5AP2A

Naturally occurring mutations in the mps1 gene predispose cells to kinase inhibitor drug resistance.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
279
structure length
256
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Naturally Occurring Mutations in the Mps1 Gene Predispose Cells to Kinase Inhibitor Drug Resistance.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 256
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ap2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ap2A01
1ZXEA 4NM0A 4MXYA 4JG8A 4HGSA 3R8MA 2CKEA 4O0UA 3NMUF 5J5TA 3R8LA 3FI4A 4ITHA 5A4QA 5IDPA 4BDGA 5EOBA 2X0GA 3CIKA 4KKHA 4D4RA 2VWVA 3HDNA 3PUPA 1IAJA 4FKSA 3VS7A 3F5XA 4DEIA 2YERA 3HP2A 3NIZA 2JIIA 2F4JA 2W1FA 3ETAA 5HG9A 3QQHA 3KRJA 5FTGA 3ELJA 3PPJA 4ZTQA 5CAQA 4O91A 4ZXTA 1S9JA 3ZLWA 3LFEA 1P2AA 3VS5A 2QHMA 2W7XA 4PDSA 3I7CA 4QOXA 3RHXA 4BDAA 2IW8A 2EXEA 5EOLA 3HAMA 1FINA 4CLIA 3UVRA 1XH6A 2XUUA 5ITAA 3BQRA 4NFNA 2CNVA 2OZAB 3LFSA 4XP3A 4ZSAA 5IEXA 1YDTE 3UIUA 3UO5A 3PP0A 4FOBA 4FSQA 2GTNA 3BGZA 4KB8A 4NEUA 4RIWB 3ZUUA 4AWIA 4MBJA 4NIFA 3TZ8A 5CF5A 4IAYA 4ZJIA 5J9ZA 5JN2A 2UW5A 4D4SA 4HPTE 3NVMB 2BTRA 4QNAA 1YWVA 3BCEA 3SW4A 3I7BA 5EDRA 4ANOA 4D1XA 2B53A 2WQNA 3F2NA 4FVPA 5M06A 3DNEA 2W9ZB 1UKIA 1V0BA 3D2KA 1RQQA 4KAOA 1HCKA 4RFZA 3PXKA 1H24A 2ITNA 3WE8A 1UU7A 2X4ZA 2ZMCA 5AP6A 1YXTA 2XK8A 4FSWA 3W16A 4DGOA 4Z55A 2ITTA 4O7WA 2EB2A 3OXTA 5IMEA 3K3JA 5HNGA 5ICPA 4AE6A 2QOBA 4FIGA 4L6QA 5KNJA 4M68A 4CQEA 3OWJA 4UMUA 2UZUE 4QMSA 5D10A 3WZJA 2CNQA 3RINA 3QTZA 3S00A 1JVPP 3VJNA 5KBQA 3DGKA 2C3KA 2ITWA 3PP1A 3NUYA 4JI9A 3TJCA 3VW6A 3W18A 3FMDA 3FV8A 2WO6A 1U54B 4DITA 4AA5A 3EQPA 4TYHA 1PJKA 4YTFA 3R22A 4FUXA 3KF4A 4RIXA 2QU6A 4J8MA 4MCVA 4EC9A 2WAJA 3EQRA 4O7LA 3E87A 5H3QA 4N6YA 2OJJA 4X3JA 4ANNA 5I4NA 5FXSA 3A4OX 2ITQA 1R0EA 2Z60A 2A27A 5KO1A 4I5PA 4IVBA 5JT2A 4QTDA 3BWJA 3GOPA 3KN6A 1CSNA 4QMVA 1M2PA 3REPA 3RPSA 3W2OA 1Q8UA 3KU2A 3PTGA 4C0TA 3CTQA 1VEBA 5EHLA 4EH4A 2QVSE 4D5HA 1RE8A 3GNIB 2Q83A 4O7SA 4RIYB 3ZDUA 2UW9A 3A7IA 3W8QA 2C1AA 4RJ8A 3WIGA 1XJDA 3EL8A 5AP5A 3KGAA 5L4QA 4Y72A 4YPSA 2VZ6A 3KXNA 3UC3A 4DTAA 4IB3A 4TXCA 3C51A 4D0XA 3ORPA 2YIYA 3A7HA 4JX7A 4E1ZA 5L2SA 4YZMA 1DAYA 3BYOA 3DY7A 3PFQA 4XV1A 4M69A 3AC4A 3QGWA 4GFGA 1U59A 4WHZA 3TNIA 5I9VA 3I5NA 3L8XA 3O50A 5L6OA 2WKMA 3FSKA 3AC8A 3PJ8A 4CKJA 2P2HA 1LR4A 4IMYA 3Q2JA 4IZAA 4XG8A 5K0KA 3K3IA 4DGLC 4RC3A 3V8SA 3DOGA 3CJFA 3MS9A 3HMOA 4ZY4A 5E1SA 3EWHA 2YITA 1ZMVA 4FGBA 4QMTA 5AP4A 4PMPA 3DU8A 4WUAA 5HCXA 4ASDA 5EQYA 3UZPA 4E93A 2YIXA 3PE1A 5D11A 4BR3A 4LV5A 4APPA 4TYGA 5EQEA 4PDOA 3EKKA 4QP6A 3N4VA 2HZNA 3NUNA 5EH0A 2YWPA 4FSMA 5K5XA 4JQ8A 2P3GX 3VBQA 3WARA 4NZWB 3UQFA 5E8ZA 3N4TA 4QPAA 4BCOA 2KTYA 4I20A 3WYYA 4NYEA 5CYIA 2HXQA 2QHNA 3I5ZA 1YVJA 1R1WA 2OGVA 3MFTA 2XKFA 3G90X 3PJCA 4PPCA 1P4FA 1YOJA 3SHEA 3NGAA 3HL7A 4DEDA 3POOA 5DT0A 4USFA 4FUYA 3LM0A 4QMMA 4LGHA 3D5UA 3EQDA 3R7IA 4F9BA 3CPCA 4BBFA 3C7QA 1PKGA 4YTCA 5B2MA 2DQ7X 3SA0A 2FSOX 4I22A 4FKJA 3AD6A 4GV1A 2C68A 3P5KA 4FOCA 4LOQA 5HO8A 5C1QB 4LGDA 4G3FA 3FMMA 3CGFA 4MNEB 3R9DA 4V0GA 3AT3A 5I0BA 3MESA 4PUZA 2IW6A 2C3JA 3D5VA 3Q3BA 4E73A 4K6ZA 4ZMEA 3ALOA 2ZB1A 5ANKA 3MVJA 5ANDA 5TOZA 4DF3A 4ONAA 2YIQA 1DI8A 3GP0A 2F2CB 4FV2A 3T9IA 3VUDA 5EW3A 3FLNC 3AQVA 4DEAA 3HA6A 3B2TA 3IONA 2JKKA 4G5PA 2HELA 4K9YA 3VO3A 3EZVA 1PXJA 5E92A 1YHSA 3GQIA 2QG7A 3TCPA 5HE3A 1ZWSA 1OUYA 3NUUA 2PMOX 3GU7A 4BTFA 3OOMA 2ONLA 3LE6A 4EZ7A 4HNIA 5LMBA 2J4ZA 4RQKA 2R3PA 2IN6A 1U46A 1GZNA 2J0KA 4FKOA 3MH3A 4TNDA 4E4MA 5CANA 1Q8WA 2BRNA 5E8UA 3PY3A 3BIZA 5AR5A 1ZOGA 2BDWA 1ATPE 1PYXA 3F5PA 4GMYA 1H8FA 5E8YA 5FBOA 4QYHA 3F9NA 3GC8A 2UV2A 5CEQA 2C6MA 4R1YA 2PZPA 3M11A 3PZEA 2PULA 5GIOE 5L2IA 4OT6A 1DAWA 1XH5A 5AV2A 3LM5A 4FV7A 4CMOA 4PTGA 4QMPA 1KSWA 1J91A 1IG1A 4WNPA 3UBDA 2VTOA 3OFMA 1JLUE 2XF0A 4TWNA 3OEFX 3HA8A 4G3EA 4YJUA 4EI4A 2XP2A 3DXNA 3GU8A 3QTQA 3QCXA 1IASA 2UUEA 3VS0A 5BVEA 1ZARA 3HMNA 4XV2A 2V5QA 4J99A 4IM3A 3KXZA 2IG7A 4L46A 4OAUC 4B8MA 3SW7A 2BKKA 3UOKA 5CAVA 3O0GA 4QMUA 3OWPA 3FZ1A 3I6UA 1PXMA 3QD0A 2OSCA 1ZYLA 3BGQA 4S32A 4I5MA 2ZOQA 1HCLA 1M2RA 3MY5A 4R1VA 5DEYA 3F2RA 5AR8A 4X2JA 3R9RA 3RZBA 3SXFA 2J0JA 2VWIA 4I6BA 2C5NA 2C30A 4KSPA 4RJ7A 3HV3A 2KULA 5AX9A 3FI2A 2C5VA 4PP9A 4ZEGA 4BCMA 4ZTMA 3E3PA 2A0CX 4GEOA 3ITZA 3NW6A 4YC6A 1XQZA 4RWJA 3RM7A 3W1FA 5L3AA 1GAGA 3BE2A 4JBQA 1K3AA 3LJ1A 4LL0A 4G6LA 3FKNA 4USDA 4ALUA 4DCAA 5KBRA 3VNTA 2YZAA 5AV1A 2GPHA 4NSTA 4AZTA 4FG8A 3NS9A 3OP5A 4LV8A 3CP9A 4O7TA 3ORIA 4M12A 3UDBA 5CEIA 5CXHA 3QZFA 2HY0A 4NJDA 4O6EA 2ZM3A 4KBCA 4KIQA 3WILA 3VF8A 5CT0A 5FXQA 1Y8GA 1A9UA 4K8AA 4L42A 2R3FA 3WZDA 1OIRA 4C2VA 2GHGA 3RP9A 1UA2A 4UZHA 4WUNA 5DA3A 4K1BA 4UMRA 2QU5A 3BLRA 3HRBA 4QYFA 4L7SA 2XKEA 5CI7A 4L68A 1CKIA 4IDVA 3VUGA 2W5HA 4FV4A 1TKIA 1HOWA 1ZMUA 3DDPA 5DNRA 2C0OA 4FR4A 5HG7A 4I92A 2GS6A 3GQLA 4BKZA 2GFCA 2Q0NA 3HVCA 4FV0A 4QT1A 4UBAA 4DINA 4Y83A 3MI9A 3IW4A 4O86A 4E4XA 1UNGA 3BHHA 2VWXA 5FWKK 4RPVA 2UZVA 4LRJA 2PMIA 4C4EA 1H28A 1GZ8A 1J3HA 3QCSA 4GIHA 2BUJA 4YU2A 1F0QA 1GIJA 3RJCA 2VGOA 3C4FA 