5AP2A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
279
structure length
256
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 256
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap2A01
2OXXA 2C5XA 3TNPC 4CMTA 2O64A 2ZB0A 2FO0A 3R6XA 4NJ3A 3PPJA 2GPHA 3QHWA 4YC8A 4WG4A 3OMVA 1G8AA 5EQPA 1ZRZA 3AC8A 3CGFA 3ENMA 4JIKA 4FGRA 5CENA 5C4KA 4FV0A 4M12A 4BCFA 3E7OA 1IA9A 5IZFA 4BCIA 4U0IA 2G2HA 3NUYA 3LJ1A 4DG3E 4AGUA 4PDOA 4X0MA 4FV1A 5G1XA 2YZLA 2ONLC 3EZRA 4QTCA 5D7VA 5HI2A 3QLGA 5AP6A 3DT1A 3CKXA 3V5TA 2QOIA 2W1DA 5AAGA 3TDWA 4D1ZA 2OKRA 3HNGA 5AP7A 3UMXA 5A9UA 4CTCA 3HA8A 2PVYA 3VUDA 4XOYA 4UZHA 3BLQA 3G5DA 4FYNA 1JLUE 4LUDA 4L8MA 3TXOA 3VF8A 3R00A 4DFZE 2F49A 3C0HA 4F09A 4LRJA 3R9RA 2W9ZB 4TW9A 3I0QA 4ENXA 5IISA 4C34A 5HTBA 3UO4A 2VWIA 4FG8A 3V51A 3GENA 3EH9A 5I9VA 1PXLA 1Z57A 4PMTA 2PE2A 3P1AA 1BLXA 4C58A 4DFBA 4RJ6A 3U4WA 3CJFA 3DZOA 3PJ2A 3VWAA 3MFRA 2RFEA 4AQCA 4RX9A 1W98A 2OO8X 3HECA 4AUAA 4EK5A 3FLQA 3LLTA 1GZ8A 2QOHA 4EWHA 4WRSA 1YRPA 2B7AA 3S4QA 1KE5A 4F9CA 5C8MA 5L6PA 5CALA 3FI8A 2W5AA 4DBNA 3OCGA 1NXKA 2CLXA 5CEQA 4EH9A 3VVHA 5L3AA 4K8AA 5J8IA 3ERKA 5TF9A 3VS4A 1G5SA 3PRFA 4M0ZA 2ETMA 3AC2A 4Y95A 4FG7A 2XKDA 2OF2A 3AC1A 4QTAA 4ENYA 5KUPA 3NEWA 4IAIA 4A7CA 4WBBB 4M0YA 2Y7JA 2C47A 3GOKA 3DK7A 1H07A 1MQBA 2GMXA 3NVMB 3PSDA 4G3GA 1J1BA 3WZUA 3ATTA 1P2AA 1UNHA 2XNMA 4ZMEA 4CTBA 1K9AA 4L68A 2GSFA 2VX3A 4I4FA 3O96A 5ANJA 3PSCA 4O0YA 5BVWA 4F70A 4YBKA 5BVOA 4ALUA 3WE8A 2V7OA 4ERKA 5BVFA 4KUJA 5C8NA 3KEXA 5CU4A 5ETIA 1BKXA 2UW4A 3AMAA 2BDWA 3ORIA 3BYSA 4NM5A 3CQWA 4LOQA 3KRLA 3VS7A 3PIZA 4PTCA 4XS2A 1O6KA 2ITPA 3QRIA 3ULIA 3FBVA 5K9IA 3A7GA 4I6QA 2PUIA 3IKAA 3GCUA 4AP7A 4JDHA 5IQDA 3PJCA 3FLSA 4G3FA 4RSSA 4ZJIA 2RSVA 3A4OX 3EFJA 4RQVA 3FWQA 4O2ZA 3QUEA 4AGCA 3FLWA 4JOAA 3OUKA 1W84A 4F1OA 4ANNA 3IW7A 4KWPA 4L3LA 1V0BA 4FIHA 5C01A 1S9IA 2EVAA 4AOTA 3ID6C 4O0XA 5CWZA 4R7BA 4BDCA 4GKIA 3OTUA 4MYGA 3VUTA 3QRKA 5CLPA 5E8VA 4ZZNA 4O81A 4C62A 4KRDA 4KA3A 2XRWA 4YSMA 3VS2A 1Q97A 5CS6A 2AUHA 4NK9A 3PLSA 4JBOA 4RIWB 3P79A 4O7RA 2Y4IB 4FKSA 3DXNA 2WTVA 2YDKA 4IHPA 3COKA 4RWIA 5HD4A 1GJOA 4WUNA 4WUAA 1UU8A 4RWKA 2GCDA 4BICA 5LXMA 3IONA 2BR1A 2FB8A 5HBHA 4RIXA 1X8BA 3OHTA 5HE0A 5CF4A 2F7XE 4QMMA 1P4FA 2HY0A 3KVXA 3QQJA 5CXHA 4CFWA 4F7JA 1AGWA 5L2SA 3DQXA 3C4FA 3VN9A 3DY7A 4U7ZA 3ZSHA 2X8DA 3D9VA 4IM0A 2QKWB 3Q2MA 4WO5A 4QP9A 5AR2A 1XBCA 4O0RA 3D5UA 3OVVA 4QNYA 3VS5A 4IDVA 4RZWA 5KHWA 5M56A 2REIA 2Z8CA 4DEIA 4RGJA 1Q99A 1XH9A 3AG9A 2X4FA 4L3JA 4R6VA 2B9IA 5J7HA 3KN5A 4RJ3A 2XS0A 2UZVA 3FLYA 4OT6A 3EQBA 1O6LA 4P7EA 4QT1A 4HCTA 2Q83A 2OIDA 1PW2A 2VTOA 3PXKA 4J53A 4PPCA 3W18A 4DGNA 4RMZA 3E8DA 2ZOQA 4XLIA 3CR0A 4G5JA 4IFCA 5EI2A 1LP4A 2FYSA 4AW5A 3F5GA 4GU9A 4TY1A 4HYUA 2NRYA 3BWFA 2IVSA 5DT0A 1M14A 4NU1A 4IAKA 2GS2A 2ITOA 4TZRA 3ACKA 4R1YA 5DT3A 4E5WA 2VAGA 4YJSA 3D94A 5DRDA 4DEEA 4O84A 2R3JA 2QC6A 5IQAA 5AR4A 4GT3A 2C5VA 3GXLA 4JLCA 3OC1A 4OW8A 3WARA 4GUEA 1W82A 2QO9A 5T3QA 3FZ1A 3VBQA 4XG8A 4XMOA 3I4BA 4ZTLA 4FSWA 2JLDA 3A8XA 3P5KA 4X7QA 5CEMA 2R0IA 3UPZA 1URCA 3VHEA 3U6JA 2QHNA 3DB6A 4GG5A 4D2WA 2YM4A 3TACA 3NIZA 1YXSA 3UGCA 4CYIA 2C5YA 3K3IA 3G51A 4IC7A 1IAHA 3SG8A 4JBPA 4ZTHA 3WILA 4LMNA 5KMOA 3GC9A 4YZ9A 3R7IA 2JFMA 3KCKA 4PNKA 4IMYA 4I6FA 3D2IA 2R3HA 4LL5A 3WF5A 2VTPA 4EK3A 4JQ8A 3RM6A 4TL0A 1GZOA 2E9UA 3PXFA 5CSHA 4HVGA 3ZU7A 5HU3A 3S0OA 5BNJA 4F1TA 3UP2A 1GY3A 4WNMA 4YUQA 3RK7A 3NNWA 3CCNA 3WE4A 4TWPA 3LCSA 4JQEA 4BI0A 3ORLA 4RFZA 5GJFA 1M17A 5GZAA 2XK3A 5E4HA 2BUJA 3HV7A 4FG9A 5ACKA 4F9WA 5HVJA 3A61A 5IH5A 4RWLA 3BYOA 5GIPE 3PJ8A 4NM0A 3E8EA 4EQMA 4IZAA 5A6NA 5M06A 5EI6A 2F57A 4ZP5A 5C4LA 4K2RA 4FBXA 3W2RA 2OG8A 3C50A 4FL2A 2W1EA 3M1SA 4TXCA 4OTRA 3QTRA 4MKCA 3G15A 4DH5A 4CMOA 3NS9A 1UWHA 2QLQA 5L6OA 4EH3A 4BCGA 5DG5A 3ZFYA 5TR6A 5LWMA 2YCFA 1L8TA 3ZLYA 4XJ0A 4XH6A 5AX3A 3W10A 2J6MA 3QXPA 4IH8A 1W83A 1YW2A 3FQHA 3QZIA 5CASA 1YDTE 4EJ7A 4CKJA 2X9EA 2Z60A 1W8CA 4LRMA 2GU8A 4EBWA 5BYLA 5E9EA 1OGUA 3IGGA 2QU6A 4GSBA 2XH5A 3HV4A 5EYDA 4EH7A 3TM0A 4X2NA 4ONAA 4U81A 4G6OA 1CDKA 2XIZA 1OM1A 2CMWA 5AIKA 5FBOA 5FEQA 1U59A 3R8VA 3UYTA 4DINA 5I9WA 5DYJA 3HGKA 4AN9A 4PQNA 5DRBA 1YDRE 4WG3A 2ZM4A 2WTKC 4AZSA 5AADA 3FXWA 4EYJA 4YC3A 2YCSA 3DBEA 3ZO3A 4CD0A 1W7HA 2BPMA 1GZNA 4MVFA 5LCJA 3QBNA 4MWHA 3CIKA 4WHZA 4R7IA 3C4XA 3W2SA 3Q60A 2OGVA 4O21A 5HLPA 4I5HA 2FSLX 5ITAA 2I6LA 4BDDA 5JSMA 2WGJA 4N6ZA 3ZDIA 5IQFA 1H4LA 2QOQA 4FV3A 2XNBA 3IPHA 4RLLA 1OI9A 5CU3A 3LFDA 3E87A 3R2BA 4EOJA 4U40A 2I0EA 4IJPA 3C4WA 4NTTA 4E93A 4FTUA 2UVXA 3C5UA 3TJDA 2VTMA 3ORTA 3AD6A 2E9VA 5JN2A 3DKOA 4CQEA 2Y4PA 5CI6A 2C6IA 2GHMA 5AUTA 3LQ3A 3FI3A 3OROA 3FQEA 2C5OA 3NNUA 4LQMA 4B8LA 2FSOX 4QPAA 5FTGA 5AV0A 3M11A 4PV0A 5IQHA 3DBDA 4H36A 5D41A 4UMTA 3S95A 2W4KA 3TTJA 4FE2A 1CM8A 3D5XA 1ZYSA 4YJRA 4E26A 1PYEA 3QQUA 4YO4A 3W8QA 2QKRA 1H26A 3NYVA 3UOJA 4I1ZA 5HIBA 2BAJA 5LVPA 4CXAA 4DBXA 3BQCA 1U54B 3FYJX 3HKOA 2PUUA 2WAJA 3DQWA 3NUSA 4KIKA 4BWXA 4W4XA 2JAMA 2OJ9A 3I6WA 4G6NA 4TWOA 3FLZA 2ITTA 1UU7A 2VTQA 3MGYA 4ASEA 4CMUA 4PNIA 