5AWMA

The crystal structure of jnk from drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian jnk proteins.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
356
structure length
345
Chain Sequence
QHYTVEVGDTNFTIHSRYINLRPIGGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVREHTVEQWKELIYEEVMDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Stress-activated protein kinase JNK
publication title The crystal structure of JNK from Drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian JNK proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 107
structure length 345
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5awmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5awmA01
3MI9A 3BWFA 5HOAA 3LXKA 5DPVA 2B1PA 4Y8DA 3C1XA 4UMQA 2R3FA 4FKIA 3DFCB 3II5A 4H3QA 5DT3A 3U9CA 2XMYA 4MYGA 3FXZA 3P0MA 4CKIA 2HELA 2ITOA 4B4LA 4Z7HA 1QCFA 2HXQA 2UZWE 5AAFA 3HMOA 4BCPA 5LCKA 5LXMA 1L8TA 2FO0A 1GIIA 3P23A 4X2GA 4HVHA 2QLUA 4EH5A 4E73A 5E8WA 2UZNA 3F82A 4KIKB 1UNGA 1YXSA 4I20A 4QMSA 2WAJA 3G6GA 3KMMA 5H8BA 4G6OA 4OTQA 4FKOA 4EQUA 3GU6A 1OITA 2XJ0A 2VWXA 4I0TA 4NJDA 1M7QA 4WRGA 1O6LA 1RJBA 4FIHA 2EB2A 4FTRA 3FE3A 4DEAA 1K2PA 4O0UA 5HVJA 5B2LA 1W8CA 2R4BA 3IG7A 3KXZA 1LUFA 5I9UA 2QG5A 3WIGA 5AM6A 3D7TB 4U42A 3BYMA 3SC1A 5EYDA 5J5TA 2JEDA 5HLWA 1ZYLA 4W9WA 5FP5A 4C34A 4IX4A 3VF9A 3QA8A 4IDTA 3RHKA 4TWPA 3IW8A 3ZYAA 3UO5A 4FEQA 2OZAB 4FV2A 1WVXA 1OKZA 3GVUA 5HG5A 1OBGA 3COIA 4J71A 3IGGA 1H26A 4TKSA 5HIDA 3VS2A 4ZIMA 2W1CA 3OT3A 3VUKA 3FL4A 4FZFB 4QQTA 5HESA 4Z3VA 4R7BA 2Y4IB 3F7WA 1YVJA 4L68A 4Z9LA 3FQSA 4C0TA 3R8ZA 5J7BA 3A7HA 5AR8A 1QL6A 4W4XA 4S2ZA 2JLDA 4J52A 4NM5A 3U6IA 2C5YA 3H4JA 1O6KA 2C6KA 2IW6A 4BDBA 4YSMA 2O0UA 3TKUA 3OS3A 1XHAA 2IW8A 2OZOA 3RINA 5DT0A 4ZAUA 2CKQA 4OW8A 2ZB1A 4F7SA 3ZO1A 4RVLA 5CZHA 5KCVA 2PVYA 3ZRLA 4M8TA 4RJ8A 3OY1A 4Q2AA 4BVUA 3R30A 4AN2A 4HW7A 5HTCA 3FHRA 2CPKE 2XNOA 4PTEA 5CXHA 4NW6A 4PQNA 3D5XA 3BI6A 5EQEA 4MK0A 2B52A 3ZLYA 4HGSA 2ZAZA 3PXZA 4N70A 5AV2A 3SLSA 4QMLA 2B53A 3HNGA 5CSHA 5BQ0A 1OVEA 1PXOA 2FGIA 4FKJA 3F69A 4FVRA 3UVQA 4C3RA 3I81A 4K33A 4BCOA 2G2IA 3RTPA 3AD5A 4ANBA 4AZSA 5ICPA 2OXDA 5HEZA 3REPA 2NRUA 3ZC6A 4J8NA 3NZ0A 3WZJA 5IDNA 3SX9A 3E64A 3FMLA 1SNUA 3CIKA 4BZOA 4K18A 2QHMA 3FDNA 4I23A 4CKRA 1V0BA 3DBEA 5EDQA 2IW9A 1JSTA 2JIUA 3ORTA 4F9YA 2RFSA 4ZY6A 3UQGA 3A2CA 4S30A 3QBNA 2P2IA 3VW8A 5E1EA 3GU5A 3IK3A 5IQEA 3BE9A 4NCTC 4FVQA 4YSJA 2CGWA 1STCE 4DF3A 3LFBA 1YI6A 4ITIA 4PRJA 2WFYA 5DWRA 4MQ1A 5AFVA 5IKWA 5A4TA 1WBNA 3LHJA 3OEFX 2XIZA 3MH2A 4EHEA 2OFUA 3QD0A 4I22A 2WZJA 4MKCA 3ZU7A 1DI8A 5IEXA 2JGZA 2E9OA 5CU3A 5LCJA 4WA9A 5M09A 4FMQA 3ZDIA 3E3PA 1OPKA 4DYMA 3LJ0A 2UW6A 1WBSA 4R5YA 5HNGA 4F9CA 2XVDA 1M2PA 3TNIA 1J91A 3KVWA 3MBLA 2WU7A 4L44A 4QTBA 5FTQA 3SW7A 1V0OA 3KL8A 3JUHA 4J53A 5AJQA 2QO9A 3RAKA 3MY0A 4AGWA 4AZEA 2PMOX 4GFOA 3I0QA 2AYPA 1CDKA 4JXFA 1T46A 5GZAA 2WPAA 2GFCA 4S32A 5BVNA 2OJJA 4XP0A 4PL4A 1K9AA 3SKCA 4ZLOA 2OU7A 1ATPE 2WTDA 3R01A 4J98A 3UBDA 4JDHA 5A54A 3UOJA 1BMKA 1DAYA 2XNGA 4ZTLA 4YTCA 2RKUA 4USDA 3Q04A 4JG6A 3PXKA 4LGGA 5AUWA 4O7LA 3MS9A 2HXLA 3SD0A 4UMPA 5DYJA 4XP3A 4LV8A 3FXXA 4XH6A 3FMEA 4AT5A 3H9OA 4GK4A 4O81A 2R3PA 5A4QA 2DUVA 3C9WA 1XQZA 1GZ8A 1F0QA 2XK3A 4HGEA 3FKNA 4WG5A 4YJSA 2R9SA 5M4CA 3KK8A 5M4FA 2YZLA 1QPJA 2VN9A 4QMPA 4ZTSA 4UV0A 3C0HA 3HMMA 2C30A 2CCIA 1FGIA 5CNOA 4GK3A 3EWHA 5DT4A 4L01A 5KMIA 5FXRA 2CDZA 2W96B 4X7QA 5GJGA 3TUDA 2BRHA 4BIBA 5HE3A 3KA0A 4JNWA 4M15A 4OBOA 2W0JA 2R64A 3PA5A 4FTQA 4BYJA 4RG0A 2R3GA 3N4VA 4JJRA 4DEIA 1SVEA 5H8GA 3S1HA 4B99A 3PG3A 3R1YA 3M42A 2F49A 3AMAA 5AIKA 2PVMA 3IW7A 3D4QA 3UNZA 5HCZA 5I0BA 5C9CA 3ATTA 3PJCA 5FEQA 4EKLA 3NWWA 4G3FA 5CU4A 3VBTA 3G51A 3THBA 3EFJA 5CF8A 4AG8A 3RBWA 3UPXA 3WE8A 3NAXA 4C61A 2C6MA 3HRCA 3WZDA 2W05A 2H8HA 3DXQA 5DVRA 3AT2A 3FPQA 3R9DA 2X6DA 4R3RA 2QQ7A 1UU8A 4RJ7A 1K3AA 5DGZA 1Z57A 4A06A 1JVPP 4DG0E 1YXVA 3LXNA 4ZTQA 4V0GA 3FLSA 4ZSGA 4Z55A 5L2QA 3CTQA 2WGJA 3PA3A 4AA0A 4DEHA 3FQEA 2WMAA 4M7IA 4GVJA 2WNTA 3EN9A 2BRGA 3KRLA 3Q5ZA 2B9FA 4TXCA 5CWZA 3TEIA 3UVPA 4EH3A 4O7SA 3IPHA 1PJKA 2VTIA 3PPJA 2XJ1A 5DG5A 4FYNA 4B8MA 4DTAA 2YWVA 4CFWA 3TG1A 2IWIA 3T3VA 3O7LB 3F66A 4HZRA 3KXMA 2JFMA 4HNIA 4I6QA 2YAKA 4BTFA 1W83A 5HO6A 3TZ9A 3NYXA 2BRBA 1GZNA 2VUWA 4IWDA 4OAUC 2JDVA 3BYSA 5C26A 1Z9XA 2EXMA 2VRXA 3ZRMA 4X3FB 3VBYA 4JRNA 5I4NA 2UW3A 3GCUA 4BCKA 3QLFA 4QMZA 3TN8A 4OTHA 2ITZA 3I4BA 4ZS4A 2YAAA 3C51A 4C4GA 2VWZA 2FSOX 5EHYA 3PVUA 2F2CB 4WUAA 1ZMUA 2QG7A 4TZRA 1O9UA 2LGCA 3NUSA 4J7BA 1OB3A 4CG9A 3UQFA 4CRSA 3ZXZA 5E92A 3CSVA 4YJRA 5D1JA 4BRXA 4RX5A 2W5HA 4O2ZA 4I4EA 3WF6A 4IC8A 2XA4A 3A62A 4KWPA 1QMZA 4FTCA 4HNFA 2UW7A 5D12A 1NY3A 2PUNA 5E4HA 3EL7A 3KN5A 3HV6A 5GNKA 3VS1A 4R78A 4K1BA 5KMKA 3SA0A 3EYGA 4DCEA 3OTUA 2XH5A 5HU3A 3NUUA 3AGMA 5JZNA 5C1QB 2G15A 5L6WL 4EONA 1OIYA 5FRIA 3L9LA 2R3LA 1FVRA 4OBPA 5IH5A 3FWQA 2UW8A 4GIHA 1VYWA 4BICA 2WIHA 2QLQA 3ZM9A 4JL9A 4FR4A 4B9DA 3QZGA 1VR2A 3MW1A 2ZVAA 5FM2A 2YA9A 5DR9A 5LARA 4ZSAA 2BIYA 2XCHA 4Y95A 5DR6A 5K0XA 1JKLA 1OIQA 2XK7A 4RBLA 1ZLTA 4TWNA 4B8LA 3C4XA 4MD9E 