3FV8A

Jnk3 bound to piperazine amide inhibitor, sr2774.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
346
structure length
331
Chain Sequence
b'NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDTLKILDFGLARVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAXXXXXDEREHTIEEWKELIYKEVMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 10
publication title Synthesis and SAR of piperazine amides as novel c-jun N-terminal kinase (JNK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 331
sequence length 346
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fv8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fv8A01
2R0UA 4HCVA 4GT3A 1U4DA 3RPSA 3P5KA 3UG1A 3EKNA 3B8RA 2WIHA 4BL1A 1IEPA 1P5EA 4F09A 2YDJA 3SRVA 4GVJA 3QD3A 4BTMA 5D10A 4CXAA 4PRJA 3TKIA 2XYUA 3IW7A 3JVRA 1XH6A 2UW5A 4GIIA 5K4JA 3EZRA 1GZ8A 1LEWA 5E1SA 5IA4A 4E5WA 3E7VA 4XG8A 5EKNA 1Q8TA 3QKKA 1UKIA 2VUWA 3CR0A 4C4HA 4F7JA 2R9SA 5IISA 3S4QA 3NIEA 2PK9A 5GJFA 2VO6A 4FOCA 4LRJA 5CT7A 3S95A 3AT4A 4FTOA 4AGDA 3DTWA 5JKGA 2I0VA 2O3PA 1J1BA 3ODYX 4EK3A 3NYVA 2BAJA 3GP0A 3BEGA 4ZJJA 4JS8A 5JFSA 2JAVA 1OIUA 3C5UA 3PSBA 4EZ5A 3UQGA 1OMWA 3A7FA 1XJDA 5DBXA 3ZO1A 2OIQA 5AR5A 4IDVA 2ZM3A 4L8MA 2C3JA 4M7IA 2PZPA 3R2YA 5CI7A 2CPKE 5H8EA 3MN3A 3JR1A 2YA9A 2YLFA 4HYSA 3NUYA 1W84A 1YKRA 4PMSA 1M7NA 2B4SB 2ZM1A 4ZSGA 4E4XA 2WB8A 4XG6A 2CDZA 2JKQA 5HX8A 3ZS5A 4W4WA 4E1ZA 2ETKA 3ROYA 3W1FA 4KIOA 4LGGA 2J90A 4BVUA 5HORA 5K0XA 3DK7A 5CSXA 3RVGA 3HNGA 4CG8A 2R5TA 4JBQA 4O0VA 4HYHA 5GJDA 1URCA 4FEVA 4YTIA 4DH8A 5AAGA 2F9GA 5KMKA 4ZJIA 2PMIA 4QTAA 1GAGA 1QMZA 4FTLA 4GMYA 5D12A 4FT3A 5EM6A 1WCCA 3RPYA 1OB3A 2VWZA 4RC2A 5EW9A 5HBJA 3LJ1A 3LJ0A 1YI4A 3OFMA 4LOPA 4ORKA 1OPJA 4EHGA 2BROA 2GNJA 3SXFA 3C4XA 2GU8A 1MUOA 3DNDA 1OL6A 4IVCA 3PY0A 3RPRA 3ZUVA 5EHLA 2R3GA 3BYUA 3QFVA 4JDHA 4BZDA 4HW7A 4GL9A 3VRZA 1OIYA 4O7LA 2P2HA 3C5IA 2XH5A 4FF8A 4CMTA 3VN9A 4YJOA 2J7TA 3E62A 3LFFA 3NVKI 3CKWA 4OTFA 2IJMA 3RKBA 5CQWA 5AMNA 2JEDA 1MQ4A 5TO8A 2O65A 4EZ3A 3I81A 4JLCA 3MTFA 2R4BA 4L42A 3DQWA 3KB7A 4R1VA 2C68A 3LHJA 4KWPA 3F69A 2XBJA 3RPOA 2PPQA 4L68A 4D2TA 3EFJA 4USFA 5KZ0A 5E8SA 5HKMA 4L52A 4AN2A 3MGYA 5DT3A 2E2BA 3KXZA 3WOWA 2B52A 4MD9E 5HIDA 4WRGA 4O0XA 3FMLA 1A48A 3LCTA 2YM5A 3MA3A 4AW2A 4RX9A 3T3UA 5FEQA 2WMBA 3LVPA 3A7HA 2GHGA 3F5PA 4EOLA 2X81A 4QYGA 4HNIA 3LQ8A 2QHMA 3ZRMA 2Z7QA 3O96A 1KSWA 4MXAA 2QR7A 1W0XC 3A99A 3ENMA 3GOPA 3EQDA 5HE1A 1MRUA 5GZ8A 5CLPA 4E73A 2OLCA 1ZOGA 5EK7A 2YJRA 3SC1A 4ANMA 3GU6A 3QTWA 3D5UA 4AE6A 4E26A 4PY1A 4D1SA 4EC9A 3UPZA 4BDDA 1IAHA 3JPVA 5BUIA 4C3FA 5KHWA 3P1AA 1OL5A 5JFXA 4JQEA 5EI2A 4ANSA 1R1WA 2IVTA 4CCUA 1KE8A 5AP7A 5E92A 3AC2A 3O23A 5LARA 3ZOSA 4F9AA 4ACHA 1FBNA 3S3IA 4YO6A 1YHWA 4O2ZA 5FBOA 5CAOA 2C69A 4WG3A 4FBXA 3M1SA 1WBPA 2I0EA 2C47A 3G15A 1YHSA 4J71A 2OWBA 5EYDA 2PMLX 3VC4A 4BBMA 1B38A 1NA7A 2OO8X 4FSUA 3UOHA 1J91A 4JI9A 2J0KA 3IG7A 2XK9A 3CEKA 3DXQA 3NCZA 5DH3A 4AT4A 2JDTA 4AU8A 3QQGA 3CY2A 3VW8A 3CIKA 5L2SA 5LQFA 3LMHA 4FTMA 3WF6A 2BDFA 5IQHA 1ZWSA 3LOKA 3PJ1A 4LRKA 3VBQA 3ZRKA 2F2UA 4ALUA 4TZRA 4UYAA 3Q52A 4CCBA 3JVSA 4O21A 2HZ0A 3CGFA 5CVGA 4DFXE 5GIOE 5K5XA 4N57A 1R0EA 4A4LA 4YLJA 3Q4ZA 3BQRA 2ITZA 1H00A 2PZRA 4L43A 4JX3A 2YIYA 4U40A 2P2IA 4WNPA 3OXZA 4ZSEA 4E8AA 3TXOA 3HV3A 5HG5A 2C0TA 4TYGA 3W8QA 3FY2A 3PA4A 3K3IA 2JBOA 5L2WA 4CFXA 1PMNA 4PX6A 2EU9A 4IZAA 2YM6A 1WMKA 2YM4A 4L6QA 3PG3A 1H25A 5HCZA 3UVPA 2VTLA 1XBCA 3HGKA 3RAKA 3H0YA 4N6YA 4DFBA 4FL3A 4NIFB 3AD4A 4E4LA 3V5JA 3KA0A 3ZC6A 5HHWA 1ATPE 3EJ1A 4IX4A 1Q41A 2IW8A 2R3HA 1CKPA 4UWCA 3EN4A 3MVJA 1UNHA 1WVXA 5J9ZA 2BHHA 4F7SA 4P5ZA 4I6BA 1KV2A 3FXWA 3RHKA 3MB6A 3EKKA 5E8VA 3UG2A 4ENYA 1NXKA 4YP8A 4F08A 3KK8A 1UA2A 2WHBA 3PJ8A 3TT0A 4UXLA 4UXQA 3BU5A 3BCEA 2YCQA 3O0GA 3LAUA 5BVKA 5AP0A 2YWPA 3QZHA 4PDOA 5I4NA 1URWA 3C4EA 2Q0BA 4EYJA 4UYNA 5F95A 3PA5A 4FKIA 4W4YA 3T9IA 3ORKA 3ANRA 4G5JA 2BALA 1Y91A 2PVMA 3F3ZA 3E3PA 3EQFA 3EB0A 1PXNA 1PXMA 1LEZA 4IX6A 4JNWA 2YAKA 5CEQA 4FVPA 3EL7A 2JITA 2W5BA 2VTAA 3JYAA 3Q2MA 2WMVA 2UW3A 4MBJA 4UWBA 4RJ7A 4EOPA 2PL0A 4X2FA 1WVWA 4G9CA 2GNIA 1XH4A 2VTIA 3OBGA 4IE9A 3VIDA 4KS8A 5BVDA 3FZRA 2XJ0A 2R3MA 2ZB1A 4JG7A 5KBRA 2WMTA 5FTOA 3E63A 2BFYA 4GK3A 5L3AA 5CTPA 4QMPA 2CSNA 3OT8A 5C1QB 3R8VA 3DBQA 4D4YA 5EM7A 4H05A 2IN6A 2LAVA 5IUHA 3Q3BA 1VYZA 4O38A 3I0OA 2GPHA 2OZAA 1FOTA 5EFQA 1R0PA 2IW6A 2E9NA 2J2IB 2QHNA 2R3FA 3KXGA 3RAWA 3U9NA 5CSHA 3FMKA 3KRWA 2GFCA 3O51A 4ALVA 4D9UA 4EOMA 4I0TA 4QYEA 3DDQA 3QUDA 4DGOA 4MXXA 2OJIA 2PY3A 4GH2A 2YCFA 4G6LA 3BYOA 4QYHA 3FLZA 4FZAB 4BGHA 3CP9A 4TYIA 4FSWA 4DFNA 2VTMA 3L8SA 4FNYA 4UWYA 4W9WA 3S1HA 4EI4A 5EG3A 1STCE 3L9MA 3BELA 5CNOA 4FZ6A 4FI1A 5J9YA 1GJOA 2PVRA 3HZTA 4IACA 3C7QA 4E5BA 2YFXA 2ZAZA 2ETRA 2BDJA 3FMDA 3LXKA 4R3RA 3U8WA 3UE4A 4XOYA 5F4NA 2WEIA 3KMWA 4IW0A 4U7ZA 5EM5A 4BTJA 4O84A 5E9EA 2QO7A 3NYXA 2EUFB 3WZKA 2UVYA 2OJGA 2F49A 2V55A 4ZZMA 3NIZA 4M0YA 4AWIA 2FO0A 4CYJA 5AP6A 2ZJWA 1JSTA 3VS3A 4TT7A 4DG3E 1UNGA 3G9NA 1FMKA 2OW3A 3KKVA 2UZOA 2HYYA 3OC1A 2YEXA 5ANGA 4NL0A 1Q8WA 3ZMMA 3QALE 4WSQA 3MH3A 4L00A 5HVJA 3U55A 