3HMIA 5BVDA 3COHA 3G33A 1BL6A 2GS6A 4IVAA 3ZBFA 3QQLA 3ENHA 3W2PA 2WIPA 5IUGA 2IVVA 4FTQA 1P5EA 4V01A 3RVGA 3COIA 4U97A 1UVRA 4UZDA 3D2KA 2IWIA 4BDFA 2X39A 2BDJA 3DKFA 1G8SA 2HIWA 4XV1A 1IR3A 5DR9A 2J51A 4ANLA 4E20A 2CKOA 1R1WA 4FVPA 3ZEPA 2OFVA 2PUPA 3ODYX 2VWZA 5AP0A 5HD7A 4ARKA 3DKCA 3QTIA 4KKEA 4C8BA 3CY2A 4RFYA 3F2NA 3P7CA 4Y72A 5DWRA 5HG9A 4L7FA 2KTYA 4L45A 2I40A 2X0GA 2YEXA 3O2MA 2QI8A 3BE9A 1NY3A 4G17A 4RIYA 5J79A 4GCJA 3ZZEA 5BVNA 4DN5A 4YLKA 3TNWA 2PMOX 3JY0A 2JEDA 3LE6A 3EN5A 2BROA 3HV3A 4FTTA 5AV4A 1Q61A 1SVHA 5FP6A 5I3OA 4EH6A 4F08A 3FE3A 4ASXA 3R9HA 4TWCA 1YQJA 2X6EA 3EYGA 3PVBA 2J0JA 3TN8A 2XJ2A 2YAAA 4C3FA 4CLIA 4GH2A 4D55A 4FSZA 4QO9A 4KAOA 5D12A 4FSYA 5EFQA 3S00A 5A6OA 2WQMA 1V0OA 2XCHA 3LFBA 4RJ5A 4E6QA 2ITXA 4PY1A 5HX6A 4YBJA 3PZEA 4EOLA 4IAYA 4HYIA 4A9TA 5HLWA 4M69A 4S34A 3TUDA 3FL4A 4R3PA 3CGOA 3DTWA 3UP7A 4MQ1A 3ALOA 3R63A 4BDHA 2QLUA 5DFPA 3VHKA 2W4JA 2W96B 2QCSA 3W32A 3HYHA 4FZAB 3K5UA 3VQUA 3LJ0A 3R8MA 2H96A 2W9FB 2X81A 2HY81 4JRVA 1ZOGA 4DGMA 5A54A 3G6HA 3O8UA 1W0XC 1ZYLA 2BHEA 4CFNA 4FKGA 4NYEA 3CLYA 3O8TA 4DT9A 5M09A 4B4LA 5ANKA 4I6HA 3L9NA 4RIOA 4ZLZA 4M15A 5CANA 5LVNA 4GK3A 1R3CA 5LWNA 3QHRA 3BRBA 3KMMA 1A9UA 2C0TA 2WMQA 3JY9A 4AZTA 1M52A 4BYIA 2VTHA 3NUPA 4JT3A 3DGKA 4GJ3A 2ZV8A 3B8QA 3LXKA 4EL9A 1J3HA 3EFKA 3G2FA 5I3RA 4F0GA 3QYWA 1UWJA 2R64A 3R0TA 4BCMA 3Q6WA 2VV9A 2Y9QA 4FZ7A 4JXFA 4K1BA 4QP6A 3R8ZA 5IUHA 2Z02A 1FVRA 2QR8A 2JIVA 5KMMA 2V0DA 3E64A 4BCPA 4QYHA 5F9EA 3QTXA 3ZFMA 4G34A 4FKWA 1Y57A 3PTGA 4GRBA 3BYMA 4I3ZA 5EOLA 3OY1A 4G9CA 4I21A 4BYJA 4GJ2A 4R5YA 5C9CA 3ZFXA 4BKJA 2VO6A 2CNQA 3A8WA 5JEBA 4EOOA 3QC4A 5EW3A 5BUEA 2QNJA 4USEA 3QQKA 3L8XA 5A14A 3NYOA 2E2BA 4PMPA 2R3FA 5C03A 4IBMA 1M2PA 3P7BA 3U51A 3ZRLA 4ACMA 5I9UA 4HPUE 5CF5A 2WFYA 1M7NA 4GUBA 5KMJA 3CKWA 5CU2A 4FTNA 2XKFA 4O1OA 4U43A 3GBZA 3UNZA 4AT4A 3AT2A 4Y46A 4EHZA 1NVSA 3A7HA 3VAPA 4Q2AA 2EB3A 4JL9A 4J52A 5E91A 3PVWA 5IEYA 5L6WL 2BKZA 3AQVA 2PMLX 2QVSE 4TYEA 2C0IA 4RJ7A 5D9HA 2GNHA 3LQ8A 3A7IA 3GU7A 4QMUA 4R5SA 2JDRA 5AAEA 3ATSA 2XNEA 3ZS5A 3DK3A 4A9SA 2ONLA 3OXZA 4IVDA 4TYIA 1IAJA 3P4KA 1QCFA 2X7GA 2LGCA 4HZRA 4RIXB 2X2KA 3C5IA 2B0QA 4C33A 4RVLA 4MXZA 2V22A 4EI4A 3EQIA 3VIDA 1PYXA 3R7YA 2I7QA 2VWVA 1GZKA 4YZCA 3IO7A 1AD5A 3LFQA 5M4CA 3F3VA 4BL1A 1M2RA 3U8WA 2PE1A 4DEDA 4J95A 3I1AA 3GI3A 2PY3A 4FK3A 3RKBA 2BIYA 2VWWA 5JQ8A 3H10A 4C0TA 2VTAA 2CDZA 5HE1A 2XNGA 2X7FA 2A0CX 5BVKA 1XBAA 1ZWSA 4EONA 4ORKA 2EU9A 2UZTA 4EKKA 3MWUA 1OECA 3F7ZA 2NO3A 2PZ5A 1JAMA 2ZV9A 5HNGA 2W1GA 2A27A 2C4GA 2QURA 3ACJA 3QALE 4IWQA 4M13A 5IA3A 3DCVA 3LZBA 1IRKA 2ZVAA 4YJPA 5M07A 4GIIA 3H0ZA 2F7ZE 3F2RA 3VQHA 2BKKA 4FTAA 3I79A 3ZONA 2GNLA 5HIEA 4O0WA 3QTWA 4IQ6A 4C2VA 4HVSA 3QUDA 5H3QA 4YJOA 4EUTA 3EQHA 4TYHA 3LMHA 2CLQA 3RI1A 3I0OA 2J90A 2XEZA 3GU5A 2HCKA 4X3FC 3QYZA 3C0GA 1E9HA 3WF7A 3QKMA 5EDQA 4BHZA 2YAKA 4MNEA 4BGQA 1YWNA 2G9XA 3DNEA 3BZ3A 1Q3WA 4FKQA 4YJQA 1WBNA 2VTNA 4TRLA 3RZFA 4BTFA 2W05A 3UIBA 3EYHA 4NSTA 4ZLYA 2CNUA 1OIRA 4GVAA 1QPDA 3Q9WA 4C35A 3EQPA 5CEKA 2E9PA 3FMEA 2PVLA 4QYYA 1R0EA 3VS3A 3UO6A 1I44A 3MPTA 4M8TA 3PDTA 4J97A 5HG5A 1J91A 5KKRC 2PU8A 3BLRA 3THBA 3FSFA 4TNBA 5KZ0A 3UVPA 4C4IA 4D0WA 4FODA 4PL4A 5EW9A 4O7ZA 4FV4A 3F66A 1K3AA 5M55A 4U41A 4RVKA 4H58A 1P14A 4FKVA 4I5CA 4D2SA 1YOJA 3EN4A 3MIAA 4MXAA 3MIYA 3C4ZA 4QTBA 4ZAUA 4RC2A 2CKQA 3N9XA 4QMOA 4BWPA 5CAUA 4KB8A 4HYHA 3HL7A 2JBOA 3OBJA 4RT7A 2WMTA 1FMOE 5LMKA 2CJMA 2CN5A 5IMEA 4AGDA 3QLFA 3KC3A 4MTAA 2UUEA 2JKKA 4XBRA 4BDGA 4I92A 2I0VA 5G6VA 3FPMA 3RK5A 4DE4A 4L7SA 4OR5A 4AN2A 2Y4IC 3N4VA 3BYVA 4YGAA 4QQCA 2R3RA 3DJ5A 4HVHA 4PUZA 4P5QA 4N0SA 2F9GA 1J7IA 2R3QA 4BCJA 3EN6A 3ORKA 2BZKB 5EI8A 3POZA 4YJTA 2CPKE 4V05A 4CCUA 2GQRA 3NW6A 3K3JA 4O96A 4ZTRA 4YU2A 3CD8A 3RWPA 4D4SA 4GV1A 3BX5A 3E7VA 2WHBA 4FL3A 5ETAA 4OLIA 2RKUA 4ACCA 1PXKA 3ELJA 3OXIA 2J0KA 2JAVA 3ZLXA 4D5KA 2WQEA 1XH5A 3HAVA 5I0BA 2DUVA 2PSQA 3NW7A 5M08A 4E1ZA 1ZYCA 3R30A 3HAMA 5JGAA 4E4XA 3MV5A 3NGAA 5DA3A 5JZJA 4AU8A 2XK7A 2QOCA 2C3JA 3QFVA 4BZDA 2JIUA 3SD0A 1UV5A 4ZJVA 4I20A 2YFXA 4JDKA 4AW2A 4QP2A 4MXCA 2Z7QA 3ORXA 5EKOA 3QRTA 2ZB1A 3SHEA 2BIKB 4FOCA 2NRUA 2C68A 3HP5A 4V04A 3UZTA 3LHJA 1SM2A 3Q96A 3FMNA 3H30A 2DYLA 3KXZA 3C13A 4MK0A 5AUZA 2XIXA 4L6QA 1H1RA 3VRZA 4EZ3A 2HZNA 4EK8A 5J5TA 4UALA 4ZY6A 3NWWA 4Y85A 2VNWA 4FEVA 2VTLA 2R3LA 3SG9A 1TQPA 1SVEA 2XP2A 4UEUA 4Y73A 5EYCA 5L2QA 3RNYA 1V0PA 4YPSA 1YXVA 4W4YA 4BBFA 2JGZA 4BCKA 5J5SA 1SMHA 1YI6A 1H24A 1WZYA 1XR1A 2OWBA 3C7QA 5IF1A 3DBCA 4FIEA 2YIQA 4OUCA 4YO6A 2VO7A 1H00A 5IU2A 1MUOA 5B2KA 4RLKA 2G2IA 5F20A 3AGMA 3ZDUA 4CG9A 5FBNC 3RPOA 3RPVA 3ORZA 3PP0A 4RA4A 4W9XA 4F4PA 4BCHA 2VO0A 5KMKA 1KSWA 2P55A 2BVAA 4ZEGA 1NW1A 2OIBA 4BBEA 3R9DA 2VO3A 3KMWA 4J71A 5HZNA 3ZHPC 3SW4A 3PSBA 4DFYA 2B9JA 2OJGA 3PJ3A 5HQ0A 4KIKB 3MPAA 4N4SA 3QU0A 5EQEA 3NW5A 3PY1A 4XV2A 5DEYA 4KRCA 4I0TA 2QHMA 4YLJA 2JFLA 5A3XA 4MF1A 4YJNA 2YJSA 4FKOA 5A4QA 2WQNA 2H6DA 5AEPA 1NT2A 4UWBA 5AIRA 5KHXA 2CCHA 5E8TA 2XYUA 1WBVA 4WNKA 4Y5HA 3DFAA 3HMPA 4NFMA 3FI4A 3QTQA 1H28A 2UV2A 