4FL3A 4LL5A 4GH2A 3GFWA 3PG1A 4X6QC 2P4IA 5AMNA 5EKOA 3GGFA 2QOLA 3VULA 4ZZOA 5J95A 4OAVB 2Z8CA 4O38A 4QMOA 4AOJA 3LLAA 4BI1A 3EFKA 3ZO4A 5AIKA 1XKKA 3QC4A 2C47A 5DPVA 3RKBA 3LOKA 4FNYA 3MH1A 4BC6A 4D0WA 5JFSA 4MQ1A 4O7RA 1OECA 5K3YA 4CCBA 4W4XA 4F1TA 2P0CA 3GT8A 4KBKA 4IVDA 4HCUA 4O6LA 4FYOA 3TKUA 2ITPA 2JEDA 1PYEA 1MRVA 1OGUA 1CKJA 1XH8A 2QLQA 2YIWA 3DAKA 3W10A 4G3CA 3P7AA 5CZHA 4YURA 3MN3A 4QMXA 3BLHA 4IC7A 4JR3A 3E3BX 1CDKA 5ANIA 5IG1A 2CGUA 1KWPA 2P2IA 2XYUA 1FGKA 2YJRA 2QI8A 4Q2AA 4U5JA 3Q6UA 5IQHA 3Q5IA 4ZSEA 3R7EA 3OUKA 4DGNA 5KMKA 2YDJA 3KMWA 4MBIA 3QYWA 4RC4A 2Y7JA 4CV8A 4I21A 4U97A 2XS0A 2GS2A 2JAMA 4CMTA 2YABA 3R28A 4BVUA 3VQUA 4HW7A 2X1NA 5IEYA 1E1VA 4F9CA 5IQGA 3Q5ZA 5HIEA 3R7YA 2I0HA 2Y8OA 3Q9WA 2QO2A 4P7EA 4PMMA 3MVHA 4FIIA 5IA0A 4WOVA 4FYNA 2WD1A 3BHUA 3I4BA 3QQUA 3P79A 4JDIA 4LRMA 4OTDA 5CSVA 4MXZA 3VAPA 4CFMA 2G2FA 4FTMA 4NTSA 3Q9YA 1YHVA 2ZV8A 4U40A 1OPJA 3NNUA 2WIPA 3NIEA 2B1PA 3MPTA 3DZOA 2PVHA 2R3RA 3Q2MA 4X2KA 1ZZ2A 5A3XA 4Y95A 2C6KA 2NRUA 3R04A 3IW6A 4TPTA 4ZTHA 4ANSA 2C6TA 4OTHA 4F7NA 4W4YA 3V5JA 4BYIA 2GMXA 4KINA 4YUQA 3R1SA 3NYNA 4FSUA 5IUIA 4HVHA 4ACHA 4NIFB 4D2PA 3ZZWA 3EQGA 4ZLOA 2HWPA 4FICA 5AUYA 4RQVA 2GNHA 3FY0A 3BBTB 3FC1X 4QP7A 5F9EA 4NH1A 4BHNA 2WTWA 5EFQA 4ZK5A 1KE9A 2X8EA 3TG1A 1L8TA 2GQGA 5AAEA 4QP2A 3V51A 1JBPE 4HGTA 5EM6A 4E5BA 4U6RA 5LVMA 4Y85A 3IW8A 1UU9A 4D55A 3QF9A 4I0SA 4AS0A 3EN6A 3C4CA 2CLXA 3L8PA 3IW7A 4GK3A 3KA0A 3FPMA 4K0YA 3VBXA 2EU9A 2V55A 4AGWA 4EYJA 2QG5A 4O83A 5EYKA 5BYYA 4S34A 5JFVA 3LMIA 4KS7A 1H4LA 2VD5A 4RJ6A 3HYHA 5CS6A 5LVNA 5FTQA 2XNEA 2BZHB 2F7ZE 3MJ2A 4WD5A 1J7LA 4FSRA 4KIKA 4M0YA 4LQMA 3P1AA 4FV3A 3OT8A 4TKSA 3TIZA 4TYHB 3QZGA 1YOLA 4DEHA 4F70A 5JK3A 3LMHA 4ZTSA 4RIXB 1H1WA 3QXOA 5IKWA 4D1SA 4RZVA 2Z02A 4YZDA 4BDDA 5M56A 2UW7A 3R73A 2VTHA 4DG3E 4A9YA 3FC2A 3DCVA 1TQIA 4MH7A 4AT3A 5T6KA 2YM7A 3N51A 2ZVAA 3QHWA 4FV5A 2W1HA 5HVJA 1J1BA 1NVRA 4MWHA 4RLLA 2QKWB 4A9UA 5HTIA 1JNKA 4FT0A 4DLJA 5JRQA 4YJVA 4R7IA 4DH1A 5FLFA 4BB4A 5E4HA 4YC3A 1QPEA 3VW8A 5CI6A 3MA6A 4AA0A 4DTKA 3QRIA 4IX6A 3ZUTA 4AW0A 3F61A 4CKIA 2RG5A 4BTKA 3RALA 5L6PA 3Q4CA 2R0UA 3ZTXA 2ITUA 2WNTA 3A62A 3OW3A 5AX3A 3QWKA 2UZTA 4EBWA 2B54A 3GOKA 4JRNA 3EKNA 3KEXA 4YJRA 1YRPA 4FKRA 4X3FA 4F9YA 3U55A 5C8NA 2OFUA 2OK1A 2WTKB 2RFNA 1KV1A 3B2WA 4HYUA 4N6ZA 3TZ9A 4U9AA 3BRBA 2XKCA 1OKYA 3QTIA 3R1YA 2C3IB 1GY3A 2A1AB 4RBLA 4XG2A 3RZFA 2CGXA 3COIA 1YXUA 5I5ZA 3BE9A 3UYSA 4ARKA 1XHAA 2XK7A 1NVQA 2VWBA 2BR1A 3DB8A 4JAJA 5EI8A 4PP7A 2FA2A 3QTXA 4MNFA 5HBHA 4FNXA 4QMQA 4F9AA 2HZ0A 5AA9A 4F4PA 3IKAA 3W2RA 4HYSA 2Z7RA 1MUOA 3ZLSA 2QOOA 5C8KA 4U3YA 5CNOA 4DFYA 3LCSA 1KE8A 5J79A 5K4IA 1KUTA 5BNJA 3OHTA 2VN9A 4RSSA 1B38A 1T45A 2CN8A 3IPHA 3MJ1A 2ITOA 3D14A 3GVUA 5DH3A 1WBSA 3O7LB 4IWOA 3ORLA 4AN9A 5A4EA 4R8QA 2GQSA 4DT9A 1Q97A 2IJMA 1BYGA 4JDHA 3NDMA 3TNQB 2OICA 2QQ7A 5CAPA 2CCIA 4O82A 2VTIA 5AFVA 2PU8A 1MRUA 3Q4UA 3QL8A 4RX8A 4TYIA 3M42A 3TM0A 3H9RA 3P9JA 5AUUA 4IH8A 3OROA 2J5EA 1OVEA 1JOWB 2J51A 4MVFA 2WGJA 4H3BA 4YC8A 3R83A 3ZSGA 3F82A 3QQGA 3OUNB 4E5AX 4Y46A 3LFCA 4V0GB 2G15A 3EQFA 3F69A 1H0VA 3KK8A 5BVKA 5ACBC 4ANBA 2CNUA 3DKCA 5AIRA 2FGIA 4U79A 3S95A 1W84A 5T68A 3JR1A 3O8PA 4Q9ZA 4MF1A 3NUAA 1OKVA 2HOGA 4F1MA 3K5VA 3COHA 3ZUVA 2Z7QA 4YZBA 3RK5A 4AGDA 4AOTA 5IEVA 3PA4A 4DFXE 4FZAB 2FSTX 4HPUE 2YM3A 4BWKA 2XM8A 1P4OA 3EQBA 4IB1A 4BIDA 2IZRA 3H9OA 3PA5A 5KKRB 1XR1A 5JGBA 2G9XA 3AC3A 2C6OA 3ORZA 5J7BA 5IDNA 3VHEA 5LMKC 3G6HA 3FXZA 4HOKA 1APME 5KMIA 1GZOA 2B0QA 2QOHA 2WU6A 2QCSA 4XYFA 4Z9LA 5E8XA 2BPMA 4V01A 3W2SA 5DN3A 4G16A 1CTPE 4O7ZA 4CV9A 3V5PA 4ZSLA 3ZCLA 1QPJA 4CGAA 1M17A 3ZC6A 5L8JA 5KMOA 3MFUA 1Y6BA 3PYYA 4GK2A 5FXRA 5GJGA 3FZPA 3ORNA 5M44A 1JKSA 3FHRA 4H3QA 4AX8A 3BYSA 2HZ4A 2YCQA 3N9XA 3UNZA 4CSVA 2CDZA 3BPRA 2O3PA 4UX9A 2I40A 3OXIA 4DBXA 4PQNA 5HO7A 4FTOA 4OBQA 4YR8A 5J87A 3TNWA 5AADA 4ZLZA 3KULA 2IVSA 2WMQA 3WYXA 5CENA 4JDJA 4DFUA 5HICA 4YNOA 2G2HA 2X9EA 4X2GA 3R30A 4FG7A 4UY9A 1PMEA 2RFDA 4FNWA 2BFXA 3H0YA 3NUSA 1W98A 4QTBA 2HWOA 5M4FA 4O1PA 5BUIA 2BILB 3C4ZA 2WQBA 3KFAA 3PLSA 1FVRA 3MV5A 3QFVA 4KD1A 5KUPA 3F3ZA 1PF8A 4O0RA 1ZAOA 4AZWA 4ORKA 4O22A 3MIAA 5HD7A 5HOAA 3V5TA 1VYZA 2F49A 4ZLYA 4FKPA 4EH3A 5FEEA 4PRJA 3UP7A 4XJ0A 3MB7A 5HNBA 2ZV2A 4LUEA 4MWIA 2RSVA 2O65A 5IA5A 3RPOA 4F64A 2QONA 1OITA 2JAVA 2B9HA 2PPQA 4Q5EA 4O7VA 3ZONA 3TXOA 4HVDA 4FEUA 4GU9A 4EH7A 4IDTA 4OBPA 2ERKA 3QWJA 4YP8A 3UE4A 4F08A 3ATSA 4IVCA 3CSVA 2OF2A 2W99B 5KHWA 3ODYX 2VX0A 4YJTA 4E6AA 5IQIA 4V04A 3EQIA 3E63A 5AP3A 2EVAA 4FKQA 3OTUA 4EHVA 2WMTA 3OY3A 4FX3A 5DOSA 2I0EA 3HRCA 5C9CA 3ROYA 4QMLA 4TW9A 1URWA 2QKRA 1M7NA 3GCQA 1OL7A 3TUDA 5M55A 4OR5A 3RWQA 4OBOA 2XIZA 4C4HA 5J7HA 3P0MA 5J9LA 1PMNA 2OW3A 4MXOA 3LVPA 4Y5QA 4B4LA 4EZ3A 3RNYA 4P5QA 3KCKA 3ZXTA 1W8CA 5D12A 1YOMA 2YWVA 2F2UA 3G0EA 2OFVA 1P14A 2VWYA 2QOIA 3A60A 3D7TA 4LI5A 4TWPA 4TL0A 3ZU7A 4RX5A 1P5EA 4RWKA 4OUCA 5A6OA 3F3UA 3NUPA 2PUPA 4FZDB 3S0OA 3UOJA 3DKOA 1XBAA 5BVNA 4I93A 1REKA 5A4LA 4EOLA 5ANOA 3OMVA 4UN0C 2OXYA 2P55A 3O23A 3PY0A 5K0XA 2R7BA 4D2SA 2CN5A 1BL6A 4M14A 4CYIA 1YW2A 