5AWMA

The crystal structure of jnk from drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian jnk proteins.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
356
structure length
345
Chain Sequence
QHYTVEVGDTNFTIHSRYINLRPIGGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVREHTVEQWKELIYEEVMDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-activated protein kinase JNK
publication title The crystal structure of JNK from Drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian JNK proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 107
structure length 345
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5awmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5awmA01
2J7TA 5DR2A 5KNJA 4IB3A 3ZO4A 4BDEA 4JBOA 4JG7A 1L8TA 2CDZA 1OKYA 2VX0A 3EN4A 4AA4A 4FEUA 3NLBA 1WVYA 3UP2A 4TN6A 4C4HA 4FSZA 4DG0E 4TL0A 4TZRA 3UYTA 3Q04A 5EKNA 3GC9A 4QMYA 4CFXA 5D7VA 4NUSA 3OF0A 3PXQA 4NIFA 5D12A 4BDBA 3A4PA 3WF8A 4I3ZA 4DGMA 5H9BA 4QP4A 3LOKA 3KRLA 4FKSA 3QD4A 1JOWB 2C6TA 2VO7A 1TVOA 3QCQA 2VTAA 3ZU7A 5GIOE 2PVNA 2VTIA 4QMLA 5ANJA 2PMLX 5JGAA 4IIRA 4NEUA 2WOUA 5HG9A 2PE2A 4E6QA 3K2LA 4IC8A 4J95A 4CZUA 1YHSA 5CQUA 1Z9XA 4FKRA 1H4LA 1OGUA 4RFYA 3UODA 2XK9A 4BCGA 2VTRA 3HL7A 5BUIA 5M09A 4IDTA 3TIZA 3U6IA 5JFWA 2GDOA 3NYXA 4TT7A 4O7NA 5AA8A 3KF4A 3S0OA 1OIRA 3EZRA 3VAPA 2H6DA 3VBYA 4GK2A 4O81A 2WGJA 3U54A 2XB7A 3QUPA 4IFGA 4UZDA 4BFMA 4PP9A 5CF5A 4K2RA 5HCYA 4BDFA 1XH4A 4FEQA 4IB0A 3PRIA 4GT5A 3VN9A 3FV8A 3GT8A 1FVTA 3ANRA 4UMTA 4KB8A 2BIKB 2WMSA 2WNTA 4H05A 2B7AA 3D7TB 3BBTB 3PVUA 1PW2A 4YC3A 4PPCA 4N4SA 5TF9A 3NYOA 4FT5A 4GK3A 4IZYA 4G31A 4FTNA 4NW6A 3TTJA 3AD5A 4F7JA 4FR4A 4FKLA 4DEGA 3PIYA 4IAKA 4JVGA 3AT4A 4FSTA 3ZBFA 5DMZA 3TZ7A 5ICPA 4MF0A 2QU6A 2V7OA 3ZEPA 3DTWA 3DXPA 2R3RA 1H00A 3GB2A 1JSUA 1VYWA 3JYAA 1JLUE 3FPMA 2C1BA 3CJFA 3I7CA 4GKHA 2F57A 2IW6A 3ATSA 1YWNA 5JSMA 4AW5A 2G01A 3OTUA 3H9FA 3C0IA 3C5UA 4FT3A 4YTHA 3HAMA 4IQ6A 5E8VA 3NWWA 3LCSA 2W4OA 4H1JA 4H36A 5IKWA 2FSMX 1BLXA 4EH3A 3HDNA 4PX6A 4I0SA 1Q3DA 3U9CA 2YCQA 5EHLA 3ORTA 5IA4A 