5AIKA 4EK6A 2XIXA 3FKOA 5KUPA 3BHYA 1M14A 1Q4LA 3V01A 4QMXA 4YHTA 2V5QA 4DGLC 2NRYA 3EQBA 2WOTA 3F2AA 5FP6A 4ZZOA 1P14A 2PWLA 3UIXA 2E9OA 4YBKA 2GNGA 5ICPA 3UZRA 1M2QA 5AP4A 3O50A 4DEGA 3PZHA 1H0VA 4RQVA 2Y8OA 2YDKA 4I92A 1QL6A 1YOMA 2WTVA 3LCOA 1L3RE 2QD9A 4XUFA 4KBAA 4FG9A 2XIZA 3VUHA 2JKKA 4KINA 3ETAA 4I6FA 4QYFA 4FIHA 3C9WA 5JSMA 2PULA 4FA2A 3O8PA 2VWWA 3GT8A 4YLKA 4S33A 5E8WA 2GS2A 5HICA 5FP5A 3QLGA 2HK5A 4EJNA 4G16A 3RPVA 4RJ4A 4RJ5A 3IW5A 4E5AX 3A8XA 4X3FA 4BDCA 5KNJA 3QQKA 5HESA 3LM0A 5HO6A 4QMWA 3RCJA 5CEOA 4GU9A 4JXFA 2ZYBA 1GZKA 3A7IA 4AGWA 3ZUUA 4C8BA 3KEXA 3R7VA 4B7TA 5IEVA 1SZMA 2ZV8A 1JBPE 4D1XA 3TNIA 3FL5A 4MWIA 5JFWA 3LQ5A 3BHUA 4O7SA 4RIXB 5AFVA 1YWVA 3DCVA 3PA3A 4RIOA 1RDQE 4FTTA 5HLPA 4ZK5A 2W4JA 2J5EA 1SNUA 5A4CA 5LVPA 4MXCA 3ZCLA 4UMRA 4ZAUA 5AA8A 4FKUA 3I6WA 2ERZE 5AAEA 2OF2A 2R2PA 4IAFA 3UBDA 4D2WA 3H9FA 5IPJA 4ASXA 4AXAA 5CEMA 5F1ZA 3F5UA 3ZXZA 4BIEA 3QGWA 4U8ZA 1KWPA 2XM8A 4OBPA 5EYCA 4KRCA 4MWHA 3PG1A 4DCEA 5IMEA 2C6OA 4LUDA 3W2QA 5KCVA 2REIA 3Q4UA 3CS9A 1PMUA 3DQXA 4MNEB 3CD8A 4TYEA 3FPMA 4QMYA 2GDOA 3OCGA 5HCXA 2WTDA 5BQ0A 4FV4A 1OUKA 3U9CA 2CNVA 3NAXA 3UC3A 4RFYA 1JLUE 3LFQA 3P86A 2BRBA 4BDGA 5JMSA 4FEWA 3PIXA 4PNKA 4D2RA 4ZTLA 1F5QA 4FEXA 3POZA 2R3LA 4G31A 3ZSHA 3BX5A 3HV7A 1V1KA 3IOKA 4EKKA 3TTIA 5KMJA 5CF5A 1O9UA 4A06A 1PMVA 3EYGA 3KXNA 4K6ZA 4PWNA 4YGAA 3G51A 4BI2A 4QYYA 4CQEA 3SOCA 1W98A 2NRUA 3OWLA 3QKMA 4RX5A 3JY0A 3AD6A 4DG0E 4OAUC 4LI5A 2BRHA 2UW4A 4RLKA 2BHEA 5HO7A 4ZY6A 5AEPA 4RT7A 2X0GA 4QPSA 3DTCA 5L8JA 4C34A 5BNJA 1OM1A 2QO2A 3QD4A 1VYWA 1FINA 3NCGA 3CTJA 3TWJA 3PTGA 3SV0A 3V8WA 1DAWA 5IF1A 3QHWA 1RE8A 2W9FB 5C8NA 2AYPA 4IX3A 3UO6A 2QLUA 5AA9A 1WFCA 4FNXA 1W82A 4LGHA 3A7GA 4FV6A 2BAQA 4EHVA 5DEWA 4DGNA 2I1MA 3RMFA 5E7RA 2CKPA 3PXYA 3FC2A 3FSKA 4OTHA 5DWRA 3NS9A 4CD0A 1OL1A 2Y7JA 2JDSA 2WMXA 3BYVA 3D5WA 4LGDA 4P90A 5T6KA 2Z7RA 3NW5A 4UZDA 4BI0A 2UZWE 1TKIA 4OLIA 2XUUA 1AQ1A 3V6RA 4RVKA 3PPJA 4BDKA 3DT1A 5H2UA 3IDPA 1PXLA 4HNFA 4U3ZA 1S9JA 2XZSA 5HBHA 1MRVA 4ZLYA 4WRSA 2PZIA 2WEVA 4FKPA 4NJDA 3PE2A 2J6MA 2GSFA 2PHKA 1H0WA 3R7EA 3FQEA 3FLSA 3NSZA 4FKWA 2ITYA 3E93A 3ZZEA 1ZY4A 3EQRA 1M7QA 4IBMA 4OBQA 3QUPA 4OW8A 4BGQA 4GVAA 2B9FA 2X2KA 2VTPA 3O7LB 4LOQA 5AP5A 4J53A 3CQWA 4UY9A 5E4HA 5DR6A 2R3JA 3G9LX 4BCIA 4F9YA 5M4CA 4C57A 2YIRA 3KU2A 3QYZA 5DT0A 4D4RA 4OTRA 4CGAA 4YC3A 3I7BA 2E9VA 4YZBA 3R00A 4RA5A 4UMPA 2V62A 3IO7A 4M8TA 3R1QA 2PE0A 4QPMA 2W0JA 4ZLZA 5LVMA 2VX0A 4RBLA 5IH6A 3UYSA 1SVEA 4LFIA 3VBVA 2YM7A 4RVLA 2W99B 3GOKA 4EYMA 3DOGA 3IGGA 3G0EA 4G5PA 4MK0A 4YJTA 5AR2A 4B99A 3MH2A 3DBFA 4HOKA 4Q5EA 4BI1A 2P4IA 2BZHB 4MD8E 5HE0A 4U3YA 3A7JA 3F3WA 3F82A 1XKKA 5HVKA 5JQ5A 3BEAA 5LWMA 4PDPA 1Z9XA 3PVGA 3LFCA 1DS5A 3AQVA 3FI4A 2YJSA 5HU3A 4IAKA 1JNKA 1BYGA 4HCUA 2PZ5A 4M67A 2QI8A 3VQUA 4WO5A 3D14A 3WZDA 4EH6A 2HWOA 2XK8A 3R02A 3SXRA 1ZMVA 5T3QA 2VX1A 3BWFA 1CSNA 4JJRA 5DG5A 5BMSA 4LM5A 3HL7A 4OTPA 5HE3A 4PP7A 5EDPA 4O7ZA 2PTKA 3KC3A 5LMKA 2VX3A 4RX8A 3VJOA 3C1XA 4BDJA 2CKQA 2VZ6A 2WTIA 2X4ZA 4A9TA 4FX3A 3UOKA 3F3UA 3OWJA 5H8GA 4BCQA 1P2AA 2PVNA 1CMKE 2HELA 3BLHA 4MXOA 3N51A 5IUGA 5LMKC 3FEGA 3VBWA 1WBVA 4FT9A 3OEZA 5A9UA 2GQSA 5FTQA 4MNFA 1OPKA 3W33A 3G5DA 2R3KA 3PVWA 3PXFA 4K8AA 4BCNA 5DEYA 2ITVA 4A07A 3TZ7A 3RM6A 4LUEA 3MV5A 3D83A 3T3VA 3GI3A 3KCFA 5CAVA 3NUXA 5J9LA 3CY3A 1H1SA 3TZMA 4BIDA 1IG1A 4EKLA 2VWXA 3D5VA 1NVSA 1B39A 5KKRB 2W1EA 2F57A 4ZS0A 2BTSA 3AXWA 3NWWA 4LRMA 5JH6A 3BLRA 4K11A 1LP4A 3GENA 2XIKA 2BCJA 2CMWA 2FYSA 3DK6A 3KK9A 3OS3A 5DE2A 2JFLA 3GC9A 3IW4A 4I0SA 1Q24A 4KAOA 4CYIA 3TUCA 1H27A 1ZMUA 2QOLA 1QPCA 3EFLA 2F7ZE 3BGQA 2QC6A 4IB3A 4CV9A 4ERKA 4D0WA 4G1WA 5F9EA 3EN5A 2GS6A 4CZUA 4MQ2A 1CKJA 2ITOA 3FMJA 3FYKX 1H1RA 3L8PA 2PMOX 2XNOA 4YNEA 5AR7A 4CEGA 2QONA 3NEWA 3P0MA 3KCKA 3UPXA 3E5AA 2OICA 4JL9A 4X21A 4ZMEA 2J0LA 3QTRA 4NIFA 2P33A 4HVHA 1KE5A 3C13A 3CE3A 5A4TA 3LFDA 4IWOA 4IAIA 4DGGA 5HNGA 2DS1A 4YTFA 2RL5A 4CRSA 3DDPA 2NNWB 4TWOA 3SX9A 3C4FA 3F5XA 4R7IA 4EHZA 1Y8GA 1CDKA 4BR3A 1TQIA 2WGJA 3V5LA 3QGYA 4AUAA 3KREA 3UZTA 2QOHA 3FMMA 1YOJA 2Z7SA 3VHKA 3Q9WA 5HU9A 3AGLA 4HPTE 2V22A 3PRFA 4AN3A 3UP7A 3TL8A 4FICA 4JR3A 3L1SA 4I3ZA 4FEQA 4BDIA 5DA3A 1T46A 4C3RA 4QD6A 3OOMA 3QTUA 4A4OA 5L2TA 1F0QA 4EOOA 1Y57A 4X2KA 3VQHA 3GU7A 3KVWA 4IVDA 4JQ8A 4UALA 4I20A 1QCFA 4AOTA 2WMRA 4S30A 1M2PA 1I09A 2VRXA 3GCUA 4LL5A 4XV2A 3DKFA 3QRKA 2GTMA 2XK3A 3KULB 1Q99A 3U6JA 2J51A 4L3PA 1GNGA 4FIFA 2PYWA 2ZV9A 3OUNB 2JDVA 3A60A 3KVXA 1XR1A 3ANQA 4IC8A 5AX3A 5HBEA 4YSJA 3FI8A 1PHKA 5AUUA 4PPAA 3R7UA 2PE1A 3CD3A 4Z9LA 4CZYB 4YJRA 4YBJA 3BBWA 5GJGA 3FWQA 1SM2A 3V5QA 4CFFA 3UO4A 4IVBA 2W96B 3OVVA 4QQJA 1XH8A 3HA6A 4O0RA 3GBZA 3GC8A 2Y6OA 4FSRA 4JBPA 4O6LA 3FMEA 2GNHA 3PVUA 4GW8A 3UNZA 2DQ7X 3TJCA 5J1VA 3E87A 5AADA 3FHIA 4JBOA 2RSVA 2ERKA 2YHVA 2BRMA 4IXPA 5HEZA 5E8UA 2YZLA 2IZTA 3A8WA 4L46A 4W4XA 5CWZA 2QOCA 4ZSAA 3E8DA 2XK4A 5JGBA 3DLZA 2BZIB 5J7BA 4DTKA 3RCDA 5CI6A 2C6MA 4ANLA 1YRPA 4GT5A 3CKXA 3ZLSA 2W1FA 4NM5A 3H10A 4BN1A 4F7LA 2VWBA 2VAGA 4FT0A 4RVMA 1KE9A 2JKMA 1WBWA 2ITUA 4YHJA 5HIBA 2O5KA 5EDRA 3H9RA 