5EW8A 1URCA 3PDTA 3NR9A 4JQEA 1W82A 4C4GA 4EJNA 3NRMA 2VTPA 3ZBFA 3U6IA 2EB3A 5HLWA 2OG8A 2PZ5A 2UVYA 3ZFMA 4CMUA 1XH4A 4F6WA 5HX8A 2VU3A 2XEYA 4XH6A 5JGAA 1WBWA 1PXLA 4G3GA 2C6IA 3KXGA 2PZYA 2WMSA 4GT5A 1OB3A 4ZSGA 3VBTA 4A06A 1PRYA 4ASEA 3IG7A 3RVGA 3I60A 3CJGA 4RZWA 3QQJA 4WG3A 2H9VA 3H4JA 2PVFA 3MH0A 2LGCA 3R00A 2EXMA 3DAEA 4C62A 3S2PA 4N4SA 4XG4A 3PSCA 5CEOA 3S3IA 4EHGA 2WMVA 2YCSA 3DT1A 4AW2A 1H27A 4RMZA 2XNBA 1ZMWA 2XB7A 4XP2A 4IB0A 1W0XC 2GNJA 2NO3A 2YM6A 4ZY5A 4ZMFA 2X2LA 2Z7LA 5CVHA 3RAHA 1OIUA 2O2UA 2YEXA 2G2IA 4YHJA 3ZLYA 2B55A 3O8TA 2YA9A 1JWHA 3A7JA 3RCDA 5EM8A 5M4IA 2J2IB 4QMWA 4E8AA 4RX7A 4R5SA 4HVGA 1FMKA 3VQHA 1FVTA 3K54A 4BGHA 2XRUA 3P78A 1GIHA 4U8ZA 3CTHA 1I44A 4LOOA 4DN5A 2RGPA 4UV0A 5DYJA 3NX8A 4XHKB 2YLFA 3DB6A 4AF3A 3LQ5A 3OXZA 4FEXA 4TYEA 3QU0A 4DFZE 3KXMA 4ANQA 3EFJA 5GZ9A 2OIQA 3QD3A 4FKTA 1ZYJA 3IECA 5LXMA 4FSYA 5FQDC 4KKEA 3W2QA 3SRVA 2WMWA 5HIBA 3SVVA 4FVRA 5DFPA 3QC9A 3SC1A 5DI1A 3Q96A 2AYPA 1WAKA 3VS4A 3OBJA 4BCQA 5LWNA 3GC9A 5F1ZA 5A6NA 4OW8A 5HCYA 5HEZA 3E93A 4GVAA 4H58A 3RPVA 1R39A 2YN8A 3BGPA 2OLCA 4CG8A 4XNEA 3H3CA 2Y4IB 3Q9ZA 1L3RE 3ENHA 3LCKA 4FC0A 3D9VA 4CD0A 5JH6A 1O9UA 3P7CA 1Q61A 4RX9A 3FMKA 3EFLA 5DR6A 3FMLA 5GHVA 4IJPA 2W9FB 3C0IA 3U9CA 4PDPA 4AZEA 4JAIA 2UZBA 2J50A 4ZTRA 4ACDA 2GU8A 1JPAA 2B4SB 4O0SA 4YJQA 3F5GA 1ZYSA 4EOSA 2PVYA 4IBMA 3UNJA 4D5KA 1BMKA 5HTBA 3UQCA 1PXKA 3C1XA 3HNGA 3KC3A 4MKCA 4XV3A 4MAOA 4FIJA 4KIKB 4LYNA 2B7AA 3C4WA 2UZOA 2BHHA 4D9UA 5FDPA 4R7BA 3I81A 4AP7A 2WEVA 5ETIA 3U6HA 4GW8A 3DK6A 3TDVA 5C4KA 4L01A 4AFEA 4EQMA 5FP5A 3MPMA 4CTBA 5AM7A 1U5RA 5E8VA 3D83A 2XIRA 4BIEA 5I9ZA 3VRZA 3DBCA 4E5WA 3BI6A 3PXZA 5C03A 3ERKA 1TVOA 3RI1A 1Q24A 4CRLA 2QC6A 4PTEA 5FEQA 4AZVA 5HBJA 3SG9A 3AMYA 2JLDA 3VUIA 3FL4A 5CXZA 1OL5A 4JIAA 3LIJA 2E9OA 5IQEA 5CU0A 1GNGA 2R3NA 4UMQA 4EOPA 4AN2A 4ZS0A 3PJ3A 4ITIA 5IQBA 3NLBA 5JZNA 3N4UA 5HQ0A 2HAKA 3KL8A 4M0ZA 2XYNA 2GHMA 2PYWA 4A07A 5DR2A 2JKQA 4WRSA 4X3FB 3TKHA 1OBDA 3KMUA 2ZDUA 3C13A 4IAAA 2VAGA 3FLQA 1VR2A 3LFNA 4FTIA 4LM5A 3LPBA 4NFMA 5BMMA 5IA2A 5HNIX 5CY3A 3EYHA 4C8BA 4FV6A 1G8SA 3M2WA 4X2NA 2W4JA 3QX4A 2JDRA 3CY3A 3FDNA 4IAKA 4BDCA 4EQUA 4TWOA 4JIKA 1SVEA 2JD5A 3UIXA 3ZRMA 5I9WA 4IAZA 4GKIA 4I41A 4PF4A 5G1XA 4FSTA 2R64A 3AOXA 3E62A 4NT4A 5HLNA 3R2BA 3U4WA 3EZRA 2QNJA 2W0JA 3F66A 3DQXA 5AR2A 3ULZA 4KBAA 4M8TA 3AC2A 2JDTA 3Q04A 4YHTA 4YBJA 4UWYA 1Q8YA 5BUJA 4EQCA 2LAVA 3DBFA 1R3CA 2XIYA 4J96A 4OTQA 5CTPA 3TWJA 2XJ0A 3FZOA 1TQPA 2OI4X 3AC5A 2CMWA 3ET7A 3GU5A 2RL5A 4GYIA 2JBPA 3ZDIA 1WBVA 3FZSA 4HCTA 3ZEWA 5GJFA 3T8OA 4E3CA 2YAKA 2BRBA 2X9FA 4FKLA 3H9FA 4ENYA 5H2UA 1WMKA 4EK4A 2PVMA 3L8SA 4TWCA 4CT1A 4UXLA 4F09A 3NCGA 3ZZEA 5ANJA 3HECA 4MTAA 4BDBA 2C3LA 3MVMA 4C4JA 2E9VA 4D2WA 3EN7A 4XS2A 2UW3A 3UMXA 2W4KA 4UEUA 2W4OA 4LGGA 4X2FA 3R9NA 3P4KA 3PXQA 4H1JA 3V5LA 5J5SA 3KVWA 5CNNA 5EHYA 4KSQA 3GB2A 3SDJA 3T3UA 3VUMA 3RPYA 5DRDA 3LFAA 3PRFA 4GG5A 3CR0A 4WA9A 5EM7A 4BCPA 3NW5A 3D5WA 2E9PA 3ORTA 4FIHA 4P90A 2IZTA 4CQGA 3DJ5A 3CKWA 1SM2A 2RFEA 2X2MA 1IR3A 3UVQA 4O96A 4DHFA 4AW1A 5EDQA 2BCJA 2BAKA 3A99A 2CLQA 3FKLA 3CTJA 4FK6A 1ZYDA 2WTVA 3QA8A 4JBOA 5AJQA 1H1PA 1R0PA 5JFXA 4QMZA 2QR7A 4BCFA 1FVVA 4PPBA 5HD4A 2ETKA 2BIYA 4R3PA 4RVTA 3GCVA 3DTCA 5DE2A 2WEIA 3BEGA 2R3LA 3DA6A 4OLIA 5AP7A 3IO7A 3W2PA 3ORMA 1JSTA 3E7VA 5ANEA 3P23A 3SX9A 3FLWA 3AMBA 4A9RA 4MEDA 4DH3A 4WBBB 4EOMA 3L9LA 1H1RA 2IZSA 1W7HA 4JL9A 4MX9A 5HESA 5HLPA 4IB5A 3LXLA 1H01A 5CSHA 4U7ZA 3COMA 4ZJVA 5KMJA 3DJ6A 3FXWA 4KNBA 4FZ7A 3TIYA 4IM0A 5ETAA 3MBLA 3ORXA 4FODA 4OTWA 3DS6A 1Z9XA 4TY1A 4YO4A 2BHEA 5FDXA 1OL6A 1OPLA 5K9IA 3OWKA 3MSSA 3SXRA 4YMJA 1Y57A 2OIDA 4W8EA 2F7EE 1MP8A 4FTUA 2J7TA 2W05A 4D1ZA 1ZOEA 4WNOA 3NNWA 4NCTA 3WF8A 3KULB 2G1TA 2XA4A 3CLYA 2E2BA 3BKBA 2XKDA 4FL1A 2XM9A 3W33A 3ZFXA 2YM8A 3FE3A 2P33A 2CGVA 3F6XA 3QZIA 1A48A 4R3CA 4JS8A 3OBGA 5KHXA 3QGYA 2OZOA 4ACCA 4D2RA 4K18A 2VTRA 4UYNA 3F2AA 1ZYCA 4DFLA 2DUVA 3TV7A 3G33A 3WIKA 4X21A 3SOAA 2GS7A 4OTRA 4RVMA 5LMKA 2IVUA 4EH9A 5M09A 3HMIA 4FEVA 4I4EA 4JJRA 1UNHA 4BCKA 4QP1A 2XMYA 4KIPA 2V7AA 5IA1A 3PRIA 3ZOSA 3C5IA 5LVLA 3R2YA 5B7VA 3R9OA 2VWUA 4QQCA 5BVOA 4XG9A 1R78A 4PNIA 2VNYA 4DT8A 3ANQA 3QQFA 4TTHB 2C5OA 3AXWA 4AG8A 4A7CA 5I3OA 3QTWA 5DMZA 3A2CA 3PIXA 2Z7SA 2B9IA 2Y0AA 1UVRA 2QURA 5LARA 3RPRA 4F7JA 3ZBXA 5BYLA 5BVDA 4O0VA 1UWJA 3O51A 1PXNA 2VWWA 3MPAA 2ZYBA 4F6SA 4GRBA 4NKAA 3QRJA 3V04A 3HRFA 4XV9A 4EORA 3F88A 5A14A 5F94A 2XNMA 3MGYA 4YJPA 1H1SA 3UG2A 2PUUA 1YKRA 2JDVA 3PVGA 4ASXA 3L9PA 5HIDA 3AT2A 5JGDA 4UB7A 4LUDA 4BDIA 5CF6A 2WOUA 5T3QA 4WT6A 3UYTA 5HBEA 3QKKA 5KKRC 5LQFA 2XNPA 5L8LA 3KKVA 1PMUA 4BI0A 4EKKA 1PXPA 1WVXA 2OWBA 2QODA 3D7TB 1S9IA 3KN5A 4IX4A 3DTWA 1KE7A 4EEVA 4BZDA 3I6WA 3WZUA 3PIYA 3Q4ZA 1V0PA 4FT3A 3FQSA 3FL5A 4CKRA 1ND4A 2V62A 4HGEA 5B2LA 3W32A 2PHKA 2PVNA 5DHJA 3FQEA 3KY2A 2XJ1A 3RWPA 4Y73A 3UQGA 4FTTA 3SGCA 4EWQA 5BMSA 2UZNA 5L2TA 2JKMA 4U81A 3ZYAA 1OI9A 3D7ZA 3FJQE 2CJMA 5KMNA 1PKDA 2R3HA 2W5BA 4R5YA 5IF1A 4FTJA 1NT2A 1PMVA 2DWBA 3MW1A 4U45A 3RCJA 2VX3A 4BZNA 2VV9A 3FYJX 4JRVA 2Y9QA 3QQLA 1K9AA 