2FH9A 3PP0A 4DEBA 3PPZA 4TWCA 5CI7A 5GJGA 4M15A 5GZAA 2XIXA 4C4EA 5IZFA 2GTNA 3PSDA 2X9EA 2ITZA 3UVPA 3GU5A 1XBBA 4QMUA 3FMEA 3MESA 4X6RA 1UWJA 3ZBXA 3EYGA 5ETFA 3HRCA 5AUXA 3BHUA 4DC2A 3FMMA 4C4JA 4EHZA 5JFXA 5J9YA 4RX8A 4FKTA 3PXYA 2UZDA 4HVHA 1DI9A 5EFQA 3TNIA 4EK6A 3O96A 4BTFA 4QMOA 5H8GA 2J0IA 4UMQA 1SMHA 5E91A 5K0XA 2ACXA 3UOHA 2LAVA 1SZMA 4FSQA 4RIXA 5DT4A 3BV2A 3SRVB 4GKIA 4ZEGA 5B0XA 4PNKA 1H1RA 4L6QA 1M52A 1PXNA 2XUUA 4JRVA 2EB3A 3GCQA 3D2KA 3LE6A 4JBQA 4LUEA 2HW7A 3QGWA 4AFJA 4G17A 2WMQA 2GU8A 4I94A 5I9ZA 4LG4A 3ORPA 2JKQA 4JQEA 5LMBA 2O0UA 3C1XA 3KA0A 2ZM4A 4L9IA 4M69B 4D4VA 2JBPA 2C0OA 2OU7A 2EXEA 1PMEA 3DOGA 4QD6A 5CQWA 4ZTQA 5AR7A 4ZXTA 3LQ5A 3UZPA 3WF7A 2YA9A 4O22A 2GS6A 3VF9A 3LMGA 5CX9A 5IEYA 3FY0A 3CKXA 4JOAA 5DRDA 2ZJWA 5AR8A 3R9OA 4JNWA 5ETAA 2B52A 2JITA 2HZIA 2DWBA 2JDVA 2UZWE 3UOKA 4JRNA 4RLKA 5DEYA 3GXLA 1H07A 3R1SA 3R0TA 3JVRA 5L8JA 3NYNA 4YBJA 1R0EA 2BUJA 3FI4A 2R3GA 2DS1A 3PXKA 4HYHA 5CNOA 1YRPA 2OXDA 3OCTA 5AAGA 4B6LA 3KRRA 3VBVA 5BQ0A 1REJA 2YM7A 4I20A 1GIIA 3BE9A 4XV3A 2PVHA 5HE1A 3EWHA 1FGIA 4XP3A 2YWPA 2UW5A 3Q6UA 3WBLA 3HVCA 4RFZA 3BX5A 4IHPA 2JDRA 3II5A 3MJ1A 4QP2A 5FG8A 4E6CA 3QTIA 5HD4A 3FHIA 1A48A 4L43A 4NTTA 4QTEA 1HCLA 3OBJA 4KKGA 4UXQA 2ONLC 2QHMA 3A4OX 3ANQA 3QLGA 2X7GA 4XV2A 3MYGA 3EN9A 2WD1A 3OWJA 4WKQA 4RQVA 4IB5A 3ZZWA 3EQFA 4EQMA 4AZSA 4Z9LA 1PJKA 1T45A 2YJRA 3LXPA 4KIOA 1PXIA 2X4FA 3L9MA 3R7IA 5E8TA 2GHGA 3PWDA 2REIA 1QL6A 4D2WA 4CMTA 1PXOA 1Q3WA 2BFYA 2WB8A 2YDIA 1Q8TA 2VTSA 4BDCA 3TJDA 3ROYA 3A7HA 2R3OA 3ID6C 3CTHA 4ZTHA 2XYUA 4MQ1A 4ENYA 4EOOA 4WD5A 2O8YA 4ASZA 2O64A 3E8CA 4MH7A 2UZLA 3GI3A 2C30A 3F3TA 3CD3A 3E88A 3U51A 5ANOA 2FUMA 4AG8A 1Q4LA 3ZOSA 1FMKA 4BR3A 2ZM1A 4I5MA 2R4BA 4GFGA 4IVCA 4C36A 1UNGA 2BVAA 1OBGA 1V0OA 3WIKA 5IMEA 3NUYA 3EQRA 4IH8A 2DUVA 2XKFA 5DA3A 5F20A 5HBHA 1IAJA 5EYCA 1GZ8A 2W7XA 1P5EA 2LGCA 3BZ3A 4EK8A 3MFSA 4Z3VA 4DFUA 5EYDA 4FKQA 4A4LA 5AJQA 4KAOA 1JBPE 1M7QA 4WUAA 5M53A 4MXZA 5AR3A 1UU3A 4N6ZA 4D28A 4M0ZA 5J5SA 3C9WA 2YDKA 2O65A 1E9HA 2R3PA 3OWLA 3QLFA 4MYGA 5CY3A 2QURA 