4R5YA 5CVFA 5AUWA 4AW1A 5J79A 5L6PA 1KUTA 2QR8A 3K54A 2V7OA 4IDTA 3RP9A 4EUUA 4LOOA 3QC4A 3LXPA 3OXTA 4DEBA 1JVPP 2H8HA 3IW8A 3WF7A 4XG2A 4IZ5A 2C6TA 4QNAA 4XV9A 2HW7A 5EDQA 3OCBA 5IA1A 3FJQE 1QPDA 5I9XA 3LLAA 2ITNA 4AX8A 5E91A 3ORLA 4XEYA 4ITJA 3BYMA 3ITZA 3QQJA 4GJ2A 4LMNA 3IECA 2W1DA 2Q83A 4X7QA 2HIWA 1FQ1B 2IVSA 2YIQA 3I0QA 3QTXA 4BDAA 3TEIA 4RX7A 4D5HA 5BPYA 3VUTA 3AT2A 2R3OA 2EXMA 3C4CA 4CTCA 3FLQA 2W9ZB 4K0YA 4QMVA 4YZCA 1FPUA 2AC3A 3W16A 5K4IA 2ZDUA 4DC2A 4RC4A 2X9FA 4G2FA 4Y46A 2OIBA 4ENXA 5IQFA 4LG4A 4E3CA 2BFXA 3LMIA 5IDPA 2UVXA 3U4WA 5L6WL 4H1MA 3KRLA 3ACKA 1ZOHA 3LXLA 2P0CA 3MJ1A 1M2RA 3TV4A 2Y4IB 3FL4A 4IM0A 3QF9A 4S2ZA 5E8ZA 3R8UA 3W32A 2OXYA 4QQTA 4A9RA 3EWHA 4AOJA 4NM3A 1OL2A 3L9PA 4EQUA 2UVZA 3SW7A 3P08A 3W8LA 3KXHA 3HV5A 4XBUA 2XIRA 2XNBA 3DXNA 2OF4A 2UZEA 3HMOA 4I5CA 4L53A 3W55A 3QA0A 4QMUA 3WBLA 2ITWA 4FG8A 5CALA 5I9YA 3ZFYA 4TPTA 4NSTA 4WUAA 3HDNA 3F3TA 4FKQA 4FGBA 4ACDA 4FE2A 1MQBA 2YIXA 2VNWA 4H3BA 1ND4A 3A4OX 2A1AB 3AD5A 5IQBA 4ZY5A 4BCOA 4YR8A 4NTSA 4GKIA 4RIXA 3PDTA 4WUNA 2C6EA 3S2PA 1JQHA 2OZOA 5JRSA 5DMZA 2IZRA 2AC5A 3AC3A 3CPCA 4MXYA 1SVHA 1WZYA 3I60A 4EHEA 5B2KA 3ATSA 4XP2A 3NYNA 3Q6UA 4AQCA 4F6SA 3WIKA 4O86A 3KQ7A 1V0BA 3RINA 4FIGA 2IVVA 4BF2A 3PJ3A 5LOHA 5I3RA 1LPUA 2CNQA 1OUYA 1BI8A 4KABA 4Q9SA 1BL7A 3PPKA 4HCTA 4MNEA 3G90X 2ITPA 4MX9A 3VUIA 3A4PA 4FT5A 3NDMA 3EFWA 3EOCA 1TVOA 5ANOA 4BBEA 3EQCA 1G8AA 3NNWA 4GKHA 3KRXA 2G1TA 4XG7A 3FDNA 3FV8A 3M2WA 3IKAA 4O96A 3R7GA 3IOPA 2W1GA 3O7LD 5I9UA 2XBAA 3UOLA 1Q97A 3HV4A 3FKNA 3C50A 3R22A 4AZSA 3Q60A 1JPAA 2C5OA 3P23A 2NO3A 3OUKA 5M44A 4LV8A 4XV3A 4D4SA 2OG8A 2C6LA 3AMAA 4IADA 3UVQA 4XP3A 3VVHA 3V04A 4PMPA 5HTCA 2WQOA 4UMTA 4R8QA 3FBVA 3DS6A 5HG7A 2VTQA 2R64A 5CAQA 1HCKA 2C1AA 2WQEA 2WU6A 1IA8A 4HZSA 2X1NA 4I22A 3VO3A 4AW5A 5B2MA 3GFEA 2B7AA 2I0YA 4FV0A 4U9AA 3TN8A 4TYHB 4FZ7A 4EOSA 2ZVAA 5FM2A 4G3EA 4U45A 3MH1A 3LQ3A 3R9RA 3Q4CA 3SD0A 3NNXA 2PVJA 3MPMA 4J1RA 4M14A 4FYOA 4A9UA 5M51A 3MVHA 2LGCA 3SDJA 3HUBA 4F1OA 5D9HA 2X39A 5IEXA 2OIDA 3TZ8A 3R71A 3BPRA 5IZFA 5DR2A 4DHFA 2GCDA 4FV5A 3RHXA 4EL9A 3HRFA 3TM0A 4I5PA 3L8XA 3QA8A 3NAYA 3M42A 4O82A 3KN6A 3QQHA 1NVQA 3TNQB 4G3GA 2BZKB 2GTNA 4BTKA 2QU6A 2OKRA 3ZONA 3ZSIA 3VS4A 4BWKA 3QRIA 3QCXA 4F64A 4KNBA 4NW5A 2WTKC 2WMUA 3QQFA 2I0HA 4FKTA 1REJA 3V51A 3SQQA 4C0TA 2R3QA 5CZHA 3FXZA 4BKYA 4CZTA 4UEUA 4EEVA 3QHRA 4K2RA 2WMWA 3FC1X 5AV3A 5BX0A 1U46A 4BCKA 4EORA 5L6OA 2YCSA 3IDBA 4G6OA 3FMNA 1OIRA 3COMA 4M3QA 3VAPA 3C0GA 4EH4A 4GCJA 4C4EA 4IFGA 1G5SA 5ANDA 4OT6A 5GZAA 3D7TB 1VR2A 2IZSA 3ORXA 3WILA 4C4IA 4O81A 2PVFA 2KULA 3ZO4A 4GYIA 3COHA 1V0OA 3SHEA 4E4NA 3LCDA 2ZV2A 3MTLA 3QYWA 2Z2WA 4OTWA 1U54B 4YPSA 4C4JA 3DAKA 4OTGA 3ENHA 4I4FA 1REKA 5C8KA 1OI9A 3R01A 4FUXA 4ZOGA 2WQMA 4AZWA 2YERA 1EH4A 4QMOA 4FSYA 4C62A 3SG8A 1H1WA 4V05A 1H01A 4U43A 4HGEA 3OD6X 4CFVA 3WI6A 3QZIA 4NW6A 1OGUA 2BMCA 4FVQA 2BUJA 4I41A 4PL4A 2CGXA 4E6QA 3VWAA 4QMLA 5CXZA 1XHAA 3VF8A 3TACA 5DYJA 5LVOA 3TNWA 2XK6A 3ORPA 2F4JA 3QRTA 4P5QA 5FGKA 4DBNA 2VGOA 3TUDA 1J7LA 4V0GB 3OZ6A 4A4XA 2I7QA 4AOIA 4KKHA 5E8YA 4F9BA 3PXRA 4QTDA 2CGUA 4RQKA 2SRCA 3N9XA 4FSNA 4XG3A 4ZJVA 5EQYA 4U0IA 1PXPA 3R9NA 3RK9A 3UQCA 2FB8A 5CNNA 4YZMA 3ZDIA 3VS7A 1LR4A 4NKSA 5KMLA 3W2CA 5DPVA 2R3NA 2VTSA 4CLIA 3COKA 3MH0A 3CGOA 1K2PA 1O6LA 2PUUA 4UBAA 2EB2A 3QQLA 5DLSA 3MESA 5HQ0A 4FKSA 5DGZA 2YM3A 3FI3A 3U51A 3DKOA 4IWPA 3FMHA 3KMUA 4Y95A 4I5HA 3IQ7A 4YPDA 4RIWB 4PP9A 4FKJA 4LQMA 5T68A 4OUCA 4ANOA 4P7EA 3IS5A 3FLYA 3PWDA 1Y8YA 2QQ7A 3AOXA 3L9NA 3OW3A 3QD0A 1VJYA 4GEOA 4N4SA 4YJVA 4BIBA 2CHLA 2ZOQA 1Q62A 2AUHA 2JDRA 4MYGA 5KMIA 4F9CA 3R1NA 3R28A 5JZNA 5E90A 1FMOE 2B9HA 2RG6A 5EHYA 3PE1A 4NT4A 4UMQA 3FSFA 4FG7A 1PXOA 4OTIA 5F20A 5A4LA 2XJ2A 4ZSLA 4EUTA 5FXQA 3U4UA 5ETIA 3PXZA 4QMTA 3UP2A 4DYMA 4QP8A 5HNBA 5IQGA 4I94A 4WNOA 4IAZA 3SG9A 4DITA 3ROCA 2GFSA 4KSQA 4F6WA 1PRYA 4H36A 2G9XA 5ANEA 4O7VA 1DAYA 2UW6A 3IK3A 4F1TA 5IQAA 4XMOA 1FGKA 4I6QA 3KL8A 2F7XE 2RG5A 1YXXA 4YU2A 3NNVA 5F94A 4RIYB 4EH5A 3SVVA 4RWJA 4O7TA 2BAKA 2VO3A 3FLWA 3MI9A 3QD2B 1JWHA 4PTCA 4L3LA 2R3RA 3OBJA 2FGIA 3OWPA 3QX2A 3OY1A 3ORZA 2YDIA 4TWPA 3H3CA 3TKUA 5CAUA 2XVDA 2XMYA 3B2WA 4X2NA 5E8XA 3RNYA 4BCGA 1ZRZA 3TV6A 1DI8A 2WMAA 4HZRA 1OL7A 3BU6A 4BFMA 4ACCA 5AAFA 5L8LA 3OW4A 4USEA 5D7AA 2VTTA 3PY1A 4DH7A 4AW0A 3P4KA 4FV7A 4G3CA 1O6YA 4HYIA 5C01A 3Q96A 3ACJA 3PY3A 5CENA 3LMGA 4CTBA 4D2PA 1W83A 3PYYA 1UWJA 3R9DA 2UV2A 1E1VA 3E7OA 4Y83A 5ACKA 3KULA 4EWQA 4ZEGA 4MH7A 1H4LA 1M17A 3GU5A 3CQUA 4JG8A 3TNHA 3QU0A 3U87A 4X3FC 4FR4A 3V6SA 5H8BA 5C4KA 3EQGA 4GV1A 4PL3A 4M69B 2H6DA 3VS0A 3GU4A 4EH9A 2UZLA 3ZLXA 3MFRA 4R3PA 4AFJA 2R7IA 4IH8A 4NU1A 4XOZA 2F2CB 4QP4A 3ZZWA 1GOLA 4GK4A 1OPLA 4B0GA 4NM7A 3LW0A 3R0TA 3ZC5A 4BZOA 2X2MA 3D2KA 3UOJA 2IO6A 3LFNA 4KBCA 3BV3A 3HP5A 2PVYA 2YCRA 2C5NA 4IX5A 4R3CA 5AR4A 3R7OA 3BHHA 5B0XA 1BLXA 3HUCA 4BYIA 2WTCA 3H30A 4C61A 2XKCA 3NZ0A 5FD2A 3RZFA 5IQEA 4M0ZA 3R63A 4DFZE 5M4IA 3CC6A 4J95A 3NW7A 4R1YA 1SVGA 3PRIA 4MHAA 4LYNA 3ZBFA 4I21A 4L7SA 1XQZA 1YXUA 5LMBA 2GQRA 4U79A 3BHVA 3RAIA 5FRIA 5CASA 3UMWA 5EM8A 