3LFFA 3PWYA 3R0TA 3QTRA 3PSBA 4PMSA 4U44A 4YGAA 4R78A 4YLKA 4D4VA 5CU2A 3AG9A 3MY0A 3VWAA 1VZOA 1H08A 2XBAA 3POZA 4G6NA 3CD3A 3TEIA 3V6RA 5E8TA 4EHZA 4FNZA 4F65A 4QP8A 3Q4TA 4FT9A 4L45A 5IA4A 3G15A 4BZOA 4F0FA 4NM3A 4YJOA 3OF0A 1K2PA 2GTMA 4KABA 5EDPA 5FM3A 3B8QA 4U42A 3PG3A 2W1EA 2UW0A 4GVJA 3DPKA 2YCFA 2VWZA 3U87A 3R1NA 4EKLA 2Y6OA 4Z3VA 2R5TA 3EN9A 3WF5A 5GZ8A 5F4NA 4BY9E 3OCSA 2Y4PA 1QPDA 3CCNA 4CEGA 4AW5A 3FBVA 4U0IA 2HW6A 3ID6C 4IHPA 4JBVA 4NTTA 4YLLA 4EUUA 3U54A 4FTQA 2WU7A 3MTFA 4LG4A 5IUHA 3HV7A 3MB6A 1H0WA 2BALA 4CFUA 2YDKA 2VO6A 1OKWA 4ZZMA 3UTOA 3UZRA 4QTEA 4F9WA 5DT4A 3LKMA 3V5QA 1JSVA 4CZYB 1OUKA 4BWXA 2UZDA 3RNIA 3FUPA 4CTCA 4MXAA 4UWBA 1GOLA 5HVYA 3ZC5A 2J90A 3BELA 4MD9E 3HMPA 5FTOA 5E1EA 4RWIA 2X8DA 3H10A 3OTVA 4MK0A 2EXCX 3SAYA 4RIOA 4BF2A 4D2TA 5CALA 3PIZA 1YI3A 4S33A 4DH7A 5EW9A 3NW7A 3UP2A 1UWHA 2WMUA 4BBEA 3E8NA 3IS5A 3DXPA 2A19B 3NYXA 3NNVA 4ZSJA 4TYJA 3C9WA 3E8CA 5K5NA 3LXNA 2QD9A 3LHJA 4UXQA 3C0GA 3PJ1A 3UOHA 4YBKA 3KB7A 2WFYA 3SRVB 1H1QA 5BQ0A 4Y5HA 2OJIA 4GKHA 2WTIA 3UO6A 2WB8A 4ZP5A 4JDKA 2RG6A 2XVDA 3TV4A 5CT7A 4J71A 2YM4A 3SOCA 4AGUA 4EOKA 5HKMA 3UJGA 4EOJA 1LEWA 4U43A 4LMUA 5AR7A 2PWLA 3GU4A 2E9NA 4FSZA 4D4YA 4AAAA 2VNWA 3MIYA 1E9HA 2C1BA 2JKOA 4DGMA 2ZMDA 3NPCA 3A8XA 3BBWA 4APCA 3UODA 1YI4A 3MFSA 5CVGA 3II5A 4BYJA 2VTAA 2ZM4A 3IGGA 2I0VA 1Y91A 2XCHA 5CEMA 2W5AA 3KRWA 4XBUA 2PE1A 3T9TA 5DWRA 1FQ1B 2ETMA 2BMCA 4FTLA 4Z16A 3FEGA 2J0LA 4MXXA 3AGMA 1GJOA 4FKUA 3WF6A 4AQCA 4C4IA 5IH5A 1M14A 5CSWA 1A06A 5JRSA 3LQ8A 4I6QA 4B9DA 3JYAA 4BCJA 4NL0A 3ZM9A 5B0XA 3ZO1A 5ETCA 3GCSA 3R6XA 2WQEA 3PWDA 1KOAA 2QOQA 4F7SA 3R9HA 2WMAA 2PZRA 4BICA 5CU6A 3NWWA 3W55A 1JQHA 3DK7A 2IVVA 3A8WA 2GFSA 3HDMA 4YO6A 3D2IA 4YSJA 5DGZA 3PLAE 2YACA 3VUKA 4I1ZA 4XP0A 4BKYA 5KMLA 5IUGA 2R3OA 3FWQA 4FG9A 2R3MA 2VO7A 2R7IA 2VRXA 3D4QA 3RBWA 1PW2A 3EL7A 4H3PA 3ENMA 3HMMA 4IZYA 2C0IA 4E20A 3E8DA 3FLSA 4NM7A 4G6OA 3TZMA 5GIPE 1OIYA 3QXPA 4PV0A 4JBPA 3WI6A 3ACJA 4UALA 4WG5A 2UW4A 4YHFA 4IAIA 3JVSA 1KE6A 4W9XA 2H8HA 4HZSA 4RLKA 3JY9A 2YZLA 4CXAA 2WTCA 5EK7A 4AT4A 4M3QA 4N0SA 2QR8A 4KKGA 4WNMA 2XK3A 2UVXA 2UW6A 3SQQA 2O0UA 4FGRA 3MFRA 5EYMA 5TO8A 4QPMA 3IDCA 3QUPA 2ZV9A 3BQCA 5TE0A 4IWQA 3QTSA 3R71A 2HZIA 4UZDA 4XLIA 3TI1A 2VTTA 2R3QA 4BGQA 5L2QA 4HJOA 3OCGA 1SNUA 1IRKA 3FXXA 2I0YA 4AU8A 5HO6A 4H05A 4PL4A 4C57A 3OT3A 1Q3DA 3RK7A 4AFJA 3TUCA 2YFXA 3GXLA 2V7OA 3SLSA 2B9JA 1YDRE 4R77A 4JLCA 5HE0A 1XH9A 2HIWA 1Q4LA 2PVKA 4YZNA 3PY1A 4I94A 4M13A 4L67A 2C5XA 4S30A 4G2FA 4RVKA 4B99A 4XOZA 4ID7A 2GDOA 4JVGA 4FTAA 2HXLA 4MYGA 4E6CA 4CFWA 2W96B 3UC4A 2WZJA 4ITJA 3W8LA 1JAMA 1O6LA 3WF7A 2X7OA 4ASZA 3Q9XA 5IH6A 4TT7A 4UMTA 4HYHA 2JDOA 1J1CA 4EYMA 5IISA 5C01A 2Y4IC 4U3ZA 4XMOA 4Z7GA 3FPQA 2OXDA 4J95A 5IMXA 5LOHA 5CQUA 5FUTA 4YJSA 2PE2A 2RFSA 2QOCA 4OTPA 5EHOA 4BDEA 4QP4A 4NUSA 4O2ZA 3W2CA 2F57A 5BX0A 4I5HA 1V0OA 2JGZA 3LFDA 3BWFA 5IA3A 2ACXA 2X39A 3A7FA 4F63A 3CKXA 5HU9A 2CPKE 1ERKA 3NYVA 4FZ6A 3V3VA 3NVKI 1KE5A 2XCKA 5CVFA 3CD8A 4C38A 3VS3A 2H96A 4DG0E 3BYMA 3R7VA 3ZEPA 4E4NA 4GYGA 4E4LA 2X81A 3P86A 4JG6A 4X6RA 5M4UA 4G1WA 5AUWA 5CEPA 4IEBA 4OGRA 4S31A 1IAHA 4EL9A 2X8IA 4AZFA 2H6DA 2WTDA 3ALNA 5KMMA 4B8LA 3VBWA 2XH5A 1XH7A 4LRKA 3QAME 4HZRA 4JOAA 4GSBA 5M07A 5CU4A 5CAUA 4PPAA 4O2PA 3NAYA 3ATTA 5AR3A 3AMAA 5AV4A 1YI6A 3TUBA 5CSXA 1AD5A 2OJFE 2NRYA 3R7GA 5E7RA 5F95A 4IWPA 3RAWA 4C35A 5IH4A 1E1XA 2V22A 4CFXA 4EH8A 5C27A 4A4LA 3PXYA 3LCDA 5FEDA 5AUTA 3H0ZA 3IW5A 3SV0A 2DYLA 4NU1A 2W1DA 2XIXA 3C4EA 3MTLA 5JQ8A 1RW8A 4A9TA 4AN3A 4K77A 5DR9A 2RKUA 4NW5A 5D9HA 5HG5A 3E92A 3AD5A 5LVOA 3VUHA 5AEPA 2JITA 2OJ9A 3GFEA 2R3GA 5M53A 1DS5A 1JKTA 2JDSA 4FEWA 2XNNA 4FVQA 3E5AA 4M66A 3UGCA 4EH2A 2GNGA 3M1SA 4ANLA 3RAKA 4GUEA 1IA8A 3V8TA 3WZKA 1SVHA 4X3FC 3DBEA 5EI2A 4EHEA 3CQEA 4BTJA 1I09A 1Z5MA 4IXPA 4CYJA 4DEEA 4RFYA 3UIMA 3RMFA 4DC2A 2XNOA 5CZIA 3CC6A 5HTCA 3LFQA 2OH0E 2VTLA 2W06A 4IW0A 5HU3A 3ZFYA 4AXAA 2OF4A 4EUTA 1PXIA 5DIAA 5ANGA 1G5SA 3MDYA 2ETRA 4GFOA 1FPUA 4TRLA 1STCE 5FP6A 4O7YA 5EI6A 3DBDA 1ZOHA 5D1JA 5CF4A 2F7XE 2PUIA 5A4TA 1UU8A 4IIRA 1BX6A 2O64A 5GZAA 4RC2A 3GC0A 3QD4A 5HHWA 1EH4A 4GIIA 1UNLA 3D94A 1OM1A 4OTIA 2IPXA 1Y8YA 3DLSA 1WCCA 3P08A 1YXXA 3DKGA 4FV1A 1IA9A 1YXVA 2WMRA 4FV9A 4HYIA 4C34A 5J1WA 2G01A 2YLEA 3KF7A 5H8EA 2ZAZA 4ZY6A 1IEPA 4EOIA 3IOPA 5KZIA 3WZEA 1BLXA 4QYYA 4I6HA 3KXHA 4RGJA 3TN8A 3UG1A 4FKGA 4IZ5A 3GENA 3QHRA 4CZTA 5HE2A 4PX6A 4KRCA 4AOIA 1V1KA 2JIUA 3O17A 3JXWA 3KRXA 5TR6A 3UIBA 4BL1A 4ZZNA 5BUEA 2NNWB 4B6LA 5E9EA 5GINE 3ORKA 3LLTA 5D7VA 4QO9A 1BUHA 3QRUA 2J0IA 2EUFB 5AM6A 4RA5A 3FY2A 1OL2A 3GCPA 4KIOA 2W17A 2C0TA 4C02A 3I1AA 4EK3A 1XBCA 5HG8A 3DFAA 4GUBA 4CLJA 3FZTA 4RT7A 4IQ6A 2OO8X 1W83A 1UV5A 3BX5A 2BRHA 4GCJA 4GT3A 4QQ5A 4YZ9A 2BKZA 4J97A 4K33A 4B0GA 4EOOA 4K11A 4X0MA 3DXQA 3R8VA 5EYCA 3NSZA 1ZRZA 2YAAA 4I4FA 2W1CA 4TN6A 3R8UA 1YWNA 5DG5A 4BFMA 4AUAA 2O63A 1CM8A 1Z57A 4HCVA 3A4PA 3TACA 2WTJA 4I3ZA 3JVRA 4JNWA 4ZTNA 4FA2A 3F7WA 4E6DA 3UZTA 1OPKA 5E8WA 5CLPA 5D41A 3ZXZA 4H39A 3D0EA 3IDPA 1WZYA 2R0IA 5EG3A 4JT3A 4J53A 3FQHA 4QRCA 3QKLA 5L6WL 