4G9RA 4M7IA 3R7UA 3OOMA 4Y8DA 4Q9ZA 3H9FA 3NUXA 4PMMA 3RCDA 4XNEA 4XP2A 3BI6A 3WYYA 3BGPA 4QQJA 1WBWA 4YZBA 2J0IA 1ZY4A 4J8NA 3VUGA 3RAHA 4B7TA 3MFSA 1QPCA 3HP2A 4OTDA 2QO7A 4G3DA 3TV6A 1UKHA 2QOKA 5HCYA 2WTJA 5TO8A 1U5QA 2GHGA 1B38A 3FMJA 4FR4A 3SXSA 1PJKA 3VJOA 4C4GA 5A4EA 5KX8A 1OIQA 2RIOA 4RIYB 3OUNB 1Y8GA 4PL5A 2YIRA 4CSVA 5CAOA 5AP1A 1FINA 2ETRA 2UZDA 5F1ZA 4RQKA 4O83A 1KUTA 1GOLA 4FNXA 2F2CB 2I1MA 3MY1A 4RPVA 4ACGA 2CCIA 4OTGA 3BHVA 1WBOA 1YOMA 4AG8A 5HE3A 3EWHA 1JWHA 2PMIA 3VW6A 4OT5A 4RRVA 2VX0A 4ZIMA 4NL0A 4O7YA 4QQ5A 5FQDC 1NA7A 1URWA 2R7BA 1PMEA 2Y6MA 2Q0NA 2XUUA 3HDMA 5LOHA 5LMAA 3H9RA 4M69B 2ZM3A 4AAAA 5TE0A 3BQRA 4BKZA 5HNIX 4CG8A 4FI1A 2OI4X 3DV3A 4UWCA 2GTNA 3BV3A 4D28A 5HIDA 5CVGA 3LLAA 3PA5A 2RFDA 4XG4A 4TKSA 3OXTA 3NVKI 4Z7GA 4EQUA 2B54A 2VRXA 4KINA 3UTOA 4WSQA 4YHJA 2WPAA 2EWAA 4F6UA 3UIUA 1XHAA 2WNTA 2DWBA 3FL5A 3ZUTA 3IW8A 4BDAA 4BI2A 5KMNA 4FEXA 4YZNA 4AE6A 1Q8TA 4O91A 2WU6A 2AYPA 2HZ0A 4CV9A 3BLHA 5HCZA 2VNYA 5E1EA 4DYMA 5CAPA 4QYGA 3R1YA 4NCTA 4O7LA 5CQUA 1BL7A 3GFEA 4JX3A 3KF4A 5ANDA 4EK6A 2RG6A 1A48A 2BFXA 3AXWA 4MX9A 3W55A 5KBQA 4EKLA 4EEVA 5J7BA 3PE2A 3S3IA 4TPTA 3MPMA 3W8LA 1Q8ZA 2XRUA 2YERA 4D9UA 1WBSA 4FT9A 3SGCA 3IOKA 1HCKA 4H1JA 4I22A 3W2CA 4O82A 3SW7A 4Q5HA 1Z9XA 4H3PA 3PIYA 5GIOE 1O6YA 4FKJA 5LMBA 1Q41A 4JX7A 4KKHA 3MFUA 3ZSGA 3QZHA 4LMUA 1FGIA 5LQFA 3U6IA 4K11A 5EHOA 3BE2A 3KQ7A 4U42A 1ND4A 4UXLA 4MNFA 3UODA 2YJRA 2VGOA 3EQCA 1EH4A 1XH7A 5ETCA 1ZLTA 4LFIA 4W8DA 3NYXA 4AA0A 2C1BA 4PP7A 1SVGA 2E9OA 4KSQA 4YTFA 5F4NA 4FKTA 4BTMA 1LUFA 2YACA 4AW1A 3Q5ZA 4IXPA 4NIFB 4LUEA 5TKDA 4QP1A 4R8QA 5BMSA 2IG7A 3R1SA 2H34A 2QOFA 2XJ0A 3GCQA 5L8KA 3IDBA 2B53A 4IWOA 4O0TA 2V62A 4LV8A 3V04A 5EQYA 2XBJA 1ZAOA 2R3MA 5E8ZA 3D0EA 3ZO2A 4A4LA 2G2FA 3O50A 3QAME 4MXOA 2UZEA 3CJGA 3WF8A 2IZRA 2PULA 4P5ZA 1OKZA 3EB0A 4XYFA 4C4JA 1DAWA 4IC8A 4XHKB 5JGBA 2SRCA 5EOBA 4Y5QA 3SXRA 4BTJA 5L2IA 2J0LA 2R3OA 2W1CA 4O38A 3L9LA 5B0XA 4YTIA 4F7SA 2H8HA 2NP8A 4IADA 4PL3A 2B9FA 3V6SA 3DDQA 2PZRA 1RW8A 4G2FA 4DFLA 5TOZA 3IW6A 1GAGA 4EZ5A 4FIIA 3U6HA 2O65A 3I5NA 3PG3A 3U9NA 3UG2A 3V5WA 2IW9A 1FPUA 4F64A 3KMUA 3RWQA 2CKPA 3DXPA 4CFXA 3NDMA 2C6OA 4WNOA 3GU8A 3OF0A 3Q4UA 4I4EA 4LYNA 2YCRA 1H1SA 3PJ1A 1F0QA 3PPZA 3R21A 5AMNA 5HTCA 2C3IB 4FMQA 1H1WA 4BIDA 3F3TA 3NUNA 4I94A 1T46A 3D83A 5AUXA 2GQGA 4G3CA 2PZPA 5AM7A 1XKKA 3KK8A 3QRUA 4HCUA 4L42A 4RVTA 3DAEA 2XM9A 3FKLA 3LCKA 4TYHB 4UMQA 4A06A 3ORPA 3LFSA 1GIHA 3A7JA 5C27A 3BV2A 1ZMWA 3FY2A 2WELA 4MNEB 3MI9A 4CEGA 5GINE 3KRXA 3RBWA 3UVQA 2WIHA 3ZRKA 1YVJA 4OBQA 2EXMA 5AM6A 1S9JA 3ZC5A 1WCCA 5FXRA 4JJRA 3SAYA 4IEBA 4CKIA 5CSWA 5HLNA 4I24A 3UPXA 2XIRA 4MF0A 3HZTA 2YHVA 2C3KA 3IS5A 4MXXA 5B7VA 3TUBA 2IN6A 4FV5A 2C69A 3MB7A 4BZOA 3K2LA 3R28A 5L2WA 2W17A 3II5A 4L3PA 2X2MA 3D7TB 3DB8A 2RGPA 4NKSA 5JKGA 3GGFA 4KIQA 4MAOA 1JKLA 2Y0AA 3C51A 2QG5A 2PUNA 2UVYA 3LM0A 3M42A 4AA4A 5JFVA 4ZSLA 4XG3A 4CNHA 1YXUA 2XNPA 1ZY5A 3FMDA 3DDPA 2XZSA 2VTIA 4NJDA 4OGRA 3GCSA 3M2WA 3DBQA 4AZEA 2VU3A 2WQBA 3RPSA 2RL5A 4AZFA 4YC6A 4E3CA 3QX4A 5DPVA 2ZDTA 4DFNA 4EOKA 3NAXA 2OLCA 4ZJJA 5K5NA 3MS9A 4QRCA 1L3RE 2BZJA 2O2UA 3HRFA 2YM8A 3CS9A 4G5PA 4LOPA 2GQSA 4RX5A 2F7EE 4JG7A 2VUWA 3LIJA 4FTJA 4MWIA 3KKVA 3GU4A 4I5MA 2PVJA 2Z7LA 2WMAA 4B8MA 4HPTE 4LGDA 2CGUA 4RC4A 4O1PA 1V1KA 5DT4A 3IOPA 2QOLA 5IMXA 4B6LA 4FSUA 4FT3A 4EORA 4OTQA 5GHVA 4O86A 4AFJA 5HE2A 2BZIB 4Z55A 5IA4A 4EQCA 5IQGA 5CU6A 5L2TA 2ITNA 4HCVA 4S2ZA 2P4IA 3R8UA 5BX0A 4XBUA 3EQDA 2VWYA 2PL0A 1OL2A 4IAAA 3SOCA 4KS7A 4WG5A 4O7SA 3SDJA 3E3BX 2WMUA 3ODZX 3WZEA 4XX9A 3W2OA 5CEPA 2XMYA 2ZAZA 4QPMA 1IEPA 4OTWA 3ULZA 3V5PA 2YM5A 3VULA 4F9AA 3KL8A 1ZARA 3VS0A 2OJIA 4ANQA 1Q8YA 4JI9A 3BIZA 5LJJA 2Z7SA 3L8VA 4IAZA 5ICPA 4GU6A 3UMWA 4FV8A 1OBGA 2XM8A 5BVEA 1SNUA 4YJVA 5K0KA 5IA0A 1IA8A 4C4FA 2BDFA 4DG0E 4FX3A 2F4JA 4O2PA 4XUFA 2AC5A 4DEAA 2VWBA 2W7XA 1TVOA 4DTBA 1CSNA 1AQ1A 3H3CA 4FSMA 3O0GA 2WTCA 2XK4A 2BAQA 1PXIA 4KSPA 2C0OA 2HOGA 4ZK5A 5AR3A 4BFMA 2XNOA 1KV2A 5AP3A 1JOWB 3IGOA 1ZZ2A 3IQ7A 4DC2A 2WOUA 4JR7A 3OT8A 4O22A 1Q3DA 4D2VA 5HKMA 4BGGA 1PXOA 3BU5A 5M51A 1NVQA 3GCPA 4FT0A 4X3FA 3QX2A 4M67A 3SLSA 1OL1A 1U4DA 1OIYA 4OBOA 1PXPA 3PY0A 3Q32A 1MRUA 3EJ1A 4IAFA 5B2MA 3ZYAA 4JBQA 2W0JA 3FMHA 3NRMA 2GNJA 1OMWA 3WBLA 3SKCA 1H0VA 4C37A 3TI1A 3DLSA 4GS6A 3E88A 3QTSA 3JR1A 4FKIA 5HG7A 4EWQA 3V5LA 3AT3A 3FMLA 3VBYA 3FZRA 3DLZA 4K0YA 4MBJA 4DEBA 4GFGA 4QMXA 2ESMA 5AR8A 4S30A 3IDCA 4IB1A 3RAKA 3N4UA 4DT8A 1YOLA 3L8SA 2P2HA 2V5QA 1XWSA 1QMZA 4XP0A 1YHSA 3JPVA 2ZM1A 4E73A 4YMJA 3PIXA 2YDIA 5HGIA 3E5AA 2WKMA 4FVRA 4NEUA 3L9PA 2QO2A 4MD9E 2X8EA 1OL6A 4XRJA 3R9NA 4JAJA 2OZAB 3OEZA 4ZSEA 5GZ9A 2Z2WA 3AC5A 5HO6A 5CXZA 3NPCA 2G01A 1BUHA 3OWPA 2UW8A 4ACHA 3S2PA 2C1AA 5AV3A 4ERWA 1PXMA 3ZMMA 2XK8A 3KGAA 3LPBA 4HGEA 2UW5A 4M14A 5IA5A 4FIFA 2YITA 1KOBA 4QMTA 4PX6A 4E4LA 5EH0A 5GNKA 3WZJA 4QNAA 5FG8A 3FMMA 5AA8A 3QUPA 2RFSA 3NCZA 4NFNA 2VTTA 3VBTA 3LCTA 5EYKA 3E62A 3DAKA 3NSZA 1BI8A 3RAWA 1OKYA 2BILB 4A9UA 4FUXA 4R3RA 4ZY4A 3C9WA 4QMZA 1BYGA 5H9BA 4A07A 4DH1A 