3DV3A 3NUAA 4J8NA 2WMQA 3REPA 1GY3A 3ALNA 2Q0NA 3GCPA 4PNIA 1BI7A 4AGCA 5JGDA 4QP7A 3LXNA 5C26A 1TQPA 5HI2A 2B1PA 5FDPA 4O7RA 4MBIA 2RKUA 5IA0A 3E8CA 3PXKA 2X6DA 5HE2A 3Q5ZA 3ZDUA 4A7CA 5C8MA 4FIJA 2H96A 3EN7A 5B7VA 4DLJA 3RK7A 4EH3A 4GRBA 4FNWA 4NJ3A 1PW2A 2W5HA 2GHMA 3DJ5A 3IDCA 4NUSA 4ACGA 4FUYA 4D2SA 4L67A 1PXJA 3I6UA 4M13A 4RZVA 3DB6A 4FKLA 4IJPA 1U5RA 1V0PA 4JX7A 4ONAA 2VU3A 4UN0C 3OCTA 4TY1A 4ERWA 4FKVA 4Z7GA 1PXIA 4AS0A 4CKIA 4KRDA 1H1PA 2BVAA 2QOQA 5DFPA 5IG1A 4I0RA 2FA2A 4CFWA 5H9BA 3D0EA 4C4GA 4PMTA 3ORTA 5CU2A 2QG5A 4OTQA 5A14A 3WZUA 5H3QA 4MXZA 4AP7A 3MFUA 1L8TA 2XP2A 4X6RA 4E4MA 1UVRA 3G6HA 4CLJA 2J0IA 4IFCA 3VS1A 1ZZ2A 3HA8A 3I7CA 3EN9A 4M12A 3UZPA 4Z55A 2B9JA 3QXOA 2R3PA 4NFNA 3CJFA 3PSCA 4PMMA 2BRGA 3N4VA 3PZEA 3MY0A 1B6CB 2XS0A 4IJ9A 5M06A 3Q2JA 1UV5A 2I6LA 1PMEA 3BI6A 3F6XA 3EIDA 4ASEA 3CCNA 5CEPA 2V7AA 2BIKB 3DK3A 5C9CA 2XRUA 4FTCA 1WBOA 3HKOA 5DI1A 2J50A 3QCQA 2ETMA 5EW3A 5BYYA 2XKFA 3P7BA 3Q4TA 1JSUA 5FUTA 5CU3A 5CXHA 2ZMDA 4ZTMA 1GIHA 4RFZA 4Q2AA 2ESMA 2W1ZA 5AWMA 3R8PA 2A2AA 1XH9A 5GZ9A 2PU8A 4CKJA 3NRMA 2JKOA 4BICA 1CKIA 3RBWA 3EHAA 4BCPA 3HMMA 4IAAA 4IANA 4KD1A 2IG7A 3EMGA 3BBTB 2CLQA 4U5JA 3OOGA 2Z8CA 4ZXTA 2Z02A 4FTKA 4K33A 4Y85A 5BMMA 1R3CA 2HOGA 1OECA 2VN9A 2O64A 2JAMA 3MB7A 2VWIA 2CCIA 2VTNA 3C4ZA 3R2BA 4QP1A 4U44A 3WF9A 4PF4A 4TN6A 2C3KA 4BCJA 5HLNA 4IM3A 3TV7A 5A4EA 4ZTHA 4B4LA 2G2IA 3AC1A 1KE7A 4ZY4A 3FUPA 4DAWA 3DPKA 4IQ6A 3ZRLA 2IZUA 2VWYA 3I1AA 4KIKB 5AV1A 3UVRA 4BCFA 5IEYA 4RWKA 3LJ2A 3F7WA 5KBQA 3VBTA 2X8EA 4C58A 4C35A 1W8CA 2I40A 4QMMA 4U81A 3WZJA 4TW9A 5A6OA 5K3YA 3R1YA 4S32A 4LMUA 5CAPA 2XNPA 1O6KA 5GHVA 4E93A 4O7YA 4JBVA 4JIKA 4U41A 4EZ7A 4QQ5A 4NM0A 3VULA 4WBOA 4HVSA 2E9PA 3KXMA 3LM5A 2O8YA 2XIYA 3K3JA 2HZIA 2A4LA 4FK6A 5DOSA 1A9UA 3OCSA 4L3JA 2VO7A 4EBWA 3MYGA 4TYHA 2QOBA 3OXIA 3F66A 1XBBA 3QC9A 4GU6A 4O0WA 2W5AA 4GIHA 4QNYA 3ZU7A 2C5YA 3VS5A 5FG8A 2RFDA 2WXVA 3NPCA 1IASA 4D5KA 4YTHA 2XK7A 4EK4A 2XCKA 3DNEA 4L7FA 3M11A 3FZOA 3PUPA 3VUKA 4YTCA 1DI9A 2OBJA 2OK1A 1Y6BA 2OJ9A 3DAEA 3DXPA 5M09A 2C3LA 4II5A 2BTRA 5L2QA 2XRWA 3UJGA 4F0GA 1H24A 2BKKA 4FC0A 2XKDA 2RGPA 4JG6A 3ULZA 4FIIA 3SW4A 4GJ3A 1PKGA 3HMIA 3MBLA 4MEDA 4X3JA 4D2VA 4EQMA 3QZFA 4AZVA 4TYJA 3EFKA 1OITA 4O83A 4M97A 4QP3A 4JRVA 2GNLA 5G1XA 4F63A 3W2OA 5I0BA 4PPCA 4DTAA 2FSTX 3UIUA 4F7NA 4FSTA 1J1CA 1YWNA 2WKMA 3SAYA 5CF6A 3CTHA 4O0SA 3NMUF 3QTSA 4AGUA 2EXEA 4O7NA 3C0HA 2NP8A 3LLTA 3RNIA 4AZEA 3W2RA 5AP3A 5FBNC 4ANNA 5ACBC 5CF4A 5EHOA 5JK3A 3JXWA 1ZYJA 3H9OA 4K77A 4RJ6A 3CXWA 4BB4A 5L8KA 1WVYA 2C5VA 4MAOA 4RC3A 3VF9A 4C37A 3TJDA 3NR9A 4FK3A 4G3DA 1IAJA 2QURA 3D7TA 4GFMA 5E8TA 5KX8A 5GINE 4BGGA 5CX9A 4ZLOA 4TRLA 2C5XA 2HXQA 2X9EA 5KMMA 2WPAA 3E88A 2DUVA 3JUHA 3WIGA 4B8LA 1U54A 3AG9A 3WE4A 3DKGA 3UO5A 4BKZA 2BDWA 4QO9A 5EOBA 4ZTQA 5IH4A 2YWVA 4UMUA 4RG0A 4XRLA 4AT5A 4WT6A 2KTYA 2XB7A 4W9XA 1GIJA 2X7FA 3ZXTA 4ZP5A 3R7IA 5IQDA 5JN2A 4C59A 3P7CA 1T45A 4FV1A 1PF8A 4YSMA 5TOZA 4X2JA 5BVEA 3U6HA 2C6IA 3PSDA 5ITAA 3AT3A 3OROA 3DJ7A 4YJUA 2HZ4A 1AGWA 2V0DA 4E6DA 2ITQA 1K9AA 4WSYA 3OF0A 2GNFA 4DH1A 5CEKA 5HD7A 4UB7A 4V0GA 4F70A 2WOUA 3Q53A 2PVKA 4FV2A 3VS2A 2OH0E 3THBA 5HIEA 2HCKA 2OH4A 4CFNA 5CSPA 4KB8A 2WU7A 4ZIMA 3WYXA 3HAVA 3PJCA 5DVRA 4DEIA 1YXTA 4A9SA 4C4FA 2B54A 2ACXA 1X8BA 4HGLA 3CTQA 4YZNA 3HLLA 3RM7A 5FQDC 2OI4X 4XRJA 4EWHA 1F3MC 2CN5A 4HGSA 3MIYA 4O22A 4E6AA 3NUPA 5DIAA 2QOOA 4IC7A 4X2GA 4EOKA 3KXXA 2RF9A 3G6GA 4FZDB 4RIWA 1H28A 3QQUA 4Y72A 3WZEA 2B9IA 4NTTA 2X8DA 4QQCA 3ZO3A 3R6XA 4WIHA 4AZFA 4Y73A 3QWJA 3O8TA 2UW8A 4HJOA 2Y0AA 3NUUA 3UDBA 2G15A 2Z7LA 3DZQA 3OG7A 3FKLA 4P4CA 3RWQA 1OIQA 5HZNA 4J99A 3UMXA 3VUMA 5HGIA 4YJNA 4QMNA 2WQNA 1R39A 4YJPA 4B6LA 3CSVA 1ZMWA 1QPEA 2VD5A 2WNTA 3G33A 2XM9A 2EWAA 5FDXA 2YITA 3TDWA 1FVTA 5M56A 3K5VA 3GB2A 4BKJA 3PLAE 1YDSE 4JT3A 4DA5A 1M52A 4JAJA 4OR5A 5L2IA 5IQCA 2OXDA 3MS9A 4F65A 4C38A 4X0MA 3HP2A 4LV5A 2X7GA 3I5NA 4BBFA 1UU7A 2DYLA 4IEBA 5IA5A 2XEYA 3Q9ZA 4Q5HA 4ID7A 2CLXA 4RWLA 5M55A 3V5TA 4TTHB 3EYHA 1OZ1A 4FKOA 3AGMA 2R0IA 1CM8A 4K18A 2WELA 1FVRA 4QMZA 2VV9A 4QTBA 4RIYA 4WG5A 4ITIA 5KO1A 3FYJX 3DFAA 5BUEA 1OKVA 2VTOA 3QX4A 2C0IA 4M84A 5AUZA 4JVGA 5GIPE 5B2LA 4PUZA 5I9WA 3KY2A 3K5UA 3F61A 2WTJA 1UU8A 1IRKA 3B8QA 3U54A 2QG7A 3PJ2A 2P3GX 3ZFXA 4O7WA 4ALWA 4DFUA 1ZYDA 4IHPA 2JBPA 4YLLA 1OKWA 3RGFA 2BZJA 1PKDA 2Y6MA 1PYEA 5HCYA 4G17A 3W18A 3L9LA 5C03A 4IB0A 3HX4A 4O91A 4RGJA 2WIPA 3E64A 2R3IA 4PQNA 2RFNA 1U59A 3E8NA 3R8MA 1BMKA 2OXXA 3ZLWA 4NH1A 4AACA 2VWVA 4N70A 4HVGA 3V3VA 5J8IA 5M4UA 1JOWB 4ZMFA 4F9WA 1NY3A 4XG4A 5CF8A 4X6QC 4M69A 2UZBA 4D9TA 3EQHA 2EB3A 3QLFA 5KE0A 3D4QA 1UKHA 4XJ0A 5AIRA 5AP1A 1Q8ZA 1U5QA 2OFVA 3HV6A 3DBCA 5EYMA 4JDIA 1I44A 1H08A 3P9JA 3D2IA 5CVHA 3DZOA 5EOLA 2YN8A 4O27B 2UZTA 4FSQA 5BVNA 1SNXA 5IDNA 3CBLA 3PP1A 4KSPA 3ODZX 3R83A 5C4LA 4IVAA 1NW1A 1VEBA 2HAKA 2VWUA 3R8LA 3R21A 4EOQA 4R7BA 2HWPA 2Y9QA 4C33A 3F2NA 2PVLA 3N4UA 3TIYA 3HYHA 4JIAA 5AV0A 2R7BA 4F6UA 4JAIA 4ARKA 5EW8A 3FLNC 2FSLX 3QRUA 4YC6A 4AA0A 1Q5KA 4JDJA 3V8SA 4AA4A 3ZO2A 3UODA 1OBDA 4R7HA 2C4GA 4K1BA 4L01A 3PP0A 