2YCSA 2HIWA 4F7NA 3TNQB 2Z7LA 3IW5A 3DA6A 1XBCA 5FWKK 5J1VA 1DI8A 3MVHA 5AV4A 4YLKA 4NW5A 2H96A 1WVWA 3LAUA 5EHYA 3ZONA 5K9IA 3HP2A 4FMQA 3O17A 2QQ7A 2B4SB 2WTJA 5BMSA 5DT3A 1JSVA 4XUFA 3RNYA 2F49A 2XIYA 5AP4A 3AD4A 4EC9A 5HNBA 3SX9A 4R6VA 2VO0A 5JRQA 4ZY6A 4M84A 4UY9A 4IVBA 2Z7SA 4KSPA 3Q4CA 1JNKA 5ACKA 4HVGA 4E5AX 2Z02A 4U3ZA 5T68A 4L01A 4NKAA 4YLJA 4O0YA 3PRFA 4ZTLA 2QCSA 5G6VA 4YLLA 4BCIA 2SRCA 4DEIA 3A99A 4EZ3A 2YN8A 4FA2A 5CENA 3L9PA 3QTRA 2NO3A 3RZFA 3R8VA 4AN2A 5IA2A 2BAQA 3O51A 4FNYA 3D5WA 2XNPA 5EI6A 1ZOHA 3R7VA 4D4SA 3CXWA 3FMJA 3AC8A 5DWRA 3I4BA 4G3DA 3R9RA 2VTHA 2F2UA 4NTSA 1NT2A 4BZOA 3W55A 5AUYA 1R39A 1PXKA 3NGAA 5TOZA 5FTQA 3RWPA 4JT3A 4D2PA 2QR8A 2WEVA 5BMMA 1KE6A 2YM6A 4XRJA 3IS5A 4WG4A 4HVIA 1YWVA 5JMSA 4EOMA 1IRKA 4ACDA 4ZLYA 1STCE 3ENMA 3C4CA 2BRBA 3QTXA 3T9TA 2VTQA 4MBLA 4C37A 3FI3A 1JKTA 3IPHA 1J7IA 3CKWA 4IJPA 3FLWA 4FT9A 3OROA 3DK3A 4PL5A 2R3JA 3IGGA 3PJ8A 5GNKA 5CYIA 4C2WA 5LMAA 5E8SA 3FWQA 2Y0AA 3LFFA 3QUDA 4I4FA 3ERKA 4PDSA 3SXRA 3UIBA 3MH0A 3OY1A 2UW6A 1BI7A 2VGOA 4YHFA 5HCXA 4YPDA 4CQGA 3EB0A 1XH5A 2XM8A 3R1NA 5FXSA 4GYGA 3CJGA 5CWZA 3FLNC 2Y4IC 1V0PA 4WUNA 3MDYA 2JGZA 3VS6A 3EQPA 4ANSA 3ET7A 3FMKA 3FE3A 1Y6AA 2UW8A 4C34A 1YWRA 3P0MA 3TKIA 3ZLSA 5AV1A 3MY1A 4TYEA 4F0FA 1SVHA 1Q41A 5AP1A 2VNYA 4EONA 3UIXA 1H25A 2FA2A 2BDWA 3VNTA 3MI9A 3EFJA 4RWLA 3R01A 4FL3A 1JPAA 4MEDA 4PL4A 2XIRA 3PIXA 3RAWA 4A9RA 1FMOE 2UZOA 4E6DA 2XS0A 3GCSA 4I6HA 3DGKA 5HZNA 3IDBA 3P7AA 2NP8A 3P79A 4BI1A 3FI8A 2XKDA 3GU7A 4KWPA 3EQCA 4WNMA 5CU4A 1FOTA 3KFAA 4U40A 3L9LA 2C68A 5AIKA 4RA5A 4GYIA 5ANIA 3BV3A 3ZHPC 3ZFMA 4YTCA 2E9UA 3LFCA 3WF6A 1T46A 3NPCA 3U6JA 3ZZEA 2HZ4A 3Q2JA 3F66A 3A62A 5IPJA 3NUUA 4BCQA 2J51A 2CGVA 4XX9A 2CN5A 1G8SA 4F9YA 4H3QA 5C4KA 3V5WA 3ZRMA 3ZLYA 1OM1A 2FB8A 2OJJA 3UC3A 2W4JA 4J71A 4BN1A 2CPKE 4FIFA 4RWIA 2PVLA 4EH8A 5IQFA 2YM8A 1RW8A 4EOIA 4CG9A 3QF9A 4O6EA 4R78A 5DGZA 3LM5A 5I0BA 3FMNA 3QQUA 5CAVA 4FTMA 2ITQA 3R1YA 5I9YA 1L3RE 4D1ZA 2IVSA 2WMBA 4FV8A 3TI1A 4G3GA 3QRIA 4RVMA 1O9UA 2WQBA 3DBCA 4S34A 1UWHA 4F9BA 5AUTA 3FSKA 3HGKA 