAA 3EQIA 2VWWA 3LAUA 4P90A 5J7BA 3UDBA 5FM3A 5KMIA 4CFWA 4YC8A 5ICPA 3V01A 4RT7A 4C59A 4OTIA 4YJPA 3VS6A 1MP8A 3NNUA 3ZSHA 2C6LA 4L42A 5IQBA 3HMIA 2FSLX 1JNKA 2CKEA 3H9OA 4L44A 1TQPA 4JBPA 3TI1A 4DTBA 4U44A 3CTHA 2OXDA 4W4YA 2B54A 4OT5A 3AC1A 3WZDA 4RWJA 4KIKB 4HJOA 1Q8TA 3EQCA 2PYWA 4ID7A 4NYEA 3QUDA 4RA5A 2WNTA 3UNJA 3SW7A 4MYGA 3KY2A 3ZLYA 3FMNA 3QTIA 4OTGA 3MTFA 3COKA 4FV6A 4DEAA 4AAAA 2VNYA 4KA3A 3IK3A 2VZ6A 5L8KA 3QXOA 2KULA 3P23A 4I6BA 5AP1A 2PUPA 4PTEA 2YEXA 3B8RA 4WD5A 4RC4A 1KE6A 4IAIA 4AW0A 4GKHA 2O8YA 2OBJA 2VTAA 1XH6A 4WUNA 1PJKA 4R5YA 3ZEWA 4F4PA 4FSTA 2IG7A 1RW8A 5BUEA 3OY3A 4Z9LA 3KRRA 5CALA 5B2KA 3BRBA 3G5DA 4C7TA 3ZMMA 4JXFA 4CYJA 4HNFA 2XJ1A 2CDZA 2W1DA 1XH5A 3SVVA 3HKOA 5IQEA 3L9LA 5D9HA 2CNUA 1NVSA 4KIPA 2FSMX 3BYUA 3MH2A 3DNDA 4YJQA 3WF7A 4IM3A 5L2WA 4FGRA 4XLIA 4RC2A 2LAVA 4BCKA 4WBBB 4EKKA 5M57A 3NUUA 3IW4A 2ACXA 2OICA 3UMWA 4FV5A 4U7ZA 4D9UA 1V0BA 5A4QA 4F0GA 5EYCA 3RK7A 1ZYCA 3MIAA 4UALA 3VBWA 4Y85A 4EH4A 4PDOA 4R7BA 3VHEA 4FKWA 1J7LA 4D1SA 1WFCA 2OJ9A 3ATTA 3QRJA 4F6SA 5ACKA 3AGLA 4CFNA 2ZM4A 3HDNA 2UZDA 1YDRE 3FY2A 3KXNA 4G6NA 4BDGA 4ZS4A 1PXJA 4IANA 1OB3A 1Q8ZA 1H26A 2XMYA 4XG3A 4FE2A 2DQ7X 3VUGA 4ZIMA 3SRVB 3HRBA 3FKOA 3LCDA 4ACMA 4FG9A 4TPTA 3RK9A 4BI2A 5M06A 2PVNA 2J9MA 3QYWA 3DB8A 4JAIA 4QMXA 2ZVAA 3KF7A 4RJ3A 5E8TA 3RTPA 4RFMA 4NCTC 2IVVA 5AWMA 4KS7A 2J6MA 4FX3A 3JR1A 3U54A 3EQFA 3QUEA 1M2QA 3ROCA 5LARA 3RPOA 3MYGA 3W2QA 5EOLA 2W0JA 2YM7A 4AGWA 3FMMA 2X6EA 3QKMA 4QNYA 4E4LA 3DBFA 3FV8A 4H3QA 5A14A 1BLXA 1PMUA 2PZPA 3QWJA 2B9JA 2DS1A 2PWLA 2NPQA 2C5YA 4UN0C 3DKGA 3WZUA 4X2FA 2HOGA 3PY1A 2NP8A 2NO3A 4C4JA 3E3PA 4DGGA 4HGEA 3R8MA 3FXZA 2GNGA 2PUUA 3R00A 5AUUA 5I9YA 3G6HA 5J5TA 4X7QA 3WZEA 2J0LA 3EZVA 4UMRA 4FV7A 3UVRA 2YZAA 3NX8A 3VULA 2CNQA 2XNMA 2YIWA 4XLVA 2YFXA 5M4CA 3NUYA 3HUCA 3V6SA 4FVPA 4C4IA 4YZNA 5DWRA 2R2PA 4IZ5A 4L67A 2BZJA 4TNDA 3EQDA 3R7UA 3AMAA 5FLFA 4FTOA 1SYKA 2B4SB 3EQPA 4IB1A 3GU5A 4DTAA 3PPJA 1T45A 1BMKA 4NEUA 5HO6A 5BVNA 1ZMUA 2ZB1A 4GK3A 4L53A 2C6KA 4RPVA 1IA8A 1VR2A 4FSRA 3LM5A 3SAYA 2WELA 3TNPC 3ZRMA 1BL6A 3RMFA 5CNOA 3C0HA 5HORA 2R3KA 2QOFA 4D9TA 2IW9A 4HYUA 4B8MA 5J1VA 4KKGA 5FTQA 4DT8A 1NT2A 4NZWB 3U4WA 2HY0A 1ZAOA 3I7CA 2XK7A 4PMPA 2OO8X 4AE6A 2Y4PA 4GFOA 2HZNA 2BFXA 1Q4LA 2DYLA 2IVSA 3CY2A 3LXKA 3FQEA 5DHJA 