4Y5QA 2X8IA 4J98A 3DU8A 4FL2A 5KMOA 5CEIA 2HZNA 4PTGA 3CJGA 4XLVA 4O2PA 5JQ8A 3ZTXA 4YUQA 4FTQA 4BZNA 1IR3A 1KE6A 4CQGA 2QODA 4K9YA 2CCHA 2PUIA 4IB5A 3BLQA 3OTUA 3ET7A 5DHJA 4BRXA 2XNMA 2XNGA 3BGZA 3I4BA 4N6ZA 3WE8A 2QCSA 3N4TA 1NT2A 3CQEA 3H4JA 3BYSA 4FV3A 2C6DA 3C0IA 3BRBA 2FUMA 3EQIA 5J5SA 3MDYA 1H26A 1R78A 4DINA 3DBDA 3OHTA 3DY7A 4GUEA 5FXRA 3KRJA 1Q8UA 4TWNA 3O17A 3FZSA 5JEBA 1P4FA 2W1HA 4W8DA 1G8SA 3GFWA 1YWRA 3ZLYA 3F2RA 1RW8A 5LVNA 1E9HA 3WF5A 1YDRE 2CJMA 4FGRA 2JLDA 3P79A 1FVVA 2UZNA 4IB1A 5LCJA 2CKOA 3D5XA 3EH9A 2H9VA 1ZLTA 4F0FA 3SLSA 4XNEA 2O0UA 2BR1A 4N0SA 4BHZA 4MQ1A 4KIPA 2PE2A 4MBLA 2X2LA 3TUBA 3POOA 4Q9ZA 3ORNA 4AG8A 2QU5A 4RVTA 5K9IA 3NNUA 2JGZA 3Q6WA 1ZZLA 1YDTE 4MCVA 5I3OA 3LFAA 1KV1A 2YACA 5CU6A 4AT3A 3ZM9A 3DBEA 4J97A 3MIAA 1YW2A 2G01A 4DT8A 3FZ1A 4H39A 2QO9A 2UZVA 3QAME 4G6NA 4O0TA 4RWIA 5AM6A 5FLFA 3W10A 2QOIA 2W05A 3FAAA 4FMQA 5AUVA 5DN3A 3MFSA 4I5MA 5BVOA 4WOVA 4IIRA 2C0OA 4OAVB 3MVLA 3ERKA 4ANBA 3ZSGA 4G9RA 1YQJA 4QRCA 2CN8A 2YABA 5D11A 3TCPA 4RPVA 1XBAA 4QOXA 1ZYLA 2FVDA 3QTQA 2QNJA 3F3VA 2E9UA 3HMNA 3LFSA 4D58A 1BX6A 4TWCA 4CRLA 2CNUA 4DCAA 4Y8DA 5TKDA 5TR6A 4E20A 5HTIA 2HY0A 1J7IA 1XO2B 4G34A 1PYXA 2EXCX 3QUEA 5J1WA 5IQIA 1Q8YA 1Q61A 5DT4A 5CU0A 3R1SA 4M68A 5A3XA 2WTWA 4Z16A 3COIA 3Q9YA 1H8FA 4XYFA 3OT3A 2BKZA 5FXSA 3AC4A 4EK8A 2XF0A 4XH6A 2WQBA 2VO0A 4WKQA 2JDOA 1LUFA 5EQEA 4WNKA 3O8UA 2GQGA 2QOFA 4FV8A 4BHNA 4C2WA 1UWHA 4NCTA 4CSVA 4ZS4A 4ASZA 4Z7HA 5CANA 3D9VA 3GNIB 2WD1A 4IM2A 4DBXA 3A61A 3HECA 2EVAA 4WHZA 5ANIA 5ANKA 2QKWB 5BVWA 5JRQA 4KIKA 1NVRA 3KRRA 3NUNA 2YZAA 1YI6A 2JIIA 3OP5A 3QCYA 2RFSA 4GG7A 2XA4A 4NCTC 3MW1A 5J7HA 4PPBA 4BC6A 4PDSA 4YZ9A 3KMMA 4GS6A 3TI1A 3MJ2A 3O2MA 5K5NA 5EI8A 2B53A 4D55A 3PVBA 3ID6C 4FTJA 2C3IB 5AUXA 3E3BX 4EOJA 2F7EE 5DRBA 1OBGA 3SRVB 4EH8A 4V04A 4CV8A 3MPTA 3DB8A 5CT0A 5D1JA 4GFOA 4CNHA 4UX9A 1VZOA 3MA6A 4EBVA 3FQSA 5AV2A 2QOKA 1J7UA 3NVMB 5I5ZA 3FPQA 3QWKA 3PXQA 4IZYA 4DEDA 3MY5A 5I9VA 3G2FA 1WAKA 3DLSA 5FM3A 4KKGA 3SKCA 2ZMCA 1OKZA 4FV9A 4QT1A 3TNPC 4ACMA 5FEEA 4CFUA 4EQCA 2PSQA 4W8EA 5IA3A 5J87A 5KKRC 4KBKA 5AR8A 4P2KA 5TF9A 4QMSA 3HAMA 3BQCA 5BYZA 1WBNA 4YC8A 3ZBXA 4NWMA 1SYKA 4FSMA 4PDYA 1ZY5A 5KZIA 3UNJA 3HRBA 2PUNA 3OEFX 4FEUA 4ZTNA 3RAHA 4ZSJA 5TE0A 1HCLA 3E92A 4XS2A 4CFMA 3AC5A 5HD4A 4YMJA 5AJQA 3GCVA 2P55A 4QMQA 2CGVA 3CPBA 3HRCA 5HO8A 4A9YA 4DFLA 2A27A 4BDFA 5DNRA 1GZNA 3HDMA 1Q3DA 4J7BA 2IPXA 1WBSA 3EN6A 4WD5A 2YISA 4GYGA 3H0ZA 2Z60A 4ZTRA 1UU3A 3BHTA 5CYIA 4CKRA 4YZDA 4S31A 3LKMA 4YURA 2XEZA 5J5TA 2J0MB 5LJJA 5TT7A 3FY0A 3ZEPA 1ZAOA 2OFUA 1FGIA 3QRJA 4XHKB 2UUEA 2JFMA 4BWPA 4U6RA 4FOBA 4XBRA 5CZIA 2VTHA 2PVHA 3C4WA 3OTVA 4PL5A 1IA9A 4WG4A 3ATTA 4RJ3A 5HLWA 5E1EA 4BCMA 4NZWB 3BE9A 4QTEA 1JKKA 5L4QA 4NKAA 1S9IA 3EQPA 4BDBA 3R9OA 4HYUA 2XNNA 2ZB0A 3Q5IA 1K3AA 1P4OA 5LCKA 4USDA 5CY3A 3TKHA 1DM2A 3A2CA 4TKSA 3RJCA 5AX9A 3PIYA 4RJ8A 1KOAA 4YHFA 3MY1A 4CMOA 2YM8A 2OJJA 3OY3A 4Y5HA 3W2SA 4BTFA 3RALA 3RTPA 4QP6A 4FTAA 2X4FA 3UIMA 1A06A 4H3QA 3GUBA 2XYNA 4J96A 4I93A 4WBBB 4C7TA 3NW6A 4CVAA 5FTGA 4R78A 4O0UA 3SOAA 2BIYA 4DG2E 1ZARA 5A46A 3ULIA 1PJKA 3EL8A 2OGVA 4KS7A 2WMSA 3BV2A 4JR7A 2OU7A 4JDKA 4TNDA 2VGPA 3WARA 4R5SA 2PMNX 4EONA 2W7XA 4F1MA 2UZDA 5IA2A 5CQUA 3R7YA 4DN5A 4PV0A 5BVFA 4NYEA 3ZFMA 4DGMA 3ZEWA 3VUGA 3GGFA 3NX8A 4L9IA 4RZWA 3T8OA 4MKCA 4WNMA 3LPBA 3Q9XA 3GQIA 3BE2A 5CSVA 2IW9A 2IWIA 1AD5A 3TIZA 3CLYA 4C36A 1XH7A 4F99A 5IU2A 4GK2A 3WYYA 3LIJA 4AE9A 4F4PA 3R8ZA 3GC0A 3GVUA 4L45A 3TTJA 2ZM4A 5HVYA 3LCSA 3R9HA 2HENA 3FHRA 3QCSA 3VHEA 2G2FA 4FTIA 4O1PA 2O63A 4TL0A 1XH5A 3QL8A 3S0OA 3UC4A 2UW7A 4FKGA 4FODA 4I4EA 2A19B 5HG9A 4AFEA 2ONLA 4EJ7A 1GZOA 3P7AA 4XG9A 4YJQA 1MP8A 5HOAA 4EK5A 3VBXA 2QVSE 1H07A 4LL0A 5HTBA 3NYOA 2X7OA 2ZV7A 2XJ1A 4NFMA 2ONLC 3OMVA 4M66A 5LXMA 3DFCB 5JZJA 4H58A 5A6NA 4DF3A 3TDVA 2W4KA 1YXSA 5D41A 1OVEA 3KF7A 1JKSA 4JOAA 4KIQA 3D7ZA 3AMYA 3F88A 2O2UA 2QLQA 2JIUA 5CSWA 4XX9A 4YO4A 5BUJA 4CG9A 4ITHA 5A4QA 3LCKA 3KGAA 4BDHA 4CT2A 3SGCA 4L44A 4FSZA 3FI2A 4GSBA 5HNIX 3ORIA 4ZTSA 3VNTA 2A0CX 2DWBA 2WO6A 3DGKA 4EH7A 2ITXA 4RFMA 2W1IA 3QTIA 3JY9A 3C51A 3QZGA 1BL6A 5LMAA 4C2VA 4DEEA 4FZFB 2GHLA 4I1ZA 4AN9A 4R77A 4CMUA 1JSVA 2FH9A 2VTJA 3LFEA 3T9TA 3D94A 4FKRA 2Y4IC 2C30A 3GCSA 4IZ7A 5M07A 3FE3A 2JD5A 3NUSA 3Q32A 1H1QA 4FTUA 5IMXA 1UNLA 4KUJA 1YI3A 3VRYA 3QXPA 2WTKB 5JT2A 4TNBA 5IKWA 3L8VA 4EC8A 3V5PA 1APME 5EH0A 2BPMA 3LZBA 4MF0A 3G0FA 4OTDA 3IGOA 4ASDA 2J5FA 4APCA 3DKCA 3ZUTA 4DT9A 4WA9A 3BGPA 3O71A 3OWKA 2ZDTA 1G3NA 1Q3WA 5AUYA 3VBYA 1ZYSA 3DJ6A 2CKEA 5GNKA 2W17A 3PIZA 2WAJA 3UGCA 3WF8A 3PFQA 4Z3VA 3VS6A 3TZ9A 4MVFA 1HOWA 4R6VA 4DEAA 1BKXA 2GS7A 4IMYA 4O6EA 4AA5A 2VNYA 4D28A 4J8MA 4EH2A 3GEQA 3QTZA 4APPA 2B55A 3NGAA 3KF4A 2IVUA 3PWYA 4DFYA 5FWKK 4GFGA 3RK5A 4YJSA 4XCUA 3VUDA 4C02A 2VTRA 3UTOA 3DA6A 4BY9E 3RI1A 3D15A 4HPUE 4HGTA 5AV4A 2J4ZA 3MFTA 5AUTA 3F9NA 3QKLA 4DLIA 3BIZA 3PLSA 1OKYA 5EI6A 1ZOEA 5ETCA 4OT5A 4B8MA 3BZ3A 3FZTA 3HVCA 2JIVA 5ETAA 4H3PA 4KA3A 2RFEA 3F7ZA 4RLLA 4AF3A 3S00A 2PUPA 5M08A 3F5GA 3IONA 3FZPA 2XNEA 1GIIA 1KOBA 5K0KA 2HXLA 4E7WA 