5FP6A 4C3PA 5FBOA 3RWQA 3A7GA 5CAQA 4EORA 1L3RE 2G2HA 3AC3A 2C5NA 4K8AA 3HMNA 4DFLA 2XF0A 4XBRA 4OTWA 3POOA 3QTZA 3GU8A 2XNNA 1BKXA 1YDSE 3CQWA 3S4QA 5KMMA 1E1XA 3NS9A 5CANA 4CMUA 3O8TA 3VC4A 3TUBA 1KE8A 2JKKA 4IHPA 5AR7A 2OO8X 2V5QA 4WG4A 4DC2A 5HO8A 4WNPA 3U4UA 2EUFB 4M0ZA 3KRXA 4YHJA 4ANLA 4IADA 4IM3A 4H3PA 2JDSA 4YR8A 3DT1A 3CY3A 4L3JA 4E20A 3KXGA 4P2KA 3L8VA 3PUPA 5G6VA 2G9XA 2JDTA 5M08A 5HBHA 4BGQA 2UVZA 4E93A 2QODA 4TT7A 2R7BA 3Q4CA 3UG1A 4BDCA 3QCXA 1R0EA 2I6LA 4KKEA 4XOYA 2ZV7A 4BZDA 4W4VA 3NCGA 2YCRA 5LWMA 4EOQA 4DT9A 2WMRA 2J0MB 3QKKA 4L42A 3RAIA 4IW0A 3MVJA 3FMJA 4CG8A 5BUIA 4E3CA 4KKHA 2XIRA 3NUPA 4IAFA 4MWIA 2P0CA 4TYEA 2VNWA 4J95A 3MH1A 5HNBA 3RAHA 2JIVA 3FSFA 4AP7A 2PYWA 4U44A 4KINA 2OZAA 2BAQA 3GFEA 5A3XA 4QQCA 4BFMA 2QVSE 3NUAA 3S0OA 3RI1A 4D2SA 3F3ZA 2XNBA 5T68A 3QCSA 1GOLA 4IWOA 1LEWA 3DV3A 3FZOA 5BVEA 3ORLA 4JIAA 2WTIA 3GXLA 2BFYA 3NW6A 3ACJA 1CKIA 2VU3A 3F5UA 1YDTE 2CN8A 2QD9A 3FPMA 3NEWA 4IBMA 4KBCA 2PY3A 5HD7A 1KUTA 1H1QA 2VWIA 4U6RA 4Z16A 4ANMA 2E9VA 1P4FA 2C0OA 3G6HA 4FSNA 2C3KA 2GS2A 4JBVA 5EM8A 3FMHA 4OLIA 4P4CA 4K9YA 4CFXA 1U5QA 3QTUA 4G5JA 2V62A 2R5TA 3QTIA 2HW6A 4QP8A 4L67A 4XG2A 4FTTA 4DGLC 3VW6A 1BI7A 5CF4A 5GJFA 3VRZA 2Q0NA 2UVXA 3CTJA 3JS2A 4D2PA 4NL0A 5EW9A 2ITPA 3MDYA 1WBPA 2XNPA 4APPA 5IA4A 5ANEA 4EC9A 2WMVA 4AZTA 3OWPA 4CTCA 2YCQA 3HMIA 3FMKA 5HLPA 4MBJA 5M55A 3TZMA 1XJDA 1JOWB 4O0VA 4USFA 3NNUA 1H1PA 3Q2MA 1Q8UA 4I21A 4UMUA 3MIYA 2A27A 3D5VA 2C6EA 1OIRA 4IX3A 3BHVA 3BPRA 3VBQA 4DBXA 2YWPA 1G8AA 1WAKA 4BKYA 4D1SA 4GU9A 3QCYA 3CGOA 4FV8A 3ZEPA 5B2MA 3HDNA 3E7OA 3U6JA 4F4PA 4J97A 2X8DA 5EHLA 3ALOA 2PUPA 4O96A 3CD3A 4PP7A 5ANJA 3IDPA 3QLGA 3DJ6A 3R6XA 4O83A 4IAYA 5BVDA 4AOIA 3HGKA 3HDMA 2QOHA 1PXLA 4CV8A 1TQMA 1P5EA 3PWDA 4I1ZA 4YPDA 4IVBA 3T9IA 5JT2A 1Z5MA 4MH7A 2W1FA 4FKVA 3ORMA 3QYWA 4IAKA 3UG2A 3BGZA 3PPKA 1XKKA 4QP4A 2ONLC 3DQXA 1VEBA 3WILA 3P08A 5HORA 1JQHA 3A4PA 1YKRA 2V22A 4H36A 3M2WA 4H1MA 1JWHA 3W8LA 4IZAA 2GQRA 1TQIA 2OFVA 5IDPA 4LG4A 4D9UA 3GP0A 2BTRA 4O6EA 4QPMA 2IPXA 4XG3A 3CCNA 4O7VA 4MQ2A 3KFAA 5DMZA 5DH3A 4GG5A 4ZTMA 2ESMA 3QD3A 2YFXA 3MTLA 2IG7A 5CU0A 5FQDC 4YLKA 5CVFA 2VV9A 3QFVA 4FA2A 3ORNA 2XKDA 3PXFA 4OT5A 1YW2A 3LM5A 3NYVA 4FL2A 3ENHA 5CQWA 4AW5A 4KBKA 3D5WA 1MUOA 5E8YA 4BDKA 4D58A 3AMYA 4D5HA 4X6RA 2OF2A 3V04A 3ZSGA 1GY3A 3QTRA 4AX8A 3PDTA 3SOCA 4BKZA 3ODYX 3VJOA 4LUEA 2DYLA 5KO1A 2GHGA 4RFZA 3QWKA 4ANSA 3BHUA 3DKCA 2IO6A 4NM0A 1Q4LA 2CN5A 3HKOA 5EKOA 5AUXA 3LLTA 4Q9ZA 5CEPA 1OL7A 1JKSA 5C03A 3PTGA 4EH6A 3A4OX 4KS7A 1UU9A 5KMNA 4ZSLA 1OPJA 4XHKB 2OWBA 2UZVA 2C3JA 2XIYA 3IDBA 5M07A 4I94A 4AE6A 1XO2B 2OKRA 4EH2A 2R0UA 4AW2A 5ANIA 5FD2A 4IWPA 1KWPA 3AC1A 3F2AA 4NCTA 4AW0A 1KV1A 4F6SA 5EOBA 4YHFA 1OKYA 3E63A 4BCNA 2F7XE 4FZ7A 5M56A 5L8JA 5C4LA 4GMYA 3RPYA 4BDIA 4G6NA 2UZUE 4EOSA 5L8KA 3HV7A 4E6QA 5ITAA 4DGNA 1HCLA 3MGYA 2PUUA 4F9BA 2RIOA 1OL5A 2WELA 4O91A 5K0KA 4WNMA 4HPTE 3LM0A 3PVWA 4TNDA 2J5EA 4U81A 4KSPA 2XK8A 4G16A 3G15A 4V0GB 2VO3A 5CVGA 4FT7A 2WTKB 2RL5A 5E8VA 4UBAA 5FM3A 1OL6A 4FT3A 4C33A 2XNEA 3R8MA 5JQ5A 4Q5HA 3LCOA 3CKWA 2GSFA 4M67A 1SYKA 4U43A 4Y73A 4PWNA 2IVVA 4CCBA 4MD7E 3G90X 2PMIA 3AOXA 5HTBA 4KNBA 3OY3A 3PRIA 4IJPA 2XKFA 4XRJA 4YJQA 3FMDA 5GHVA 3MFUA 4F65A 3KCKA 2XEYA 3WZUA 3E8NA 2FH9A 5M4UA 3H9FA 3W55A 4EC8A 2ZMCA 4PL5A 2VTSA 3R2BA 1PXNA 4G17A 2XK9A 2XIKA 5JGAA 5FXSA 2P2HA 4FZAB 4BTMA 2X7GA 3ZO4A 1CM8A 3IQ7A 3K5VA 3UOKA 3HLLA 2QR8A 4IC7A 4XG8A 3NYOA 1VZOA 4FT0A 3O7LD 4QP6A 3W2PA 4Z7GA 1ZY5A 2RFEA 5ACKA 3TJCA 3VS6A 5I3RA 2AUHA 2X2MA 3IO7A 1ND4A 3GCSA 2OSCA 5C8MA 5IMXA 1RQQA 2BVAA 3LW0A 5A4EA 2CSNA 2EWAA 4CRLA 2WOTA 3OUKA 4HOKA 4UY9A 5BX0A 4OGRA 2Z8CA 3BYVA 4IB0A 3Q96A 3ZTXA 4E6DA 5LMBA 5E1SA 4NFMA 3MA3A 1CMKE 3O71A 4PMMA 4KS8A 2OIBA 2H96A 3HX4A 3QGYA 3L8SA 3WYYA 3ORKA 3G5DA 4UB7A 5JRQA 4P90A 2CGUA 1M2QA 3KXHA 3TZ8A 4O86A 2YDJA 3WZEA 3Q4TA 1U54A 1NT2A 3NLBA 2YIXA 2B9JA 3NR9A 4IB5A 2VTHA 3U55A 3HV5A 1UWHA 2QOQA 4FG7A 3LMIA 2W5BA 4KIOA 2PVRA 4XV3A 3IGOA 4Q9SA 4CFNA 1CKJA 4GCJA 4AGUA 3WI6A 3ACKA 3EQFA 3RNYA 3QRUA 2PTKA 4FSUA 2FYSA 2XBAA 2XZSA 4AW1A 2A2AA 4O82A 2Y4PA 1YHSA 3LFQA 2VWUA 5AR5A 3EHAA 4GFGA 4JR3A 2Q83A 3TT0A 2QKWB 1LP4A 4LUDA 4YJOA 3E7VA 1M14A 5I9VA 4I3ZA 4O0TA 4BTKA 2P3GX 4MXAA 5M44A 4BCFA 1UWJA 3DB6A 4PPCA 3DA6A 4FNXA 4LV5A 4N6ZA 3BEGA 4QT1A 4RIXB 4X21A 4ACGA 3SGCA 3W18A 2R3JA 3DKOA 1RW8A 3LXPA 3OWLA 3E92A 5HHWA 1B6CB 5DBXA 3TCPA 1YRPA 2Y4IC 4U8ZA 4ASZA 1YHWA 5BYLA 2XYUA 3JYAA 1P14A 2WQEA 2XP2A 2HWPA 1J7IA 3KKVA 2DWBA 2JDOA 2BILB 4M84A 4CLJA 3LQ5A 4ZOGA 4CSVA 2G2FA 2RGPA 3ZXTA 4EK6A 4DLJA 4BN1A 1WZYA 3I60A 1KOAA 5KBQA 2QC6A 3F5PA 4HVIA 3TDWA 4BCJA 1XWSA 3EKKA 3R73A 4HCVA 4OR5A 4IQ6A 4R1YA 5BVWA 1FVVA 3MFTA 3HUCA 3TTIA 3UYTA 5KE0A 4B0GA 4FOBA 5DIAA 2DS1A 4FIFA 1H1SA 3L9MA 3QTXA 3Q9ZA 4M68A 3GQLA 3FJQE 4YZ9A 1FINA 3AMBA 3BBTB 1U59A 1I09A 3VS0A 3PYYA 3P5KA 4YUQA 2PHKA 5JSMA 4DEEA 3DLZA 5J1WA 3PRFA 2EXEA 1OUYA 1PXIA 3O2MA 4WOVA 2J7TA 3ZSIA 5CF5A 4I92A 5HI2A 1U46A 2W4KA 5J9LA 2X7FA 3EQBA 5CEQA 4F99A 4EWHA 3OW4A 4EL9A 2YLEA 3HP2A 4XOZA 4DBNA 2GNJA 3W16A 3KY2A 3VF8A 