5CU3A 3GENA 3B2TA 4I4EA 4R7IA 2PMNX 3BWFA 1KE9A 4QOXA 4X3FA 2WTWA 4G16A 4MNFA 4OTGA 4RVTA 2F2CB 1OITA 4EH7A 4FVRA 4JQ8A 3DLZA 5L2WA 1YOLA 4HPTE 4GUBA 3RAKA 3U4WA 5DOSA 1PXPA 4YC6A 4IAYA 2WMWA 5EDRA 4M97A 3OVVA 3F9NA 3ORNA 4R1VA 4YZ9A 3WZUA 4Y83A 5A9UA 3FKNA 4J1RA 5CXZA 2OXYA 5JGBA 3E8DA 5LVMA 4CG8A 4IWOA 1GZKA 1Y6BA 4XP2A 5HLNA 5HESA 4A06A 3VQHA 5L6OA 4R7BA 3L8SA 2JIVA 3Q5IA 5E90A 5CSWA 4IWDA 2CGWA 3QZGA 2JKKA 4UWYA 3WZKA 4FTUA 4MXYA 3DAJA 3RKBA 4BDJA 5BNJA 3BGQA 4MBJA 1SNXA 5CF4A 5LWNA 3P7CA 3JR1A 4L67A 4OGRA 5D9HA 3QA0A 4AT3A 3KB7A 1UA2A 4K6ZA 4G3EA 4PDOA 3DV3A 4W9XA 4CTBA 2B9IA 4ALVA 3LCOA 2UW4A 2IO6A 2YITA 4FTJA 4HGEA 2HCKA 4ITIA 4A9SA 4MK0A 3WILA 1M7NA 2OH0E 4IX5A 2RG6A 4BI2A 2IWIA 4YSMA 1IA9A 3D94A 3PDTA 3MJ2A 3DXQA 5IQDA 4QTCA 5D10A 4QP3A 4F1OA 1H26A 3HLLA 3IW4A 4CKIA 2WQOA 5CXHA 4AOTA 3QTUA 3QQGA 2BZHB 3H30A 4U79A 4WG3A 3RAIA 1H1WA 1KWPA 3SGCA 4PPAA 3HEGA 3S4QA 3IGOA 2R3IA 3OCBA 4QYYA 3KK8A 4X2JA 1APME 2I0HA 2WMRA 5F95A 4A9UA 3U4UA 4C2VA 2HWPA 3A7IA 5EDPA 1ZOGA 4F70A 3I5NA 4OTIA 2CNUA 3TV6A 5LMKA 1CMKE 4QO9A 3THBA 3A7GA 4TWNA 3VQUA 4RC3A 4BCNA 3LLAA 4FKGA 3KXMA 2F7EE 1PXMA 5FGKA 2R64A 3ORXA 3R30A 4WNKA 1YVJA 4Q5HA 2OZAB 1G5SA 4FKIA 4FV3A 3G0EA 3D7ZA 2BZKB 5ETIA 3KVWA 2BCJA 3ENHA 2ERZE 3F2AA 2C6MA 4XP0A 5KBRA 4CV9A 3UC4A 4L3PA 4IZ5A 5C1QB 4FTQA 4HNIA 4AE6A 3G90X 3KCKA 3LXNA 5KKRC 3SVVA 5FUTA 3V8SA 3GVUA 5M44A 4A9YA 4XOYA 3MVJA 4HGLA 4L8MA 1E1XA 4A9TA 1P4OA 4B9DA 1PHKA 3DJ5A 4ZMEA 1WAKA 4ERKA 1G3NA 3NNVA 5HG7A 5CS6A 5IQHA 2W9ZB 2R3MA 3EN7A 4A4XA 3IONA 3KRWA 5HLWA 3BKBA 1OL6A 2HENA 4EQCA 2JLDA 4ZOGA 3VC4A 4M3QA 2A0CX 2JKOA 3ELJA 3FXWA 4FYNA 1P4FA 1Q8YA 2WTKC 4FVQA 4FZDB 4PWNA 3RGFA 5TR6A 3CGFA 3S3IA 3OC1A 3CIKA 1EH4A 3W32A 3TV4A 4CNHA 2GS2A 3VS3A 2ZV8A 3QALE 4FOBA 1A06A 4JAIA 4DEEA 5HO7A 2R0IA 4K0YA 4CKRA 4GRBA 5AEPA 5DI1A 2C1AA 1WBWA 2VX3A 1BUHA 3DU8A 3EHAA 2X7FA 4FC0A 4J52A 4KNBA 4MHAA 4OW8A 3SOCA 4OTQA 5M4IA 4WRSA 5HEZA 4AW2A 2QLQA 4JIAA 4UBAA 4DG2E 5BVEA 2JC6A 4QYGA 1Y57A 5CSXA 3NUNA 3SQQA 3D83A 3WI6A 3WIGA 2RIOA 4BI0A 5L2TA 4K8AA 3EYHA 1ZYSA 