1SMHA 3V5WA 5IH5A 5M57A 2ITTA 3LE6A 4G3FA 3DAJA 2BILB 5LWNA 4I23A 3ZYAA 2UW9A 5IUIA 5AR3A 2XCHA 4FYNA 2FSMX 4XLIA 5I9ZA 4DTBA 3U6IA 1J3HA 2J0JA 3MSSA 1BUHA 4M15A 5DR9A 1PY5A 3FXXA 4U97A 4W4VA 4E6CA 3KN5A 4PTEA 5JFVA 2NPQA 1XWSA 1E1XA 2B0QA 4U80A 5AM7A 4BDEA 2C1BA 3W2PA 3ZHPC 3SA0A 4QTCA 4FTRA 4HVIA 5KMNA 5M4FA 2OZAB 2GMXA 4RA4A 4JRNA 2CGWA 3A62A 1JAMA 2WFYA 4OBOA 1QPJA 4FNZA 3R73A 3VJNA 5EKOA 4MTAA 5M53A 1YVJA 2YLEA 5FEDA 4CT1A 3GCQA 4RRVA 3GXLA 4H1JA 3ZM4A 1TQMA 3QBNA 2XKEA 4RSSA 4S34A 4B9DA 2UW0A 4UV0A 2C6KA 2J9MA 2QKRA 5CS6A 3II5A 3IW6A 3JS2A 3ZH8A 3SXSA 4DEHA 5KHXA 5A54A 4DH3A 4F0IA 4IWQA 3E8EA 4XV1A 3R04A 5G6VA 1WBTA 2PZYA 1CTPE 4MD7E 4D0XA 5EQPA 5BYLA 2H34A 4GG5A 2FSOX 3MWUA 5C27A 1W7HA 3FQHA 5LVLA 3BU3A 4QP9A 3GQLA 1JKLA 4DE4A 5CU4A 3GC7A 3RZBA 4BCHA 1Z57A 4IWDA 4J52A 1YHVA 4I24A 3MPAA 3GU8A 3HMPA 4C3PA 3TG1A 4AZTA 3BWJA 2YAAA 2RIOA 2JC6A 4KKEA 4FTNA 4GT4A 3P78A 3ALOA 1ZXEA 3BKBA 3ORMA 1RJBA 4NEUA 3AC8A 3UNKA 3PPZA 2W1CA 4IAYA 4JQ7A 4I6HA 5HG8A 4DH5A 1PXKA 3HEGA 4MF1A 1Z5MA 3LFBA 2OSCA 4D1ZA 2OJFE 5DRDA 2G2HA 2HW6A 4TXCA 4FT7A 3VW6A 4RMZA 3UYTA 2UZUE 5ANJA 1Y6AA 4UZHA 4BYJA 3UIBA 4ZZNA 1MRYA 5ETFA 4QPAA 4QP2A 3UQFA 4AAAA 4HVDA 4U42A 5HX6A 2X6EA 2YIWA 3KFAA 3V8TA 4FIEA 4XP0A 2W06A 4O0YA 5J95A 3I79A 3R30A 5AP2A 3I5ZA 4EOIA 1RQQA 1UU9A 3MVMA 4GUBA 4O1OA 4X3FB 5JGAA 2WZJA 4YNOA 4FL1A 4ANQA 1JKTA 2BRNA 3NLBA 1YOLA 4D4VA 3IPHA 5EYKA 1ZYCA 4OGRA 2Y4PA 4NK9A 4V01A 3K2LA 4FVRA 2W4OA 5D7VA 4BWXA 3EZVA 1ERKA 2HY81 3Q04A 1YXVA 3AMBA 3RWPA 3ELJA 3B2TA
chains in the Genus database with same CATH superfamily
2R0UA 4HCVA 4GT3A 1U4DA 3RPSA 3P5KA 3UG1A 3EKNA 3B8RA 2WIHA 4BL1A 1IEPA 1P5EA 4F09A 2YDJA 3SRVA 4GVJA 3QD3A 4BTMA 5D10A 4CXAA 4PRJA 3TKIA 2XYUA 3IW7A 3JVRA 1XH6A 2UW5A 4GIIA 5K4JA 3EZRA 1GZ8A 1LEWA 5E1SA 5IA4A 4E5WA 3E7VA 4XG8A 5EKNA 1Q8TA 3QKKA 1UKIA 2VUWA 3CR0A 4C4HA 4F7JA 2R9SA 5IISA 3S4QA 3NIEA 2PK9A 5GJFA 2VO6A 4FOCA 4LRJA 5CT7A 3S95A 3AT4A 4FTOA 4AGDA 3DTWA 5JKGA 2I0VA 2O3PA 1J1BA 3ODYX 4EK3A 3NYVA 2BAJA 3GP0A 3BEGA 4ZJJA 4JS8A 5JFSA 2JAVA 1OIUA 3C5UA 3PSBA 4EZ5A 3UQGA 1OMWA 3A7FA 1XJDA 5DBXA 3ZO1A 2OIQA 5AR5A 4IDVA 2ZM3A 4L8MA 2C3JA 4M7IA 2PZPA 3R2YA 5CI7A 2CPKE 5H8EA 3MN3A 3JR1A 2YA9A 2YLFA 3UDTA 4HYSA 3NUYA 1W84A 1YKRA 4PMSA 1M7NA 2B4SB 2ZM1A 4ZSGA 4E4XA 2WB8A 4XG6A 2CDZA 2JKQA 5HX8A 3ZS5A 4W4WA 4E1ZA 2ETKA 3ROYA 3W1FA 4KIOA 4LGGA 2J90A 4BVUA 5HORA 5K0XA 3DK7A 5CSXA 3RVGA 3HNGA 4CG8A 2R5TA 4JBQA 4O0VA 4HYHA 5GJDA 1URCA 4FEVA 4YTIA 4DH8A 5AAGA 2F9GA 5KMKA 4ZJIA 2PMIA 4QTAA 1GAGA 1QMZA 4FTLA 4GMYA 5D12A 4FT3A 5EM6A 1WCCA 3RPYA 1OB3A 2VWZA 4RC2A 5EW9A 5HBJA 3LJ1A 3LJ0A 1YI4A 3OFMA 4LOPA 4ORKA 1OPJA 4EHGA 2BROA 2GNJA 3SXFA 3C4XA 2GU8A 1MUOA 3DNDA 1OL6A 4IVCA 3PY0A 3RPRA 3ZUVA 5EHLA 2R3GA 3BYUA 3QFVA 4JDHA 4BZDA 4HW7A 4GL9A 3VRZA 1OIYA 4O7LA 2P2HA 3C5IA 2XH5A 4FF8A 4CMTA 3VN9A 4YJOA 2J7TA 3E62A 3LFFA 3NVKI 3CKWA 4OTFA 2IJMA 3RKBA 5CQWA 5AMNA 2JEDA 1MQ4A 5TO8A 2O65A 2XANA 4EZ3A 3I81A 4JLCA 3MTFA 2R4BA 4L42A 3DQWA 3KB7A 4R1VA 2C68A 3LHJA 4KWPA 3F69A 2XBJA 3RPOA 2PPQA 4L68A 4D2TA 3EFJA 4USFA 5KZ0A 5E8SA 5HKMA 4L52A 4AN2A 3MGYA 5DT3A 2E2BA 3KXZA 3WOWA 2B52A 4MD9E 5HIDA 4WRGA 4O0XA 3FMLA 1A48A 3LCTA 2YM5A 3MA3A 4AW2A 4RX9A 3T3UA 5FEQA 2WMBA 3LVPA 3A7HA 2GHGA 3F5PA 4EOLA 2X81A 4QYGA 4HNIA 3LQ8A 2QHMA 3ZRMA 2Z7QA 3O96A 1KSWA 4MXAA 2QR7A 1W0XC 3A99A 3ENMA 3GOPA 3EQDA 5HE1A 1MRUA 5GZ8A 5CLPA 4E73A 2OLCA 1ZOGA 5EK7A 2YJRA 3SC1A 4ANMA 3GU6A 3QTWA 3D5UA 4AE6A 4E26A 4PY1A 3W0OA 4D1SA 4EC9A 3UPZA 4BDDA 1IAHA 3JPVA 5BUIA 4C3FA 5KHWA 3P1AA 1OL5A 5JFXA 4JQEA 5EI2A 4ANSA 1R1WA 2IVTA 4CCUA 1KE8A 5AP7A 5E92A 3AC2A 3O23A 5LARA 3ZOSA 4F9AA 4ACHA 1FBNA 3S3IA 4YO6A 1YHWA 4O2ZA 5FBOA 5CAOA 2C69A 4WG3A 4FBXA 3M1SA 1WBPA 2I0EA 2C47A 3G15A 1YHSA 4J71A 2OWBA 5EYDA 2PMLX 3VC4A 4BBMA 1B38A 1NA7A 2OO8X 4FSUA 3UOHA 1J91A 4JI9A 2J0KA 3IG7A 2XK9A 3CEKA 3DXQA 3NCZA 5DH3A 4AT4A 2JDTA 4AU8A 3QQGA 3CY2A 3VW8A 3CIKA 5L2SA 5LQFA 3LMHA 4FTMA 3WF6A 2BDFA 5IQHA 1ZWSA 3LOKA 3PJ1A 4LRKA 3VBQA 3ZRKA 2F2UA 4ALUA 4TZRA 4UYAA 3Q52A 4CCBA 3JVSA 4O21A 2HZ0A 3CGFA 5CVGA 4DFXE 5GIOE 5K5XA 4N57A 1R0EA 4A4LA 4YLJA 3Q4ZA 3BQRA 2ITZA 1H00A 2PZRA 4L43A 4JX3A 2YIYA 4U40A 2P2IA 4WNPA 3OXZA 4ZSEA 4E8AA 3TXOA 3HV3A 5HG5A 2C0TA 4TYGA 4O4BB 3W8QA 3FY2A 3PA4A 3K3IA 2JBOA 5L2WA 4CFXA 1PMNA 4PX6A 2EU9A 4IZAA 2YM6A 1WMKA 2YM4A 4L6QA 3PG3A 1H25A 5HCZA 3BLAA 3UVPA 2VTLA 1XBCA 3HGKA 3RAKA 3H0YA 4N6YA 4DFBA 4FL3A 4NIFB 3AD4A 4E4LA 3V5JA 3KA0A 3ZC6A 5HHWA 1ATPE 3EJ1A 4IX4A 1Q41A 2IW8A 2R3HA 1CKPA 4UWCA 3EN4A 3MVJA 1UNHA 1WVXA 4AQKA 5J9ZA 2BHHA 4F7SA 4P5ZA 4I6BA 1KV2A 3FXWA 3RHKA 3MB6A 1G8KA 3EKKA 5E8VA 3UG2A 4ENYA 1NXKA 4YP8A 4F08A 3KK8A 1UA2A 2WHBA 3PJ8A 3TT0A 4UXLA 4UXQA 3BU5A 3BCEA 2YCQA 3O0GA 3LAUA 5BVKA 5AP0A 2YWPA 3QZHA 4PDOA 5I4NA 1URWA 3C4EA 2Q0BA 4EYJA 4UYNA 5F95A 3PA5A 4FKIA 4W4YA 3T9IA 3ORKA 3ANRA 4G5JA 2BALA 4O4FA 1Y91A 2PVMA 3F3ZA 3E3PA 3EQFA 3EB0A 1PXNA 1PXMA 1LEZA 4IX6A 4JNWA 2YAKA 5CEQA 4FVPA 3EL7A 2JITA 2W5BA 2VTAA 3JYAA 3Q2MA 2WMVA 2UW3A 4MBJA 4UWBA 4RJ7A 4EOPA 2PL0A 4X2FA 1WVWA 4G9CA 2GNIA 