3ZO3A 4ACMA 1REJA 4DE4A 3QLFA 3QQKA 4ZS4A 4RFMA 3GBZA 3QUEA 2WELA 2GSFA 4FIFA 2WQMA 4DCEA 3HV4A 4CFFA 4CNHA 5EM5A 2PVLA 3C50A 4QTAA 3TZ7A 1F3MC 1ZLTA 2WXVA 4I0RA 4QP9A 5DVRA 5AR4A 4F7LA 5HORA 4MQ2A 3D15A 5JFWA 4G9CA 5AAGA 4AGCA 4KUJA 3TTIA 1YDSE 3LJ2A 2O8YA 4NK9A 4WSQA 4DBNA 4JQ7A 4QD6A 2CKPA 4R6VA 4MHAA 3EMGA 3G9NA 4QYGA 1KV2A 3NZ0A 4G31A 4USEA 1UU3A 3BU6A 3LFBA 5GNKA 3R8ZA 2PUNA 2FH9A 2YM5A 3O71A 4O7NA 2QO9A 2AUHA 4O0WA 2ZDTA 4C3PA 4D58A 3PVUA 4MD8E 3HLLA 2PE0A 2F9GA 2OXXA 2R4BA 3LCOA 5CAOA 4CT2A 5KZ0A 4O1OA 4ZIMA 3BU3A 2XNGA 2Y6MA 2I1MA 2IVTA 4LFIA 2PVJA 2WIHA 2VGPA 3GC7A 3VS6A 3QUDA 5KE0A 4BGGA 2VTJA 2C4GA 4KWPA 3VRYA 5E91A 3I0QA 3FI3A 1NXKA 2J0MB 3R01A 3TV6A 1F5QA 4QYEA 4L7FA 5BVFA 4IWDA 3ZM4A 2FUMA 2BRMA 4J52A 5LMAA 3KCFA 3TNPC 3MYGA 4BDKA 4XG7A 4ZAUA 1G8AA 2J5FA 2HCKA 1CKPA 4I0TA 5FD2A 5TT7A 3OS3A 3I0OA 3WBLA 2BVAA 2FSMX 3IQ7A 5TKDA 1PXOA 2UZLA 4M15A 3OD6X 4IX3A 3KMMA 4FEQA 4FT5A 4FTCA 4EH5A 3FYKX 3EHAA 4J98A 4IADA 4CFVA 3EOCA 3F3WA 3LXKA 4L9IA 4I23A 3NYOA 3PZHA 4O0TA 5LCJA 4EH6A 1LUFA 2X7GA 4RVLA 3CE3A 4HNFA 4CVAA 3CEKA 5AUXA 1H25A 3CQWA 4DH8A 3C0HA 2R9SA 4PNKA 4L3JA 4XRJA 4W8DA 2GCDA 2HK5A 2ZM1A 4QMYA 4BN1A 3KRLA 3DLZA 3EN4A 5HZNA 3GUBA 4L44A 2FVDA 3EB0A 4W4VA 3VS2A 4DYMA 2WMBA 4EK6A 4CRSA 4DEBA 4QNYA 5I9YA 1QPCA 2GHLA 4L52A 4F0IA 4BCHA 1FMOE 5K4JA 4HVSA 4NWMA 2PY3A 4IACA 4RJ3A 3ZRLA 2BZJA 5JEBA 5C8MA 3A61A 3EFWA 4ZJJA 3PJ2A 5HI2A 2QOKA 2W1ZA 2ITYA 4HGLA 5M08A 4BRXA 2I6LA 2PZIA 1JKKA 4FL2A 4TNBA 3KQ7A 4PL5A 2GNFA 4GFMA 4EOQA 5M4CA 5C4LA 3C5UA 1TQMA 3CGOA 2X4FA 3R7UA 4AT5A 3FMNA 4AE9A 2VO0A 5H8GA 2GNLA 2AC3A 3ZMMA 4MF0A 4G34A 3SXSA 5IU2A 2UW8A 4PY1A 2Q0BA 4L8MA 4GU6A 4ENXA 5DT3A 1WBTA 1Q3WA 3F5UA 3U4UA 2B9FA 4BCGA 3DKFA 1H00A 2XBJA 3PSDA 2J6MA 4QQJA 1QL6A 3NAXA 2ITXA 3T3VA 3L1SA 3RGFA 1OKZA 2OZAA 1NVSA 2DS1A 3JPVA 3QKMA 4MBLA 4GG7A 4O0YA 4XG6A 4HVIA 1MQBA 4RRVA 5H9BA 5CASA 4RIWA 4EWHA 4WG4A 1M52A 5KX8A 3FMHA 3OEZA 3OZ6A 1LP4A 1OBGA 3GU6A 4EC8A 3CQUA 4UWCA 5DEWA 4WO5A 1G3NA 3L9NA 3HP5A 3OG7A 5HX6A 3PVWA 4FKIA 3DK3A 2CKQA 3E64A 4NW6A 3BHVA 4FE2A 5FGKA 3CXWA 1OIQA 2YJSA 3EH9A 4C58A 3ACKA 2AC5A 4EONA 1Q41A 3FMEA 2R3IA 2V0DA 3G51A 3TT0A 3TL8A 4IZ7A 3ZSHA 4FBXA 5DRBA 1XWSA 3PXRA 2BROA 3PPZA 4QQTA 1GZKA 3ZO2A 3K5UA 4YLJA 5AUZA 2VTMA 4D28A 3EJ1A 3VBYA 3EQCA 4XG3A 3HV6A 1ZY4A 4JG7A 3DFCB 3KVXA 3VIDA 5LJJA 1WBNA 3LW0A 4G3DA 4BBMA 5CQWA 1M2QA 2WTKC 1PY5A 3G6GA 4L43A 1O6KA 3OC1A 1U54A 1J7UA 2ZV7A 4Q5HA 3OW4A 5AV0A 2JC6A 2IZUA 3CY2A 5F20A 3HGKA 3G2FA 4P4CA 4YNEA 4M97A 4C37A 2A4LA 2UVZA 3MWUA 3KK9A 4KS8A 4XBRA 5E8SA 4BDFA 2WPAA 2JBOA 2IW9A 2FYSA 2UZWE 4RJ5A 2C6DA 1ZZLA 4O0XA 2H34A 5BVWA 4A4XA 3HEGA 3U6JA 3DZQA 3JY0A 5M57A 3CBLA 3FLZA 4BWPA 2XK6A 2YHVA 4PMTA 2IWIA 2OKRA 3DV3A 3LCTA 4AACA 3ROCA 5IZFA 2UZEA 4BCIA 2JIVA 1X8BA 2VUWA 4RIYA 4P2KA 4OTGA 5H8BA 5HGIA 4O21A 2CKOA 1Q99A 3V6SA 4IFCA 3HAVA 4IANA 1H26A 3ZHPC 3AD4A 4II5A 4F6UA 4CZUA 4F99A 3ODZX 3QRTA 3QTUA 5I9UA 3QCQA 5J9YA 3HZTA 3RHKA 4Q9SA 3PPKA 3PVBA 5EQPA 5IQDA 2YIRA 2XRWA 2OBJA 4CG9A 4ACGA 1B6CB 2REIA 3NNXA 3D5XA 3QRKA 4I5CA 4XOYA 1DI9A 4V05A 4G5JA 4FF8A 4NKSA 4CFNA 1UKHA 2XIKA 4W4WA 4CCUA 3OVVA 2OU7A 4I24A 4MD7E 1Y6AA 2SRCA 5DBXA 2X6DA 5HCZA 3SD0A 3UVPA 3DBQA 4FK3A 2ZB0A 5IQFA 3BYVA 5JMSA 2A2AA 3Q53A 4ERWA 4DG2E 2VTNA 1AGWA 2VTQA 3E7OA 3ANRA 3VVHA 4UMPA 2NPQA 2NP8A 3O8UA 5HVKA 2RF9A 3VHKA 4XX9A 3BEAA 1J7IA 4FMQA 1YXSA 4WRGA 1QMZA 4J1RA 3LJ0A 5ETFA 4M84A 5J8IA 2R2PA 2PMNX 3RAIA 4GJ3A 1KOBA 3KRRA 3SKCA 3ZH8A 3ZSIA 1SNXA 3PA3A 3QBNA 4AA4A 5JSMA 3HUBA 1OMWA 4RA4A 4N70A 2ONLC 4YZCA 4EK8A 2JFMA 5L8KA 5E90A 1NY3A 3JUHA 2VO3A 4R3RA 5AAFA 3HUCA 2Z2WA 3OCTA 3UNKA 3RK9A 4GK4A 4DLIA 2BFYA 3U9NA 2C5YA 1FOTA 4DFNA 3LQ3A 2PSQA 4IC8A 4WSYA 1LPUA 1B39A 1DM2A 2CGWA 4FIEA 1XBBA 1ZY5A 2X6EA 3B8RA 1Q8TA 2CCHA 3QZHA 4ERKA 1CMKE 4L3PA 5CWZA 3E88A 3V01A 2PL0A 3U8WA 3EQHA 1WFCA 4O81A 5CX9A 1BKXA 4W9WA 5TF9A 4BIBA 1XO2B 4QTCA 4AZSA 1BI8A 4O27B 3ULIA 4MNEA 4O84A 1T46A 3VN9A 5B2KA 3S1HA 4NJ3A 4ANMA 2EWAA 1RJBA 1QCFA 2ITVA 5AP1A 5AP0A 4QP3A 4BKJA 5JZJA 3FKOA 5IQAA 3DDQA 3G9LX 3AC1A 5JQ5A 2XZSA 2YISA 3DAJA 3EYGA 2BZIB 5JKGA 1U5QA 4GT4A 2FB8A 1YHWA 2HY81 1SZMA 1Q5KA 3QD2B 3VC4A 3R21A 4E26A 2QLUA 4EBVA 1JKLA 1BI7A 3QYZA 2ERZE 2B52A 5A46A 3F3VA 2BRGA 3O7LD 2ITZA 4BTMA 4EZ5A 3JS2A 4RWLA 3THBA 3FSFA 4BCNA 3BLQA 3UPZA 1VYWA 2VTSA 5A9UA 2HYYA 3BYUA 3MY1A 4Y8DA 3H30A 4JXFA 3G5DA 3FMJA 5D7AA 3O2MA 3CPBA 3R02A 1WBPA 3DJ7A 3VUTA 4XEYA 4C61A 3UPXA 4H36A 4YTHA 2CHLA 3L8VA 3VS1A 3Q52A 4FKVA 4FTRA 2BDJA 2QOFA 4JR7A 5CEKA 1GIIA 1OZ1A 4M67A 3IGOA 4J8NA 4NM5A 4XLVA 4XUFA 4E6QA 2ZJWA 5A4CA 3HKOA 4PTCA 4D9TA 4FV8A 4IX5A 5BYZA 3KREA 1JSUA 2YDIA 2JFLA 1WVYA 5BPYA 3EIDA 3OWLA 4XCUA 3UO4A 3ZS5A 4G9RA 5C26A 1LEZA 2BTSA 2C6EA 2X7FA 4GS6A 1FBNA 3QALE 3LMGA 3VBVA 1MRYA 5J1VA 4C3RA 4M69B 4BDHA 3RTPA 3L9MA 4C59A 2OJGA 2VX1A 4FT7A 3TDWA 3Q32A 5FM2A 5CU3A 2PVRA 3IDBA 4YPDA 1SVGA 4WNKA 5I3RA 4H1MA 5EYDA 3I79A 5I9XA 4U80A 4DEGA 4L53A 3TJDA 2HENA 4FKWA 4PL3A 4DGGA 2XK9A 3AT4A 4YTIA 5M51A 1BL7A 5GJDA 3R63A 1RDQE 3BU5A 4L3LA 4F0GA 4FTKA 4FTNA 