4L67A 3FDNA 3KXXA 2IJMA 1LPUA 3AD5A 4CFUA 4MXYA 2BTRA 4FGBA 4EUUA 4FZ6A 4D9TA 2C6DA 4PPAA 3ZO4A 5DBXA 2OH4A 3TZMA 1JBPE 3G0EA 3O23A 4S32A 3F9NA 4FEQA 5E90A 3R01A 1ERKA 4HNFA 4JDJA 4YTCA 5ANEA 1H1PA 2ITZA 1G3NA 5EK7A 4LG4A 3GC0A 3KREA 5FGKA 5K0XA 2C6LA 4JR3A 3CE3A 4R1VA 4YHTA 3UNJA 3Q3BA 1BX6A 5I9XA 5KCVA 2R0UA 4QMSA 4DEGA 2PE0A 2BALA 5EKNA 3H9OA 4BDEA 2ZV2A 5CVHA 4NIFA 4D4VA 3HMOA 4J8MA 1H1QA 3RPRA 1WFCA 3SXFA 4IZYA 3F5PA 4C61A 5A46A 4FSNA 4IWDA 2W1IA 4EH5A 2J5EA 4JQ7A 2UW3A 3OCBA 3HV5A 4QOXA 4YTHA 4ZTSA 1FOTA 3BCEA 3CSVA 5IQCA 5E8YA 5AV2A 3PWDA 3EKNA 5KZIA 4C7TA 1PXJA 3JUHA 3LOKA 3MW1A 1XH8A 2Y6OA 3SQQA 4E6AA 5IEVA 2LAVA 2XIYA 4IACA 3EL8A 5ETFA 4L43A 4QYEA 4TYJA 3TKIA 1H8FA 4AS0A 1Q8UA 4LM5A 1JSUA 4ITJA 4BCOA 3MH0A 4ZTQA 4MBLA 1PKGA 4WA9A 5JGDA 2PVKA 4HGSA 3BEAA 2PVRA 4FTKA 4EH2A 4A9RA 1OUYA 2I0HA 4BWKA 3IK3A 3I81A 3UDBA 4B0GA 3E8NA 4HNIA 4EHGA 1PXNA 2JKOA 4QD6A 4QTEA 4ASDA 2HXQA 4D5HA 4AWIA 2R3NA 5HOAA 1PMVA 4Z7HA 3UIMA 5EW8A 4BRXA 1KOAA 3GP0A 4QQTA 2BFYA 5JH6A 1DAYA 2WXVA 5AR7A 4F63A 1E1VA 3DNDA 3QTUA 1K2PA 3GC7A 4EOQA 5FP5A 3QGWA 2W99B 3RK9A 3MJ2A 2OH0E 4L9IA 4DG2E 5C26A 2X2LA 3WIGA 3F6XA 3PFQA 4BN1A 1UA2A 4F1MA 3D15A 3T3VA 3HX4A 4V0GB 5AP5A 1R39A 5HCXA 3D7ZA 4EOMA 4ZLOA 3U54A 1ZOEA 4U45A 4D2TA 4C59A 3VC4A 4AGWA 2YIXA 2CGXA 4PF4A 3BEGA 2VN9A 3V3VA 2UZNA 3GQLA 5CTPA 5DOSA 2PZIA 4AT3A 3BBTB 3Q9XA 4AA5A 2WQOA 2C6EA 3OWJA 4G31A 2WMWA 4CRSA 1GIJA 3OG7A 2QR7A 2OIQA 3WIKA 3D7TA 2QG7A 4FKPA 3EOCA 4JIAA 1Q24A 3V5QA 4ALVA 4CT2A 4ANMA 3U9CA 3VF9A 3E3PA 2YM7A 3MESA 3D14A 2BCJA 3G0FA 3JXWA 3ZCLA 4E6DA 4KBKA 2OU7A 3HMNA 4AW0A 2PMNX 4II5A 4FZFB 5J1WA 4F6SA 2R3PA 4IIRA 4ZTMA 2ZDUA 4NW5A 1OBDA 2HELA 3F3WA 3KA0A 3ZUUA 3KY2A 4HJOA 4IX4A 4NTSA 1XH6A 2WMXA 1YWVA 3ALNA 2YISA 3QD2B 2XBAA 4Z9LA 5M53A 2VWXA 2FSTX 3UBDA 2YLEA 3KXNA 3MVJA 3POOA 4FNYA 3TNIA 1OIUA 4F9BA 1FGKA 3PWYA 5JFSA 3B2TA 3MVMA 3UC3A 3KVWA 2VD5A 2V55A 2O8YA 5FDXA 4ZY5A 3Q6UA 4JVGA 4K9YA 4D1SA 5D10A 2WTWA 2A19B 4EYMA 3QWJA 2C6MA 1OKWA 5BUJA 5CAVA 5A4LA 2PHKA 4MQ2A 3U87A 1ZMVA 4LRKA 1M7QA 4O6LA 4X6QC 4MBIA 3T8OA 3TUCA 1OPKA 4QP3A 3TWJA 4RA5A 4UWYA 3QQHA 5H8GA 4F65A 4QP4A 2PWLA 4ZOGA 2ITWA 3PYYA 4O7TA 3LKMA 2XKCA 3Q04A 3CPBA 4XV3A 3NCGA 3AMBA 3CPCA 3IG7A 5FEEA 3SVVA 2X6DA 1MQ4A 2YDJA 3KULA 5CYIA 4BR3A 4TN6A 4W9WA 4BCNA 4EK4A 3R7EA 3FYKX 4M3QA 3ZSIA 3AC4A 3PRIA 3TCPA 1F3MC 1BMKA 4C36A 3QCQA 3VO3A 4J98A 4OTFA 4FF8A 2HYYA 4CGAA 3QF9A 4QMNA 4HW7A 3BBWA 4USFA 2R4BA 3JS2A 3KXGA 1UKIA 3BGQA 3EQGA 2ERKA 2I0YA 2PYWA 1QPJA 3HA6A 4L46A 4FSTA 3VUHA 1FBNA 3BYUA 2IZSA 4R3CA 1Q62A 4BHNA 4GKHA 4YNEA 5K5XA 4CV8A 1XQZA 4ANBA 5DMZA 4DTAA 3PLAE 4A4OA 3EL7A 4YPDA 5FRIA 4TWNA 4BBMA 2JDTA 3GQIA 3P08A 4B99A 1UU3A 3K54A 4ACDA 4RC3A 1DS5A 3LFFA 2XJ1A 5KNJA 2HXLA 4FEWA 5L8JA 3NR9A 1JQHA 3WZDA 2UZWE 3GU6A 4HYSA 5KMLA 4HVDA 4EC8A 4U9AA 5ANOA 1YDSE 3P0MA 4P4CA 3QC9A 3UOHA 4D0XA 3A7FA 3G90X 5I9ZA 4E5AX 4GL9A 4W8EA 4C57A 4CFMA 3QCSA 3RALA 4ANOA 3QQFA 1U5RA 4AFEA 4ZSAA 4F9YA 3FHRA 1GIIA 4U6RA 5HO7A 5M4FA 1WVWA 3NZ0A 4XG7A 3ZLSA 4NM3A 3F69A 4AXAA 4AZVA 3OW4A 4XP3A 2ZJWA 1SZMA 4DGOA 4GW8A 1OUKA 4CFVA 4PDPA 5HVKA 3P78A 3CQUA 3TTIA 4E5BA 1B6CB 5JK3A 3UO5A 4C3PA 2HAKA 3QCYA 3MA6A 1APME 2OSCA 2WMBA 4CZUA 3QKLA 4DH3A 5HVYA 4NUSA 2UZUE 4RX8A 5JFWA 3ITZA 4C3RA 3F61A 2GTMA 2H9VA 5EM7A 3OY3A 4O0UA 2OZAA 4H3QA 1F5QA 4BKYA 1WBTA 3LW0A 3GVUA 4U5JA 3AT4A 2GFSA 4S31A 4IB5A 3PA4A 4JAIA 5E92A 2P2IA 4Z16A 5CSVA 3OD6X 3CXWA 3PP1A 4FICA 2UW0A 5L8LA 2VGPA 1YWRA 3G9NA 4IVBA 4LGHA 3T3UA 4H1MA 4AE9A 1WBPA 4HGLA 2PZYA 3QL8A 1ZYJA 4DA5A 4G3EA 2CGVA 4MD7E 1PRYA 2WTDA 5DE2A 3MY5A 3ROYA 2X8IA 4FV2A 3KFAA 5HU9A 3V8TA 1FMKA 3HUCA 4H39A 3QKKA 3GUBA 4FK6A 2JDVA 4IZ5A 4X3FB 4YZDA 3SRVA 3UQFA 3TIZA 2YA9A 4AOJA 2UW6A 4Y83A 2WO6A 3ZC6A 3EQFA 2YLFA 3Q5IA 5FXSA 2ETKA 3TZ8A 3LFAA 3DXQA 5DIAA 1JKSA 5EM5A 2WD1A 4L01A 3FLNC 5BUIA 5E8SA 5EG3A 5GJGA 4FTLA 4NWMA 5AP2A 4BIBA 3MJ1A 2XB7A 4BI1A 2UZOA 3QA0A 2OXDA 3JVSA 4FVQA 4FSRA 1FVVA 3R83A 1LR4A 2VTSA 3I6UA 3OBGA 3QZFA 4ZS4A 3UZPA 5CF8A 2XA4A 2YWVA 1JVPP 5KKRB 3R71A 3R9OA 3OS3A 3VRYA 4KBAA 4M84A 3UQGA 3T9IA 3WI6A 1ATPE 2QOOA 4WSYA 4BDJA 3NUAA 4ZS0A 3LXLA 2WMVA 3UG1A 4APCA 4M68A 3DZQA 5BYYA 3HMMA 5IA1A 4OBPA 5LMKC 2GFCA 4DTKA 4YLLA 2XEYA 2HW6A 4QMVA 2BRHA 4X3JA 5CNNA 2OBJA 3OZ6A 1KE7A 2ZYBA 2IW8A 3PPKA 4EH8A 4OAUC 5AAFA 3EKKA 3MBLA 2JIIA 4IX3A 4WNPA 1WVXA 2W1FA 3Q9ZA 3ANRA 4EC9A 4XG2A 3BU6A 4W4VA 5IKWA 4D2PA 3TV7A 3TV4A 4DGLC 1KWPA 4G6LA 3R7OA 4GVJA 4DCEA 4QMWA 3BU3A 4OAVB 4F7NA 4IM2A 4QMYA 5FLFA 2XYNA 3ET7A 2XK6A 3OWLA 2WEVA 4KS8A 4EOPA 4L00A 3TJCA 3KRJA 3LQ5A 4LL0A 4TYGA 4AACA 3MTFA 4YR8A 1Q4LA 4F6WA 1RQQA 1SYKA 5HTIA 3Q53A 1TKIA 3V8SA 1JKTA 2XVDA 4LGGA 5CAQA 1Q8WA 4CT1A 4U8ZA 4BDBA 3NAYA 4IDTA 2XNNA 5DI1A 3Q4TA 3TZ9A 4E7WA 3CC6A 1PMNA 5F95A 3LJ2A 5K3YA 3FEGA 1TQMA 3PXRA 3OP5A 2F2UA 3RCJA 3UYSA 3HRBA 2J4ZA 4BDIA 3ZUVA 5KBRA 5BYZA 4MD8E 3LFCA 5IDPA 4IX5A 3BHHA 3F5XA 3QRJA 4PTGA 3UZRA 5J9YA 3DOGA 3DJ6A 4IANA 4IVCA 5IUIA 4I93A 4ZMFA 2A2AA 3WZKA 2BMCA 2C3LA 4JG8A 4TTHB 1CTPE 5FM2A 