1XH4A 2VTIA 3OBGA 4IE9A 3VIDA 4KS8A 5BVDA 3FZRA 1VLRA 2XJ0A 2R3MA 2ZB1A 4JG7A 5KBRA 3W0QA 2WMTA 5FTOA 3E63A 2BFYA 4GK3A 5L3AA 5CTPA 4QMPA 2CSNA 3OT8A 5C1QB 3R8VA 3DBQA 4D4YA 5EM7A 4H05A 2IN6A 2LAVA 2IEWA 5IUHA 3Q3BA 1VYZA 4O38A 3I0OA 2GPHA 2OZAA 1FOTA 5EFQA 1R0PA 2IW6A 2E9NA 2J2IB 2QHNA 2R3FA 3KXGA 3RAWA 3U9NA 5CSHA 3FMKA 3KRWA 2GFCA 3O51A 4ALVA 4D9UA 4EOMA 3TMOA 4I0TA 4QYEA 3DDQA 3QUDA 4DGOA 4MXXA 2OJIA 2PY3A 4GH2A 2YCFA 4MUQA 4G6LA 3BYOA 4QYHA 3FLZA 4FZAB 4BGHA 3CP9A 4TYIA 4FSWA 4DFNA 2VTMA 3L8SA 4FNYA 4UWYA 4W9WA 3S1HA 4EI4A 5EG3A 1STCE 3L9MA 3BELA 5CNOA 4FZ6A 4FI1A 5J9YA 1GJOA 2PVRA 3HZTA 4IACA 3C7QA 4E5BA 2YFXA 2ZAZA 2ETRA 2BDJA 3FMDA 3LXKA 4R3RA 3U8WA 3UE4A 4XOYA 5F4NA 2WEIA 3KMWA 4IW0A 4U7ZA 5EM5A 4BTJA 4O84A 5E9EA 2QO7A 3NYXA 2EUFB 3WZKA 2A98A 2UVYA 2OJGA 2F49A 2V55A 4ZZMA 3NIZA 4M0YA 4AWIA 2FO0A 4CYJA 5AP6A 2ZJWA 1JSTA 3VS3A 4TT7A 4DG3E 1ST0A 1UNGA 3G9NA 1FMKA 2OW3A 3KKVA 2UZOA 2HYYA 3OC1A 2YEXA 5ANGA 4NL0A 1Q8WA 3ZMMA 3QALE 4WSQA 3MH3A 4L00A 5HVJA 3U55A 5AIKA 4EK6A 2X0OA 2XIXA 3FKOA 5KUPA 3BHYA 1M14A 1Q4LA 3V01A 4QMXA 4YHTA 2V5QA 4DGLC 2NRYA 3EQBA 2WOTA 3F2AA 5FP6A 4ZZOA 3AKKA 1P14A 2PWLA 3UIXA 2E9OA 4YBKA 2GNGA 5ICPA 3UZRA 1M2QA 5AP4A 3O50A 4DEGA 3PZHA 4AXCA 1H0VA 4RQVA 2Y8OA 2YDKA 4I92A 1QL6A 1YOMA 2WTVA 3LCOA 1L3RE 2QD9A 4XUFA 4KBAA 4FG9A 2XIZA 3VUHA 2JKKA 4KINA 3ETAA 4I6FA 4QYFA 4FIHA 3C9WA 5JSMA 2PULA 4FA2A 3O8PA 2VWWA 3GT8A 4YLKA 4S33A 5E8WA 2GS2A 5HICA 5FP5A 3QLGA 2HK5A 4EJNA 4G16A 3RPVA 4RJ4A 4RJ5A 3IW5A 4E5AX 3A8XA 4X3FA 4BDCA 5KNJA 3QQKA 5HESA 4BJJA 3LM0A 5HO6A 4QMWA 3RCJA 5CEOA 4GU9A 4JXFA 2ZYBA 1GZKA 3A7IA 4AGWA 3ZUUA 4C8BA 3KEXA 3R7VA 4B7TA 5IEVA 1SZMA 2ZV8A 1JBPE 4D1XA 3TNIA 3FL5A 4MWIA 5JFWA 3LQ5A 3BHUA 4O7SA 4FRFA 4RIXB 5AFVA 1YWVA 3DCVA 3PA3A 4RIOA 1RDQE 4FTTA 5HLPA 4ZK5A 2W4JA 2J5EA 2XARA 1SNUA 5A4CA 5LVPA 4MXCA 3ZCLA 4UMRA 4ZAUA 5AA8A 4FKUA 3I6WA 2ERZE 5AAEA 2OF2A 2R2PA 4IAFA 3UBDA 4D2WA 3H9FA 5IPJA 4ASXA 4AXAA 5CEMA 5F1ZA 3F5UA 3ZXZA 4BIEA 3QGWA 4U8ZA 1KWPA 2XM8A 4OBPA 5EYCA 4KRCA 4MWHA 3PG1A 4DCEA 5IMEA 2C6OA 4LUDA 3W2QA 5KCVA 2REIA 3Q4UA 3CS9A 1PMUA 3DQXA 4MNEB 3CD8A 4TYEA 3FPMA 4QMYA 2GDOA 3OCGA 5HCXA 2WTDA 5BQ0A 4FV4A 1OUKA 3U9CA 2CNVA 3NAXA 3UC3A 4RFYA 1JLUE 3LFQA 3P86A 2BRBA 4BDGA 5JMSA 4FEWA 3PIXA 4PNKA 4D2RA 4ZTLA 1F5QA 4FEXA 3POZA 2R3LA 4G31A 3ZSHA 3BX5A 3HV7A 1V1KA 3IOKA 4EKKA 3TTIA 5KMJA 5CF5A 1O9UA 4A06A 1PMVA 3EYGA 3KXNA 4K6ZA 4PWNA 4YGAA 3G51A 4BI2A 4QYYA 4CQEA 3SOCA 1W98A 2NRUA 3OWLA 3QKMA 4RX5A 3JY0A 3AD6A 4DG0E 4OAUC 3O5AA 4LI5A 2BRHA 2UW4A 4RLKA 2BHEA 5HO7A 4ZY6A 5AEPA 4RT7A 2X0GA 4QPSA 3DTCA 5L8JA 4C34A 5BNJA 1OM1A 2QO2A 3QD4A 1VYWA 1FINA 3NCGA 3CTJA 3TWJA 3PTGA 3SV0A 3V8WA 1DAWA 5IF1A 3QHWA 1RE8A 2W9FB 5C8NA 2AYPA 4IX3A 3UO6A 2QLUA 5AA9A 1WFCA 4FNXA 1W82A 4LGHA 3A7GA 4FV6A 2BAQA 4EHVA 5DEWA 4DGNA 2I1MA 3RMFA 5E7RA 2CKPA 3PXYA 3FC2A 3FSKA 4OTHA 5DWRA 3NS9A 4CD0A 1OL1A 2Y7JA 2JDSA 2WMXA 3BYVA 3D5WA 4LGDA 4P90A 5T6KA 2Z7RA 3NW5A 4UZDA 4BI0A 2UZWE 1TKIA 4OLIA 2XUUA 1AQ1A 3V6RA 4RVKA 3PPJA 4BDKA 3DT1A 5H2UA 3IDPA 1PXLA 4HNFA 4U3ZA 1S9JA 2XZSA 5HBHA 1MRVA 4ZLYA 3W0PA 4WRSA 2PZIA 2WEVA 4FKPA 4NJDA 3PE2A 2J6MA 2GSFA 2PHKA 1H0WA 3R7EA 3FQEA 4QDVA 3FLSA 3NSZA 4FKWA 2ITYA 3E93A 3ZZEA 1ZY4A 3EQRA 1M7QA 4IBMA 4OBQA 3QUPA 4OW8A 4BGQA 4GVAA 2B9FA 3NFGB 2X2KA 2VTPA 3O7LB 4LOQA 5AP5A 4J53A 3NFFB 3CQWA 4UY9A 5E4HA 5DR6A 2R3JA 3G9LX 4BCIA 4F9YA 5M4CA 4C57A 2YIRA 3KU2A 3QYZA 5DT0A 4D4RA 4OTRA 4CGAA 4YC3A 3I7BA 2E9VA 4YZBA 3R00A 4RA5A 4UMPA 2V62A 3IO7A 4M8TA 3R1QA 2PE0A 4QPMA 2W0JA 4ZLZA 5LVMA 2VX0A 4RBLA 5IH6A 3UYSA 1SVEA 4LFIA 3VBVA 2YM7A 4RVLA 2W99B 3GOKA 4EYMA 3DOGA 3IGGA 3G0EA 4G5PA 4MK0A 4YJTA 5AR2A 4B99A 3MH2A 3DBFA 4HOKA 4Q5EA 4BI1A 2P4IA 2BZHB 4MD8E 5HE0A 4U3YA 3A7JA 3F3WA 3F82A 1XKKA 5HVKA 5JQ5A 3BEAA 5LWMA 4O4CA 1Z9XA 3PVGA 4PDPA 3LFCA 1DS5A 3AQVA 3FI4A 2YJSA 5HU3A 4IAKA 1JNKA 1BYGA 4HCUA 2PZ5A 4M67A 2QI8A 3VQUA 4WO5A 3D14A 3WZDA 4EH6A 2HWOA 2XK8A 3R02A 3SXRA 1ZMVA 3W0MA 5T3QA 2VX1A 3BWFA 1CSNA 4JJRA 5DG5A 5BMSA 4LM5A 3HL7A 4OTPA 5HE3A 4PP7A 5EDPA 4O7ZA 2PTKA 3KC3A 5LMKA 2VX3A 4RX8A 3VJOA 3C1XA 4BDJA 2CKQA 2VZ6A 2WTIA 2X4ZA 4A9TA 4FX3A 3UOKA 3F3UA 3OWJA 5H8GA 4BCQA 1P2AA 2PVNA 1CMKE 2HELA 3BLHA 4MXOA 3N51A 5IUGA 5LMKC 3FEGA 3VBWA 1WBVA 4FT9A 3OEZA 5A9UA 2GQSA 5FTQA 4MNFA 1OPKA 3W33A 3G5DA 2R3KA 3PVWA 3PXFA 4K8AA 4BCNA 5DEYA 2ITVA 4A07A 3TZ7A 3RM6A 4LUEA 3MV5A 3D83A 3T3VA 3GI3A 3KCFA 5CAVA 3NUXA 5J9LA 3CY3A 1H1SA 3TZMA 4BIDA 1IG1A 4EKLA 2VWXA 3D5VA 1NVSA 1B39A 5KKRB 2W1EA 2F57A 4ZS0A 2BTSA 3AXWA 2NYAA 3NWWA 4LRMA 5JH6A 3BLRA 4K11A 1LP4A 3GENA 2XIKA 2BCJA 2CMWA 2FYSA 3DK6A 3KK9A 3OS3A 5DE2A 2JFLA 3GC9A 3IW4A 4I0SA 1Q24A 4KAOA 4CYIA 3TUCA 1H27A 1ZMUA 2QOLA 1QPCA 3EFLA 2F7ZE 3BGQA 2QC6A 4IB3A 4CV9A 4ERKA 4FJVA 4D0WA 4G1WA 5F9EA 3EN5A 2GS6A 4CZUA 4MQ2A 1CKJA 2ITOA 3FMJA 3FYKX 1H1RA 3L8PA 2PMOX 2XNOA 4YNEA 5AR7A 4CEGA 2QONA 3NEWA 3P0MA 3KCKA 3UPXA 3E5AA 2OICA 4JL9A 4X21A 4ZMEA 2J0LA 3QTRA 4NIFA 2P33A 4HVHA 1KE5A 3C13A 3CE3A 4QDEA 5A4TA 3LFDA 4IWOA 4IAIA 4DGGA 1W2CA 5HNGA 2DS1A 4YTFA 2RL5A 4CRSA 3DDPA 