3UP2A 4P5ZA 4DFXE 3AC3A 4UX9A 2J0MB 3THBA 3P4KA 5DNRA 4EC8A 1P4FA 3SA0A 3W55A 5HU9A 2VO7A 5EDPA 1V0PA 4A9RA 5KBRA 3OUNB 3QCQA 2UZEA 3O23A 3T3UA 1MQBA 4XG9A 4I23A 4WO5A 3FMDA 3KMMA 3N51A 2GHGA 3ANQA 4DEHA 1MQ4A 4IJPA 3V8SA 5M4UA 3DTWA 3DB6A 4YZ9A 5EM6A 1PXNA 4IADA 4OUCA 1CSNA 3IW8A 3GFWA 5EM8A 5DLSA 5EKOA 3V8TA 2CJMA 3NEWA 4X3FB 4O7NA 3HMOA 3O0GA 4AWIA 5LMKA 3FMJA 4XP3A 5HICA 4O82A 1IEPA 3ZO4A 5C01A 4O7ZA 4O7SA 5J9YA 2YLEA 3PY3A 4RSSA 3G33A 1H8FA 4M84A 5KO1A 5BNJA 1R78A 2CNVA 3TIZA 2QO7A 2C3KA 3M11A 3QXPA 4FZ6A 2PTKA 4MK0A 4YHTA 1JKSA 5J1WA 4CCBA 2ITWA 2UW0A 2VO6A 3E64A 1FOTA 3RCDA 4YU2A 2JBOA 2W06A 5C4LA 4ARKA 1W8CA 4K11A 5B0XA 4CT1A 3AT2A 3GGFA 3V8WA 3G0FA 2ZMCA 4PMTA 4JIAA 5BVKA 3WF6A 3GB2A 2PMLX 3CQUA 3R04A 5M51A 3O8PA 5K0KA 5AM6A 4LMNA 4E6AA 3CEKA 4XV2A 2FYSA 3U87A 5EI2A 4F6WA 3Q53A 5LCJA 2WIHA 4IC8A 3F82A 2CN8A 5EYDA 5BVWA 4DFBA 1ZYSA 4FEWA 3PP0A 3KRWA 4M69A 4EHVA 3VIDA 2B9HA 3PXKA 4C4EA 3WF5A 3NUSA 4O0SA 3NNWA 1YVJA 2BHHA 1G5SA 3HMPA 3VS4A 4DHFA 2VGPA 4AZWA 4C34A 3C4XA 4L3JA 5BMSA 4AT5A 2C5VA 3Q4UA 2EB3A 2YIRA 3QQHA 5DEYA 4FKJA 4E6QA 2V55A 5IQHA 2OJFE 3UIXA 3SRVA 2OF2A 3CR0A 5JQ8A 3F5GA 5AX3A 3MS9A 3F2RA 3BV3A 3O50A 2B53A 4YO6A 1DI9A 3KC3A 3Q9ZA 3KF4A 4RFZA 4YJUA 3V5LA 2C5XA 1FVVA 4MEDA 2WMSA 3UIMA 2R3GA 4XOZA 4AF3A 3IONA 4AFJA 4Y5QA 2BHEA 4L00A 3QAME 3GI3A 5T68A 1TQIA 1GIJA 3HVCA 4NKSA 3RINA 4FKPA 4BKYA 4ZSEA 2CKOA 3QRUA 2C6DA 3KK8A 3NRMA 4IDVA 4JDHA 1J1BA 1VYWA 2DWBA 3GCUA 2H34A 4HW7A 4FZ7A 4XBRA 5ANDA 5EI6A 4TWCA 4DH3A 4ERWA 4W8DA 4CNHA 4YR8A 2WMAA 3ENMA 2C1BA 5LVLA 3GVUA 2C3LA 3S95A 4UBAA 5IEYA 3CGOA 5LQFA 3RM6A 3D2IA 3IKAA 3O51A 4C4HA 4FOCA 2VTJA 4U43A 4NIFB 3RKBA 4KB8A 5GIOE 5C8NA 3QUPA 4ANQA 1YHWA 4QPMA 5J79A 3VUTA 1PXPA 3MY0A 4C58A 1CKIA 4JBOA 2V22A 3EYGA 2GNIA 4B8LA 2G9XA 4G3EA 4YC3A 4DFNA 2OH4A 3R1SA 4IW0A 4F7JA 4EH5A 4M13A 5F95A 4FKRA 4R8QA 5K3YA 2BAQA 3V5QA 2R3HA 4DEEA 3D5WA 2BZHB 3H0ZA 1XH8A 4MF1A 1Q5KA 4NH1A 4QTBA 5CF6A 2VX3A 1STCE 3FHRA 4L3PA 4XHKB 5IEVA 1YXTA 4WKQA 2WKMA 3QFVA 2WQMA 2XP2A 1OIUA 4D5HA 1OZ1A 2ITUA 3GU4A 4XMOA 5CANA 1OKYA 5LWNA 3D94A 5EHOA 3SV0A 1BI8A 3BHYA 3PWDA 4FTLA 4G17A 2JDSA 4RRVA 3C0GA 4UYNA 3QRIA 4LL5A 3LQ3A 3LW0A 3QQKA 3DAEA 2PSQA 4AT4A 5ETIA 3Q52A 5A46A 4F1MA 4U41A 5I9WA 3NUXA 5I4NA 2R3OA 1ZMVA 4RZVA 2I1MA 1I09A 3HP2A 3QHWA 3MSSA 2WMTA 3GC8A 5EKNA 4QD6A 2GNFA 3KRLA 5T6KA 4L45A 4PL5A 5AUVA 5EW9A 3SXFA 3T9IA 2OFUA 4H39A 3A7IA 4H3BA 4IE9A 4JG8A 4BCNA 4G31A 5CF5A 2GNHA 1HCKA 5JK3A 2EB2A 3VS2A 3WZKA 2BPMA 2IN6A 2BRMA 2P0CA 3ORPA 4ZJIA 1Y8YA 2F2CB