4ERWA 3ZFXA 1JSUA 4RA4A 5FBNC 5DLSA 3UPZA 1TVOA 4RFMA 1ZARA 3UP2A 2VTAA 3CQEA 2WIPA 4I6BA 3V5JA 3FYJX 3COKA 1UU7A 3CJGA 1JKTA 4DFUA 3IOPA 3BLHA 1PMUA 3QZIA 3LQ3A 2E9NA 3UC4A 2YERA 4DFYA 5HVYA 2Y8OA 1XH8A 2NO3A 5CSWA 3OTVA 2VGPA 4QOXA 5EYMA 4BKJA 4DN5A 4QTEA 4UMRA 4P5ZA 1S9IA 3OG7A 2BTSA 4EH4A 5KKRB 4CTBA 4AQCA 3AT3A 4L7FA 3IW5A 4FIIA 3FKOA 4FKPA 3VS7A 1MQ4A 3IKAA 3LFAA 3MH3A 5ETCA 3UQCA 3F5XA 4HVGA 4ARKA 2NPQA 4NZWB 4HVSA 2V55A 4K77A 5BVKA 3BKBA 2YACA 3MVHA 2WU6A 3Q9XA 5L6OA 4IJ9A 4RQKA 3EJ1A 3E93A 3ZLSA 3LZBA 3BCEA 4RZVA 4A4XA 2QOLA 3GCVA 5BVFA 4E4LA 4RZWA 4FEUA 4XMOA 4IXPA 3DBDA 2OG8A 4XP2A 4IZ5A 4U5JA 4NIFA 4XNEA 3DK3A 4O0YA 3W1FA 5DRDA 4G9CA 3MVMA 5M57A 3GB2A 5CU6A 4GKHA 1Y8YA 3A99A 3SXFA 2VTOA 3PVGA 1YXUA 5CEKA 2SRCA 3ANRA 2X0GA 3NPCA 5FTOA 5JQ8A 4WO5A 2PUIA 3E62A 2GQGA 3LMHA 4EOOA 4CFMA 4BTJA 2ZB0A 4Y46A 4LOOA 3QZFA 2PZYA 3CJFA 3QQFA 3VQHA 4PPAA 3S3IA 2QOCA 3R83A 3JVSA 4IFGA 4ERKA 5KUPA 2BPMA 3R8LA 3L8XA 3NNXA 3VO3A 3VUTA 4XRLA 2WTCA 3PSCA 2OICA 2PZIA 4M14A 2W06A 4EZ3A 4GT3A 5EQPA 4YTHA 2KTYA 4JOAA 2R2PA 2VTTA 5L2IA 2Z7SA 3ORZA 4S31A 4IVDA 3QHWA 3VIDA 2C6OA 4UWBA 3D83A 4X2JA 3QALE 2C0TA 1H00A 5BYZA 4EQMA 3CLYA 3NGAA 2X2LA 5IG1A 3MJ1A 3NW7A 3SW4A 4F1TA 2UW5A 3R7VA 4BY9E 4RSSA 4O21A 4O1OA 4TYHB 2OGVA 1R1WA 3JPVA 5E91A 3RZFA 4RVMA 3TL8A 1KSWA 3VBXA 4FTUA 1SM2A 4UXQA 1YDRE 3ZO2A 4MBIA 3EFLA 3MY5A 4BL1A 5J7HA 4GL9A 3R8VA 3PJ1A 3POZA 4QO9A 3TIYA 2ITXA 1AGWA 4F9WA 3WF9A 3O51A 2VGOA 4GJ2A 5I9YA 1REJA 2BZIB 3P9JA 4R7IA 3Q4UA 3W2QA 4F7NA 4QQJA 4U45A 4A9TA 1ZWSA 2WKMA 4FV0A 4MCVA 3QD2B 2OI4X 2X9FA 1F5QA 2J0JA 4O22A 3U9NA 4D55A 4UX9A 1Y6BA 2R7IA 5EM7A 2FB8A 3D15A 4PNIA 3M11A 5IA5A 2PPQA 2JKOA 4FTIA 2I0HA 3EMGA 1J1BA 5IUGA 3HAMA 2HENA 2W9ZB 3H0YA 3OOMA 4H39A 4DINA 4DH5A 3B8QA 5CAPA 5EYCA 3TKHA 4QYEA 2O5KA 3GT8A 2G1TA 4TRLA 3BV3A 1H08A 5G1XA 3R04A 3A8WA 3ZFYA 4A9UA 2F9GA 5ETIA 4LQMA 2ONLA 4AACA 2R0IA 3CPBA 3CD8A 3PZHA 3QRTA 1JNKA 5LMAA 5IA0A 3R7IA 2E9PA 4MXOA 2J90A 2WMBA 3FZTA 3LFSA 4JBOA 5JK3A 4N57A 4FKGA 2I1MA 5JRSA 3R7UA 4ZS0A 3DCVA 3NAYA 3ORPA 4WNKA 4J8MA 3KCFA 3QKLA 3SG9A 5AUVA 5JFVA 3G0FA 5BUEA 4Y5QA 5EW3A 2PE1A 4EH9A 4O0RA 4OTRA 4FVPA 3ROCA 3VS5A 3SG8A 2W1EA 3TTJA 4EUUA 3E8DA 3SV0A 1GNGA 2QOOA 3TDVA 3UZRA 4W4WA 4AA4A 3R2YA 3LVPA 5ACBC 1Q97A 2XBJA 1IRKA 4Y5HA 4WSQA 1ZXEA 1YXTA 2FSMX 3R1QA 3FBVA 4UYAA 4E5BA 3I5NA 5CF6A 1YWVA 4XG9A 4JQ7A 5AWMA 4FGRA 2OJFE 3PP0A 4APCA 3G9NA 2QI8A 2YABA 4FODA 4RIWA 4CT1A 1IA8A 2BKZA 4FTMA 4I0RA 4LI5A 4KBAA 4MXXA 3ET7A 4I93A 4PTCA 4A9RA 4RX9A 3MFRA 4H3BA 3H30A 3OMVA 4ITHA 4NKAA 2UZTA 4AOTA 5B7VA 3QX2A 3LJ2A 4GEOA 4ZJJA 4F08A 5IU2A 4CFVA 5IQGA 3DK6A 5J95A 1W98A 2PVJA 2CKPA 3R63A 2GNIA 3MB6A 4ACDA 1U54B 4G5PA 5HE1A 3D0EA 3V5LA 2H9VA 3C0IA 4EUTA 2JBPA 2JKQA 3KB7A 4IMYA 4ZMFA 3U4WA 4NKSA 4O0WA 4KA3A 3R02A 3BHHA 3F3TA 4W9XA 3Q3BA 4IIRA 4FKSA 4XLVA 3Q6UA 4IACA 3ZM4A 3F2RA 4O7TA 4ASDA 4BIEA 2QR7A 2XIXA 3GNIB 1H27A 5A6NA 4FT9A 1PY5A 4B7TA 1NVRA 3AC8A 3PY3A 4JDIA 1ZMWA 1Y6AA 4KRDA 4USEA 3FMMA 3OUNB 3PLSA 3DJ5A 4EK3A 2XNMA 4O0XA 4MWHA 4N4SA 4CCUA 4QNYA 4E26A 2CNVA 4E4MA 4C37A 3VJNA 3UOHA 1PF8A 3ANQA 3DGKA 4FKRA 3GENA 2VAGA 4L46A 4WUNA 4PMSA 4ZK5A 5CYIA 3VULA 4QMWA 4FNYA 1NVSA 1YOMA 3UJGA 4AFEA 1XH5A 1PYXA 2RG6A 4U9AA 4XYFA 4YBJA 5CI7A 1PKDA 3C13A 5B2KA 1Q8TA 1APME 1MRYA 2EXCX 4X2KA 2VWYA 4RJ4A 4XG7A 4D2TA 3DU8A 1GJOA 1NVQA 5AP6A 5D7VA 4TTHB 4AE9A 3PIZA 4GS6A 4RQVA 5EDRA 5IEYA 5IH6A 3OD6X 2X2KA 5DHJA 1J7UA 4RIXA 3BHYA 2QOIA 1Q5KA 4WSYA 4ZXTA 4D9TA 5AAGA 3RK7A 5HVKA 5HZNA 4FEXA 1NXKA 3V5TA 4UMTA 3TNHA 2ZYBA 3PIYA 3Q6WA 4X0MA 5IUIA 4D5KA 5A4LA 1U5RA 2A0CX 3NDMA 2XKCA 5CEIA 4BBMA 4GSBA 4O6LA 2QCSA 4MTAA 3V6RA 2C47A 2GQSA 2PMNX 3TV6A 3BLQA 3LFNA 3T8OA 1FQ1B 5EM5A 4NFNA 3VBWA 4R77A 1PMNA 4DH7A 2YDKA 4QTAA 2HY81 2HZ0A 3ZHPC 4GG7A 4GJ3A 3G0EA 4LYNA 2ITVA 4FG9A 4CVAA 1PXJA 4BWXA 4PV0A 2I7QA 2BAKA 5TKDA 4JLCA 4ZTHA 3VUGA 3EFWA 1M2RA 3BGPA 3QU0A 4IFCA 4Y83A 4A4LA 4DAWA 1Q3DA 5F4NA 2ZDTA 1PXPA 1ZOHA 2X81A 3EQRA 4L3PA 5K3YA 4XEYA 5FUTA 4O0SA 1JSVA 3KQ7A 3N9XA 3QCQA 3CGFA 5DE2A 3GU7A 3R71A 4YURA 3D9VA 3RNIA 2J2IB 1GIHA 3I5ZA 3KF7A 4GIIA 4PDOA 3W33A 5F9EA 5L2WA 2OJ9A 2NNWB 3PFQA 5CSVA 2ETMA 4G2FA 2C6TA 3I7BA 3ZUTA 4PNKA 4G3GA 3CPCA 4LGHA 5ANDA 5FTGA 4NT4A 3V8SA 4DH1A 4Y85A 4BDAA 3T9TA 3OXZA 3ZEWA 3ZBXA 4M13A 4S33A 3AC4A 3K3IA 3PSBA 2IVSA 2PVKA 5C8NA 2A19B 1BL7A 2IVTA 2QO2A 4HCTA 3QC4A 4XBUA 4FX3A 4EZ7A 1H8FA 2WD1A 3K5UA 4RC4A 4FC0A 4MEDA 4ID7A 5DEWA 1Q3WA 2C4GA 4ANQA 3AD4A 4XV2A 4I41A 4X3JA 3ORIA 5IH4A 4WBOA 4A9SA 3RM6A 4OTPA 2JKMA 2PVFA 2VTLA 5AR2A 1BX6A 4R5SA 1YOLA 2OK1A 4JX3A 5CLPA 4AF3A 3MESA 4RWIA 2R3RA 3NNVA 4CFFA 5C01A 5LWNA 4EOJA 3BELA 3H9RA 3PY0A 2ETKA 4FF8A 4C02A 3F88A 4CV9A 4EQCA 3BU6A 5H2UA 2PULA 2XM8A 4JT3A 4YJNA 1HOWA 5HKMA 3GC8A 5DOSA 5J8IA 2CLXA 5ANGA 3O0GA 3H0ZA 3F3UA 4WNOA 4NIFB 3L1SA 2BDWA 3ZLWA 4DEGA 5E7RA 4C62A 4GYIA 3A8XA 4U97A 5AP0A 5AV3A 4CYIA 4EOIA 4BDFA 5K4IA 4BHZA 5EH0A 4PP9A 4ZSJA 3PJ8A 4QMTA 4HYIA 4NYEA 3Q2JA 5TR6A 2FSLX 5AUZA 5AADA 2ZM3A 1UVRA 3ZC5A 2UZBA 4I5MA 4XG4A 3AC5A 1PHKA 4JS8A 4QQ5A 2PE0A 4LM5A 4YC8A 3S00A 