2WIPA 2DQ7X 3TXOA 5TO8A 3ALNA 4C3RA 3Q9ZA 4EYJA 1OMWA 4S2ZA 3KGAA 3GUBA 1UVRA 5BYZA 5IUGA 5J5TA 3QTZA 2CN8A 1KSWA 3H3CA 4CYIA 4GG7A 4ANLA 3IOKA 3ZCLA 3P23A 2WZJA 4E1ZA 2UW3A 4YZDA 2BMCA 4ZSAA 4AZWA 4EH6A 4QMVA 5DH3A 4M66A 3UZRA 3S1HA 1F5QA 3AMBA 3A7JA 3R00A 4RMZA 3RHXA 4GUEA 3DLSA 5BVWA 5HNGA 3EN5A 1IASA 2YABA 4V0GA 2F9GA 1Q8ZA 2VNWA 1Q97A 4YBKA 3SXSA 5CF8A 2RF9A 1U54B 2UZTA 5B2LA 1YOJA 4M14A 2QONA 4S33A 1M2PA 2P3GX 2B53A 4D2SA 5L8KA 3E8EA 3F5UA 4D55A 3C7QA 2CGXA 4FZFB 4IM0A 3K5VA 3KK9A 4F0IA 2RGPA 2BDFA 4L45A 3N4UA 4RSSA 3QX2A 3A61A 3DY7A 4K9YA 2F4JA 3MH3A 3UBDA 4MF1A 3QRJA 1BL6A 2IJMA 2RFDA 5KKRB 5C03A 3COHA 4IM3A 3W1FA 4UWBA 5I4NA 4GCJA 3T3VA 1XKKA 4DTKA 3PSCA 4X2KA 2G2FA 4XH6A 4P7EA 4YZNA 4EI4A 4EK5A 5L2IA 2PVRA 1YXVA 4FZAB 2JBOA 2XRWA 3O0GA 1URWA 5J7BA 3F7WA 2QG7A 3MPMA 3POZA 4F65A 3UO4A 1WMKA 3PA4A 3QD3A 3QC4A 4BIDA 2ESMA 4QYEA 5B2KA 5JFVA 2WTKB 3NSZA 3VRYA 2JDTA 3IW7A 4BZNA 4F1TA 4FKOA 4O0RA 4DFZE 4BWKA 3EQDA 5AAEA 3PY3A 4D2VA 4FG9A 2AC5A 4JJRA 4RJ6A 4F7LA 3C13A 4QMWA 2XK6A 3Q52A 5B2MA 3K3JA 3IKAA 4HYIA 4Q9SA 3RJCA 3PUPA 4E20A 3MGYA 4RWKA 5DT0A 3ZDUA 1TKIA 4ANQA 1ZRZA 3KEXA 2PE0A 1KOAA 2NPQA 5KZIA 3TNWA 4DCAA 4MD7E 4EHVA 2PTKA 2ZV9A 4GU9A 5M55A 1ZYDA 2VTMA 4QYFA 4ZTSA 2V22A 2C3LA 4PV0A 4BIEA 4ZS4A 4LOOA 2YEXA 2BTRA 2FSLX 3NW7A 3M2WA 3NYVA 4MXOA 2GQRA 3N4VA 1W98A 4PMTA 5GINE 2F7XE 2XK8A 2VO3A 4KBCA 3HYHA 3UIUA 5HHWA 3HMPA 4RBLA 4RIWB 3GOKA 3H9OA 4Q2AA 3Q9YA 4F08A 5CEIA 5CAOA 4N0SA 4CGAA 3V8TA 3AGMA 5JZNA 2C6OA 2VWVA 3DBEA 2XK3A 4USDA 5BVDA 3R71A 4QPSA 4RIYA 3B8QA 3MFTA 1QPDA 3V5JA 5C9CA 2X81A 4AP7A 5M4UA 4G2FA 3NUXA 3Q5ZA 3V6RA 1ZYLA 3PG3A 4CLIA 4K77A 3VUDA 4TPTA 3KY2A 3Q32A 1JKLA 4TYHA 5KMLA 4L52A 2X2LA 3C50A 5AUUA 3OMVA 4KRDA 4AS0A 3GFWA 5E1EA 3DTCA 4O0TA 4RZVA 1RQQA 3FI2A 2RKUA 2A2AA 4LV8A 5IH6A 4YZCA 3FYJX 4MD9E 3GBZA 2PULA 2J4ZA 4TKSA 4B4LA 3HAVA 3F6XA 4IXPA 4XEYA 3V8WA 4ERWA 5A4CA 5EM5A 2PHKA 5K5XA 3SLSA 3U9NA 5IDNA 2W1FA 3N51A 5AR2A 4FEWA 3RP9A 4HCVA 3DB6A 1GY3A 2GNHA 4MWIA 4EUTA 2UV2A 4FV2A 4G6NA 3EIDA 3PPJA 3SXFA 4USEA 3BHYA 4C4FA 2UW0A 