chains in the Genus database with same CATH superfamily
5HG9A 4QP3A 5ACBC 4AZFA 2ZYBA 4MXAA 3NLBA 4PUZA 4QPAA 5BYLA 3BKBA 2YJRA 4FTKA 4PRJA 5DT4A 3RK5A 5AJQA 3W0PA 4BI1A 2HELA 2CLQA 5L2SA 5E90A 4BBMA 4DN5A 1Q24A 2QOCA 3PLSA 4GSBA 2Y9QA 4ZOGA 4F9WA 4QMSA 5EFQA 4ORKA 3HRFA 2E9PA 3OWKA 2EXCX 1K2PA 2NRYA 4DFLA 2Y4IB 4FUYA 5FEDA 5AUXA 2WMQA 4KAOA 5LMBA 5AP4A 3QLGA 2QOKA 3QZGA 4ZZNA 4TYHA 3ML1A 3FXWA 3K3IA 4LL0A 1JLUE 2PZYA 3TJCA 2I40A 3K3JA 3MVLA 3QHRA 4FODA 4ACHA 2NYAA 4FNXA 3W2PA 1YI3A 3ORKA 2OIQA 4ZSJA 5JRSA 3V5WA 4AGUA 3TKUA 1JOWB 2A4LA 2Z7LA 5HVKA 4IHPA 4WG3A 5KX8A 4JX7A 4U8ZA 2YWVA 4CMOA 3RAHA 2J2IB 4XRLA 3TUCA 4NJDA 5HCYA 4C3PA 4I94A 5F4NA 4ACCA 5EQPA 4Z3VA 3SD0A 4MBIA 5DG5A 4I5MA 3PRFA 3TTJA 5JGAA 5LVPA 3PVWA 3LFBA 5DOSA 4O0YA 3GBZA 4QP7A 2E2BA 5DN3A 2RG5A 5KZ0A 4CTBA 4F9YA 2Y0AA 3JUHA 3DY7A 3L1SA 4QPSA 3QRKA 4FL2A 5KBQA 3NYNA 4KKHA 5EHLA 4FTTA 3LOKA 4WRSA 4MUQA 1UNGA 3C4EA 2X2LA 4IJ9A 5C26A 3A4PA 4HVGA 1M52A 4WIHA 5EYKA 3PVGA 5J95A 4DLJA 4OTDA 2Z2WA 2HY81 2BIKB 3OT8A 3RHXA 2XIZA 3D83A 2BROA 2VNWA 3TNWA 1PMVA 3TV4A 1ATPE 2ERZE 3C7QA 2CLXA 3KRJA 4N70A 1NXKA 3Q6UA 4NTSA 4O83A 5FP5A 5AAFA 3EL7A 5AR5A 5FP6A 2QR7A 4FSYA 5JRQA 3U55A 2PL0A 4ALUA 2H96A 3PXRA 3NIZA 2C0IA 3TNHA 2RFEA 4CD0A 5CI7A 3PVBA 2XIYA 4CLIA 2C6MA 2CCHA 3D9VA 4UMQA 3A8XA 3R7GA 2E9OA 4G6LA 4IX4A 4MQ1A 1VJYA 3EIDA 2ZV2A 3LVPA 3UQCA 3W0MA 2G1TA 5HCXA 2ONLA 4O7YA 4HCVA 1LR4A 2YHVA 3R22A 3VS7A 2A2AA 2UZTA 2BMCA 1UU7A 2YABA 4ZTLA 2C6EA 2VD5A 3F7WA 1WVYA 2YM3A 3O17A 3ZO1A 1ZMWA 3SG8A 4ZMFA 2YIYA 3C13A 4OAUC 4HYIA 4A4LA 5E8YA 3BWJA 4L8MA 4AAYA 3MH3A 4QMUA 3S2PA 4RWLA 3W0RA 1M7NA 3PUPA 3G0EA 3AXWA 4EZ7A 4LRJA 4XX9A 2XJ2A 2VTLA 3EKNA 3GU7A 4CLJA 4KABA 3E8DA 3JPVA 3PDTA 4F65A 4XP2A 2YDKA 4KINA 2J5EA 2OJJA 4ZTRA 3G9NA 1J3HA 1GNGA 3LHJA 2W5HA 1TKIA 2QHNA 4HOKA 4WNMA 5CU3A 4BZOA 4F0FA 3BLAA 3GCQA 4AACA 4A07A 3DBDA 4LGDA 4DH1A 3FWQA 4GMYA 3FI2A 4J99A 4GG7A 3F2NA 5CU0A 2XK6A 1FINA 3RGFA 2JIVA 2XRWA 4F08A 4Y5HA 1ZOGA 3BU6A 4L6QA 4RLLA 3R1YA 4TTHB 4AXAA 5B2MA 1PXKA 2WU7A 4FIIA 4QMNA 2OZOA 3D5VA 3NZ0A 