4NM7A 4ENXA 4OAVB 3U8WA 5LOHA 5CASA 5M53A 3CR0A 2FA2A 5DEYA 5KBRA 1A9UA 2CMWA 2IZTA 2R3NA 4M69A 3BQRA 4OTFA 5LVPA 3FUPA 2VTQA 3CP9A 4FKLA 2RSVA 2XKEA 3FI4A 3HRBA 4KUJA 4F0IA 2GS7A 4ZEGA 3RZBA 2J5FA 2WMWA 4M66A 4TW9A 4J96A 2GHMA 3I79A 5F94A 5FWKK 4EH7A 3I6UA 4NK9A 2PK9A 2B55A 4FKQA 2X6EA 5CALA 3AD6A 3I0OA 4HGLA 1OGUA 1R0PA 2X4FA 3PSDA 4DGOA 4DGGA 2YM7A 2C5XA 4PUZA 4DT8A 1WCCA 2OJIA 2OF4A 5KZ0A 1PMEA 4CXAA 2I40A 4EOKA 4EJNA 3PLAE 4FL1A 2H34A 3BEAA 1W0XC 5I9WA 2ITQA 5CX9A 5AV0A 4K11A 5FDPA 3D94A 2PVNA 2PSQA 5FG8A 3IW6A 4CQEA 1HCKA 4FK3A 3HZTA 4MNEA 5DNRA 4TY1A 4W8EA 4CMTA 4FSWA 5BNJA 5AP3A 3SXSA 2X9EA 3HL7A 5AM7A 4L43A 3OT8A 3V51A 4DFXE 5FXQA 2ITYA 3DXPA 5E90A 2WTKC 3GCQA 4JG8A 3Q53A 3I6WA 5DFPA 4UWCA 4Y72A 2C5VA 2UW0A 3UODA 3TKIA 4TYHA 5IEVA 4DFZE 4ALWA 4EOMA 5EI8A 3WBLA 3R7EA 4L52A 5I5ZA 4EHVA 2YM8A 4WT6A 3EQDA 4QP3A 4X2FA 4F64A 4C2WA 1RDQE 3PXYA 2FVDA 3WE4A 2V7OA 4C58A 3PJ3A 2OH0E 4CZYB 4GW8A 4GFMA 5EW8A 3FEGA 4RGJA 2GPHA 4IDVA 5H8EA 3R21A 5LJJA 5L3AA 5DRBA 2VTRA 1H28A 1YHVA 2QOFA 1WMKA 3EYHA 4DTKA 3VS4A 2R3QA 4XV1A 2IZRA 5BMMA 4ASXA 3UZTA 2CHLA 5AX3A 5HIBA 2WQMA 2O65A 2GMXA 3UIMA 4HYHA 3VUHA 3FLYA 4ZY5A 3NW5A 3QF9A 2GNLA 2C6DA 4YLLA 3G33A 2ZMDA 4M3QA 2GS6A 2RG5A 3WF8A 3C4CA 5AP1A 4L45A 2EB3A 3C4FA 3UNJA 3ZONA 4GUBA 4YU2A 4YC6A 5HX8A 4HJOA 2ITUA 4EOLA 3MB7A 4MVFA 3RP9A 4BCGA 3MWUA 4E4NA 4GKIA 2HW7A 2ERZE 3LE6A 3OVVA 4ZTNA 3MY1A 5CS6A 3OEZA 1ZMVA 2OIDA 3IS5A 1Y91A 1OECA 3LFDA 3BX5A 3VHEA 5K5NA 4NH1A 5CVHA 2YJSA 5GINE 4DTBA 5AUTA 4CQGA 4TYIA 3TXOA 3DS6A 4O2PA 4RWJA 4FYOA 3TV7A 4O7ZA 2Y6MA 2W1IA 3EQIA 3KXXA 4CFUA 3UDBA 3R9RA 2I0YA 1P4OA 3Q60A 3VUDA 3NUYA 2BMCA 4GRBA 3Q32A 3A60A 3F3VA 4HCUA 3QTQA 2WMXA 3HECA 4RIWB 3R8UA 4BBEA 2HAKA 3DTWA 4UALA 4RMZA 2VTJA 3GOPA 4NWMA 4ONAA 4XLIA 5HG9A 4G3DA 3K2LA 2J4ZA 2Y9QA 3FSKA 2H6DA 4DE4A 4I5HA 3OROA 1V1KA 3VUMA 3F61A 3FI3A 2O63A 2X7OA 2WMQA 3MH0A 3P86A 4MXZA 3PWYA 3OFMA 3BZ3A 5I3OA 3DAJA 2WHBA 3PXRA 2CGXA 2QONA 3TNWA 3UO6A 5ANKA 1LR4A 4H05A 4A9YA 4ZMEA 3UE4A 4K6ZA 4C4JA 5AUUA 5IISA 1TKIA 4FL3A 4UYNA 4O38A 1OKWA 5TT7A 4LRJA 4FGBA 3FL5A 4KD1A 5JGDA 4FIEA 4AT4A 2BRNA 1DI9A 4V05A 4ZSEA 3RPRA 4BCMA 2XK4A 3DB8A 5CZIA 4O7WA 2BCJA 3PIXA 1ZYCA 5DN3A 4DH3A 3U54A 2VO0A 4QYYA 3R7YA 5KX8A 1WBOA 3RHXA 4DCAA 1QPCA 3RWPA 4E7WA 2R3MA 4KABA 2Z7LA 3LIJA 3QA0A 2CLQA 5AA9A 4K2RA 1PW2A 3KXNA 2WTJA 5HO7A 4AOJA 1XBCA 2ZJWA 4IANA 3UP7A 2JAMA 3EL8A 4F6WA 3LFCA 1J7LA 5AEPA 3N4TA 2WTVA 3U87A 1XH4A 3DFAA 2IJMA 2V0DA 5M51A 5AUYA 5CQUA 4BDJA 2YCSA 4YGAA 4YJVA 4RRVA 4NSTA 4G6LA 4L53A 2BAJA 4EBWA 1OM1A 3C4ZA 2W4OA 3MYGA 5FDXA 4U3ZA 5JFSA 5L2TA 2Z7RA 4FNWA 4FNZA 4RX8A 2QHNA 1OL1A 2J0IA 3AQVA 3QRJA 4QMXA 4EBVA 4BIDA 3KGAA 1OIUA 2QOKA 2P33A 1S9JA 4RFYA 2PVLA 5EI2A 3A61A 3NVKI 3R8PA 4EOPA 4Q5EA 2C6LA 2UZOA 3MA6A 3VN9A 3C4WA 3EZRA 1W7HA 3KREA 4ALVA 3DZOA 3PA4A 3C5UA 3EZVA 3QUEA 3ULIA 1Q61A 3FY0A 3TWJA 3SHEA 3QTSA 1VJYA 3GC9A 3PG1A 4HPUE 4R3CA 4YO6A 4FK6A 5KMJA 4CGAA 3FV8A 2IZUA 2YIYA 2YIWA 3D2IA 4CLIA 2BDJA 5A9UA 2VTNA 3FLZA 5F95A 3OBJA 2VX0A 3BGQA 4AGCA 5JFWA 4HVDA 2WEVA 5CU2A 4MAOA 3LCDA 3QHRA 3FI8A 3PPZA 4KSQA 2XK6A 3QL8A 4FIGA 1AQ1A 4RWLA 5FGKA 1ZYSA 4FSMA 3VQUA 3DZQA 5BMSA 4F7LA 4ACMA 5L8LA 2XUUA 3V01A 3U51A 2YLFA 4FT5A 2XM9A 3MV5A 4FOCA 3TJDA 4U7ZA 2YIQA 3V6SA 4DEDA 5KKRC 4BC6A 3DDPA 3LJ1A 5AX9A 3HVCA 4FUXA 1FMOE 3HRFA 4O27B 5CSXA 5FLFA 5TO8A 4O7RA 3A7FA 3NRMA 3W2OA 5LVNA 3OF0A 3G9LX 5KNJA 2Z2WA 2I0EA 4MD8E 4BI0A 2PU8A 4QD6A 3KMWA 5D10A 3E8EA 3TM0A 3O96A 3R22A 4QPAA 4GV1A 3JY9A 1FGKA 1UNHA 2J50A 4U40A 3L8PA 3B8RA 4YMJA 4ZY4A 1URCA 4FV6A 2OXYA 1Q62A 4QRCA 4EI4A 4OUCA 2IN6A 2ITNA 1IR3A 2AC3A 4YHTA 4H58A 2GTMA 1SMHA 4WBBB 4O84A 1UV5A 3H10A 3NMUF 1SNXA 3PXQA 1UU3A 3GC0A 3EIDA 4XS2A 2GNHA 4GYGA 2VX1A 4I6FA 2YCFA 4BB4A 4FV9A 4D0XA 1W84A 5KMLA 4F6UA 2VWWA 1BYGA 1JBPE 4I24A 4QNAA 3F3WA 1IA9A 3PE2A 3B2TA 3LKMA 3QXPA 1J3HA 1PYEA 4HZSA 4HYSA 2XB7A 4LOQA 1H0WA 1X8BA 4NUSA 3QRKA 4B6LA 3BIZA 2QU6A 3COHA 5F20A 3C0GA 1Y8GA 3SOAA 5J9ZA 3IONA 5KHWA 3G2FA 4O7NA 5L2SA 4UWYA 4BCHA 2OH4A 4CEGA 3EFKA 5EFQA 2UZDA 4RIOA 3KULA 4D4RA 4RIYA 3DTCA 4IVAA 3FZSA 4QMYA 5AR4A 3V5QA 4A07A 4M97A 4QP1A 2XEZA 5H9BA 1GZOA 1GIJA 3GBZA 1ERKA 4DEBA 4KRCA 3ZFMA 4X2NA 1G3NA 2YHVA 3W2CA 5IQBA 3OOGA 4FI1A 4RLLA 4RVTA 3UTOA 3DKGA 4FKTA 2BZHB 2O2UA 3WIKA 4M69B 1XBAA 3RCDA 4JBPA 4C35A 5HCXA 5A14A 3ZBFA 3UO4A 3OWJA 2X39A 3GOKA 4I0SA 5I9XA 4EYJA 4RJ3A 2C1AA 2ZV8A 5HBJA 4IAAA 5EOLA 3EQHA 3QWJA 4JG7A 3OXTA 2P55A 3MFSA 2Y6OA 4IVCA 4P7EA 3KVXA 4EK4A 3NSZA 1B38A 4FEVA 4E5WA 4EJ7A 3EN4A 2RF9A 3HV4A 4E1ZA 4F7JA 1WVWA 3QZHA 2YISA 5AIRA 5AP2A 1E9HA 1YWRA 1M52A 4NM3A 1H1WA 3HV3A 4QP7A 3WF7A 5IQIA 3OCSA 4GK2A 4MX9A 3D14A 2ITWA 5EKNA 3QQLA 2W17A 3P7CA 5K4JA 1J1CA 2C3LA 2QURA 3ODZX 2PE2A 3KRRA 3MTFA 4QMMA 3BHTA 5F1ZA 3ZS5A 4EK5A 4RWKA 5HD4A 4N6YA 2FUMA 3RPOA 2REIA 3OP5A 3IOKA 3NYNA 4FIJA 4MNEB 2PL0A 3E5AA 4PDPA 2WMSA 4QTCA 5EK7A 5FEDA 3KK9A 4D1XA 4CKJA 2VNYA 3VWAA 5KHXA 4QMVA 3UMXA 5CNNA 4DG3E 3ZLXA 1FPUA 1KE5A 1W82A 3P78A 3RJCA 4A7CA 2WO6A 3AC2A 4MNFA 4FG8A 1YOJA 1U4DA 2ZDUA 4PTGA 4RA5A 5AP5A 3BU5A 1BL6A 