3G0FA 3DNDA 3QLGA 4PWNA 4C7TA 3QA0A 4M7IA 2GQRA 3VJOA 4D2VA 4DTBA 4ALVA 4C3FA 5AUVA 3FZRA 4LOPA 4BDJA 4DFBA 4ZTLA 5A54A 4WIHA 2WMXA 4DA5A 3IK3A 1AQ1A 3FHIA 3V5WA 3NUXA 3GEQA 5CF8A 2J9MA 4KRDA 3QCYA 5HE1A 3R7OA 3ZLXA 3IOKA 1OL1A 3HV5A 2XEZA 3OY1A 2BIKB 4IJ9A 1WBOA 2X2KA 3COKA 1Q8ZA 3MA3A 5FG8A 3WE4A 2E9UA 4WKQA 3BHYA 1H07A 3RM6A 3OOGA 3BV2A 4RG0A 1FGIA 3CS9A 4ZOGA 3OCBA 5AA8A 4N57A 3LXPA 2C6LA 4OTFA 3VF9A 4GJ2A 3PE2A 3TKIA 3R1QA 4E7WA 2BAQA 3LZBA 4R7HA 3WOWA 2OH4A 4BI2A 3K2LA 4G17A 4YJNA 1U4DA 2FO0A 2PK9A 2RIOA 2W1IA 3MH2A 3NCZA 4L00A 2IO6A 2R3KA 2WQOA 2HW7A 4ALWA 4BHZA 5L2WA 3R8PA 4C36A 2XK4A 5LCKA 3TNHA 2BAJA 2QO7A 1VJYA 4C33A 2PMLX 2R3JA 4NCTC 2WOTA 4U41A 4LMNA 4JX3A 5EKNA 4Z7HA 3FLYA 4IAFA 4C4FA 5CSPA 2YCRA 4X7QA 4C2WA 1PHKA 3BV3A 3PXFA 5ACKA 1SYKA 5G6VA 3ZRKA 4QPSA 3A7GA 1MQ4A 2FSLX 3AGLA 3BZ3A 3TTJA 4A9SA 1NW1A 3QX2A 4FSNA 4OT5A 3NEWA 3EN5A 3F7ZA 2BZKB 2O5KA 5FBNC 4EK5A 2W1GA 3FAAA 2C69A 4TZRA 5AWMA 3P7BA 5DLSA 3UOLA 4DH5A 3U51A 4K2RA 4S2ZA 3WF9A 1O6YA 2ESMA 4I6FA 4QMNA 2CSNA 3LAUA 4B7TA 3Q60A 1SMHA 4UYAA 4A4OA 2BDFA 4FI1A 4DAWA 3KXXA 4J7BA 3S4QA 4IE9A 3V8WA 5LVPA 3Q6WA 4PDYA 4P5ZA 5IPJA 2OIBA 3C4XA 4GL9A 4FZFB 3DQWA 4EJ7A 3MVLA 1Q62A 4RJ4A 2XJ2A 3UMWA 3HX4A 4IM2A 4WBOA 5AV3A 3SG8A 4KA3A 1NA7A 1WVWA 4YSMA 2I7QA 5IQCA 3BHTA 4XRLA 5LWMA 4IFGA 3FI8A 1YQJA 4IVAA 5FRIA 5AP2A 3GCUA 2PTKA 1M7QA 2GNIA 3E8EA 3O96A 5KCVA 2WHBA 4F1OA 3F3TA 4MXCA 1YWRA 3GI3A
chains in the Genus database with same CATH superfamily
1ZXEA 4NM0A 4MXYA 4JG8A 4HGSA 3R8MA 2CKEA 4O0UA 3NMUF 5J5TA 3R8LA 3FI4A 4ITHA 5A4QA 5IDPA 4BDGA 5EOBA 2X0GA 3CIKA 4KKHA 4D4RA 2VWVA 3HDNA 3PUPA 1IAJA 4FKSA 3VS7A 3F5XA 4DEIA 2YERA 3HP2A 3NIZA 2JIIA 2F4JA 2W1FA 3ETAA 5HG9A 3QQHA 1W2FA 3KRJA 5FTGA 3ELJA 3PPJA 4ZTQA 5CAQA 4O91A 4ZXTA 2X0PA 1S9JA 3ZLWA 3LFEA 1P2AA 3VS5A 2QHMA 2W7XA 4PDSA 3I7CA 4QOXA 3RHXA 4BDAA 2IW8A 2EXEA 5EOLA 3HAMA 2XARA 1FINA 1TZDA 4CLIA 3UVRA 1XH6A 2XUUA 5ITAA 3BQRA 4NFNA 2CNVA 2OZAB 3LFSA 4XP3A 4ZSAA 5IEXA 1YDTE 3UIUA 3UO5A 3PP0A 4FOBA 4FSQA 2GTNA 3BGZA 4KB8A 4NEUA 4RIWB 3ZUUA 4AWIA 4MBJA 4NIFA 3TZ8A 5CF5A 4IAYA 4ZJIA 5J9ZA 5JN2A 3W0NA 2UW5A 4D4SA 4HPTE 3NVMB 2BTRA 4QNAA 1YWVA 3BCEA 3SW4A 3I7BA 5EDRA 4ANOA 4D1XA 2B53A 2WQNA 3F2NA 4FVPA 5M06A 3DNEA 2W9ZB 1UKIA 1V0BA 3D2KA 1RQQA 4KAOA 1HCKA 4RFZA 3PXKA 1H24A 2ITNA 3WE8A 1UU7A 2X4ZA 2ZMCA 5AP6A 1YXTA 2XK8A 4FSWA 3W16A 4DGOA 4Z55A 2ITTA 3BL7A 4O7WA 2EB2A 3OXTA 5IMEA 3K3JA 5HNGA 5ICPA 4AE6A 2QOBA 4FIGA 4L6QA 5KNJA 4M68A 4CQEA 3OWJA 2XAOA 4UMUA 2UZUE 4QMSA 5D10A 3WZJA 2CNQA 3RINA 3QTZA 3S00A 1JVPP 3VJNA 5KBQA 3DGKA 2C3KA 2ITWA 3PP1A 3NUYA 4JI9A 3TJCA 3VW6A 3W18A 3FMDA 3FV8A 2WO6A 1U54B 4DITA 4AA5A 3EQPA 4TYHA 1PJKA 4YTFA 3R22A 4FUXA 3KF4A 4RIXA 2QU6A 4J8MA 4MCVA 4EC9A 2WAJA 3EQRA 4O7LA 3E87A 5H3QA 4N6YA 2OJJA 4X3JA 4ANNA 5I4NA 5FXSA 3A4OX 2ITQA 1R0EA 2Z60A 2A27A 5KO1A 4I5PA 4IVBA 5JT2A 4QTDA 3BWJA 3GOPA 3KN6A 1CSNA 4QMVA 1M2PA 3REPA 3RPSA 3W2OA 1Q8UA 3KU2A 3PTGA 4C0TA 3CTQA 1VEBA 5EHLA 4EH4A 2QVSE 4D5HA 1RE8A 3GNIB 2Q83A 4O7SA 4RIYB 3ZDUA 4DDGA 2UW9A 3A7IA 3W8QA 2C1AA 4RJ8A 3WIGA 1XJDA 3EL8A 5AP5A 3KGAA 5L4QA 4Y72A 4YPSA 2VZ6A 3KXNA 3UC3A 4DTAA 4IB3A 4TXCA 3C51A 4D0XA 3ORPA 2YIYA 3A7HA 4JX7A 4E1ZA 5L2SA 4YZMA 1DAYA 3BYOA 3DY7A 3PFQA 4XV1A 4M69A 3AC4A 3QGWA 4GFGA 1U59A 4WHZA 3TNIA 5I9VA 3I5NA 3L8XA 3O50A 5L6OA 2WKMA 3FSKA 3AC8A 3PJ8A 4CKJA 2P2HA 1LR4A 4IMYA 3W0RA 3Q2JA 4IZAA 4XG8A 5K0KA 3K3IA 4DGLC 4RC3A 3V8SA 3DOGA 3CJFA 3MS9A 3HMOA 4ZY4A 5E1SA 3EWHA 2YITA 1ZMVA 4FGBA 4QMTA 5AP4A 4PMPA 3DU8A 4WUAA 5HCXA 4ASDA 5EQYA 3UZPA 4E93A 2YIXA 3PE1A 5D11A 4BR3A 4LV5A 4APPA 4TYGA 5EQEA 4PDOA 3EKKA 4QP6A 3N4VA 2HZNA 3NUNA 5EH0A 2YWPA 4FSMA 5K5XA 4JQ8A 2P3GX 3VBQA 3WARA 4NZWB 3UQFA 5E8ZA 3N4TA 4QPAA 4BCOA 2KTYA 4I20A 3WYYA 4NYEA 5CYIA 2HXQA 2QHNA 3I5ZA 1YVJA 1R1WA 2OGVA 3MFTA 2XKFA 3G90X 3PJCA 4PPCA 4AAYA 1P4FA 1YOJA 3SHEA 3NGAA 3HL7A 4DEDA 3POOA 5DT0A 4USFA 4FUYA 3LM0A 4QMMA 4LGHA 3D5UA 3EQDA 3R7IA 4F9BA 3CPCA 4BBFA 3C7QA 1PKGA 4YTCA 5B2MA 2DQ7X 3SA0A 2FSOX 4I22A 4FKJA 3AD6A 4GV1A 2C68A 3P5KA 4FOCA 4LOQA 3W0SA 3UDSA 5HO8A 5C1QB 4LGDA 4G3FA 3FMMA 3CGFA 4MNEB 3R9DA 4V0GA 3AT3A 5I0BA 3MESA 4PUZA 2IW6A 2C3JA 3D5VA 3Q3BA 4E73A 4K6ZA 4ZMEA 3ALOA 2ZB1A 5ANKA 3MVJA 5ANDA 5TOZA 4DF3A 4ONAA 2YIQA 1DI8A 3GP0A 2F2CB 4FV2A 3T9IA 3VUDA 5EW3A 3FLNC 3AQVA 4DEAA 3HA6A 3B2TA 3IONA 2JKKA 4G5PA 2HELA 4K9YA 3VO3A 3EZVA 1PXJA 5E92A 2NYAA 1YHSA 3GQIA 2QG7A 3TCPA 5HE3A 1ZWSA 1OUYA 3NUUA 2PMOX 3GU7A 4BTFA 3OOMA 2ONLA 3LE6A 4EZ7A 4HNIA 5LMBA 2J4ZA 4RQKA 2R3PA 2IN6A 1U46A 1GZNA 2J0KA 4FKOA 3MH3A 4TNDA 4E4MA 5CANA 1Q8WA 2BRNA 5E8UA 3PY3A 3BIZA 5AR5A 1ZOGA 2BDWA 1ATPE 1PYXA 3F5PA 4GMYA 1H8FA 5E8YA 5FBOA 4QYHA 3F9NA 3GC8A 2UV2A 5CEQA 2C6MA 4R1YA 2PZPA 3M11A 3PZEA 2PULA 5GIOE 5L2IA 4OT6A 1DAWA 1XH5A 5AV2A 3LM5A 4FV7A 4CMOA 4PTGA 4QMPA 1KSWA 1J91A 1IG1A 4WNPA 3UBDA 2VTOA 3OFMA 1JLUE 2XF0A 4TWNA 3OEFX 3HA8A 4G3EA 4YJUA 4EI4A 2XP2A 3DXNA 3GU8A 3QTQA 3QCXA 1IASA 2UUEA 3VS0A 5BVEA 1ZARA 3HMNA 4XV2A 2V5QA 4J99A 4IM3A 3KXZA 2IG7A 4L46A 4OAUC 4B8MA 3SW7A 2BKKA 3UOKA 5CAVA 