5EQYA 3LIJA 2BCJA 2Z7RA 3C9WA 3ZDIA 4A9TA 1QPJA 4CV8A 4FTNA 2JKOA 3BHTA 5AV0A 1W84A 3OWLA 4IAZA 4RVTA 5E92A 4EORA 3PP1A 4XCUA 1TFFA 2HZIA 4FV0A 4O4FA 3MVMA 3OWPA 4FKQA 5H8BA 4USDA 3QZFA 1K9AA 2IO6A 3COIA 3MB7A 4I6FA 1A06A 4J8MA 2C68A 4FTMA 3WE4A 4BCOA 3GFEA 4LYNA 1S9JA 5E4HA 4EOLA 1YI4A 3R8PA 2G2IA 4X3JA 4WNOA 3VAPA 2VTNA 1APME 4MWIA 3DBQA 3L8SA 3R30A 3ZFMA 3AC8A 3QCSA 4OTHA 4XUFA 1U5RA 2G01A 3GOKA 5FEEA 3W8QA 5IISA 1YWRA 2UZWE 3ZYAA 5L6WL 3S0OA 4TY1A 4YLKA 4YJOA 1XMLA 5E8WA 1OBGA 3ZSIA 4LM5A 5AAEA 4IVBA 3BLHA 4JLCA 1ERKA 1TQMA 4QYYA 4BTJA 4ZTSA 4EWHA 4GV1A 5HX6A 1Q8WA 3FDNA 1XBAA 3QTXA 2X8DA 3RZFA 3HLLA 4M0ZA 4IVDA 2HW6A 3EYHA 3FKLA 5CEPA 2XM8A 3EMGA 4DG3E 4KWPA 3NW6A 4S2ZA 2X0QA 4EH2A 1J7UA 5I9UA 4ZZMA 2PVMA 2W1FA 4RIWA 3NIEA 1OL5A 1KWPA 4E5WA 4GG5A 2G15A 3W0OA 1GOLA 3JVSA 3ZDUA 4G9CA 3Q60A 4FOBA 4PWNA 3LXNA 5TF9A 3FZTA 1PXIA 3HUBA 3VUIA 3OFMA 2WMXA 4X2NA 4BBFA 3OF0A 2C47A 3I60A 5CVGA 3PSBA 5AR8A 5BYZA 3U4UA 1Q62A 5AV1A 1W2CA 3IDCA 5D41A 5KKRC 3KRXA 1PYXA 2C3IB 4FKOA 5DT3A 1W82A 4QYEA 4CXAA 4DH5A 4AW5A 4L01A 2UVXA 3F3ZA 4H3PA 4O38A 4QMYA 3ZLSA 2JDTA 3LCTA 4IWPA 2B52A 3D0EA 4HGTA 3W10A 1H1WA 5CVFA 4FSNA 5GNKA 2C5OA 2BR1A 1PXLA 5FBOA 4TYEA 4IWDA 4GK4A 1FMOE 4AW2A 4CEGA 3R7EA 5M4FA 5IA4A 2O65A 4FZFB 1PF8A 4MQ2A 4IFCA 3RI1A 2ITQA 4QYGA 4FT7A 4EHEA 4FRFA 4DT9A 4ASDA 3QQGA 3F3VA 1LPUA 2EWAA 4PTCA 4RJ7A 4D2SA 4AA0A 2PE0A 1B38A 3H10A 3IOKA 3ORTA 4YZBA 5E8XA 4I41A 3MA3A 4GK2A 3JYAA 2CHLA 4FL3A 4U3ZA 1WCCA 4Q5HA 3FMKA 2ETKA 1YKRA 4J52A 5DIAA 4CVAA 3LMHA 3BCEA 4E7WA 4GUBA 4D4SA 4TWNA 1R0PA 3KGAA 4FG7A 3AOXA 2OFVA 5HO8A 4QMPA 3SOCA 3NGAA 3UG2A 2RGPA 5KNJA 4L46A 4BYIA 4GH2A 5JZJA 4IX5A 4YTHA 2PUNA 1YXXA 3LJ1A 3KB7A 5EDRA 4E4XA 4IX3A 1YW2A 3R6XA 1XH7A 3UVQA 2R64A 4BDAA 4QEBA 3AT3A 3DK3A 3HAMA 3WIKA 4ITHA 4FSQA 2HWOA 3MPMA 4QTCA 1WBPA 2WU6A 3FPQA 2ZM1A 1S9IA 4WSYA 4QMZA 3TZ9A 2ERKA 3H3CA 3NR9A 4EOQA 5KMKA 4BDBA 3BLRA 2UZVA 3EFJA 2X7FA 4MTAA 5DR6A 5G1XA 4ZY4A 3KMUA 3DOGA 3CPCA 4EOIA 4MXYA 4BHNA 5KMLA 2I7QA 4PP9A 4H1JA 4BC6A 3CLYA 4L52A 5L6PA 2YACA 3PWYA 5CVHA 5FGKA 2QHMA 1Q3WA 3VUHA 5I3OA 4JDJA 3ZRKA 2B1PA 2I0EA 4NUSA 2WFYA 2XKDA 3VS5A 4JT3A 3I7BA 4E93A 2W96B 2ITVA 3VBXA 4D1ZA 2OLCA 1JQHA 5LCKA 3WE8A 5HU3A 2R3NA 1KV2A 1PRYA 3B8QA 2P4IA 3OD6X 3HV5A 3QTRA 3R7OA 5IA0A 4E5BA 5F9EA 