1KE7A 4JI9A 1KOBA 5A4CA 4RC2A 4IZYA 3DAEA 4RVKA 1M17A 3MSSA 5AAEA 4U41A 2J9MA 2ZV2A 1O6YA 3N51A 3BLRA 4LOPA 3ROYA 3S2PA 4LFIA 4XG6A 2GCDA 5K5XA 3A7IA 2PZ5A 3WZKA 4IZ7A 1PMVA 2VTMA 4NU1A 5DA3A 2O64A 4G9RA 4JRVA 4EYMA 3R9OA 2B9HA 4RX7A 4YBKA 4CT2A 3D7ZA 3VBVA 3O8UA 4FTNA 1V0PA 2UZEA 4GT4A 4A4OA 2W7XA 1A48A 4HYUA 4G1WA 3TNPC 2QOBA 4YNOA 2OBJA 4EHGA 5JEBA 2X8EA 1IEPA 4JAJA 4KKGA 3BE2A 5M06A 3FAAA 2PZPA 4DITA 1T45A 4GUEA 4M12A 3GFWA 1CKPA 5LVLA 3ULZA 4AA5A 5J9YA 3QQHA 3FZRA 3RK9A 4YP8A 4D4VA 1IASA 3LXLA 3GI3A 4F1OA 3PE1A 2GTNA 2GNFA 5E8TA 3QD4A 4BDGA 4C8BA 4DG2E 1DS5A 3Q9WA 4LRKA 3GCPA 4X3FC 4AAAA 2XRWA 4X6QC 5HCYA 4R8QA 1QPDA 3L9NA 4AN9A 3LLAA 3SRVA 4YTIA 3AG9A 3PZEA 1MRVA 5CT0A 3ZUUA 4YJUA 3PJ2A 3ZSHA 4FZ6A 4FUYA 4UXLA 4MBLA 2YJRA 2B0QA 5LMKC 3CQUA 4RPVA 2BKKA 2R3HA 4PF4A 3KU2A 3WARA 4CMOA 3R1SA 4E4XA 5EHOA 3AGLA 5GJDA 5IQAA 4IX5A 4LMUA 3LPBA 4YC3A 3ZZEA 2VD5A 2BFXA 3I1AA 4BI2A 1JLUE 5JZJA 2O8YA 4OT6A 2ZV9A 1GZKA 1UA2A 2EU9A 2JDRA 3DK7A 3IW4A 3FKLA 3OBGA 3MVLA 3TV4A 4QMUA 5AMNA 5EQYA 2JITA 3DBQA 3W32A 1H25A 1FOTA 1FMKA 3QUDA 4S34A 3RCJA 2B4SB 4XX9A 1BI8A 3COMA 4QYFA 4BGHA 3H3CA 4JQ8A 4PL3A 3RPSA 3W10A 3MN3A 4LL5A 2X8IA 3BBWA 4TPTA 4WIHA 3WYXA 4FSQA 4RJ6A 3E87A 1Q24A 2YM6A 5L6PA 2HZIA 1Q41A 4V04A 2WTWA 4ZZMA 3V8WA 4R7HA 4L6QA 2RFNA 2PWLA 4BF2A 3Q4ZA 4AS0A 3F5GA 4GT5A 2NRYA 1UKHA 3NX8A 2BIKB 4GU6A 3R9HA 1ZYDA 5CAOA 4IB3A 2BHEA 4J99A 4FKWA 3BU3A 3CXWA 3NUXA 3SVVA 2UW9A 4L8MA 3QAME 4EH8A 3DBCA 2RFDA 2YZAA 2BALA 3ENMA 2OW3A 1ZYJA 4R6VA 4BGGA 3MPAA 2C0IA 2WMTA 4ANNA 1EH4A 3ZO3A 2GFSA 3HP5A 4BBFA 5ETFA 1MQBA 4JQEA 4NW5A 3K3JA 3QC9A 3FC2A 4W8DA 5E9EA 4BR3A 3T3UA 3CC6A 2JFLA 3NIEA 4AFJA 4IM2A 4IAZA 4ZJIA 4ORKA 2CGVA 2Z02A 2VX3A 4JVGA 3QYZA 4BWKA 3FZPA 4F0FA 1DM2A 3FC1X 2B9IA 3BV2A 3ZH8A 4F0GA 4YJTA 4KB8A 1BLXA 4GH2A 5TF9A 5IUHA 2GDOA 3O17A 1OKVA 3UIUA 3ZDUA 3DOGA 4RC3A 3C5IA 2J51A 2J0LA 4K0YA 4G31A 5HG8A 4E6AA 4U0IA 3CKXA 5JKGA 3E8CA 3FYKX 2B54A 3KEXA 2HWOA 1G8SA 4EK8A 4AXAA 2UZLA 4AT3A 2P4IA 5L4QA 3NNWA 4C38A 1H07A 3LCTA 3BYOA 3EQCA 4W4YA 3MIAA 3CY2A 5DR2A 1QPEA 3RM7A 4DHFA 2F2UA 2G01A 3HEGA 4OBQA 4XCUA 2YN8A 3LAUA 5TOZA 5ETAA 1SVGA 4YJPA 5HIEA 5LQFA 3KMUA 4E5AX 3PP1A 3BWJA 3KF4A 2JD5A 5EM6A 5B0XA 3EN7A 2UW4A 4TWOA 5CI6A 2Z60A 4C2VA 4U79A 4ZJVA 5EI6A 3QGWA 3FLNC 4D1ZA 2XYNA 4BWPA 3HUBA 4ZZNA 4EZ5A 3JY0A 1XH9A 3EKNA 2HZ4A 5J79A 3DBFA 2IVUA 5HLNA 3LFFA 4PDSA 5I9ZA 3TACA 2WMUA 1KV2A 4O7YA 2ITTA 3R28A 4IB1A 4QYGA 5CENA 4KAOA 5IQDA 3EB0A 2ZM1A 3FI2A 5E8UA 4YTFA 3WF5A 4I5CA 1TQPA 3O8PA 3VUIA 5J87A 2R3KA 5C4KA 5T3QA 5EDPA 5J5SA 5E8SA 2QO7A 3FMNA 4F9AA 1VYZA 1NW1A 1YWNA 1Q99A 4JR7A 2EVAA 4JIKA 4IEBA 3GU4A 3V8TA 3PY1A 3P7BA 5D7AA 3OW3A 4ZTRA 4IH8A 4C57A 5BPYA 1PRYA 4QPSA 3V5WA 5T6KA 3TI1A 3GEQA 4RLKA 4FTKA 5ANOA 2UUEA 2YM4A 3TNQB 4BHNA 1XH7A 3UVRA 4C36A 3BYUA 1XBBA 3HA6A 4H1JA 3FLQA 4KIKA 3D5UA 3QTWA 4IX6A 5D11A 3MJ2A 3PVBA 4AZWA 5HX6A 2YIRA 5JFXA 3C4EA 3RPVA 1IAHA 3Q5IA 2W9FB 2PZRA 2C68A 3P7AA 4AGDA 4NJ3A 5IZFA 4EKKA 3W2SA 3TUCA 2CKOA 3LQ8A 2Z7QA 2Q0BA 3TIZA 4TN6A 2VTPA 5DI1A 3ZZWA 3UNKA 3DNEA 1IG1A 3DPKA 3DY7A 5CTPA 5HICA 4TNBA 1R39A 2WQOA 4JDJA 3GGFA 4LRMA 1PKGA 2F7EE 1A06A 1LEZA 3D7TA 4AWIA 1OI9A 2PMLX 4FV4A 5HE2A 5FEEA 4D2VA 3D2KA 4II5A 3GUBA 4M0YA 3UIXA 4CYJA 3VS3A 4YZBA 5KZIA 2W1DA 3M1SA 4G3CA 4QTDA 1WBVA 2DQ7X 2BRMA 5C27A 4F1MA 4PDYA 5GIPE 3SXRA 3C50A 3BQCA 4BCIA 3VHKA 5JMSA 3C7QA 3O50A 4AZVA 1ZOGA 3EOCA 4CZTA 4D4YA 2QU5A 4UZHA 2CNUA 2CCHA 4C59A 2BZKB 3KN6A 3FY2A 3R1NA 3UIBA 1JPAA 4ZLZA 3BRBA 3KULB 2CNQA 4RIYB 1OL2A 1MRUA 4C4FA 1XR1A 5IF1A 1WBWA 3CTHA 4QMOA 5E8ZA 2R3IA 2CJMA 1SZMA 5D9HA 2X4ZA 5JN2A 5E8XA 4MHAA 4G34A 3E88A 4KIPA 2BUJA 3LFEA 1OMWA 3F6XA 4MXYA 4IWQA 4KIQA 4FSYA 4QP2A 4N0SA 3RVGA 1JAMA 4I5PA 4RJ5A 3EQGA 2UV2A 4YZCA 3DAKA 5LVOA 2YM5A 1MP8A 2OJGA 2AC5A 4IM0A 4BYIA 3I7CA 1Q8WA 3OZ6A 2BDFA 3OCTA 4XUFA 2HYYA 4QMNA 2I0VA 4PY1A 3IECA 4NTTA 2CKEA 4O1PA 4WKQA 3R0TA 4L9IA 3EN5A 2A1AB 2XCKA 4QYHA 3DXNA 3UC3A 2QKRA 4FTLA 4R3PA 3O23A 3QX4A 2YM3A 4UN0C 2VWVA 2FSTX 3DNDA 4FTOA 3V3VA 4C3FA 4CD0A 2C1BA 2W1GA 1Q8ZA 4DH8A 1PXMA 1YI4A 3EH9A 4JDKA 4LGDA 3ZOSA 4BZNA 4JX7A 1REKA 2Y0AA 4ZLYA 3AT4A 1FVTA 2GHLA 2HCKA 3EN6A 1ZZLA 5EYKA 3IDCA 1R3CA 2F4JA 3NUNA 5IMEA 2HOGA 3ID6C 3FXWA 4YZDA 4F09A 4PMPA 2F7ZE 4ACCA 3F9NA 4DA5A 1Y57A 2C69A 1YXXA 5CEOA 4FE2A 3CS9A 3UOLA 4FKUA 3HYHA 4G3EA 3R7OA 2ZM4A 2V7AA 5CEMA 3MPMA 3FLWA 3P1AA 3OC1A 5AV1A 3KRJA 3N4UA 4D0WA 5HNIX 4TYJA 4D4SA 5IQHA 1H4LA 1KE6A 4YZNA 5CXZA 1UNLA 4OTDA 2W99B 5HE0A 1OZ1A 2B7AA 2F57A 4MF0A 3S95A 4IAIA 4C4IA 5A6OA 2C3IB 2OXXA 3FZ1A 3UGCA 1GAGA 4CZUA 2OLCA 3VNTA 3R9NA 4BDEA 3HAVA 4CNHA 2C6IA 2WQBA 3JXWA 3SAYA 4DFNA 1CTPE 2ACXA 2OIQA 3F7ZA 1E1VA 5C8KA 4FBXA 3GQIA 3QKMA 3JVRA 4V01A 4F63A 2XRUA 3DLSA 3UYSA 3F2NA 3DDQA 4FTAA 5AP7A 2HZNA 2UVYA 5EG3A 2W5AA 2W1HA 2BROA 2WXVA 1H24A 4YZMA 5CY3A 3QXOA 2W4JA 1OUKA 3HA8A 1YI3A 2HY0A 3ATSA 4AU8A 3NIZA 5AV4A 5KMOA 3RMFA 2JBOA 3CE3A 3A7JA 3ZUVA 1SVHA 2BR1A 4ENYA 3AXWA 3KRWA 4NTSA 4TYGA 3CEKA 3TZ7A 2JIIA 1M7NA 4NEUA 3ORXA 1KE9A 5A46A 2WOUA 4EHZA 3ITZA 2E2BA 4FSZA 3SRVB 3ALNA 1R78A 