2NNWB 4TWOA 3SX9A 3C4FA 3F5XA 4R7IA 4EHZA 1Y8GA 1CDKA 4BR3A 1TQIA 2WGJA 3V5LA 3QGYA 4AUAA 3KREA 3UZTA 2QOHA 3FMMA 1YOJA 2Z7SA 3VHKA 3Q9WA 5HU9A 3AGLA 4HPTE 2V22A 3PRFA 4AN3A 3UP7A 3TL8A 4FICA 4JR3A 3L1SA 4I3ZA 4FEQA 4BDIA 5DA3A 1T46A 4C3RA 4QD6A 3OOMA 3QTUA 4A4OA 5L2TA 1F0QA 4EOOA 1Y57A 4X2KA 3VQHA 3GU7A 3KVWA 4IVDA 4JQ8A 4UALA 4I20A 1QCFA 4AOTA 2WMRA 4S30A 1M2PA 1I09A 2VRXA 3GCUA 4LL5A 4XV2A 3DKFA 3QRKA 2GTMA 2XK3A 3KULB 1Q99A 3U6JA 2J51A 4L3PA 1GNGA 4FIFA 2PYWA 2ZV9A 3OUNB 2JDVA 3A60A 3KVXA 1XR1A 3ANQA 4IC8A 5AX3A 5HBEA 4YSJA 3FI8A 1PHKA 5AUUA 4PPAA 3R7UA 2PE1A 3CD3A 4Z9LA 4CZYB 4YJRA 4YBJA 3BBWA 5GJGA 3FWQA 1SM2A 3V5QA 4CFFA 3UO4A 4IVBA 2W96B 3OVVA 4QQJA 1XH8A 3HA6A 4O0RA 3BL9A 3GBZA 3GC8A 2Y6OA 4FSRA 4JBPA 4O6LA 3FMEA 2GNHA 3PVUA 4GW8A 3UNZA 2DQ7X 3TJCA 5J1VA 3E87A 5AADA 3FHIA 4JBOA 2RSVA 2ERKA 2YHVA 2BRMA 4IXPA 5HEZA 5E8UA 2YZLA 2IZTA 3A8WA 4L46A 4W4XA 5CWZA 2QOCA 4ZSAA 3E8DA 2XK4A 5JGBA 3DLZA 2BZIB 5J7BA 4DTKA 3RCDA 5CI6A 2C6MA 4ANLA 1YRPA 4GT5A 3CKXA 3ZLSA 2W1FA 4NM5A 3H10A 4BN1A 4F7LA 2VWBA 2VAGA 4FT0A 4RVMA 5BV3A 1KE9A 2JKMA 1WBWA 2ITUA 4YHJA 5HIBA 2O5KA 5EDRA 3H9RA 4R5YA 5CVFA 5AUWA 4AW1A 5J79A 5L6PA 1KUTA 2QR8A 3K54A 2V7OA 4IDTA 3RP9A 4EUUA 4LOOA 1TZDA 3LXPA 3OXTA 3QC4A 1JVPP 4DEBA 2H8HA 3IW8A 3WF7A 4XG2A 4IZ5A 2C6TA 4QNAA 4XV9A 2HW7A 5EDQA 3OCBA 5IA1A 3FJQE 1QPDA 5I9XA 3LLAA 2ITNA 4AX8A 5E91A 3ORLA 4XEYA 4ITJA 3BYMA 3ITZA 3QQJA 4GJ2A 4LMNA 3IECA 2W1DA 2Q83A 4X7QA 2HIWA 1FQ1B 2IVSA 2YIQA 3I0QA 3QTXA 4BDAA 3TEIA 4RX7A 4D5HA 5BPYA 3VUTA 3AT2A 2R3OA 2EXMA 3C4CA 4CTCA 3FLQA 2W9ZB 4K0YA 4QMVA 4YZCA 1FPUA 2AC3A 3W16A 5K4IA 2ZDUA 4DC2A 4RC4A 2X9FA 4G2FA 4Y46A 2OIBA 4ENXA 5IQFA 4LG4A 4E3CA 2BFXA 3LMIA 5IDPA 2UVXA 3U4WA 5L6WL 4H1MA 3KRLA 3ACKA 1ZOHA 3LXLA 2P0CA 3MJ1A 1M2RA 3TV4A 2Y4IB 3FL4A 4IM0A 3QF9A 4S2ZA 5E8ZA 3R8UA 3W32A 2OXYA 4QQTA 4A9RA 3EWHA 4AOJA 4NM3A 1OL2A 3L9PA 4EQUA 2UVZA 3SW7A 3P08A 3W8LA 3KXHA 3HV5A 4XBUA 2XIRA 2XNBA 3DXNA 2OF4A 2UZEA 3HMOA 4I5CA 4L53A 3W55A 3QA0A 4QMUA 3WBLA 2ITWA 4FG8A 5CALA 5I9YA 4DHIB 3ZFYA 4TPTA 4NSTA 4WUAA 3HDNA 3F3TA 4FKQA 4FGBA 4ACDA 4FE2A 1MQBA 2YIXA 2VNWA 4H3BA 1ND4A 3A4OX 2A1AB 3AD5A 5IQBA 4ZY5A 4BCOA 4YR8A 4NTSA 4GKIA 4RIXA 3PDTA 4WUNA 2C6EA 3S2PA 1JQHA 2OZOA 5JRSA 5DMZA 2IZRA 2AC5A 3AC3A 3CPCA 4MXYA 1SVHA 1WZYA 3I60A 4EHEA 5B2KA 3ATSA 4XP2A 3NYNA 3Q6UA 4AQCA 4F6SA 3WIKA 4O86A 3KQ7A 1V0BA 3RINA 4FIGA 2IVVA 4BF2A 3PJ3A 5LOHA 5I3RA 1LPUA 2CNQA 1OUYA 1BI8A 4KABA 4Q9SA 1BL7A 3PPKA 4HCTA 4MNEA 3G90X 2ITPA 4MX9A 3VUIA 3A4PA 4FT5A 3NDMA 3EFWA 3EOCA 1TVOA 5ANOA 4BBEA 3EQCA 1G8AA 3NNWA 4GKHA 3KRXA 2G1TA 4XG7A 3FDNA 3FV8A 3M2WA 3IKAA 4O96A 3R7GA 3IOPA 2W1GA 3O7LD 5I9UA 2XBAA 3UOLA 1Q97A 3HV4A 3FKNA 3C50A 3R22A 4AZSA 1OGYA 3Q60A 1JPAA 2C5OA 3P23A 2NO3A 3OUKA 5M44A 4LV8A 3P5JC 4XV3A 4D4SA 3AKJA 2OG8A 2C6LA 3AMAA 4IADA 3UVQA 4XP3A 3VVHA 3V04A 4PMPA 2XAMA 5HTCA 2WQOA 4UMTA 4R8QA 3FBVA 3DS6A 5HG7A 2VTQA 2R64A 5CAQA 1HCKA 2C1AA 2WQEA 2WU6A 1IA8A 4HZSA 2X1NA 4I22A 3VO3A 4AW5A 5B2MA 3GFEA 2B7AA 2I0YA 4FV0A 4U9AA 3TN8A 4TYHB 4FZ7A 4EOSA 2ZVAA 5FM2A 4G3EA 4U45A 3MH1A 3LQ3A 3R9RA 3Q4CA 3SD0A 3NNXA 2PVJA 3MPMA 4J1RA 4M14A 4FYOA 4AXDA 4A9UA 5M51A 3MVHA 2LGCA 3SDJA 3HUBA 4F1OA 5D9HA 2X39A 5IEXA 2OIDA 3TZ8A 3R71A 3BPRA 5IZFA 5DR2A 4DHFA 2GCDA 4FV5A 3RHXA 4EL9A 3HRFA 3TM0A 4I5PA 3L8XA 3QA8A 3NAYA 3M42A 4O82A 3KN6A 3QQHA 1NVQA 3TNQB 4G3GA 2BZKB 2GTNA 4BTKA 2QU6A 2OKRA 3ZONA 3ZSIA 3VS4A 4BWKA 3QRIA 3QCXA 4F64A 4KNBA 4NW5A 2WTKC 2WMUA 3QQFA 2I0HA 4FKTA 1REJA 3V51A 3SQQA 4C0TA 2R3QA 5CZHA 3FXZA 4BKYA 4CZTA 4UEUA 4EEVA 3QHRA 4K2RA 2WMWA 3FC1X 5AV3A 5BX0A 1U46A 4BCKA 4EORA 5L6OA 2YCSA 3IDBA 4G6OA 3FMNA 1OIRA 3COMA 4M3QA 3VAPA 3C0GA 4EH4A 4GCJA 4C4EA 4IFGA 1G5SA 5ANDA 4OT6A 5GZAA 3D7TB 1VR2A 2IZSA 3ORXA 3WILA 4C4IA 4O81A 2PVFA 2KULA 3ZO4A 4GYIA 3COHA 1V0OA 3SHEA 4E4NA 3LCDA 2ZV2A 3MTLA 3QYWA 2Z2WA 4OTWA 1U54B 4YPSA 4C4JA 3DAKA 4OTGA 3ENHA 4I4FA 1REKA 5C8KA 1OI9A 3AKLA 3R01A 4FUXA 4ZOGA 2WQMA 4AZWA 2YERA 1EH4A 4QMOA 4FSYA 4C62A 3SG8A 1H1WA 4V05A 1H01A 4U43A 4HGEA 3OD6X 4CFVA 3WI6A 3QZIA 4NW6A 1OGUA 2BMCA 4FVQA 2BUJA 4I41A 4PL4A 2CGXA 4E6QA 3VWAA 4QMLA 5CXZA 4I6LA 1XHAA 3VF8A 3TACA 5DYJA 5LVOA 3TNWA 2XK6A 3ORPA 2F4JA 3QRTA 4P5QA 5FGKA 4DBNA 2VGOA 3TUDA 1J7LA 4V0GB 3OZ6A 4A4XA 2I7QA 4AOIA 4KKHA 5E8YA 4F9BA 3PXRA 4QTDA 2CGUA 4RQKA 2SRCA 3N9XA 4FSNA 4XG3A 4ZJVA 5EQYA 4U0IA 1PXPA 3R9NA 3RK9A 3UQCA 2FB8A 5CNNA 4YZMA 3ZDIA 3VS7A 1LR4A 4NKSA 5KMLA 3W2CA 5DPVA 2R3NA 2VTSA 4CLIA 3COKA 3MH0A 3CGOA 1K2PA 1O6LA 2PUUA 4UBAA 2EB2A 3QQLA 5DLSA 3MESA 5HQ0A 4FKSA 5DGZA 2YM3A 3FI3A 3U51A 3DKOA 4IWPA 3FMHA 3KMUA 4Y95A 4I5HA 3IQ7A 4YPDA 4RIWB 4PP9A 4FKJA 4LQMA 5T68A 4OUCA 4ANOA 4P7EA 3IS5A 3FLYA 3PWDA 1Y8YA 2QQ7A 3AOXA 3L9NA 3OW3A 3QD0A 1VJYA 4GEOA 4N4SA 4YJVA 4BIBA 2CHLA 2ZOQA 1Q62A 2AUHA 2JDRA 4MYGA 5KMIA 4F9CA 3R1NA 3R28A 5JZNA 5E90A 1FMOE 2B9HA 2RG6A 5EHYA 3PE1A 4NT4A 4UMQA 3FSFA 4FG7A 1PXOA 4OTIA 5F20A 5A4LA 2XJ2A 4ZSLA 4EUTA 5FXQA 3U4UA 5ETIA 3PXZA 4QMTA 3UP2A 2AQXA 4DYMA 4QP8A 5HNBA 5IQGA 4I94A 4WNOA 4IAZA 3SG9A 4DITA 3ROCA 2GFSA 4KSQA 4F6WA