2WEIA 3NYVA 3EB0A 3TZMA 5CAPA 4ZTHA 4G3DA 1Z57A 2X0OA 4D0XA 3KREA 5FM2A 4UWBA 4CRLA 1JKTA 4JIKA 4DF3A 2Z8CA 5HKMA 3ZFYA 1NVRA 4R6VA 2RFDA 3M42A 3D5UA 3O8UA 5C8MA 4BDJA 1KSWA 2HWPA 3WZJA 5CU4A 5J8IA 2PVJA 1Y6BA 4MXOA 4GU9A 3G9LX 1U5QA 4JQ8A 4CMUA 4IFGA 3ORXA 3OTVA 4L3LA 2V7OA 3ZU7A 5IQGA 4F1OA 4I93A 2CN5A 3DKOA 3JXWA 2F2UA 3DFCB 2YA9A 1FPUA 5CYIA 3SXSA 3VS1A 4D2TA 3DFAA 5I5ZA 1GZNA 5JFSA 4D2PA 4FKTA 1OL7A 4FG8A 3WF9A 2ESMA 4FTJA 5TE0A 3IS5A 4AE9A 3G90X 3ZUUA 4I3ZA 5CSXA 5E9EA 2JDVA 4V0GA 4D4YA 3CTJA 4IVCA 5HESA 4BN1A 2I6LA 4YZCA 1Q41A 4W9XA 3DAKA 3OROA 2Q83A 2BRNA 5KMNA 1LEZA 4FK6A 4NK9A 3CC6A 2VTSA 5D12A 3AKJA 3CP9A 5IUHA 3LFQA 3TCPA 5M44A 4MBJA 5AP6A 5HVJA 3ET7A 5KMOA 4EBVA 1F0QA 1W7HA 3TDVA 2VTQA 1WAKA 4O21A 5DT0A 2PK9A 4FTAA 5G6VA 5I9ZA 3QC9A 4ERKA 3SDJA 4EK8A 1P5EA 4ZJJA 2WEVA 4CKJA 3R8LA 4M69B 1ZLTA 5CXHA 3DLZA 4AN2A 1REJA 3KXMA 3VW8A 4D4RA 4J96A 5BUIA 4TYIA 4YJNA 2B0QA 3FPMA 4NWMA 2QOOA 4CG9A 2W05A 4FEVA 2VUWA 5EQEA 2AUHA 1YHSA 2PMOX 4GYIA 5CAVA 3I0OA 5HE0A 1BI7A 3DGKA 1W2FA 3P7BA 4GRBA 5HG5A 4M12A 1QPEA 1M7QA 3C5IA 3DK7A 3QD3A 4Z16A 4E4MA 3GENA 4QMTA 5CS6A 1NW1A 4UWYA 1G8KA 3IO7A 5DR2A 2X8IA 1YOMA 3L9MA 5DGZA 2J0IA 2ZV8A 5E1SA 3BIZA 3I4BA 2V62A 3UPXA 4JR7A 5AA8A 3FMEA 5DA3A 3ZO3A 3KCFA 5H3QA 3TNIA 2PULA 4IIRA 4TN6A 5DPVA 3H30A 2P33A 3BYMA 4I0SA 4KBCA 4MBLA 4QP8A 5CQWA 3K2LA 3PIZA 4GW8A 4C2VA 2XAMA 4G3GA 1ZY4A 4I20A 3Q5ZA 2GQRA 1FGKA 1OIYA 3ZBXA 4W4VA 4L7FA 5A54A 1XWSA 5AP5A 3KULA 3PXQA 3PE1A 4IAKA 1AQ1A 5HE1A 3CD8A 4EHZA 1DAWA 4J8NA 2Z60A 3ZONA 4ANMA 3R71A 4BIBA 3Q4TA 5AV4A 4H05A 4I6LA 4FSZA 2XKCA 3OHTA 2BRBA 2G2HA 3R73A 4C8BA 3BE2A 4DE4A 3NMUF 4FNYA 5GINE 1ZYLA 3ZLWA 3LFNA 3BQRA 5HHWA 2Y7JA 3WARA 5GZAA 4AXFA 3QYZA 4PF4A 1L8TA 4YJTA 3ETAA 5HNGA 4EH6A 1MRVA 2BIYA 3V04A 5GZ8A 1OIRA 5DRDA 3RPYA 4CV9A 3U6HA 1XHAA 4DG0E 4O86A 1TVOA 3G15A 3ZSGA 3OW4A 4EH3A 4D1XA 3PXYA 5C8KA 5EI8A 1W83A 1URWA 3ANRA 3C0IA 3QZHA 1HOWA 2DUVA 4KNBA 2XBJA 3Q6WA 4FT3A 4RJ4A 3ROYA 3ZS5A 4PDYA 4FMQA 3NCZA 1SZMA 2O5KA 2JLDA 2VWIA 5C03A 4PMSA 3DBEA 4P2KA 2F4JA 3W2SA 4CFXA 4HZSA 3WIGA 5CF8A 2GMXA 5BPYA 5BYYA 2C6IA 3OEZA 5TKDA 5KMMA 3PG1A 2A0CX 4BDHA 1WVXA 3UO5A 1PHKA 1OL6A 2FSTX 4LMUA 4RZWA 4IACA 3QZIA 2FB8A 4O0XA 2OF4A 1UVRA 4NFNA 2R3LA 5FDPA 2HCKA 4F9CA 3ORMA 2PVHA 5DE2A 4EOMA 4USEA 5HD4A 5L6OA 