5IQFA 2J0KA 4WG3A 3QQUA 4FV3A 3NVMB 4RT7A 4XJ0A 1B39A 5D41A 4MF1A 3V5PA 3QQKA 5GIOE 3JR1A 1WBTA 4LMNA 5GZ8A 4DLIA 4BCQA 2VZ6A 2XS0A 3Q9YA 1XH6A 4U3YA 3OXIA 2O3PA 3Q52A 4P5QA 4FV7A 3E3BX 4GVAA 1PXKA 2J6MA 2ERKA 4FSTA 4HGTA 3DQWA 4E8AA 5TE0A 3OWKA 3RAWA 5IA3A 2R3OA 4YLJA 3QUPA 3LOKA 2BHHA 3ERKA 4C7TA 1WVYA 4ZP5A 2X1NA 2WQNA 5H3QA 4C4HA 3HMPA 3P79A 4BDHA 4UZDA 5BVOA 3R7GA 1H0VA 1ZY4A 3KC3A 3W8QA 3ETAA 5HBEA 4FSRA 3U6HA 3RGFA 2HK5A 4ZZOA 3OHTA 3QRIA 1ZRZA 3W2RA 3DJ7A 2A4LA 4MXCA 3ZMMA 1ZZ2A 2NP8A 4I4FA 5HQ0A 3FQHA 2VO6A 4PPBA 1DAWA 2HIWA 3FHIA 3VAPA 1F3MC 5AA8A 2IZSA 5CAVA 2XJ2A 4XV9A 5M4IA 4EWQA 5CAUA 1H1RA 4LL0A 1NA7A 1OPLA 5GZ9A 3K54A 4ALUA 2W1ZA 4R1VA 3RK5A 1FBNA 2GNGA 1RE8A 2JC6A 1G5SA 5HTIA 2C5OA 4BI1A 1JKKA 4AUAA 2BZJA 4AN3A 5BYYA 1LPUA 1YQJA 3CBLA 4PMTA 4BDDA 5IQCA 4PX6A 4E6CA 4D2WA 1P2AA 4DFBA 1Q8YA 5HG7A 1ZOEA 2YITA 3ELJA 1H01A 3ZCLA 3MPTA 1UKIA 3VRYA 4FICA 1URWA 5JGBA 3B2WA 3LMGA 3OCBA 2ETRA 5BUJA 5IA2A 3SDJA 4X3FA 5LVMA 4UEUA 5CT7A 4FV1A 3UMWA 1I44A 4D28A 5IPJA 4QP9A 3UZPA 4C4EA 1IAJA 4YPSA 4F70A 2ZOQA 3L9PA 2JAVA 1BUHA 4ASEA 4FEWA 2VWBA 5LMKA 5AP4A 3RALA 1ZAOA 1CSNA 3DKFA 3QQJA 3LCSA 3VVHA 5CSPA 3OCGA 4L3LA 2YDIA 4QMQA 4ITJA 3LCKA 1OBDA 5HGIA 2GU8A 2PVHA 4OTGA 4D2RA 4TL0A 4L7SA 2E9UA 4DGMA 5JH6A 4AZFA 2VO7A 2LAVA 5K9IA 1WFCA 2QNJA 3QQGA 2KULA 2WB8A 5J1VA 4WHZA 4J1RA 3ZRKA 4IE9A 5IA1A 4FZDB 4JBQA 4OTIA 3R00A 3EQPA 4TWCA 5AR3A 2Y7JA 4ACHA 3RKBA 3GC7A 3NCZA 4WD5A 3SQQA 2YEXA 4U80A 4ANOA 4FTJA 2WEIA 5HU9A 3P4KA 4YNEA 4WRSA 4YO4A 1AD5A 3WOWA 4I6HA 4JAIA 4FV5A 4L00A 4EEVA
chains in the Genus database with same CATH superfamily
3MI9A 3BWFA 5HOAA 3LXKA 5DPVA 2B1PA 4Y8DA 3C1XA 4UMQA 2R3FA 4FKIA 3DFCB 3II5A 4H3QA 5DT3A 3U9CA 2XMYA 4MYGA 3FXZA 3P0MA 4CKIA 2HELA 2ITOA 4B4LA 4Z7HA 1QCFA 2HXQA 2UZWE 5AAFA 3HMOA 4BCPA 5LCKA 5LXMA 1L8TA 2FO0A 1GIIA 3P23A 4X2GA 4HVHA 2QLUA 4EH5A 4E73A 5E8WA 2UZNA 3F82A 4KIKB 1UNGA 1YXSA 4I20A 4QMSA 2WAJA 3G6GA 3KMMA 5H8BA 4G6OA 4OTQA 4FKOA 4EQUA 3GU6A 1OITA 2XJ0A 2VWXA 4I0TA 4NJDA 1M7QA 4WRGA 1O6LA 1RJBA 4FIHA 2EB2A 4FTRA 3FE3A 4DEAA 1K2PA 4O0UA 5HVJA 5B2LA 1W8CA 2R4BA 3IG7A 3KXZA 1LUFA 5I9UA 2QG5A 3WIGA 5AM6A 3D7TB 4U42A 3BYMA 3SC1A 5EYDA 5J5TA 2JEDA 4O4CA 5HLWA 1ZYLA 4W9WA 5FP5A 4C34A 4IX4A 3VF9A 3QA8A 4IDTA 3RHKA 4TWPA 3IW8A 3ZYAA 3UO5A 4FEQA 2OZAB 4FV2A 1WVXA 1OKZA 3GVUA 5HG5A 1OBGA 3COIA 4J71A 3IGGA 1H26A 4TKSA 5HIDA 3VS2A 4ZIMA 2W1CA 3OT3A 3VUKA 3FL4A 4FZFB 4QQTA 5HESA 4Z3VA 4R7BA 2Y4IB 3F7WA 1YVJA 4L68A 4Z9LA 3FQSA 4C0TA 3R8ZA 5J7BA 3A7HA 5AR8A 1QL6A 4W4XA 4S2ZA 2JLDA 4J52A 4NM5A 3U6IA 2C5YA 3H4JA 1O6KA 2C6KA 2IW6A 4BDBA 4YSMA 2O0UA 3TKUA 3OS3A 1XHAA 2IW8A 2OZOA 3RINA 5DT0A 4ZAUA 2CKQA 4OW8A 2ZB1A 4F7SA 3ZO1A 4RVLA 5CZHA 5KCVA 2PVYA 3ZRLA 4M8TA 4RJ8A 3OY1A 4Q2AA 4BVUA 3R30A 4AN2A 4HW7A 5HTCA 3FHRA 2CPKE 2XNOA 4PTEA 5CXHA 4NW6A 4PQNA 3D5XA 3BI6A 5EQEA 4MK0A 2B52A 3ZLYA 4HGSA 2ZAZA 3PXZA 4N70A 5AV2A 3SLSA 4QMLA 2B53A 3HNGA 5CSHA 5BQ0A 1OVEA 1PXOA 2FGIA 4FKJA 3F69A 4FVRA 3UVQA 4C3RA 3I81A 4K33A 4BCOA 2G2IA 3RTPA 3AD5A 4ANBA 4AZSA 5ICPA 2OXDA 5HEZA 3REPA 2NRUA 3ZC6A 4J8NA 3NZ0A 3WZJA 5IDNA 3SX9A 3E64A 3FMLA 1SNUA 3CIKA 4BZOA 4K18A 2QHMA 3FDNA 4I23A 4CKRA 1V0BA 3DBEA 5EDQA 2IW9A 1JSTA 2JIUA 3ORTA 4F9YA 2RFSA 4ZY6A 3UQGA 3A2CA 4S30A 3QBNA 2P2IA 3VW8A 5E1EA 3GU5A 3IK3A 5IQEA 3BE9A 4NCTC 4FVQA 4YSJA 2CGWA 1STCE 4DF3A 3LFBA 1YI6A 4ITIA 4PRJA 2WFYA 5DWRA 4MQ1A 5AFVA 5IKWA 5A4TA 1WBNA 3LHJA 3OEFX 2XIZA 3MH2A 4EHEA 2OFUA 3QD0A 4I22A 2WZJA 4MKCA 3ZU7A 1DI8A 5IEXA 2JGZA 2E9OA 5CU3A 5LCJA 4WA9A 5M09A 4FMQA 3ZDIA 3E3PA 1OPKA 4DYMA 3LJ0A 2UW6A 1WBSA 4R5YA 5HNGA 4F9CA 2XVDA 1M2PA 3TNIA 1J91A 3KVWA 3MBLA 2WU7A 4L44A 4QTBA 5FTQA 3SW7A 1V0OA 3KL8A 3JUHA 4J53A 5AJQA 2QO9A 3RAKA 3MY0A 4AGWA 4AZEA 2PMOX 4GFOA 3I0QA 2AYPA 1CDKA 4JXFA 1T46A 5GZAA 2WPAA 2GFCA 4S32A 5BVNA 2OJJA 4MUQA 4XP0A 4PL4A 1K9AA 3SKCA 4ZLOA 2OU7A 1ATPE 2WTDA 3R01A 4J98A 3UBDA 4JDHA 5A54A 3UOJA 1BMKA 1DAYA 2XNGA 4ZTLA 4YTCA 2RKUA 4USDA 3Q04A 4JG6A 3PXKA 4LGGA 5AUWA 4O7LA 3MS9A 2HXLA 3SD0A 4UMPA 5DYJA 4XP3A 4LV8A 3FXXA 4XH6A 3FMEA 4AT5A 3H9OA 4GK4A 4O81A 2R3PA 5A4QA 2DUVA 3C9WA 1XQZA 1GZ8A 1F0QA 2XK3A 4HGEA 3FKNA 4WG5A 4YJSA 2R9SA 5M4CA 3KK8A 5M4FA 2YZLA 1QPJA 2VN9A 4QMPA 4ZTSA 4UV0A 3C0HA 3HMMA 2C30A 2CCIA 1FGIA 5CNOA 4GK3A 3EWHA 5DT4A 4L01A 5KMIA 5FXRA 2CDZA 2W96B 4X7QA 5GJGA 3TUDA 2BRHA 4BIBA 5HE3A 3KA0A 4JNWA 4M15A 4OBOA 2W0JA 2R64A 3PA5A 4FTQA 4BYJA 4RG0A 2R3GA 3N4VA 4JJRA 4DEIA 1SVEA 5H8GA 3S1HA 4B99A 3PG3A 3R1YA 3M42A 2F49A 3AMAA 5AIKA 2PVMA 3IW7A 3D4QA 3UNZA 5HCZA 5I0BA 5C9CA 3ATTA 3PJCA 5FEQA 4EKLA 3NWWA 4G3FA 5CU4A 3VBTA 3G51A 3THBA 3EFJA 5CF8A 4AG8A 3RBWA 3UPXA 3WE8A 3NAXA 4C61A 2C6MA 3HRCA 3WZDA 2W05A 2H8HA 3DXQA 5DVRA 3AT2A 3FPQA 3R9DA 2X6DA 4R3RA 2QQ7A 1UU8A 4RJ7A 1K3AA 5DGZA 1Z57A 4A06A 1JVPP 4DG0E 1YXVA 3LXNA 4ZTQA 4V0GA 3FLSA 4ZSGA 4Z55A 5L2QA 3CTQA 2WGJA 3PA3A 4AA0A 4DEHA 3FQEA 2WMAA 4M7IA 4GVJA 2WNTA 3EN9A 2BRGA 3KRLA 3Q5ZA 2B9FA 4TXCA 5CWZA 3TEIA 3UVPA 4EH3A 4O7SA 3IPHA 1PJKA 2VTIA 3PPJA 2XJ1A 4AXCA 5DG5A 4FYNA 4B8MA 4DTAA 2YWVA 4CFWA 3TG1A 2IWIA 