4I6FA 3VVHA 3CCNA 3L1SA 2XNBA 2X0GA 5CALA 3EQHA 4PL3A 4ORKA 2C0TA 1XBAA 5DPVA 1H1PA 3DDPA 4HW7A 3O71A 4Y46A 4MNEA 4EOSA 1BI8A 2A4LA 4E6AA 2GQGA 2YIRA 4J96A 4ZY4A 4FUXA 4WT6A 1RJBA 3OD6X 3D14A 5GJFA 5CZHA 4GFOA 3M1SA 5FBNC 5A4TA 5KMNA 3TUDA 1YOMA 2VN9A 4KBKA 4EH4A 3DFCB 4ZLZA 2XJ1A 3VULA 3EMGA 5BYYA 4BICA 3R1QA 4CFNA 1TQMA 2PVYA 3MVMA 4EL9A 1OECA 2J9MA 4OBPA 5HVJA 3C4EA 3R04A 3VUIA 2C5XA 3PYYA 2P33A 3MPAA 4V05A 3OOGA 5IQAA 4AW1A 4TNDA 5FXRA 2X6EA 5CASA 3OCGA 4WBBB 2OWBA 4AW0A 2WTCA 2V55A 4DTBA 2JAVA 3F5XA 4G6LA 4KABA 5LVPA 4FYOA 1Q5KA 4AT5A 4TYIA 1Z57A 2HAKA 2UZBA 4OUCA 1W82A 4RJ5A 4ZIMA 3UQCA 4I22A 4WSYA 4XG4A 1W83A 3NEWA 3BWJA 4NIFB 2I6LA 5DFPA 3UPXA 2HK5A 4FSRA 4EC8A 4DGOA 1OIYA 2HYYA 2XZSA 5KZ0A 2BHEA 2E9PA 4YURA 3KREA 3EKKA 3GQIA 1SYKA 4ID7A 4Y72A 5I3RA 2JD5A 3OEZA 2QOBA 2W0JA 5AP3A 2QO7A 5AV0A 5HTBA 4ZY5A 4IX3A 4O2PA 4HVSA 1CKJA 1M14A 1ATPE 3PJ1A 5CVHA 3A60A 4EJNA 3ORZA 2BZIB 5M06A 4U0IA 3MY5A 2YAAA 1W7HA 3QU0A 2FVDA 5HIDA 2JEDA 2R0UA 1OIQA 5A46A 3TIYA 5TE0A 2WKMA 5KE0A 2YCRA 4IAZA 3KRJA 3FQEA 3IK3A 4MBIA 1R3CA 4L46A 5FD2A 5HD7A 4B0GA 5IF1A 4TXCA 3FL4A 3D4QA 4PMPA 1WZYA 2JFLA 2GCDA 2QKWB 2UZUE 3ORMA 4C33A 3Q9WA 4G9CA 1JKSA 5EYMA 1S9IA 4BCOA 3TDWA 3DAKA 4RT7A 5CEKA 2NNWB 2YM3A 4DFLA 3QRKA 4MTAA 2A19B 4G5PA 4WG5A 4YJQA 2WAJA 5JRSA 4F6UA 4YTIA 1FGKA 2QU5A 3NUAA 2PYWA 2Z7RA 3LJ0A 3R7YA 5CTPA 3GC7A 4FV6A 3MA6A 5HCZA 3CEKA 4ENXA 4XG3A 3ZSIA 1VJYA 2UVYA 3E5AA 4GT4A 2XKEA 4CD0A 3QKLA 4O27B 3UQGA 4AGDA 5E92A 3WE4A 1PXLA 2CHLA 3ITZA 4TYHB 5BUEA 3A7FA 2ZAZA 2J90A 2R7IA 3D5UA 3PG1A 3AT3A 2EU9A 3COMA 3R2YA 4EEVA 4XS2A 4GU6A 4JIKA 4JG8A 4LOQA 4D2RA 2GNIA 4GIIA 4MXAA 5EW3A 3TL8A 1UKHA 3PXFA 4ZP5A 5E7RA 2PZRA 1O6KA 4HYUA 4DEDA 2YACA 4O7ZA 4O7YA 3H0YA 3QKKA 4MX9A 4C57A 2IPXA 2XBAA 3FJQE 3Q3BA 4FK3A 3U87A 4AA0A 4QRCA 5AIRA 3E3PA 2R5TA 3DZQA 3RBWA 2E9VA 5EYKA 2WHBA 3EFLA 3FQHA 1GOLA 3LFQA 3ZO2A 4QMNA 4EZ7A 4EWQA 4D0XA 3G9NA 4ACCA 4NK9A 3AQVA 3FY2A 2X2KA 3QYWA 4NZWB 5J7HA 4JQ7A 4Z55A 4YJOA 2EVAA 3C4ZA 3FL5A 3C4XA 3ROCA 5CSPA 4YO4A 3DKFA 4E3CA 4FVPA 5DRBA 2ZDTA 1M17A 