4FZDB 5FM3A 3UJGA 3NIEA 4V0GA 4FA2A 3NLBA 5I4NA 5CF6A 2WU7A 3TNQB 5A4CA 5IA2A 4N70A 4FNWA 2NNWB 3F2AA 2CHLA 5FTQA 2QODA 5CVFA 3KN6A 4IFGA 3QTZA 5A4TA 3CP9A 5IDNA 2HZ4A 3IW5A 2B55A 3OTVA 3IW4A 3BELA 4F0FA 4OTPA 5F94A 1FQ1B 2JKQA 4EZ7A 2ERZE 4EOSA 4DH8A 5HEZA 3N51A 2BZHB 4NT4A 3LM5A 5HICA 4BCQA 2B9HA 3QD0A 5AV1A 2GNIA 4I6BA 4CKRA 1ZYDA 3R04A 4U3YA 3ZOSA 3R1QA 4RX7A 3WYXA 4WIHA 4UYAA 4QMQA 2PK9A 2UW9A 5L4QA 3MDYA 4LOOA 4QPSA 4U79A 3ZM9A 1LEZA 4J7BA 3PG1A 4BGHA 3A99A 4D1XA 5K4JA 3CQEA 5E8XA 5EDPA 4K33A 4P90A 3W33A 3ZTXA 3SOAA 2IZTA 1P4OA 3O7LB 3NX8A 3FXXA 2HK5A 2YZAA 5TT7A 3F3ZA 1YI3A 3I7BA 3LVPA 5AUWA 2EUFB 3F88A 4WKQA 3R73A 5AJQA 1VYZA 4GYIA 2RG5A 3EHAA 3QCXA 2OFUA 3DA6A 3U4UA 4GIHA 1YXXA 2OJFE 2B52A 3PXQA 3FV8A 3KCFA 4FT7A 2HENA 5E1SA 5H8BA 2ITQA 3FJQE 2VTJA 5AP4A 2FUMA 3O8PA 4UY9A 3FXZA 3GT8A 4USDA 3F5UA 5FTOA 3O51A 5LVOA 1PY5A 2QU5A 5EHLA 2J2IB 2PTKA 5AR5A 3MN3A 5FEDA 4DFXE 4BB4A 5EYMA 2R2PA 4IB3A 5DH3A 5CEOA 3PA3A 2C6KA 1A06A 4FTOA 4KIOA 3ZXZA 4O7NA 1VR2A 5IH4A 1KE8A 4WD5A 4IB0A 5IPJA 5M57A 4QMLA 4A9YA 5DN3A 2Z7RA 4AX8A 3PXYA 4KD1A 3O17A 2DQ7X 1I09A 2WEIA 1JKKA 3AMYA 3BGZA 5DEWA 4FSQA 3HDNA 2R7IA 4H05A 4G1WA 5FD2A 3KXMA 4A4XA 2Y8OA 2FH9A 3E93A 3P7AA 3SA0A 3L8PA 4FKLA 5EDRA 3UOLA 2JBPA 2ZMCA 3EFWA 1XH4A 3NNXA 3TT0A 3OCSA 5CU0A 3IDPA 3PUPA 3F7WA 4YP8A 2CNVA 2W1HA 2ZMDA 3FQSA 1YXTA 2R5TA 4H3BA 3ORNA 3PVGA 4MH7A 4XLVA 5AWMA 1VEBA 2HW7A 4CFFA 4EHEA 4FTIA 1WMKA 2WOTA 3OOGA 4ANSA 1OB3A 5AUYA 2IZUA 3ZRMA 4GFMA 2W1ZA 3F82A 4HOKA 4I0RA 3V8WA 4LI5A 4IM3A 5CNOA 5DLSA 2FGIA 2FVDA 2X1NA 3KU2A 5IH6A 3CEKA 3L1SA 1Y8YA 3I5ZA 4YJUA 2W5BA 2IO6A 4X2GA 5I9YA 3REPA 2BRNA 4RJ4A 4D2RA 5JRSA 3ZM4A 3BKBA 3VUMA 2YWPA 1OL5A 2VTRA 5CI7A 3EMGA 3CD3A 4IX6A 5AUVA 3QD4A 3BHUA 3MYGA 2GHLA 2IVUA 3LCOA 4M97A 2J7TA 3HRCA 3HV6A 5ANIA 4I5PA 5DGZA 3W16A 3EZVA 5DVRA 3TEIA 2O5KA 4ZZMA 3RP9A 3RTPA 4PPBA 3B2WA 5CT7A 1QL6A 5JZNA 4PDYA 4RBLA 3O7LD 4I23A 3MY0A 5CX9A 3N4TA 2W4OA 1DI8A 1RJBA 1RDQE 5M44A 1GNGA 1KE9A 3B8RA 5IQIA 4J96A 1T45A 2B4SB 2JDSA 1KE6A 4C4EA 3KF7A 3VBVA 4BZNA 1H01A 1HCLA 2R3KA 3NMUF 2W5HA 4NCTC 2YIYA 5JRQA 2XIKA 3V6RA 3FC2A 4L53A 5JT2A 3FZSA 3ANQA 3KULB 3DBFA 3OFMA 4WOVA 3MSSA 1CKJA 4GG7A 3RPYA 3VBWA 1MP8A 2HWPA 4CZYB 2P33A 2QONA 4LV5A 5HG8A 3GNIB 4XV9A 4CRLA 2J9MA 3VBXA 3HEGA 3FUPA 4K77A 5DR2A 1R0PA 4MHAA 3R1NA 1JSVA 5DHJA 3UNKA 5JMSA 5JFXA 4APPA 3PY3A 2VWUA 5LARA 4EBVA 4UX9A 4PWNA 3ZEWA 1JPAA 2YN8A 5B2LA 4Q5EA 3BHTA 3FZPA 1OPJA 2HWOA 4YZMA 4FV6A 1WAKA 2A4LA 3FKNA 4FNZA 3T9TA 3DK6A 4TT7A 3VNTA 1MRVA 4CYJA 1MRYA 3AOXA 5C8KA 4JS8A 4DAWA 3ZBXA 3UIXA 1XBBA 4O7WA 5AFVA 2PVNA 3CTJA 5DNRA 1REKA 4FV9A 1LEWA 4X6RA 3VUIA 4RWJA 2AC3A 4O0VA 5H8EA 5I5ZA 4PRJA 2OK1A 4JNWA 3TDVA 4HVIA 4C38A 3PXZA 3G9LX 3DJ7A 3CBLA 3AGLA 3MH3A 3NNVA 2C5NA 4YSJA 1PHKA 2JD5A 4KIPA 4O0SA 2UZBA 3ORMA 4BF2A 1IASA 1PKDA 2J0MB 1YHWA 3P23A 3V01A 3FZTA 2ACXA 4XG9A 3DPKA 4UB7A 3RHXA 3RAIA 2QOBA 1REJA 3Q9YA 3IECA 3Q4ZA 3ETAA 4CLJA 4IE9A 4UXQA 4FT5A 4AZWA 5HHWA 4CVAA 3I7CA 1OZ1A 5IQEA 3C4CA 5KMIA 3DTCA 3FZOA 2P0CA 3A60A 4IJ9A 4NKAA 2YM6A 2EXCX 5ANGA 3KXHA 4L52A 3ZH8A 4X2KA 4BIEA 3U55A 4ID7A 5AX9A 5T68A 3KB7A 3ZZWA 4UMPA 5HORA 5BQ0A 4J99A 4CCBA 1STCE 3TKHA 5J1VA 3Q2JA 4KNBA 4ZSGA 5CEIA 3CTQA 4GEOA 2JITA 2VZ6A 3NYNA 1Z5MA 2CSNA 3FC1X 1ZXEA 4AF3A 1OPLA 4E4NA 3PVUA 1VYWA 3QGYA 4X21A 1NVRA 1J1CA 2J50A 3PE1A 3QZGA 4IZ7A 4ASZA 4DGGA 5J9LA 5BPYA 3FMKA 4RIWA 3UQCA 5J9ZA 4PP9A 5E8WA 4FL1A 3C4EA 5K4IA 4XRLA 3FY0A 3VS6A 2KULA 2UZLA 5C1QB 2YCQA 5AA9A 3TG1A 3LMIA 2CN8A 2ITVA 3LAUA 4BC6A 4K18A 2C6TA 3SRVB 4BDKA 1KV1A 1YHVA 4RG0A 2O3PA 4K6ZA 4X2JA 3Q52A 4AOIA 4EOIA 4FOBA 4NZWB 3RMFA 2IVTA 3R02A 2YM3A 4BTKA 2GNGA 3E8CA 3RZBA 3OWKA 3WF9A 4ITIA 1YKRA 2G1TA 1QPEA 1OITA 2Q0BA 2NPQA 3UVRA 2R3GA 3EQRA 3GEQA 3QXOA 5E8UA 4KBCA 3BWJA 2FA2A 5CZIA 3V5JA 3ZLWA 1UU9A 2GDOA 3AD4A 3MFTA 2WTKB 5IG1A 5J87A 4RVMA 1CMKE 3VJNA 3RHKA 3DU8A 2O0UA 4GT5A 1J7UA 3H4JA 4JBVA 3HLLA 4UBAA 4X2FA 5FWKK 4DCAA 5M4UA 4WBOA 3UE4A 2QQ7A 2YIWA 3L9MA 1OVEA 3MVLA 3JYAA 3ROCA 2RF9A 1TQIA 4ITHA 5CY3A 5CZHA 2OXYA 5HBJA 3R2YA 3MH2A 4FTCA 3MA3A 2OJJA 3HVCA 5HESA 4DLIA 4XOZA 4N57A 2CKEA 3LCDA 3FPQA 2WMRA 4G16A 4PTEA 2BRGA 3HUBA 1CKPA 4FUYA 1JSTA 4NW6A 4WT6A 1U46A 3RGFA 4UMUA 4QMPA 4CQGA 1IG1A 3R7GA 1E1XA 2A1AB 3R8PA 1HOWA 3I60A 5FDPA 2QD9A 4HZSA 4RZVA 4FIGA 4U44A 1YI4A 3E92A 3K5VA 5HBEA 1UNLA 2C30A 3BPRA 3RJCA 3DAJA 4TNDA 3SC1A 2GS7A 3VW8A 4AN3A 4E6CA 1JNKA 4BY9E 3CTHA 3OEFX 3TZ7A 1M2QA 2JDOA 1Q5KA 2YABA 3GOPA 5GZ8A 4M66A 3Q4CA 4DITA 4AT5A 4F99A 2G15A 1H25A 2EXEA 4P2KA 4IW0A 3GFWA 3D5WA 4GFOA 4RFMA 3RNIA 4YURA 4DH7A 2OZOA 5FXQA 3ZO1A 5HNBA 1DI9A 4DEHA 1OKVA 2OICA 3FHIA 3KK9A 3MTLA 4JG6A 2ITYA 4ZXTA 2PPQA 3LFEA 4QP7A 4W4WA 1H0WA 1Y6BA 2WB8A 4U3ZA 2JKMA 3EIDA 3R7VA 2PVMA 3DS6A 1PMUA 2FSMX 4HGTA 4QYFA 3QA8A 2BTSA 3JVRA 4C02A 3QWKA 3G6GA 1VJYA 3KRWA 5EHYA 5HO8A 4Z3VA 4C4HA 3MB6A 2X4ZA 3OW3A 4FV7A 3DKGA 5LCKA 4Q9SA 4R77A 2UVZA 5E7RA 4GYGA 4YNOA 3LXPA 4QTDA 4RJ8A 4IWPA 5ACBC 5HX8A 1XJDA 4BVUA 4DFUA 5KO1A 3E63A 3P86A 2X7OA 4S33A 