3T3VA 3O7LB 3F66A 4HZRA 3KXMA 2JFMA 4HNIA 4I6QA 2YAKA 4BTFA 1W83A 5HO6A 3TZ9A 3NYXA 2BRBA 1GZNA 2VUWA 4IWDA 4OAUC 2JDVA 3BYSA 5C26A 1Z9XA 2EXMA 2VRXA 3ZRMA 4X3FB 3VBYA 3W0OA 4JRNA 5I4NA 2UW3A 3GCUA 4BCKA 3QLFA 4QMZA 3TN8A 4OTHA 2ITZA 3I4BA 4ZS4A 2YAAA 3C51A 4C4GA 2VWZA 2FSOX 5EHYA 3PVUA 2F2CB 4WUAA 1ZMUA 2QG7A 4TZRA 3PFYA 1O9UA 2LGCA 3NUSA 4J7BA 1OB3A 4CG9A 3UQFA 4CRSA 3ZXZA 5E92A 3CSVA 4YJRA 5D1JA 4BRXA 4RX5A 2W5HA 4O2ZA 4I4EA 3WF6A 4IC8A 2XA4A 3A62A 4KWPA 1QMZA 4FTCA 4HNFA 2UW7A 5D12A 1NY3A 2PUNA 5E4HA 4DDGA 3EL7A 3KN5A 3HV6A 5GNKA 3VS1A 4QDEA 4R78A 4K1BA 5KMKA 3SA0A 3EYGA 4DCEA 3OTUA 2XH5A 5HU3A 3NUUA 3AGMA 5JZNA 5C1QB 2G15A 5L6WL 4EONA 1OIYA 5FRIA 3L9LA 2R3LA 1FVRA 4OBPA 5IH5A 3FWQA 2UW8A 4GIHA 1VYWA 3AKLA 4BICA 3P5JC 2WIHA 2QLQA 3ZM9A 4JL9A 4FR4A 4B9DA 3QZGA 1VR2A 3MW1A 2ZVAA 5FM2A 2YA9A 5DR9A 5LARA 4ZSAA 2BIYA 2XCHA 4Y95A 5DR6A 5K0XA 1JKLA 1OIQA 2XK7A 4RBLA 1ZLTA 4TWNA 4B8LA 3C4XA 4MD9E 5FP6A 4C3PA 5FBOA 3RWQA 3A7GA 5CAQA 4EORA 1L3RE 2G2HA 3AC3A 2C5NA 4K8AA 3HMNA 3BLAA 4DFLA 2XF0A 4XBRA 4OTWA 3POOA 3QTZA 3GU8A 2XNNA 1BKXA 1YDSE 3CQWA 3S4QA 5KMMA 1E1XA 3NS9A 5CANA 4CMUA 3O8TA 3VC4A 3TUBA 1KE8A 2JKKA 4IHPA 5AR7A 2OO8X 2V5QA 4WG4A 4DC2A 5HO8A 4WNPA 3U4UA 2EUFB 4M0ZA 4JMQA 3KRXA 4YHJA 4ANLA 4IADA 4IM3A 4H3PA 2JDSA 4YR8A 3DT1A 3CY3A 4L3JA 4E20A 3KXGA 4P2KA 3L8VA 3PUPA 5G6VA 2G9XA 2JDTA 5M08A 5HBHA 4BGQA 2UVZA 4E93A 2QODA 4TT7A 2R7BA 3Q4CA 3UG1A 4BDCA 3QCXA 1R0EA 2I6LA 4KKEA 4XOYA 2ZV7A 4BZDA 4W4VA 3NCGA 2YCRA 5LWMA 4EOQA 4DT9A 2WMRA 2J0MB 3QKKA 4L42A 3RAIA 4IW0A 3MVJA 3FMJA 4CG8A 5BUIA 4E3CA 4KKHA 2XIRA 3NUPA 4IAFA 4MWIA 2P0CA 4TYEA 3TMOA 2VNWA 4J95A 3MH1A 5HNBA 3RAHA 2JIVA 3FSFA 4AP7A 2PYWA 4U44A 4KINA 2OZAA 2BAQA 3GFEA 5A3XA 4QQCA 4O4FA 2QVSE 4BFMA 3S0OA 3NUAA 3RI1A 4D2SA 3F3ZA 2XNBA 5T68A 3QCSA 1GOLA 4IWOA 3UDZA 1LEWA 3DV3A 3FZOA 5BVEA 5BV3A 3ORLA 4JIAA 2WTIA 3GXLA 2BFYA 3NW6A 3ACJA 1CKIA 2VU3A 3F5UA 1YDTE 2CN8A 2QD9A 3FPMA 3NEWA 4IBMA 4KBCA 2PY3A 5HD7A 1KUTA 1H1QA 2VWIA 4U6RA 4Z16A 4ANMA 2E9VA 1P4FA 2C0OA 3G6HA 4FSNA 2C3KA 2GS2A 4JBVA 5EM8A 3FMHA 4OLIA 4P4CA 4K9YA 4CFXA 1U5QA 3QTUA 4G5JA 2V62A 2R5TA 3QTIA 2HW6A 4QP8A 4L67A 4XG2A 4FTTA 4DGLC 3VW6A 1BI7A 5CF4A 5GJFA 3VRZA 2Q0NA 2UVXA 3CTJA 3JS2A 4D2PA 4NL0A 5EW9A 2ITPA 3MDYA 1WBPA 2XNPA 4APPA 5IA4A 5ANEA 4EC9A 2WMVA 4AZTA 3OWPA 4CTCA 2YCQA 3HMIA 3FMKA 5HLPA 4MBJA 5M55A 3TZMA 1XJDA 1JOWB 4O0VA 4USFA 3NNUA 1H1PA 3Q2MA 1Q8UA 4I21A 4UMUA 3MIYA 2A27A 3D5VA 2C6EA 1OIRA 4IX3A 3BHVA 3BPRA 3VBQA 4DBXA 2YWPA 1G8AA 1WAKA 4BKYA 4D1SA 4GU9A 3QCYA 3CGOA 4FV8A 3ZEPA 5B2MA 3HDNA 3E7OA 3U6JA 4F4PA 4J97A 2X8DA 5EHLA 3ALOA 2PUPA 4O96A 3CD3A 4PP7A 5ANJA 3IDPA 3QLGA 3DJ6A 3R6XA 4O83A 4IAYA 5BVDA 4AOIA 3HGKA 3HDMA 2QOHA 1PXLA 4CV8A 1TQMA 1P5EA 3PWDA 4I1ZA 4YPDA 4IVBA 3T9IA 5JT2A 1Z5MA 4MH7A 2W1FA 4FKVA 3ORMA 3QYWA 4IAKA 3UG2A 3BGZA 3PPKA 1XKKA 4QP4A 2ONLC 3DQXA 1VEBA 3WILA 3P08A 5HORA 1JQHA 3A4PA 1YKRA 2V22A 4H36A 3M2WA 4H1MA 1JWHA 3W8LA 4IZAA 2GQRA 1TQIA 2OFVA 5IDPA 4LG4A 4D9UA 3GP0A 2BTRA 4O6EA 4QPMA 2IPXA 4XG3A 3CCNA 4O7VA 4MQ2A 3KFAA 5DMZA 5DH3A 4GG5A 4ZTMA 2ESMA 3QD3A 2YFXA 3MTLA 2IG7A 5CU0A 5FQDC 4YLKA 5CVFA 2VV9A 3QFVA 4FA2A 3ORNA 2XKDA 3PXFA 4OT5A 1YW2A 3LM5A 3NYVA 4FL2A 4DHIB 3ENHA 5CQWA 4AW5A 4KBKA 3D5WA 1MUOA 5E8YA 4BDKA 4D58A 3AMYA 4D5HA 4BJJA 4X6RA 2OF2A 3V04A 3ZSGA 1GY3A 3QTRA 4AX8A 3PDTA 3SOCA 4BKZA 3ODYX 3VJOA 4LUEA 2DYLA 5KO1A 2GHGA 4RFZA 3QWKA 4ANSA 3BHUA 3DKCA 2IO6A 4NM0A 1Q4LA 2CN5A 3HKOA 5EKOA 5AUXA 3LLTA 4Q9ZA 5CEPA 1OL7A 1JKSA 5C03A 3PTGA 4EH6A 2AEGA 3A4OX 4KS7A 1UU9A 5KMNA 4ZSLA 1OPJA 4XHKB 2OWBA 2UZVA 2C3JA 2XIYA 3ML1A 3IDBA 5M07A 4I94A 4AE6A 1XO2B 1TFFA 2OKRA 4EH2A 2R0UA 4AW2A 5ANIA 5FD2A 4IWPA 1KWPA 3AC1A 3F2AA 4NCTA 4AW0A 1KV1A 4F6SA 5EOBA 4YHFA 1OKYA 3E63A 4BCNA 2F7XE 4FZ7A 5M56A 5L8JA 5C4LA 4GMYA 3RPYA 4BDIA 4G6NA 2UZUE 4EOSA 5L8KA 3HV7A 4E6QA 5ITAA 4DGNA 1HCLA 3MGYA 2PUUA 4F9BA 2RIOA 1OL5A 2WELA 4O91A 5K0KA 3W0QA 4WNMA 4HPTE 3LM0A 3PVWA 4TNDA 2J5EA 4U81A 4KSPA 4O4DA 2XK8A 4G16A 3G15A 4V0GB 2VO3A 5CVGA 4FT7A 2WTKB 2RL5A 5E8VA 4UBAA 5FM3A 1OL6A 4FT3A 4C33A 2XNEA 3R8MA 5JQ5A 4Q5HA 3LCOA 3CKWA 2GSFA 4M67A 1SYKA 4U43A 4Y73A 4PWNA 2IVVA 4CCBA 4MD7E 3G90X 2PMIA 3AOXA 5HTBA 4KNBA 3OY3A 3PRIA 4IJPA 2XKFA 4XRJA 4YJQA 3FMDA 5GHVA 3MFUA 4F65A 3KCKA 2XEYA 3WZUA 3E8NA 2FH9A 5M4UA 3H9FA 3W55A 4EC8A 2ZMCA 4PL5A 2VTSA 3R2BA 1PXNA 4G17A 2XK9A 2XIKA 5JGAA 5FXSA 2P2HA 4FZAB 4BTMA 2X7GA 3ZO4A 1CM8A 3IQ7A 3K5VA 3UOKA 3HLLA 2QR8A 4IC7A 4XG8A 3NYOA 1VZOA 4FT0A 3O7LD 4QP6A 3W2PA 4Z7GA 1ZY5A 2RFEA 5ACKA 3TJCA 3VS6A 5I3RA 2AUHA 2X2MA 3IO7A 1ND4A 3GCSA 2OSCA 5C8MA 5IMXA 1RQQA 2BVAA 3LW0A 5A4EA 2CSNA 2EWAA 4CRLA 2WOTA 3OUKA 4HOKA 4UY9A 5BX0A 4OGRA 2Z8CA 3BYVA 4IB0A 3Q96A 3ZTXA 4E6DA 5LMBA 5E1SA 4NFMA 3MA3A 1CMKE 3O71A 4PMMA 4KS8A 2OIBA 2H96A 3HX4A 3QGYA 3L8SA 3WYYA 1VLRA 3ORKA 3G5DA 4UB7A 5JRQA 4P90A 2CGUA 1M2QA 3KXHA 3TZ8A 2IEWA 4O86A 2YDJA 3WZEA 3Q4TA 1U54A 1NT2A 3NLBA 2YIXA 2B9JA 3NR9A 4IB5A 2VTHA 2X0QA 3U55A 3HV5A 1UWHA 2QOQA 4FG7A 3LMIA 2W5BA 4KIOA 2PVRA 4XV3A 3IGOA 4Q9SA 4CFNA 1CKJA 4GCJA 4AGUA 3WI6A 3ACKA 