3FC2A 4GIHA 1Q61A 4OBQA 4ZTNA 5L8LA 3HAVA 2HAKA 4MD8E 1GY3A 3FBVA 3O2MA 3HV6A 3OTUA 3C51A 4FV2A 1CKJA 2VO0A 1M2PA 4KBKA 4A9YA 3BL7A 2X0PA 3LM0A 5LWMA 4AXCA 4CFMA 4RX8A 4WRGA 4D5KA 3GC0A 3UYTA 2YIXA 3PXFA 4O0TA 2QQ7A 3E62A 4JBQA 3EHAA 5HTBA 1O6LA 4M3QA 4YGAA 5AUZA 3ZM9A 5BUJA 5A3XA 3R7YA 1Z9XA 3F7ZA 4X21A 4EOKA 2WZJA 2JIIA 3O5AA 4JR3A 4FIFA 2V0DA 5AP0A 4F9BA 3OBGA 5K4IA 4GU6A 2GS2A 4UZDA 4RQVA 1UU8A 1FVRA 2ZV9A 4JS8A 2IJMA 3F61A 4TYHB 3TL8A 1Q8YA 3II5A 4G6OA 4TRLA 3QQFA 4PMMA 5IH6A 3VQHA 3QTSA 3HECA 2ZOQA 3A99A 3NAYA 1IAHA 5DEWA 2XRUA 1XH9A 2FO0A 2HK5A 1BX6A 5E8ZA 4TKSA 3TMOA 2OSCA 4ANNA 4QT1A 5B7VA 4UV0A 4YTFA 4RIXB 4NCTA 3P08A 3O96A 2XIRA 1OKZA 3K54A 4M66A 3MWUA 3BI6A 3W0NA 4Y72A 4DDIA 4S32A 4EZ3A 4DBXA 3FMHA 3FZOA 3Q3BA 5GJDA 5HG7A 4J95A 5CEMA 3UTOA 3QKKA 4C4FA 3CIKA 2OIBA 3PZEA 4ZMEA 1FMKA 2QONA 2W1EA 4ACGA 3A7JA 3POOA 3MTLA 4P4CA 4LUEA 4UYAA 2X1NA 2AC5A 3BEGA 3RHKA 5IQCA 2YM5A 3ULZA 4HGSA 2R7IA 3MJ1A 3C1XA 3ENHA 4OBOA 3UOKA 4E1ZA 2CGUA 5AUYA 5AP2A 3EN4A 1OI9A 3R02A 2W7XA 4ANBA 4X3FC 2P55A 4II5A 3QA0A 2XIXA 3IPHA 3MFTA 1UNHA 4AN9A 2GSFA 3IECA 4A7CA 4GVJA 3FL4A 5LVNA 3E63A 3ODZX 1YRPA 3FI8A 3OWJA 5HNIX 2XYUA 3UZRA 4R7HA 4E4NA 2YAAA 5CSVA 2UUEA 2UW5A 3GOPA 4G5PA 3QTZA 4ZZOA 4BYJA 4W8EA 3NYOA 3QTUA 4FV4A 4YSMA 3AG9A 2IZRA 4U97A 3LQ5A 3O8TA 2Z02A 4FIJA 5M56A 3PA5A 4YPDA 4DITA 4XNEA 1OKWA 3RWQA 2VX0A 2C1AA 4Y46A 1UKIA 3QC4A 3HP5A 3PIYA 5ITAA 4NJ3A 4HCTA 3ZC5A 3W0SA 3UC3A 1KOBA 3CQEA 1SMHA 3EN7A 4USFA 1L3RE 3FLYA 4G2FA 4HGLA 1OPKA 2W5AA 3P86A 4YLLA 3ZBFA 3KXZA 2R0UA 4U79A 4O7WA 2PVFA 4XV1A 3P0MA 1H1RA 3PYYA 4X6QC 3SXRA 4PDPA 3R63A 3V3VA 3R7IA 1J91A 1Q3DA 4NSTA 3C50A 4BZNA 1KV1A 2YCQA 5IDNA 5AIKA 4XYFA 5CZIA 3H0YA 4WNPA 3C4WA 3FAAA 2VWYA 5DR9A 5HBJA 3ALNA 4YHJA 3NUAA 3QGWA 4B0GA 3ZC6A 4U3YA 3QF9A 2KTYA 4F7SA 4LOPA 4DFZE 3BYOA 4XG8A 4BCJA 2UZUE 2RFSA 2QODA 3E8NA 4BRXA 5JMSA 5B2LA 4P5QA 1IRKA 1OMWA 4ZXTA 4BCQA 1OGYA 3CKXA 4UXQA 1YDTE 4R77A 4FKLA 2XNBA 2Q0NA 5K4JA 5HVYA 5IKWA 3VF8A 1KE8A 3KQ7A 5L8JA 4GVAA 5FQDC 4YNEA 3EKKA 4D4VA 4GJ2A 3MV5A 4OR5A 4BDIA 4FEXA 3P7AA 2J0JA 2BRHA 2IZSA 3E7VA 4AN3A 2BAJA 2YAKA 1QCFA 1F5QA 4C37A 2BVAA 1VZOA 4JJRA 3UIBA 3WBLA 1ZY5A 4FT0A 4X0MA 4XG6A 4MD7E 3PLAE 1CDKA 2VO3A 3PG3A 4F1TA 3AMYA 3C5UA 2WO6A 3ORZA 2QR8A 5CQUA 1OBDA 2I0VA 2RFNA 1W2DA 4LQMA 