1OL7A 3A62A 2WTIA 3CY3A 4FTMA 3GB2A 5EM8A 3BHYA 2UW7A 4D58A 4DHFA 3PZHA 4O6EA 4F7LA 4XCUA 2X9FA 3C1XA 3VUKA 3COMA 2R3IA 4F0IA 3ZXTA 4FTRA 3NUUA 4D4RA 4B9DA 5CQWA 4YHFA 1Y6AA 5LVMA 1SNXA 2PVFA 4QP8A 3LMGA 4FIJA 5D7AA 2BRBA 4U80A 1VZOA 2WMSA 2ITUA 3FI2A 4GT4A 2XCKA 2IPXA 5CSPA 3RM7A 2BAKA 4ALWA 1O9UA 2B1PA 3W1FA 2J5FA 2EB2A 4ZTNA 4MCVA 1H27A 1ZZLA 4O27B 4OTHA 2VX1A 2OF4A 3UC4A 4PMSA 3AC3A 4GMYA 4UV0A 4EJNA 2PVHA 3RINA 3EN7A 4UN0C 5H2UA 4J1RA 2XK9A 5KE0A 2CGWA 3EN9A 3FAAA 3R8LA 3VS1A 3LXNA 5GJDA 3SV0A 4ZZOA 4E8AA 5FUTA 3TKUA 4DLJA 4R78A 2WZJA 4N6YA 1UNGA 5JQ5A 3S1HA 4FKRA 3OT3A 1BI7A 4ZSJA 3EFLA 4XG6A 5CT0A 2XKEA 4DF3A 3KRRA 5AUUA 2DS1A 4I0SA 3GCVA 3UOKA 4R7HA 5D11A 2BHHA 3WF6A 4C2WA 2E9NA 3QD3A 3H0YA 2RFNA 3F3UA 3OCTA 3GC8A 4JRNA 4PDSA 1FVTA 4I41A 5IEXA 4GK4A 5T6KA 4EH4A 4KABA 2GNFA 5CSXA 5D1JA 4EHVA 4XEYA 5J95A 5LVLA 3SX9A 1PF8A 3LFNA 4NM7A 1ZMUA 4MEDA 2P3GX 1J7LA 4OTIA 3FKOA 4FKUA 2OW3A 4JDIA 4KKGA 4L44A 3WOWA 4FYOA 3TNHA 3W2QA 3D5VA 2IW6A 2BRMA 2O63A 4O7VA 1CKIA 5EM6A 3FSKA 3A2CA 1Y91A 1ZOHA 3A4PA 4D4YA 4FEUA 3QQGA 3TL8A 2R9SA 5BMMA 1U54A 5M4IA 1XO2B 4GK2A 3C0IA 3P9JA 2XF0A 4FC0A 4WRGA 4UMRA 2ZV7A 1H08A 2W06A 1WVYA 2JC6A 3O71A 3TIYA 5IQBA 4NH1A 1RE8A 4CZTA 2HZIA 2V7AA 4UYNA 5DR6A 3DFCB 1DM2A 3MH1A 3D4QA 3MVHA 1B39A 3R22A 4E4MA 1R78A
chains in the Genus database with same CATH superfamily
2OXXA 2C5XA 3TNPC 4CMTA 2O64A 2ZB0A 2FO0A 3R6XA 4NJ3A 3PPJA 2GPHA 3QHWA 4YC8A 4WG4A 3OMVA 1G8AA 5EQPA 1ZRZA 3AC8A 3CGFA 3ENMA 4JIKA 4FGRA 5CENA 5C4KA 4FV0A 4M12A 3TYKA 4BCFA 3E7OA 1IA9A 5IZFA 4BCIA 4U0IA 2G2HA 3NUYA 3LJ1A 4DG3E 4AGUA 4PDOA 4X0MA 4FV1A 4O4EA 5G1XA 2YZLA 2ONLC 3EZRA 4QTCA 5D7VA 5HI2A 3QLGA 5AP6A 3DT1A 3CKXA 3V5TA 2QOIA 2W1DA 5AAGA 3TDWA 4D1ZA 2OKRA 3HNGA 5AP7A 3UMXA 5A9UA 4CTCA 3HA8A 2PVYA 3VUDA 4XOYA 4UZHA 3BLQA 3G5DA 4FYNA 1JLUE 4LUDA 4L8MA 3TXOA 3VF8A 3R00A 4DFZE 2F49A 3C0HA 4F09A 4LRJA 3R9RA 2W9ZB 4TW9A 3I0QA 4ENXA 5IISA 4C34A 5HTBA 3UO4A 2VWIA 4FG8A 3V51A 3GENA 3EH9A 5I9VA 1PXLA 1Z57A 4PMTA 2PE2A 3P1AA 1BLXA 4C58A 4DFBA 4RJ6A 3U4WA 3CJFA 3DZOA 3PJ2A 3VWAA 3MFRA 2RFEA 4AQCA 4RX9A 1W98A 2OO8X 3HECA 4AUAA 4EK5A 3FLQA 3LLTA 1GZ8A 2QOHA 4EWHA 4WRSA 1YRPA 2B7AA 3S4QA 1KE5A 4F9CA 5C8MA 5L6PA 5CALA 3FI8A 2W5AA 4DBNA 3OCGA 1NXKA 2CLXA 5CEQA 4EH9A 3VVHA 5L3AA 4DDIA 4K8AA 5J8IA 3ERKA 5TF9A 3VS4A 1G5SA 3PRFA 4M0ZA 2ETMA 4LV7A 3AC2A 4Y95A 4FG7A 2XKDA 2OF2A 3AC1A 4QTAA 4ENYA 5KUPA 3NEWA 4IAIA 4A7CA 4WBBB 4M0YA 2Y7JA 2C47A 3GOKA 3DK7A 1H07A 1MQBA 2GMXA 3NVMB 3PSDA 4G3GA 1J1BA 3WZUA 3ATTA 1P2AA 1UNHA 2XNMA 4ZMEA 4CTBA 1K9AA 4L68A 2GSFA 2VX3A 4I4FA 3O96A 5ANJA 3PSCA 4O0YA 5BVWA 4F70A 4YBKA 5BVOA 4ALUA 3WE8A 2V7OA 4ERKA 5BVFA 4KUJA 5C8NA 3KEXA 5CU4A 5ETIA 1BKXA 2UW4A 3AMAA 2BDWA 3ORIA 3BYSA 4NM5A 3CQWA 4LOQA 3KRLA 3VS7A 5BV3A 3PIZA 4PTCA 4XS2A 1O6KA 2ITPA 3QRIA 3ULIA 3FBVA 5K9IA 3A7GA 4I6QA 2PUIA 3IKAA 3GCUA 4AP7A 4JDHA 5IQDA 3PJCA 3FLSA 4G3FA 4RSSA 4ZJIA 2RSVA 3A4OX 3EFJA 4RQVA 3FWQA 4O2ZA 3QUEA 4AGCA 3FLWA 4JOAA 3OUKA 1W84A 4F1OA 4ANNA 3IW7A 4KWPA 4L3LA 1V0BA 4FIHA 5C01A 1S9IA 2EVAA 4AOTA 3ID6C 4O0XA 5CWZA 3BL7A 4R7BA 4BDCA 4GKIA 3OTUA 4MYGA 3VUTA 3QRKA 5CLPA 5E8VA 4ZZNA 4O81A 4C62A 4KRDA 4KA3A 2XRWA 4O4DA 4YSMA 3ML1A 3VS2A 1Q97A 5CS6A 2AUHA 4NK9A 3PLSA 4JBOA 4RIWB 3P79A 4O7RA 2Y4IB 4FKSA 2XAOA 3DXNA 2WTVA 2YDKA 4IHPA 3COKA 4RWIA 5HD4A 1GJOA 4WUNA 4WUAA 1UU8A 4RWKA 2GCDA 4BICA 5LXMA 3IONA 2BR1A 2FB8A 5HBHA 4RIXA 1X8BA 3OHTA 5HE0A 5CF4A 2F7XE 4QMMA 1P4FA 2HY0A 3KVXA 3QQJA 5CXHA 4CFWA 4F7JA 1AGWA 5L2SA 3DQXA 3C4FA 3VN9A 3DY7A 4U7ZA 3ZSHA 2X8DA 3D9VA 4IM0A 2QKWB 3Q2MA 4WO5A 4QP9A 5AR2A 1XBCA 4O0RA 3D5UA 3OVVA 4QNYA 3VS5A 4IDVA 4RZWA 5KHWA 5M56A 4AQKA 2REIA 2Z8CA 4DEIA 4RGJA 1Q99A 1XH9A 3AG9A 2X4FA 4L3JA 4R6VA 2B9IA 5J7HA 3KN5A 4RJ3A 2XS0A 2UZVA 3FLYA 4OT6A 3EQBA 1O6LA 4P7EA 4QT1A 4HCTA 2Q83A 2OIDA 1PW2A 2VTOA 3PXKA 4J53A 4PPCA 3W18A 4DGNA 4RMZA 3E8DA 2ZOQA 4XLIA 3CR0A 4G5JA 4IFCA 5EI2A 1LP4A 2FYSA 4AW5A 3F5GA 4GU9A 4TY1A 4HYUA 2NRYA 3BWFA 2IVSA 5DT0A 1M14A 4NU1A 4IAKA 2GS2A 2ITOA 4TZRA 3ACKA 4R1YA 5DT3A 4E5WA 2VAGA 4YJSA 3D94A 5DRDA 4DEEA 4O84A 2R3JA 2QC6A 2X0PA 5IQAA 5AR4A 4GT3A 2C5VA 3GXLA 4JLCA 3OC1A 4OW8A 3WARA 4GUEA 1W82A 2QO9A 5T3QA 1VLRA 3FZ1A 3VBQA 4XG8A 4XMOA 3I4BA 4ZTLA 4FSWA 2JLDA 3A8XA 3P5KA 4X7QA 5CEMA 2R0IA 3UPZA 1URCA 3VHEA 3U6JA 2QHNA 3DB6A 4GG5A 4D2WA 2YM4A 3TACA 3NIZA 1YXSA 3UGCA 4CYIA 2C5YA 3K3IA 3G51A 4IC7A 1IAHA 3SG8A 4JBPA 4ZTHA 3WILA 4LMNA 5KMOA 3GC9A 4YZ9A 3R7IA 2JFMA 3KCKA 4PNKA 4IMYA 4I6FA 3D2IA 2R3HA 4LL5A 3WF5A 2VTPA 4EK3A 4JQ8A 3RM6A 4TL0A 1GZOA 2E9UA 3PXFA 5CSHA 4HVGA 3ZU7A 5HU3A 2ZFYA 3S0OA 5BNJA 4F1TA 3UP2A 1GY3A 4WNMA 4YUQA 3RK7A 3NNWA 3CCNA 3WE4A 4TWPA 3LCSA 4JQEA 4BI0A 3ORLA 4RFZA 5GJFA 1M17A 5GZAA 2XK3A 5E4HA 2BUJA 3HV7A 4FG9A 5ACKA 4F9WA 5HVJA 3A61A 5IH5A 4RWLA 3BYOA 5GIPE 3PJ8A 4NM0A 3E8EA 4EQMA 4IZAA 5A6NA 5M06A 5EI6A 2F57A 4ZP5A 5C4LA 4K2RA 4FBXA 3W2RA 2OG8A 3C50A 4FL2A 2W1EA 3M1SA 4TXCA 4OTRA 3QTRA 4MKCA 3G15A 4DH5A 4CMOA 3NS9A 1UWHA 2QLQA 5L6OA 4EH3A 4BCGA 5DG5A 3ZFYA 