3O0GA 4QMUA 3OWPA 3FZ1A 3TYKA 3I6UA 1PXMA 3QD0A 2OSCA 1ZYLA 3BGQA 4S32A 4I5MA 2ZOQA 1HCLA 1M2RA 3MY5A 4R1VA 5DEYA 3F2RA 5AR8A 4X2JA 3R9RA 3RZBA 3SXFA 2J0JA 2VWIA 4I6BA 2C5NA 2C30A 4KSPA 4RJ7A 3HV3A 2KULA 5AX9A 3FI2A 2C5VA 4PP9A 4ZEGA 4BCMA 4ZTMA 3E3PA 2A0CX 4GEOA 3ITZA 3NW6A 4YC6A 1XQZA 4RWJA 3RM7A 3W1FA 5L3AA 1GAGA 3BE2A 4JBQA 1K3AA 3LJ1A 4LL0A 4G6LA 3FKNA 4USDA 4ALUA 4DCAA 5KBRA 3VNTA 2YZAA 5AV1A 2GPHA 4NSTA 4AZTA 4FG8A 3NS9A 3OP5A 4LV8A 3CP9A 4O7TA 3ORIA 4M12A 3UDBA 3UDTA 5CEIA 5CXHA 3QZFA 2HY0A 4NJDA 4O6EA 2ZM3A 4KBCA 4KIQA 3WILA 3VF8A 5CT0A 5FXQA 1Y8GA 1A9UA 4K8AA 4L42A 2R3FA 3WZDA 1OIRA 4C2VA 2GHGA 3RP9A 1UA2A 4UZHA 4WUNA 5DA3A 4K1BA 4UMRA 2QU5A 3BLRA 3HRBA 4QYFA 4L7SA 2XKEA 5CI7A 4L68A 1CKIA 4IDVA 3VUGA 2W5HA 4FV4A 3W0OA 1TKIA 1HOWA 1ZMUA 3DDPA 5DNRA 2C0OA 4FR4A 5HG7A 4I92A 2GS6A 3GQLA 4BKZA 2GFCA 2Q0NA 3HVCA 4FV0A 4QT1A 4UBAA 4DINA 4Y83A 3MI9A 3IW4A 4O86A 4E4XA 1UNGA 3BHHA 2VWXA 5FWKK 4RPVA 2UZVA 4LRJA 2PMIA 4C4EA 1H28A 1GZ8A 1J3HA 3QCSA 4GIHA 1G8KA 2BUJA 4YU2A 1F0QA 1GIJA 3RJCA 2VGOA 3C4FA 4FL3A 4LL5A 4GH2A 3GFWA 3PG1A 4X6QC 2P4IA 5AMNA 5EKOA 3GGFA 2QOLA 3VULA 4ZZOA 5J95A 4OAVB 2Z8CA 4O38A 4QMOA 4AOJA 3LLAA 4BI1A 3EFKA 3ZO4A 5AIKA 1XKKA 3QC4A 2C47A 5DPVA 3RKBA 3LOKA 4FNYA 3MH1A 4BC6A 4D0WA 5JFSA 4MQ1A 4O7RA 1OECA 5K3YA 4CCBA 4W4XA 4F1TA 2P0CA 3GT8A 4KBKA 4IVDA 4HCUA 4O6LA 4FYOA 3TKUA 2ITPA 2JEDA 1PYEA 1MRVA 1OGUA 1CKJA 1XH8A 2QLQA 2YIWA 3DAKA 3W10A 4G3CA 3P7AA 5CZHA 2XANA 4YURA 3MN3A 4QMXA 3BLHA 4IC7A 4JR3A 3E3BX 1CDKA 5ANIA 5IG1A 2CGUA 1KWPA 2P2IA 2XYUA 1FGKA 2YJRA 2QI8A 4Q2AA 4U5JA 3Q6UA 5IQHA 3Q5IA 4ZSEA 3R7EA 3OUKA 4DGNA 5KMKA 2YDJA 3KMWA 4MBIA 3QYWA 4RC4A 2Y7JA 4CV8A 4I21A 4U97A 2XS0A 2GS2A 2JAMA 4CMTA 2YABA 3R28A 4BVUA 3VQUA 4HW7A 2X1NA 5IEYA 1E1VA 4F9CA 5IQGA 3Q5ZA 5HIEA 3R7YA 2I0HA 2Y8OA 3Q9WA 2QO2A 4P7EA 4PMMA 3MVHA 4FIIA 5IA0A 4WOVA 4FYNA 2WD1A 3BHUA 3I4BA 3QQUA 3P79A 4JDIA 4LRMA 4OTDA 5CSVA 4MXZA 3VAPA 4CFMA 2G2FA 4FTMA 4NTSA 3Q9YA 1YHVA 2ZV8A 4U40A 1OPJA 3NNUA 4DHIB 2WIPA 3NIEA 2B1PA 3MPTA 3DZOA 2PVHA 3W0MA 2R3RA 3Q2MA 4X2KA 1ZZ2A 5A3XA 4Y95A 2C6KA 2NRUA 3R04A 3IW6A 4TPTA 4ZTHA 4ANSA 3BLAA 2C6TA 4OTHA 4F7NA 4W4YA 3V5JA 4BYIA 2GMXA 4KINA 4YUQA 3R1SA 3NYNA 4FSUA 5IUIA 4HVHA 4ACHA 2IEWA 4NIFB 4D2PA 3ZZWA 3EQGA 4ZLOA 2HWPA 4FICA 5AUYA 4RQVA 2GNHA 3FY0A 3BBTB 3FC1X 4QP7A 5F9EA 4NH1A 4BHNA 2WTWA 5EFQA 4ZK5A 1KE9A 2X8EA 3TG1A 1L8TA 2GQGA 5AAEA 4QP2A 3V51A 1JBPE 4HGTA 5EM6A 4E5BA 4U6RA 5LVMA 4Y85A 3IW8A 1UU9A 4D55A 3QF9A 4I0SA 4AS0A 3EN6A 3C4CA 2CLXA 3L8PA 3IW7A 4GK3A 3KA0A 3FPMA 4K0YA 3VBXA 2EU9A 2V55A 4AGWA 4EYJA 2QG5A 4O83A 5EYKA 5BYYA 4S34A 5JFVA 3LMIA 4KS7A 1H4LA 2VD5A 4RJ6A 3HYHA 5CS6A 5LVNA 5FTQA 2XNEA 2BZHB 2F7ZE 3MJ2A 4WD5A 1J7LA 4FSRA 4KIKA 4M0YA 4LQMA 3P1AA 4FV3A 3OT8A 4TKSA 3TIZA 4TYHB 3QZGA 1YOLA 4DEHA 4F70A 5JK3A 3LMHA 4ZTSA 4RIXB 1H1WA 3QXOA 5IKWA 4D1SA 4RZVA 2Z02A 4YZDA 4BDDA 5M56A 2UW7A 3R73A 2VTHA 4DG3E 4A9YA 3FC2A 3DCVA 1TQIA 4MH7A 4AQKA 4AT3A 5T6KA 2YM7A 3N51A 2ZVAA 3QHWA 4FV5A 2W1HA 5HVJA 1J1BA 1NVRA 4MWHA 4RLLA 2QKWB 4A9UA 5HTIA 1JNKA 4FT0A 4DLJA 5JRQA 4YJVA 4R7IA 4DH1A 5FLFA 4BB4A 5E4HA 4YC3A 1QPEA 3VW8A 5CI6A 3MA6A 4AA0A 4DTKA 3QRIA 4IX6A 3ZUTA 4AW0A 3F61A 4CKIA 2RG5A 4BTKA 3RALA 5L6PA 3Q4CA 2R0UA 3ZTXA 2ITUA 2WNTA 3A62A 3OW3A 5AX3A 3QWKA 2UZTA 4EBWA 2B54A 3GOKA 4JRNA 3EKNA 3KEXA 4YJRA 1YRPA 4FKRA 4X3FA 4F9YA 3U55A 5C8NA 2OFUA 2OK1A 2WTKB 2RFNA 1KV1A 3B2WA 4HYUA 4N6ZA 3TZ9A 4U9AA 3BRBA 2XKCA 1OKYA 3QTIA 3R1YA 2C3IB 1GY3A 2A1AB 4RBLA 4XG2A 3RZFA 2CGXA 3COIA 1YXUA 5I5ZA 3BE9A 3UYSA 4ARKA 1XHAA 2XK7A 1NVQA 2VWBA 2BR1A 3DB8A 4JAJA 5EI8A 4PP7A 3PFYA 2FA2A 3QTXA 4MNFA 5HBHA 4AXEA 4FNXA 4QMQA 4F9AA 2HZ0A 5AA9A 4F4PA 3IKAA 3W2RA 4HYSA 2Z7RA 1MUOA 3ZLSA 2QOOA 5C8KA 3TMOA 4U3YA 5CNOA 4DFYA 3LCSA 1KE8A 5J79A 5K4IA 1KUTA 5BNJA 3OHTA 2VN9A 4RSSA 4JMQA 1B38A 1T45A 2CN8A 3IPHA 3MJ1A 4FRFA 2ITOA 3D14A 3GVUA 5DH3A 1WBSA 3O7LB 4IWOA 3ORLA 4AN9A 5A4EA 4R8QA 2GQSA 4DT9A 1Q97A 2IJMA 1BYGA 4JDHA 3NDMA 3TNQB 2OICA 2QQ7A 5CAPA 2CCIA 4O82A 2VTIA 5AFVA 2PU8A 1MRUA 3Q4UA 3QL8A 4RX8A 4TYIA 3M42A 3TM0A 3H9RA 3P9JA 5AUUA 4IH8A 3OROA 2J5EA 1OVEA 1JOWB 2J51A 4MVFA 2WGJA 4H3BA 4YC8A 3R83A 3ZSGA 3F82A 3QQGA 3OUNB 4E5AX 4Y46A 1TFFA 3LFCA 4V0GB 2G15A 3EQFA 3F69A 1H0VA 3KK8A 5BVKA 5ACBC 4ANBA 2CNUA 3DKCA 5AIRA 1G8JA 2FGIA 4U79A 3S95A 1W84A 3KIOC 5T68A 3JR1A 3O8PA 4Q9ZA 4MF1A 3NUAA 1OKVA 2HOGA 4F1MA 2IF8A 3K5VA 3COHA 3ZUVA 2Z7QA 4YZBA 3RK5A 4AGDA 4AOTA 5IEVA 3PA4A 4DFXE 4FZAB 2FSTX 4HPUE 2YM3A 4BWKA 2XM8A 1P4OA 3EQBA 4IB1A 4BIDA 2IZRA 3H9OA 3PA5A 5KKRB 1XR1A 5JGBA 2G9XA 3AC3A 2C6OA 3ORZA 5J7BA 5IDNA 3VHEA 5LMKC 3G6HA 3FXZA 4HOKA 1APME 5KMIA 4QDEA 1GZOA 2B0QA 2QOHA 2WU6A 2QCSA 4XYFA 4Z9LA 5E8XA 2BPMA 4V01A 3W2SA 5DN3A 4G16A 1CTPE 4O7ZA 4CV9A 3V5PA 4ZSLA 3ZCLA 1QPJA 4CGAA 1M17A 3ZC6A 5L8JA 5KMOA 3MFUA 1Y6BA 3PYYA 4GK2A 5FXRA 5GJGA 3FZPA 3ORNA 5M44A 3O5AA 1JKSA 3FHRA 4H3QA 4AX8A 3BYSA 2HZ4A 2YCQA 3N9XA 3UNZA 4CSVA 2CDZA 3BPRA 2O3PA 4UX9A 2I40A 3OXIA 4DBXA 4PQNA 5HO7A 4FTOA 4OBQA 4YR8A 5J87A 3TNWA 5AADA 4ZLZA 3KULA 2IVSA 2WMQA 3WYXA 