3P79A 4IWOA 3BGPA 4XEYA 4CZYB 4RVKA 1RE8A 2VAGA 3RNIA 2UZLA 4Q9SA 3KVWA 2E9UA 2XUUA 3U9CA 3HX4A 2I0HA 4E26A 4W4WA 3BBTB 2BDWA 3KL8A 4U45A 5AADA 5CAQA 4AZSA 3OY1A 2UW9A 2FVDA 4MD9E 2P2HA 5JFXA 2WMBA 2R3PA 4YBJA 5IF1A 1IR3A 3EFLA 4JBVA 2PMIA 1WVWA 3GU8A 4NU1A 1YXUA 4PL4A 5CNNA 2YLFA 2W4OA 3FLWA 5ANGA 5E8SA 4MCVA 4XG7A 3UOLA 3LFFA 3ALOA 3DDPA 4BTKA 3TN8A 4FTCA 5M09A 4JVGA 5IA5A 3DXNA 1OL2A 3GXLA 4FSWA 2NNWB 4RIWB 1VYZA 4DCEA 3OCGA 4XG4A 2R9SA 4FYOA 2QOQA 3F3TA 4TWOA 4RBLA 1OIQA 4G34A 3FZ1A 4FTUA 3CXWA 4RX9A 1W0XC 2X7GA 3B2WA 3IW6A 1IASA 1P4OA 4K9YA 2JFLA 4RIXA 1PKGA 2IZTA 3FMLA 3RZBA 4PTGA 3NWWA 5A4EA 3DXPA 5FUTA 3H9RA 3ZHPC 4EOOA 4L7SA 1HCLA 2YCSA 3Q9WA 3DKCA 4LG4A 3UQFA 3JY0A 4MXXA 1Y8GA 1G8SA 1ZXEA 2C6OA 4DGNA 3Q4ZA 2V7AA 4O4DA 3ZZWA 1V0OA 4YO4A 3BX5A 3JVRA 4R3CA 2VX1A 4AQKA 4JL9A 1IG1A 2QU6A 3M2WA 4I0RA 4LFIA 4RIYA 5HTIA 2QLQA 2R3RA 1R1WA 3I6UA 4IZYA 4O0RA 4BKZA 4RJ8A 4U80A 2XK4A 2H8HA 1GIIA 2WTWA 5F1ZA 1LUFA 4O84A 3EQHA 3KXGA 3VN9A 3W2RA 2VWXA 4FNZA 5AX9A 1XH4A 3CY3A 3QKLA 4G9RA 2EXMA 4QP4A 4U0IA 1H1QA 3EZRA 4K18A 3AC4A 3RVGA 4ZY6A 4RX5A 1WBWA 2Y4IC 3VBVA 2JKMA 3VBQA 4RVMA 4C2WA 1XKKA 2XANA 2GQSA 2FSOX 2O64A 2X81A 4BR3A 3ORNA 3POZA 5CTPA 5FDXA 4M97A 4X2GA 3OCSA 3RM7A 4C3RA 2XA4A 4IM2A 4O4BB 2YISA 3FI4A 3KIOC 2GQGA 3E3BX 4DEIA 2IWIA 3FHIA 5LVOA 4CKIA 4U42A 3LFCA 3H9FA 3LCKA 4AU8A 5BMMA 2F7XE 4J53A 1UNLA 5TO8A 3SOAA 4UXLA 2FA2A 3UNZA 2IW6A 5IQDA 1H1PA 2W17A 4I5CA 5H8GA 1GZ8A 2WMUA 4UWCA 3W18A 5IQFA 3OXTA 2J0KA 3CBLA 4F7NA 1JKKA 1WBOA 2J50A 5C1QB 2XH5A 3LFEA 5AIRA 3U9NA 2O63A 3FL5A 5IU2A 4DINA 1Q97A 4O1OA 2QC6A 2BTSA 3R83A 4J71A 4C33A 4E6DA 3HEGA 2UVYA 3TACA 4M67A 5ANJA 1A48A 1PYEA 4Z7GA 2GTNA 4FV1A 5J9ZA 4I4EA 3ZXZA 3UGCA 3V5PA 4W9WA 5HD7A 3F6XA 3HZTA 2X4FA 4FIEA 5GJFA 3R2BA 5AUTA 5AA9A 3TZ8A 5I9VA 1UWJA 2W1IA 1WBVA 4GFMA 5FEQA 5HIBA 3MY1A 3Q4CA 2QKWB 4WT6A 4IB5A 1UA2A 2JKKA 2CCIA 4U9AA 5DH3A 3L8XA 5EK7A 4R3RA 4FK3A 4YP8A 4O4EA 3FE3A 5HLPA 4F6UA 4UMPA 4C62A 4FTIA 4YZMA 4ALWA 4AP7A 4XV3A 4ANSA 2W1GA 4B7TA 2A1AB 1KUTA 1ZZLA 2IVTA 3VWAA 2BDJA 3E92A 5H9BA 3BYVA 4K6ZA 1OKVA 2YJSA 3U51A 1ZZ2A 4I24A 3DS6A 1KOAA 4FA2A 4BJJA 2BFYA 2PVLA 3QX4A 3HV4A 5IA1A 4BGQA 2R0IA 4M0YA 2ITYA 2HYYA 1H07A 3ORIA 4G3CA 2VWBA 5FG8A 2BILB 4KBAA 2GFSA 3C4ZA 3EN6A 4BDDA 5A4LA 3TTIA 2AC3A 5KHXA 