5TR6A 5LWMA 2YCFA 1L8TA 3ZLYA 4XJ0A 4XH6A 5AX3A 3W10A 2J6MA 3QXPA 4IH8A 1W83A 1YW2A 3FQHA 3QZIA 5CASA 1YDTE 4EJ7A 4CKJA 2X9EA 2Z60A 1W8CA 4LRMA 2GU8A 4EBWA 5BYLA 5E9EA 1OGUA 3IGGA 2QU6A 4GSBA 2XH5A 3HV4A 5EYDA 4EH7A 3TM0A 4X2NA 4ONAA 4U81A 4G6OA 1CDKA 2XIZA 1OM1A 2CMWA 5AIKA 5FBOA 5FEQA 1U59A 3R8VA 3UYTA 4DINA 5I9WA 5DYJA 3HGKA 4AN9A 4PQNA 5DRBA 1YDRE 4WG3A 2ZM4A 2WTKC 4AZSA 5AADA 3FXWA 4EYJA 4YC3A 2YCSA 3DBEA 3ZO3A 4CD0A 4AXFA 1W7HA 2BPMA 1GZNA 4MVFA 5LCJA 3QBNA 4MWHA 3CIKA 4WHZA 4R7IA 3C4XA 3W2SA 3Q60A 2OGVA 1G8KA 4O21A 5HLPA 4I5HA 2FSLX 5ITAA 2I6LA 4BDDA 5JSMA 2WGJA 4N6ZA 3ZDIA 5IQFA 1H4LA 2QOQA 4FV3A 2XNBA 3IPHA 4RLLA 1OI9A 5CU3A 3LFDA 3E87A 3R2BA 4EOJA 4U40A 2I0EA 4IJPA 3C4WA 4NTTA 4E93A 4FTUA 2UVXA 3C5UA 3TJDA 2VTMA 3ORTA 3AD6A 2E9VA 5JN2A 3DKOA 4CQEA 2Y4PA 5CI6A 2C6IA 2GHMA 5AUTA 3LQ3A 3FI3A 3OROA 3FQEA 2C5OA 3NNUA 4LQMA 4B8LA 2FSOX 4QPAA 5FTGA 5AV0A 3M11A 4PV0A 5IQHA 3DBDA 4H36A 5D41A 4UMTA 3S95A 2W4KA 3TTJA 4FE2A 1CM8A 3D5XA 1ZYSA 4YJRA 4E26A 1PYEA 3QQUA 4YO4A 3W8QA 2QKRA 1H26A 3NYVA 3UOJA 4I1ZA 5HIBA 2BAJA 5LVPA 4CXAA 4DBXA 3BQCA 1U54B 3FYJX 3HKOA 2PUUA 2WAJA 3DQWA 3NUSA 4KIKA 4BWXA 4W4XA 2JAMA 2OJ9A 3I6WA 4G6NA 4TWOA 3FLZA 2ITTA 1UU7A 2VTQA 3MGYA 4ASEA 4CMUA 4PNIA 3HMIA 5BVDA 3COHA 3G33A 1BL6A 2GS6A 4IVAA 3ZBFA 3QQLA 3ENHA 3W2PA 2WIPA 5IUGA 2IVVA 4FTQA 1P5EA 4V01A 3RVGA 3COIA 4U97A 1UVRA 4UZDA 3D2KA 2IWIA 4BDFA 2X39A 2BDJA 3DKFA 1G8SA 2HIWA 4XV1A 1IR3A 5DR9A 2J51A 4ANLA 4E20A 2CKOA 1R1WA 4FVPA 3ZEPA 2OFVA 2PUPA 3ODYX 3P5JC 2VWZA 5AP0A 5HD7A 4ARKA 3DKCA 3QTIA 4KKEA 4C8BA 3CY2A 4RFYA 3F2NA 3P7CA 4Y72A 5DWRA 5HG9A 4L7FA 2KTYA 4L45A 2I40A 2X0GA 2YEXA 3O2MA 2QI8A 3BE9A 1NY3A 4G17A 4RIYA 5J79A 4GCJA 3ZZEA 5BVNA 4DN5A 4YLKA 3TNWA 2PMOX 3JY0A 2JEDA 3LE6A 3EN5A 2BROA 3HV3A 4FTTA 5AV4A 1Q61A 1SVHA 5FP6A 5I3OA 4EH6A 4F08A 3FE3A 4ASXA 3R9HA 4DHJA 4TWCA 1YQJA 2X6EA 3EYGA 3PVBA 2J0JA 3TN8A 2XJ2A 2YAAA 4C3FA 4CLIA 4GH2A 4D55A 4FSZA 4QO9A 4KAOA 5D12A 4FSYA 3W0OA 5EFQA 3S00A 5A6OA 2WQMA 1V0OA 2XCHA 3LFBA 4RJ5A 4E6QA 2ITXA 4PY1A 5HX6A 4YBJA 3PZEA 4EOLA 4IAYA 3TMOA 4HYIA 4A9TA 5HLWA 4M69A 4S34A 3TUDA 3FL4A 4R3PA 3CGOA 3DTWA 3UP7A 4MQ1A 3ALOA 3R63A 4BDHA 2QLUA 5DFPA 3VHKA 2W4JA 2W96B 2QCSA 3W32A 3HYHA 4FZAB 3K5UA 3VQUA 3LJ0A 3R8MA 2H96A 2W9FB 2X81A 2HY81 4JRVA 1ZOGA 4DGMA 5A54A 3G6HA 3O8UA 1W0XC 1ZYLA 2BHEA 4CFNA 4FKGA 3O5AA 3CLYA 3O8TA 4NYEA 4DT9A 5M09A 4B4LA 5ANKA 4I6HA 3L9NA 4RIOA 4ZLZA 4M15A 5CANA 5LVNA 4GK3A 1R3CA 5LWNA 3QHRA 3BRBA 3KMMA 1A9UA 2C0TA 2WMQA 3JY9A 1TFFA 4AZTA 1M52A 4BYIA 2VTHA 3NUPA 4JT3A 3DGKA 4GJ3A 2ZV8A 3B8QA 3LXKA 4EL9A 1J3HA 3EFKA 3G2FA 5I3RA 4F0GA 3QYWA 1UWJA 2R64A 3R0TA 4BCMA 3Q6WA 2VV9A 2Y9QA 4FZ7A 4JXFA 4K1BA 4QP6A 3R8ZA 5IUHA 2Z02A 1FVRA 2QR8A 2JIVA 5KMMA 2V0DA 3E64A 4BCPA 4QYHA 5F9EA 3QTXA 3ZFMA 4G34A 4FKWA 1Y57A 3PTGA 4GRBA 3BYMA 4I3ZA 5EOLA 3OY1A 4G9CA 4I21A 4BYJA 4GJ2A 4R5YA 5C9CA 3ZFXA 4BKJA 2VO6A 2CNQA 3A8WA 5JEBA 4EOOA 3QC4A 5EW3A 5BUEA 2QNJA 4USEA 3QQKA 3L8XA 5A14A 3NYOA 2E2BA 4PMPA 2R3FA 5C03A 4IBMA 1M2PA 3P7BA 3U51A 3ZRLA 4ACMA 5I9UA 4HPUE 5CF5A 2WFYA 3NFFB 1M7NA 4GUBA 5KMJA 3CKWA 5CU2A 4FTNA 2XKFA 4O1OA 4U43A 3GBZA 3UNZA 4AT4A 3AT2A 4Y46A 4EHZA 1NVSA 3A7HA 3VAPA 4Q2AA 2EB3A 4JL9A 4J52A 5E91A 3PVWA 5IEYA 5L6WL 2BKZA 3AQVA 2PMLX 2QVSE 4TYEA 2C0IA 4RJ7A 5D9HA 2GNHA 3LQ8A 3A7IA 3GU7A 4QMUA 4R5SA 2JDRA 5AAEA 3ATSA 2XNEA 3ZS5A 3DK3A 4A9SA 2ONLA 3OXZA 4IVDA 4TYIA 1IAJA 3P4KA 1QCFA 2X7GA 2LGCA 4HZRA 4RIXB 2X2KA 3C5IA 2B0QA 4C33A 4RVLA 4MXZA 2V22A 4EI4A 3EQIA 3VIDA 1PYXA 3R7YA 2I7QA 2VWVA 1GZKA 4YZCA 3IO7A 1AD5A 3LFQA 5M4CA 3F3VA 4BL1A 1M2RA 3U8WA 2PE1A 4DEDA 4J95A 3I1AA 3GI3A 2PY3A 4FK3A 3RKBA 2BIYA 2VWWA 5JQ8A 3H10A 4C0TA 2VTAA 2CDZA 5HE1A 2XNGA 2X7FA 2A0CX 5BVKA 1XBAA 1ZWSA 4EONA 4ORKA 2EU9A 2UZTA 4EKKA 3MWUA 1OECA 3F7ZA 2NO3A 2PZ5A 1JAMA 2ZV9A 5HNGA 2W1GA 2A27A 2C4GA 2QURA 3ACJA 3QALE 4IWQA 4M13A 5IA3A 3DCVA 4O4BB 3LZBA 1IRKA 2ZVAA 4YJPA 5M07A 4GIIA 3H0ZA 2F7ZE 3F2RA 3VQHA 2BKKA 4FTAA 3I79A 3ZONA 2GNLA 5HIEA 4O0WA 3QTWA 4IQ6A 4C2VA 4HVSA 3QUDA 5H3QA 4YJOA 4EUTA 3EQHA 4TYHA 3LMHA 2CLQA 3RI1A 3I0OA 2J90A 2XEZA 3GU5A 2HCKA 4X3FC 3QYZA 3C0GA 1E9HA 3WF7A 3QKMA 5EDQA 4BHZA 2YAKA 4MNEA 4BGQA 1YWNA 2G9XA 3DNEA 3BZ3A 1Q3WA 4FKQA 4YJQA 1WBNA 2VTNA 4TRLA 3RZFA 4BTFA 2W05A 3UIBA 3EYHA 4NSTA 4ZLYA 2CNUA 1OIRA 4GVAA 1QPDA 3Q9WA 4C35A 3EQPA 5CEKA 2E9PA 3FMEA 2PVLA 4QYYA 1R0EA 3VS3A 3UO6A 1I44A 3MPTA 4M8TA 3PDTA 4J97A 5HG5A 1J91A 5KKRC 2PU8A 3BLRA 3THBA 3FSFA 4TNBA 5KZ0A 3UVPA 4C4IA 4D0WA 4FODA 4PL4A 5EW9A 4O7ZA 4FV4A 3F66A 1K3AA 5M55A 4U41A 4RVKA 4H58A 1P14A 4FKVA 4I5CA 4D2SA 1YOJA 3EN4A 3MIAA 4MXAA 3MIYA 3C4ZA 4QTBA 4ZAUA 4RC2A 2CKQA 4BJJA 3N9XA 4QMOA 4BWPA 2IEWA 5CAUA 4KB8A 4HYHA 3HL7A 2JBOA 3OBJA 4RT7A 2WMTA 1FMOE 5LMKA 2CJMA 2CN5A 5IMEA 4AGDA 3QLFA 3KC3A 4MTAA 2UUEA 2JKKA 4XBRA 4BDGA 4I92A 2I0VA 5G6VA 3FPMA 3RK5A 4DE4A 4L7SA 4OR5A 4AN2A 2Y4IC 3N4VA 3BYVA 4YGAA 4QQCA 2R3RA 3DJ5A 4HVHA 4PUZA 4P5QA 4N0SA 2F9GA 1J7IA 2R3QA 4BCJA 3EN6A 3ORKA 2BZKB 5EI8A 3POZA 4YJTA 2CPKE 4V05A 4CCUA 