2X0QA 5CENA 4JDJA 4DFUA 2A98A 5HICA 4YNOA 2G2HA 2X9EA 4X2GA 3R30A 4FG7A 4UY9A 1PMEA 2RFDA 4FNWA 2BFXA 3H0YA 3NUSA 1W98A 4QTBA 3BL9A 2HWOA 5M4FA 4O1PA 5BUIA 2BILB 3C4ZA 2WQBA 3KFAA 3PLSA 1ST4A 1FVRA 3MV5A 3QFVA 4KD1A 5KUPA 3F3ZA 1PF8A 4O0RA 1ZAOA 4AZWA 4ORKA 4O22A 3NFFB 3MIAA 5HD7A 5HOAA 3V5TA 1VYZA 2F49A 4ZLYA 4FKPA 4EH3A 5FEEA 4PRJA 3UP7A 4XJ0A 3MB7A 5HNBA 2ZV2A 4LUEA 4MWIA 2RSVA 2O65A 5IA5A 3RPOA 4F64A 2QONA 1OITA 2JAVA 2B9HA 2PPQA 4Q5EA 4O7VA 3ZONA 3TXOA 4HVDA 4FEUA 4GU9A 4EH7A 4IDTA 4OBPA 2ERKA 3QWJA 4YP8A 3UE4A 4F08A 3ATSA 4IVCA 3CSVA 2OF2A 2W99B 5KHWA 3ODYX 2VX0A 4YJTA 4E6AA 5IQIA 3W0PA 4V04A 3EQIA 3E63A 5AP3A 2EVAA 4FKQA 3OTUA 4EHVA 2WMTA 3OY3A 4FX3A 5DOSA 2I0EA 3HRCA 5C9CA 3ROYA 4QMLA 4TW9A 1URWA 2QKRA 1M7NA 3GCQA 1OL7A 3TUDA 5M55A 4OR5A 3RWQA 4OBOA 2XIZA 4C4HA 5J7HA 3P0MA 5J9LA 1PMNA 2OW3A 4MXOA 3LVPA 4Y5QA 4B4LA 4EZ3A 3RNYA 4P5QA 3KCKA 4AXCA 3ZXTA 1W8CA 5D12A 1YOMA 2YWVA 2F2UA 3G0EA 2OFVA 1P14A 2VWYA 2QOIA 3A60A 3D7TA 4LI5A 4TWPA 4TL0A 3ZU7A 4RX5A 1P5EA 4RWKA 4OUCA 5A6OA 3F3UA 3NUPA 2PUPA 4FZDB 3S0OA 3UOJA 3DKOA 1XBAA 5BVNA 4I93A 1REKA 5A4LA 4EOLA 5ANOA 3OMVA 4UN0C 2OXYA 2P55A 3O23A 3PY0A 3PUFC 5K0XA 2R7BA 4D2SA 2CN5A 1BL6A 4M14A 4CYIA 1YW2A 5EW8A 1URCA 3PDTA 3NR9A 4JQEA 1W82A 4C4GA 4EJNA 3NRMA 2VTPA 3ZBFA 3U6IA 2EB3A 5HLWA 2OG8A 2PZ5A 2UVYA 3ZFMA 4CMUA 1XH4A 4F6WA 5HX8A 2VU3A 2XEYA 4XH6A 5JGAA 1WBWA 1PXLA 4G3GA 2C6IA 3KXGA 2PZYA 2WMSA 4GT5A 1OB3A 4ZSGA 3VBTA 4A06A 1PRYA 4ASEA 3IG7A 3RVGA 3I60A 3CJGA 4RZWA 3QQJA 4WG3A 2H9VA 3H4JA 2PVFA 3MH0A 2LGCA 3R00A 1W2DA 2EXMA 3DAEA 3S2PA 4C62A 4N4SA 4XG4A 3PSCA 5CEOA 3S3IA 4EHGA 2WMVA 2YCSA 3DT1A 4AW2A 1H27A 4RMZA 2XNBA 1ZMWA 2XB7A 4XP2A 4IB0A 1W0XC 2GNJA 2NO3A 2YM6A 4ZY5A 4ZMFA 2X2LA 2Z7LA 5CVHA 3RAHA 1OIUA 2O2UA 2YEXA 2G2IA 4YHJA 3ZLYA 2B55A 3O8TA 2YA9A 1JWHA 3A7JA 4O4FA 3RCDA 5EM8A 5M4IA 2J2IB 4QMWA 4E8AA 4RX7A 4R5SA 4HVGA 1FMKA 3VQHA 1FVTA 3K54A 4BGHA 3AKLA 2XRUA 3P78A 1GIHA 4U8ZA 3CTHA 1I44A 4LOOA 2ZFYA 4DN5A 2RGPA 4UV0A 5DYJA 3NX8A 4XHKB 2YLFA 3DB6A 4AF3A 3LQ5A 3OXZA 4FEXA 4TYEA 3QU0A 4DFZE 3KXMA 4ANQA 3EFJA 5GZ9A 2OIQA 3QD3A 4FKTA 1ZYJA 3IECA 5LXMA 4FSYA 5FQDC 4KKEA 3W2QA 3SRVA 2WMWA 5HIBA 3SVVA 4FVRA 5DFPA 3QC9A 3SC1A 5DI1A 3Q96A 2AYPA 1WAKA 3VS4A 3OBJA 4BCQA 5LWNA 3GC9A 5F1ZA 5A6NA 4OW8A 5HCYA 5HEZA 3E93A 4GVAA 4H58A 3RPVA 1R39A 2YN8A 3BGPA 2OLCA 4CG8A 4XNEA 3H3CA 2Y4IB 3Q9ZA 1L3RE 3ENHA 3LCKA 4FC0A 3D9VA 4CD0A 5JH6A 1O9UA 3P7CA 1Q61A 4RX9A 3FMKA 3EFLA 5DR6A 3FMLA 5GHVA 4IJPA 2W9FB 3C0IA 3U9CA 4PDPA 4AZEA 4JAIA 2UZBA 1VLRA 2J50A 4ZTRA 4ACDA 2GU8A 1JPAA 2B4SB 4O0SA 4YJQA 3F5GA 1ZYSA 4EOSA 2PVYA 4IBMA 3UNJA 4D5KA 1BMKA 5HTBA 3UQCA 1PXKA 3C1XA 3HNGA 3KC3A 4MKCA 4XV3A 4MAOA 4FIJA 4KIKB 4LYNA 2B7AA 3C4WA 2UZOA 2BHHA 4D9UA 5FDPA 4R7BA 3I81A 4AP7A 2WEVA 5ETIA 3U6HA 4GW8A 3DK6A 3TDVA 5C4KA 4L01A 4AFEA 4EQMA 5FP5A 3MPMA 4CTBA 5AM7A 1U5RA 5E8VA 3D83A 2XIRA 4BIEA 5I9ZA 3NFGB 3VRZA 3DBCA 4E5WA 3BI6A 3PXZA 5C03A 3ERKA 1TVOA 3RI1A 1Q24A 4CRLA 2QC6A 4PTEA 5FEQA 4AZVA 5HBJA 3SG9A 3AMYA 2JLDA 3VUIA 3FL4A 5CXZA 1OL5A 4JIAA 3LIJA 2E9OA 5IQEA 5CU0A 1GNGA 2R3NA 4UMQA 4F78A 4EOPA 4AN2A 4ZS0A 3PJ3A 4ITIA 5IQBA 3NLBA 5JZNA 3N4UA 5HQ0A 2HAKA 3KL8A 4M0ZA 2XYNA 2GHMA 2PYWA 4A07A 5DR2A 2JKQA 4WRSA 4X3FB 3TKHA 1OBDA 3KMUA 2ZDUA 3C13A 4IAAA 2VAGA 3FLQA 1VR2A 3LFNA 4FTIA 4LM5A 3LPBA 4NFMA 5BMMA 5IA2A 5HNIX 5CY3A 3EYHA 4C8BA 4FV6A 1G8SA 3M2WA 4X2NA 2W4JA 3QX4A 2JDRA 3CY3A 3FDNA 4IAKA 4BDCA 4EQUA 4TWOA 4JIKA 1SVEA 2JD5A 3UIXA 3ZRMA 5I9WA 4IAZA 4GKIA 4I41A 4PF4A 5G1XA 4FSTA 2R64A 3AOXA 3E62A 4NT4A 5HLNA 3R2BA 3U4WA 3EZRA 2QNJA 2W0JA 3F66A 3DQXA 5AR2A 3ULZA 4KBAA 4M8TA 3AC2A 2JDTA 3Q04A 4YHTA 4YBJA 4UWYA 1Q8YA 5BUJA 4EQCA 2LAVA 3DBFA 1R3CA 2XIYA 4J96A 4OTQA 5CTPA 3TWJA 2XJ0A 3FZOA 1TQPA 2OI4X 3AC5A 2CMWA 3ET7A 3GU5A 2RL5A 4GYIA 2JBPA 3ZDIA 1WBVA 3FZSA 4HCTA 3ZEWA 5GJFA 3T8OA 4E3CA 2YAKA 2BRBA 2X9FA 4FKLA 3H9FA 4ENYA 5H2UA 1WMKA 4EK4A 2PVMA 3L8SA 4TWCA 4CT1A 4UXLA 4F09A 3NCGA 3ZZEA 5ANJA 3HECA 4MTAA 4BDBA 2C3LA 3MVMA 4C4JA 2E9VA 4D2WA 3EN7A 4XS2A 2UW3A 3UMXA 2W4KA 4UEUA 2W4OA 4LGGA 4X2FA 3R9NA 3P4KA 3PXQA 4H1JA 3V5LA 5J5SA 3KVWA 1XMMA 5CNNA 5EHYA 4KSQA 3GB2A 3SDJA 3T3UA 3VUMA 3RPYA 5DRDA 4MUQA 3LFAA 3PRFA 4GG5A 3CR0A 4WA9A 5EM7A 4BCPA 3NW5A 3D5WA 2E9PA 3ORTA 4FIHA 4P90A 2IZTA 4CQGA 3DJ5A 3CKWA 1SM2A 2RFEA 2X2MA 1IR3A 3UVQA 4O96A 4DHFA 4AW1A 5EDQA 2BCJA 2BAKA 3A99A 2CLQA 3FKLA 3CTJA 4FK6A 1ZYDA 2WTVA 3QA8A 4JBOA 5AJQA 1H1PA 1R0PA 5JFXA 4QMZA 2QR7A 4BCFA 1FVVA 4PPBA 5HD4A 2ETKA 2BIYA 4R3PA 4RVTA 3GCVA 3DTCA 5DE2A 2WEIA 3BEGA 2R3LA 3DA6A 4OLIA 5AP7A 3IO7A 3W2PA 3ORMA 1JSTA 3E7VA 5ANEA 3P23A 3SX9A 3FLWA 3AMBA 4A9RA 4MEDA 4DH3A 4WBBB 4EOMA 3L9LA 1H1RA 2IZSA 1W7HA 4JL9A 4MX9A 5HESA 5HLPA 4IB5A 3LXLA 1H01A 5CSHA 4U7ZA 3COMA 4ZJVA 5KMJA 3DJ6A 3FXWA 4KNBA 4FZ7A 3TIYA 4IM0A 5ETAA 3MBLA 3ORXA 4FODA 4OTWA 3DS6A 1Z9XA 4TY1A 4YO4A 2BHEA 5FDXA 1OL6A 1OPLA 5K9IA 3OWKA 3MSSA 3SXRA 4YMJA 1Y57A 2OIDA 4W8EA 2F7EE 1MP8A 4FTUA 2J7TA 2W05A 4D1ZA 1ZOEA 4WNOA 3NNWA 4NCTA 3WF8A 3KULB 2G1TA 2XA4A 3CLYA 2E2BA 3BKBA 2XKDA 4FL1A 2XM9A 3W33A