4GT4A 4PPCA 2GNLA 2AYPA 3R7VA 3U6JA 2XZSA 4V0GB 2W99B 4WHZA 2QOIA 3NAXA 5LMAA 5TOZA 3KN6A 4HVIA 2C0OA 1OITA 3F3WA 2XKFA 4FTRA 4F7LA 3TUDA 4IAFA 4I6HA 5CSWA 4O7TA 3R9HA 3PIXA 3DJ6A 1GJOA 3NNVA 3A8WA 3ZOSA 2UW8A 4I0TA 3TXOA 4UB7A 2C69A 2B9FA 5IUGA 5D7VA 3LFAA 3U8WA 2JDRA 4BZDA 4F9AA 3QTWA 3BE9A 3ZH8A 3TWJA 3ZLXA 4RMZA 3ULIA 3MJ2A 3MVHA 4YPSA 2XCHA 2ZB0A 1CKPA 3ZTXA 3D5XA 4C61A 4ZAUA 4M14A 3CJFA 4BCMA 1Y91A 4HPTE 5HOAA 2YN8A 2BAKA 4FKVA 4I1ZA 5EG3A 3M1SA 1YXSA 1QPCA 3RWPA 3A7FA 2JKQA 3ZXTA 4WOVA 1RQQA 1DM2A 4YJSA 1T46A 2QURA 3Q5IA 3WOWA 4B99A 4RG0A 5JEBA 4FKGA 2XNEA 2WTDA 3LQ8A 4CZTA 5EW8A 2XJ0A 4LV8A 4OBPA 2WTKB 2CGVA 2ZDTA 4QQTA 3K5UA 3W16A 5IZFA 3LMIA 2BZKB 4JG6A 4P7EA 4IVAA 4ZP5A 4BF2A 4C38A 3AD6A 3FLZA 4ASZA 5LVMA 4KRDA 1TZDA 2CKPA 2W9FB 4TT7A 3TDWA 2YIQA 3UO4A 3LPBA 5CENA 3GEQA 5K0XA 4O6EA 3RAKA 2WQEA 3EFKA 3OVVA 1G8JA 2XEYA 4JX3A 3T3VA 3MGYA 5CY3A 3TZ7A 3P78A 4CKRA 1SVEA 2W1CA 3EN9A 4Y73A 5DFPA 3R8VA 1SNXA 4XH6A 4ASEA 3KFAA 1BUHA 3ZZEA 3V5TA 3GQLA 4BCPA 3KULB 4QMQA 2F57A 3E5AA 4PNIA 4AXEA 3DTCA 3SC1A 4QQCA 4ZEGA 3N4UA 1KE5A 4DFUA 4FNWA 2R3FA 4G3FA 2F9GA 4OTQA 5FWKK 3ERKA 3UG1A 3OP5A 4K77A 2R5TA 2ZV7A 4G16A 3P5JC 4YMJA 4D2VA 3PA3A 1GIHA 5CZHA 4RA4A 5D1JA 1XBCA 4QRCA 3QALE 4FT9A 3VQUA 3A60A 4PPAA 4DEDA 1OVEA 1PKDA 4TW9A 4LDTA 4FBXA 3FC1X 2VWZA 4ZTMA 5I3RA 4GT5A 5BVOA 4FV9A 2OWBA 3GQIA 2BRGA 3E8CA 1H01A 1DS5A 2QI8A 3MBLA 5BQ0A 2BDFA 4ASXA 5AMNA 2YCRA 5EM5A 5F94A 1O6YA 2ZDUA 3T8OA 2VWUA 3N9XA 4A06A 3VS0A 3KN5A 1R39A 5IH5A 3FYJX 4AW1A 4WNKA 4JNWA 2VTOA 3ZRLA 4TNBA 1K3AA 3ZCLA 1QPDA 4IM0A 4O27B 4UMUA 3LCOA 4QMWA 5EDQA 2QG5A 2XNPA 1R0EA 3DQXA 3R8ZA 3R9NA 1PW2A 5FXSA 4ZLYA 5JQ5A 3UDZA 5E8UA 4E3CA 5L3AA 4L9IA 3ID6C 3I6WA 3LXPA 4BICA 4EK6A 2XNGA 3TEIA 3VJNA 3BL9A 3QA8A 2W9ZB 2GU8A 3UODA 4Y8DA 3TUBA 4KIOA 2GTMA 4MKCA 1JKLA 4IWQA 4V05A 3GCSA 3RAIA 4R7IA 2R3MA 4QTEA 4I4FA 2UW7A 2HXQA 3JY9A 5CAUA 4CG8A 3AQVA 3FXXA 3TV7A 2E9VA 3G2FA 2Y6OA 4AOTA 3Q2JA 3CS9A 3IOPA 3NS9A 1W98A 4OT6A 2WTIA 4QOXA 3NUNA 4BCHA 2WTVA 3PSDA 1U54B 2ETRA 2VTTA 3NUPA 2PZRA 5JGDA 3UMXA 2XVDA 3OOGA 4H36A 1M17A 3IDBA 1FGIA 3C4CA 3PRIA 4R5SA 1ZOEA 5HLNA 4RGJA 3G51A 3EL8A 4RVLA 5GJGA 2GNJA 3QL8A 4EJNA 5CX9A 4AZVA 4QMMA 2CKQA 1JWHA 4O91A 4BCIA 3DPKA 4LOOA 4TXCA 3WF8A 2C6TA 3QWKA 3UOHA 1O6KA 3BELA 5L2IA 3KVXA 1U59A