2GQRA 3NW6A 3K3JA 4O96A 4ZTRA 4YU2A 3CD8A 3RWPA 4D4SA 4GV1A 3BX5A 3E7VA 2WHBA 4FL3A 5ETAA 4OLIA 2RKUA 4ACCA 1PXKA 3ELJA 3OXIA 2J0KA 2JAVA 3ZLXA 4D5KA 2WQEA 1XH5A 3HAVA 5I0BA 2DUVA 2PSQA 3NW7A 5M08A 4E1ZA 1ZYCA 3R30A 3HAMA 5JGAA 4E4XA 3MV5A 3NGAA 5DA3A 5JZJA 4AU8A 2XK7A 2QOCA 2C3JA 3QFVA 4BZDA 2JIUA 3SD0A 1UV5A 4ZJVA 4I20A 2YFXA 4JDKA 4AW2A 4QP2A 4MXCA 2Z7QA 3ORXA 5EKOA 3QRTA 2ZB1A 3SHEA 2BIKB 4FOCA 2NRUA 2C68A 3HP5A 4V04A 3UZTA 3LHJA 1SM2A 3Q96A 3FMNA 3H30A 2DYLA 3KXZA 3C13A 4MK0A 5AUZA 2XIXA 4L6QA 1H1RA 3VRZA 4EZ3A 2HZNA 4EK8A 5J5TA 4UALA 4ZY6A 3NWWA 4Y85A 2VNWA 4FEVA 2VTLA 2R3LA 3SG9A 1TQPA 1SVEA 2XP2A 4UEUA 4Y73A 5EYCA 5L2QA 3RNYA 1V0PA 4YPSA 1YXVA 4W4YA 4BBFA 2JGZA 4BCKA 5J5SA 1SMHA 4JMQA 1YI6A 1H24A 1WZYA 1XR1A 2OWBA 3C7QA 5IF1A 3DBCA 4FIEA 2YIQA 4OUCA 4YO6A 2VO7A 1H00A 5IU2A 1MUOA 5B2KA 4RLKA 2G2IA 5F20A 3AGMA 3ZDUA 4CG9A 5FBNC 3RPOA 3RPVA 3ORZA 3PP0A 4RA4A 4W9XA 4F4PA 4BCHA 2VO0A 5KMKA 1KSWA 2P55A 2BVAA 4ZEGA 1NW1A 2OIBA 4BBEA 3R9DA 2VO3A 3KMWA 4J71A 5HZNA 3ZHPC 3SW4A 3PSBA 4DFYA 2B9JA 2OJGA 3PJ3A 5HQ0A 4KIKB 3MPAA 4N4SA 3QU0A 5EQEA 3NW5A 3PY1A 4XV2A 5DEYA 4KRCA 4I0TA 2QHMA 4YLJA 2JFLA 5A3XA 4MF1A 4YJNA 2YJSA 4FKOA 5A4QA 2WQNA 2H6DA 5AEPA 1NT2A 4UWBA 5AIRA 5KHXA 2CCHA 5E8TA 2XYUA 1WBVA 4WNKA 4Y5HA 3DFAA 3HMPA 4NFMA 3FI4A 3QTQA 1H28A 2UV2A 4G9RA 4M7IA 3R7UA 3OOMA 4Y8DA 4Q9ZA 3H9FA 3NUXA 4PMMA 3RCDA 4XNEA 4XP2A 3BI6A 3WYYA 3BGPA 3UDSA 4QQJA 1WBWA 4YZBA 2J0IA 1ZY4A 4J8NA 3VUGA 3RAHA 4B7TA 3MFSA 1QPCA 3HP2A 4OTDA 2QO7A 4G3DA 3TV6A 1UKHA 2QOKA 5HCYA 2WTJA 5TO8A 1U5QA 2GHGA 1B38A 3FMJA 4FR4A 3SXSA 1PJKA 3VJOA 4C4GA 5A4EA 5KX8A 1OIQA 2RIOA 4RIYB 3OUNB 1Y8GA 4PL5A 2YIRA 4CSVA 5CAOA 5AP1A 1FINA 2ETRA 2UZDA 5F1ZA 4RQKA 4O83A 1KUTA 1GOLA 4FNXA 2F2CB 2I1MA 3MY1A 4RPVA 4ACGA 2CCIA 4OTGA 3BHVA 1WBOA 1YOMA 4AG8A 5HE3A 3EWHA 1JWHA 2PMIA 3VW6A 4OT5A 4RRVA 2VX0A 4ZIMA 1XMLA 4NL0A 4O7YA 4QQ5A 5FQDC 1NA7A 1URWA 2R7BA 1PMEA 2Y6MA 2Q0NA 2XUUA 3HDMA 5LOHA 5LMAA 3H9RA 4M69B 2ZM3A 4AAAA 5TE0A 3BQRA 4BKZA 5HNIX 4CG8A 4FI1A 2OI4X 3DV3A 4UWCA 2GTNA 3BV3A 4D28A 5HIDA 5CVGA 3LLAA 3PA5A 2RFDA 4XG4A 4TKSA 3OXTA 3NVKI 4Z7GA 4EQUA 2B54A 2VRXA 4KINA 3UTOA 4WSQA 4YHJA 2WPAA 2EWAA 4F6UA 3UIUA 1XHAA 2WNTA 2DWBA 3FL5A 3ZUTA 3IW8A 4BDAA 4BI2A 5KMNA 4FEXA 4YZNA 4AE6A 1Q8TA 4O91A 2WU6A 2AYPA 2HZ0A 4CV9A 3BLHA 5HCZA 2VNYA 5E1EA 4DYMA 5CAPA 4QYGA 3R1YA 4NCTA 4O7LA 5CQUA 1W2CA 1BL7A 3GFEA 4JX3A 3KF4A 5ANDA 4EK6A 2RG6A 1A48A 2BFXA 3AXWA 4MX9A 3W55A 5KBQA 4EKLA 4EEVA 5J7BA 3PE2A 3S3IA 4TPTA 3MPMA 3W8LA 1Q8ZA 2XRUA 2YERA 4D9UA 1WBSA 4FT9A 3SGCA 3IOKA 1HCKA 4H1JA 4I22A 3W2CA 4O82A 3SW7A 4Q5HA 1Z9XA 4H3PA 1W2DA 3PIYA 5GIOE 1O6YA 4FKJA 5LMBA 1Q41A 4DDGA 4JX7A 4KKHA 3MFUA 3ZSGA 3QZHA 4LMUA 1FGIA 5LQFA 3U6IA 4AXCA 4K11A 5EHOA 3W0NA 3BE2A 3KQ7A 4U42A 1ND4A 4UXLA 4MNFA 3UODA 4DHIB 2YJRA 2VGOA 3EQCA 1EH4A 1XH7A 5ETCA 1ZLTA 4LFIA 4W8DA 3NYXA 4AA0A 2C1BA 4PP7A 1SVGA 2E9OA 4KSQA 4YTFA 5F4NA 4FKTA 4BTMA 1LUFA 2YACA 4AW1A 3Q5ZA 4IXPA 4NIFB 4LUEA 5TKDA 4QP1A 4R8QA 5BMSA 2IG7A 3R1SA 2H34A 2QOFA 2XJ0A 3GCQA 5L8KA 3IDBA 2B53A 4IWOA 4O0TA 2V62A 4LV8A 3V04A 5EQYA 2XBJA 1ZAOA 3KIOC 2R3MA 5E8ZA 3D0EA 3ZO2A 4A4LA 2G2FA 3O50A 3QAME 4MXOA 2UZEA 3CJGA 3WF8A 2IZRA 2PULA 4P5ZA 1OKZA 3EB0A 4XYFA 4C4JA 1DAWA 4IC8A 4XHKB 5JGBA 2SRCA 5EOBA 4Y5QA 3SXRA 4BTJA 5L2IA 2J0LA 2R3OA 2W1CA 4O38A 3L9LA 5B0XA 4YTIA 4F7SA 2H8HA 2NP8A 4IADA 4PL3A 2B9FA 3V6SA 3DDQA 2PZRA 1RW8A 4G2FA 4DFLA 5TOZA 3IW6A 1GAGA 4EZ5A 4FIIA 3U6HA 2O65A 3I5NA 3PG3A 3U9NA 3UG2A 3V5WA 2IW9A 1FPUA 4F64A 3KMUA 3RWQA 2CKPA 3DXPA 4CFXA 3NDMA 2C6OA 4WNOA 3GU8A 3OF0A 3Q4UA 4I4EA 4LYNA 2YCRA 1H1SA 3PJ1A 1F0QA 3PPZA 3R21A 5AMNA 4O4CA 2C3IB 4FMQA 5HTCA 1H1WA 4BIDA 3F3TA 3NUNA 4I94A 1T46A 3D83A 5AUXA 2GQGA 4G3CA 2PZPA 5AM7A 1XKKA 3KK8A 3QRUA 4HCUA 4L42A 4RVTA 3DAEA 2XM9A 3FKLA 3LCKA 4TYHB 4UMQA 4A06A 3ORPA 3LFSA 1GIHA 3A7JA 5C27A 3BV2A 1ZMWA 3FY2A 2WELA 4MNEB 3MI9A 4CEGA 5GINE 3KRXA 3RBWA 3UVQA 2WIHA 3ZRKA 1YVJA 4OBQA 2EXMA 5AM6A 1S9JA 3ZC5A 1WCCA 5FXRA 4JJRA 3SAYA 4IEBA 4CKIA 5CSWA 5HLNA 4I24A 3UPXA 2XIRA 4MF0A 3HZTA 2YHVA 2C3KA 3IS5A 4MXXA 5B7VA 3TUBA 2IN6A 4FV5A 2C69A 3MB7A 4BZOA 3K2LA 3R28A 5L2WA 2W17A 3II5A 4L3PA 2X2MA 3D7TB 3DB8A 2RGPA 4NKSA 2XANA 5JKGA 3GGFA 4KIQA 4MAOA 1JKLA 2Y0AA 3C51A 2QG5A 2PUNA 2UVYA 3LM0A 3M42A 4AA4A 5JFVA 4ZSLA 4XG3A 4CNHA 1YXUA 2XNPA 1ZY5A 3FMDA 3DDPA 2XZSA 4BJJB 2VTIA 4NJDA 4OGRA 3GCSA 3M2WA 3DBQA 4AZEA 2VU3A 2WQBA 3RPSA 2RL5A 4AZFA 4YC6A 4E3CA 3QX4A 5DPVA 2ZDTA 4DFNA 4EOKA 3NAXA 2OLCA 4ZJJA 5K5NA 3MS9A 4QRCA 1L3RE 2BZJA 2O2UA 3HRFA 2YM8A 3CS9A 4G5PA 4LOPA 2GQSA 4RX5A 2F7EE 4JG7A 2VUWA 3LIJA 4FTJA 4MWIA 3KKVA 3GU4A 4I5MA 2PVJA 2Z7LA 2WMAA 4B8MA 4HPTE 4LGDA 2CGUA 4RC4A 4O1PA 1V1KA 5DT4A 3IOPA 2QOLA 5IMXA 4B6LA 4FSUA 4FT3A 4EORA 4OTQA 5GHVA 4O86A 4AFJA 5HE2A 2BZIB 4Z55A 5IA4A 4EQCA 5IQGA 5CU6A 5L2TA 2ITNA 4HCVA 4S2ZA 2P4IA 3R8UA 5BX0A 4XBUA 3EQDA 2VWYA 2PL0A 1OL2A 4IAAA 3SOCA 4KS7A 4WG5A 4O7SA 3SDJA 3E3BX 2WMUA 3ODZX 3WZEA 4XX9A 3W2OA 5CEPA 2XMYA 2ZAZA 4QPMA 1IEPA 4OTWA 3ULZA 3V5PA