2XNOA 3F3VA 1BX6A 2BILB 3QBNA 3F2RA 4XBRA 2QOCA 2GTMA 4FL1A 3DJ7A 4CLJA 3NNXA 3MY0A 2ZVAA 3QKMA 4PTCA 4YNEA 5M56A 2R2PA 4L42A 2HELA 2P2HA 3TNHA 4FTLA 2R3NA 5CLPA 5G1XA 4II5A 2XNGA 4ZZNA 1BKXA 2IW9A 3QTQA 3R7GA 5IA1A 2E9NA 2HW6A 3R02A 4ITJA 3CC6A 1JQHA 4DA5A 4P2KA 1OL7A 5AAFA 1ZAOA 4RZWA 4RIXB 4C59A 1VR2A 2P0CA 3DT1A 4O86A 3H9RA 1XH9A 3UQFA 4RPVA 4ONAA 2HXLA 4J98A 2XJ0A 3RI1A 2GNGA 2WMUA 2XK4A 4ARKA 2BIYA 4BZDA 1PY5A 4F9CA 4FTCA 3SW7A 3DFAA 4NYEA 2C69A 1UU7A 5IQCA 2V5QA 4FSUA 5GZ8A 3AC1A 3R8UA 1YXUA 4PUZA 4QMXA 2XBJA 4KIQA 5F4NA 3P7BA 4CT2A 5LVNA 1YXTA 2R9SA 4EH2A 5HTCA 4FUYA 5AX9A 4ASDA 4G3CA 5AP2A 4DINA 4PMSA 4BY9E 2B9HA 5C4LA 4PNIA 2BDJA 3DJ6A 2VV9A 3UYSA 3G15A 2I0EA 1PYEA 5ACBC 3UTOA 4QYHA 5AR5A 4X3JA 4BWXA 4F6SA 1YDTE 4FBXA 4CFUA 4FV5A 4FG8A 3CQWA 1J3HA 2QI8A 3I60A 4UALA 2BRNA 4OBQA 2VX1A 4O96A 4BCHA 3RCDA 4RIOA 3KXNA 1NW1A 3B2WA 2W06A 3RPRA 1AQ1A 3VUGA 3E7VA 3T3UA 3FSFA 3OHTA 4AQCA 2W1EA 3QXPA 4BB4A 3MIAA 4BDIA 4L7FA 3RHKA 4GG5A 3OCSA 4R7HA 4Y5QA 4CXAA 3DBQA 3Q2MA 3K3IA 4AGCA 4NM3A 4XG8A 4BF2A 4KIKA 3NVMB 5IU2A 3ORKA 4YGAA 3EOCA 4ZZOA 3QL8A 5K0KA 1G8AA 5DLSA 1NA7A 1NY3A 2HY0A 4WNOA 4B7TA 3MB6A 4KA3A 4JL9A 3G2FA 4IW0A 3ZSHA 3MBLA 2OO8X 3HMIA 3E3BX 4ACHA 2G2HA 2F7ZE 5BYLA 2C5NA 2VTTA 4QQCA 5DHJA 5FBOA 4ANBA 4FG7A 1SM2A 4NJ3A 4UEUA 3UG2A 3F3ZA 3GCUA 4BVUA 4EH9A 3QFVA 1PRYA 3QQLA 2GPHA 2QNJA 3PE1A 3O2MA 3Q9XA 4DAWA 4FIHA 4BRXA 3VJOA 5HVKA 5CEMA 2W4KA 2JIIA 3CPCA 5C8MA 5J9LA 1Y91A 1OKWA 4J99A 4BBEA 1YI4A 5FM2A 2WMVA 3RTPA 1OL1A 3CP9A 5FRIA 4LMNA 1YQJA 2ZDUA 2PWLA 4S32A 3QC9A 4CMUA 3GCPA 3PTGA 4IBMA 4F4PA 1GIJA 1DAWA 5AP6A 1Y8GA 3R7UA 4OLIA 5K4IA 3CR0A 4BHNA 4FTRA 3W33A 2PUNA 1OUYA 2Y8OA 1JAMA 3AC5A 4MKCA 4R1YA 3REPA 4YJNA 5HX8A 1KOBA 3CY2A 4Z16A 2EUFB 3KXZA 2B1PA 3TM0A 2YDJA 4GK4A 3VF8A 4DCEA 3P5KA 5H3QA 4DE4A 2ITOA 3ZM9A 3ZO1A 2Y6OA 3PJ3A 2OFVA 4APPA 4CZYB 5H8EA 3OTVA 4GT3A 3FUPA 3F82A 2QOLA 4FT7A 1GZOA 3LLTA 4XG7A 3QD2B 3ZM4A 2O5KA 4DN5A 1URCA 4QTAA 2BRGA 3DZOA 4IX4A 4U7ZA 3C4WA 2G9XA 4O21A 3A8WA 4WA9A 2IVVA 2VGPA 2P2IA 4G6OA 5LVOA 3TG1A 4YU2A 1CKIA 