3EQFA 3RNYA 3QRUA 2PTKA 4FRFA 4FSUA 2FYSA 2XBAA 2XZSA 4AW1A 2A2AA 4O82A 2Y4PA 1YHSA 3LFQA 2VWUA 5AR5A 3EHAA 4GFGA 4JR3A 2Q83A 3TT0A 2QKWB 1LP4A 4LUDA 4YJOA 3E7VA 1M14A 5I9VA 4I3ZA 4O0TA 4BTKA 2XALA 2P3GX 4MXAA 5M44A 4BCFA 1UWJA 3DB6A 4PPCA 3DA6A 4FNXA 4LV5A 4N6ZA 3BEGA 4QT1A 4RIXB 4X21A 4ACGA 3SGCA 3W18A 2R3JA 3DKOA 1RW8A 3LXPA 3OWLA 3E92A 3AKKA 5HHWA 1B6CB 5DBXA 3TCPA 1YRPA 2Y4IC 4U8ZA 4ASZA 1YHWA 5BYLA 2XYUA 3JYAA 1P14A 2WQEA 2XP2A 2HWPA 1J7IA 3KKVA 2DWBA 2JDOA 2BILB 4M84A 4CLJA 3LQ5A 4ZOGA 4CSVA 2G2FA 2RGPA 3ZXTA 4EK6A 4DLJA 4BN1A 1WZYA 3I60A 1KOAA 5KBQA 2QC6A 3F5PA 4HVIA 3TDWA 4BCJA 1XWSA 3EKKA 3R73A 4HCVA 4OR5A 4IQ6A 4R1YA 5BVWA 1FVVA 3MFTA 3HUCA 3TTIA 3UYTA 5KE0A 4B0GA 4FOBA 5DIAA 2DS1A 4FIFA 1H1SA 3L9MA 3QTXA 3Q9ZA 4M68A 3GQLA 3FJQE 4YZ9A 1FINA 3AMBA 3BBTB 1U59A 1I09A 3VS0A 3PYYA 3P5KA 4YUQA 2PHKA 5JSMA 4DEEA 3DLZA 5J1WA 3PRFA 2EXEA 1OUYA 1PXIA 3O2MA 4WOVA 2J7TA 3ZSIA 5CF5A 4I92A 5HI2A 1U46A 2W4KA 5J9LA 2X7FA 3EQBA 5CEQA 4F99A 4EWHA 3OW4A 4EL9A 2YLEA 3HP2A 4XOZA 4DBNA 2GNJA 3W16A 4QDVA 3KY2A 3PUFC 3VF8A 4ERWA 4LV7A 3ZFXA 1JSUA 4RA4A 5FBNC 5DLSA 3UPZA 1TVOA 4RFMA 1ZARA 3UP2A 2VTAA 3CQEA 2WIPA 4I6BA 3V5JA 3FYJX 3COKA 1UU7A 3CJGA 1JKTA 3UDSA 4DFUA 3IOPA 3BLHA 1PMUA 3QZIA 3LQ3A 2E9NA 3UC4A 3VONA 2YERA 4DFYA 5HVYA 2Y8OA 1XH8A 2NO3A 5CSWA 3OTVA 2VGPA 4QOXA 5EYMA 4BKJA 4DN5A 4QTEA 4UMRA 4P5ZA 1S9IA 3OG7A 2BTSA 4EH4A 5KKRB 4CTBA 4AQCA 3AT3A 4L7FA 3IW5A 4FIIA 3FKOA 4FKPA 3VS7A 1MQ4A 3IKAA 3LFAA 3MH3A 5ETCA 3UQCA 3W0NA 3F5XA 4HVGA 4ARKA 2NPQA 4NZWB 4HVSA 2V55A 4K77A 5BVKA 3BKBA 1OGYA 2YACA 3MVHA 2WU6A 3Q9XA 5L6OA 4IJ9A 4RQKA 3EJ1A 3E93A 3ZLSA 3LZBA 3BCEA 4RZVA 4A4XA 2QOLA 3GCVA 5BVFA 4E4LA 4RZWA 4FEUA 4XMOA 4IXPA 3DBDA 2OG8A 4XP2A 2A98A 4IZ5A 4U5JA 4NIFA 4XNEA 3DK3A 4O0YA 3W1FA 5DRDA 4G9CA 3MVMA 5M57A 3GB2A 5CU6A 4GKHA 1Y8YA 3A99A 3SXFA 2VTOA 3PVGA 1YXUA 5CEKA 2SRCA 3ANRA 2X0GA 3NPCA 5FTOA 5JQ8A 4WO5A 2PUIA 3E62A 2GQGA 3LMHA 4EOOA 4CFMA 4BTJA 2ZB0A 4Y46A 4LOOA 3QZFA 2PZYA 3CJFA 3QQFA 3VQHA 3W0PA 4PPAA 3S3IA 2QOCA 3R83A 3JVSA 4IFGA 4ERKA 5KUPA 2BPMA 3R8LA 3L8XA 3NNXA 3VO3A 3VUTA 4XRLA 2WTCA 3PSCA 2OICA 2PZIA 4M14A 2W06A 4EZ3A 4GT3A 5EQPA 4YTHA 2KTYA 4JOAA 2R2PA 2VTTA 5L2IA 2Z7SA 3ORZA 4AXDA 4S31A 4IVDA 3QHWA 4BJJB 3VIDA 2C6OA 4UWBA 3D83A 4X2JA 3QALE 2C0TA 1H00A 5BYZA 4EQMA 3CLYA 3NGAA 2X2LA 5IG1A 3MJ1A 3NW7A 3SW4A 4F1TA 2UW5A 3R7VA 4BY9E 4RSSA 4O21A 4O1OA 4TYHB 1W2DA 2OGVA 1R1WA 3JPVA 5E91A 3RZFA 4RVMA 3TL8A 1KSWA 3VBXA 4FTUA 1SM2A 4UXQA 1YDRE 3ZO2A 4MBIA 3EFLA 3MY5A 4BL1A 5J7HA 4GL9A 3R8VA 3PJ1A 3POZA 4QO9A 3TIYA 2ITXA 1AGWA 4F9WA 3WF9A 3O51A 2VGOA 4GJ2A 5I9YA 1REJA 2BZIB 3P9JA 4R7IA 3Q4UA 3W2QA 4F7NA 4QQJA 4U45A 4FJVA 4A9TA 1ZWSA 2WKMA 4FV0A 4MCVA 3QD2B 2OI4X 2X9FA 1F5QA 2J0JA 4O22A 3U9NA 4D55A 4UX9A 1Y6BA 2R7IA 5EM7A 2FB8A 3D15A 4PNIA 3M11A 5IA5A 2PPQA 2JKOA 4FTIA 2I0HA 3EMGA 1J1BA 5IUGA 3HAMA 2HENA 2W9ZB 3H0YA 3OOMA 4H39A 4DINA 4DH5A 3B8QA 5CAPA 5EYCA 3TKHA 4QYEA 2O5KA 3GT8A 2G1TA 4TRLA 3BV3A 1H08A 5G1XA 3R04A 3A8WA 3ZFYA 4A9UA 2F9GA 5ETIA 4LQMA 2ONLA 4AACA 2R0IA 3CPBA 3CD8A 3PZHA 3QRTA 1JNKA 5LMAA 5IA0A 3R7IA 2E9PA 4MXOA 2J90A 2WMBA 3FZTA 3LFSA 4JBOA 5JK3A 1XMMA 4FKGA 2I1MA 5JRSA 3R7UA 4N57A 4ZS0A 3DCVA 3NAYA 3ORPA 4WNKA 4J8MA 3KCFA 3QKLA 3SG9A 4O4EA 5AUVA 5JFVA 3G0FA 5BUEA 4Y5QA 5EW3A 2PE1A 4EH9A 4O0RA 4OTRA 4FVPA 3ROCA 3VS5A 3SG8A 2W1EA 3TTJA 4EUUA 3E8DA 3SV0A 1GNGA 2QOOA 3TDVA 3UZRA 4W4WA 4AA4A 3R2YA 3LVPA 5ACBC 1Q97A 2XBJA 1IRKA 4Y5HA 4WSQA 1ZXEA 1YXTA 2FSMX 3R1QA 3FBVA 4UYAA 4E5BA 3I5NA 5CF6A 1YWVA 4XG9A 4JQ7A 5AWMA 4FGRA 2OJFE 3UDTA 3PP0A 4APCA 3G9NA 2QI8A 2YABA 4FODA 4RIWA 4CT1A 1IA8A 2BKZA 4FTMA 4I0RA 4LI5A 4KBAA 4MXXA 3ET7A 4I93A 4PTCA 4A9RA 4RX9A 3MFRA 4H3BA 3H30A 3OMVA 4ITHA 4NKAA 2UZTA 4AOTA 5B7VA 3QX2A 3LJ2A 4GEOA 4ZJJA 4F08A 5IU2A 4CFVA 5IQGA 3DK6A 5J95A 1W98A 2PVJA 2CKPA 3BL7A 3R63A 2GNIA 3MB6A 4ACDA 1U54B 4G5PA 5HE1A 3D0EA 3V5LA 2H9VA 3C0IA 4EUTA 2JBPA 2JKQA 3KB7A 4IMYA 4ZMFA 3U4WA 4NKSA 4O0WA 4KA3A 3R02A 3BHHA 3F3TA 4W9XA 3Q3BA 4IIRA 4FKSA 4XLVA 3Q6UA 4IACA 3ZM4A 3F2RA 4O7TA 4ASDA 4BIEA 2QR7A 2XIXA 3GNIB 1H27A 5A6NA 4FT9A 1PY5A 4B7TA 1NVRA 3AC8A 3PY3A 4JDIA 1ZMWA 1Y6AA 4KRDA 4USEA 3FMMA 3OUNB 3PLSA 3DJ5A 4EK3A 2XNMA 4O0XA 4MWHA 4N4SA 4CCUA 4QNYA 4E26A 2CNVA 4E4MA 4C37A 3VJNA 3UOHA 1PF8A 3ANQA 3DGKA 4FKRA 3GENA 2VAGA 4L46A 4WUNA 4PMSA 4ZK5A 5CYIA 3VULA 4QMWA 4FNYA 1NVSA 1YOMA 3UJGA 4AFEA 1XH5A 1PYXA 2RG6A 1XMLA 4U9AA 4XYFA 4YBJA 5CI7A 1PKDA 3C13A 5B2KA 1Q8TA 1APME 1MRYA 2EXCX 4X2KA 2VWYA 4RJ4A 4XG7A 4D2TA 3DU8A 1GJOA 1NVQA 5AP6A 5D7VA 4TTHB 4AE9A 3PIZA 4GS6A 4RQVA 5EDRA 5IEYA 5IH6A 3OD6X 2X2KA 5DHJA 1J7UA 4RIXA 3BHYA 2QOIA 1Q5KA 4WSYA 4ZXTA 4D9TA 5AAGA 3RK7A 5HVKA 5HZNA 4FEXA 1NXKA 3V5TA 4UMTA 3TNHA 2ZYBA 3PIYA 3Q6WA 4X0MA 5IUIA 4D5KA 5A4LA 1U5RA 2A0CX 3NDMA 2XKCA 5CEIA 4BBMA 4GSBA 4O6LA 2QCSA 4MTAA 3V6RA 2C47A 2GQSA 2PMNX 3TV6A 3BLQA 3LFNA 3T8OA 1FQ1B 5EM5A 4NFNA 3VBWA 4R77A 1PMNA 4DH7A 2YDKA 4QTAA 2HY81 2HZ0A 3ZHPC 4GG7A 4GJ3A 3W0RA 3G0EA 4LYNA 2ITVA 4FG9A 4CVAA 1PXJA 4BWXA 4PV0A 2I7QA 2BAKA 5TKDA 4JLCA 4ZTHA 3VUGA 3EFWA 1M2RA