3CPBA 3VO3A 3BU3A 4C3FA 3FZTA 3KL8A 3ZMMA 3WARA 2C5VA 3BYOA 4CCBA 2QO9A 2IVTA 1FPUA 4IACA 4QPAA 1BMKA 4EH5A 5HVYA 4YNOA 3ZS5A 3FHRA 2J50A 4BCFA 4Z7HA 4FNZA 2OF4A 3OBGA 4FV4A 5C27A 2QOHA 3SOAA 5IEXA 2VTLA 4UYNA 2PMOX 3I0QA 3FLSA 4A4OA 3LFNA 3S2PA 5AUWA 4AUAA 1U5RA 2QOFA 3DNDA 3DPKA 4APCA 5IA3A 3QCXA 4U45A 5IEVA 3VHKA 5AADA 2V0DA 3CSVA 3PLAE 3GC8A 4H1MA 3KXHA 2OIDA 4PDYA 5E8YA 4C4GA 3OP5A 2XP2A 3GQLA 5M51A 2E2BA 2W1IA 4JBVA 2UZVA 3CBLA 3H0ZA 4XV9A 3HKOA 1XR1A 2XEYA 4MXCA 3FZRA 3JS2A 1ZMWA 3E8NA 3GU6A 3RK5A 4DH5A 1B38A 2ITTA 1F3MC 5AWMA 1REKA 3BGZA 4AZFA 4EYMA 4OAVB 2ETRA 2Y6MA 3TKUA 3LFBA 4BDAA 5FM3A 4EHEA 5M07A 1SVGA 4X3FC 1FVVA 4GIHA 2JDOA 2W1DA 3UVRA 2OF2A 5L6PA 3JY9A 4NJDA 5K4JA 3QZHA 2OH4A 4ZTRA 4XLIA 5D1JA 5A14A 5EM7A 4L7SA 4UYAA 3KXGA 1OPKA 3RPOA 5IMXA 3D9VA 1NVSA 3RZBA 3FLYA 3K5UA 2BAJA 5LWMA 1WBVA 2YM4A 2YERA 5AP5A 5L3AA 1ZZ2A 3GNIB 3MB7A 3PY1A 4W4VA 1MQBA 3W8QA 3Q4ZA 2XCHA 2I0VA 2YAKA 2QOKA 4IDVA 4XMOA 4XV1A 4TYGA 4G3FA 5FEQA 3HMNA 1KE7A 4R3PA 2XYNA 1U4DA 5FP5A 3UMWA 4S30A 3UZTA 2WEIA 2I40A 4RVKA 1F0QA 1AGWA 4XHKB 3VUTA 2I1MA 4X2FA 4I21A 4XYFA 5I9UA 5B7VA 2XNNA 3V6SA 1K9AA 5HIBA 3RPVA 4E4MA 3NRMA 3BELA 4JI9A 3TJCA 4BBFA 5BVOA 3PSBA 1JWHA 4KS8A 4YTFA 4O7LA 2P4IA 2VWXA 2CCIA 4BGQA 2X2MA 4E5BA 2VZ6A 2PK9A 5HORA 2VTOA 3N4TA 1OIUA 1OUKA 3MH1A 1OKZA 3G6HA 4AZEA 3FMHA 1RDQE 4EBVA 4AN9A 5KMKA 2YIXA 3AT2A 4IVAA 4PY1A 5FTOA 3FBVA 2CSNA 1UV5A 3PVWA 2GNFA 4J53A 2PMIA 3H4JA 3NCZA 3AD6A 3DBFA 3M42A 4J8MA 4M8TA 3V5TA 3E64A 4WO5A 3DB8A 2BTSA 3KMUA 4OTFA 3R28A 3SW4A 5BVNA 5HQ0A 4QP8A 3O23A 4RX9A 3EZVA 2GQSA 2W99B 4FSMA 3LFEA 4O7WA 3IG7A 5HG5A 4GSBA 5HE0A 4BL1A 2R3KA 1KUTA 3MIYA 3PJCA 2CJMA 4UZHA 1PF8A 2GSFA 3EL7A 2ETKA 1W84A 1GIHA 3CLYA 3NDMA 5ANGA 3VUHA 3V01A 4FX3A 3O7LD 1ND4A 4PTEA 3EKNA 4CRLA 1Q24A 3KF7A 3BEGA 4B99A 5LMKC 5LXMA 1MRUA 5FEDA 3JUHA 2BFXA 2PZPA 2QOIA 3KN5A 4ZSJA 2OGVA 1H08A 2X4ZA 5HI2A 3UNZA 4N70A 3LPBA 1LEWA 4WHZA 4E73A 4DLJA 1UKIA 3E93A 3UOLA 3RPSA 3E62A 2EB2A 2HOGA 3FKOA 3KN6A 4KD1A 3T8OA 4D2TA 1J1BA 1U59A 3JPVA 3IQ7A 2VRXA 2UW9A 3D5XA 2GNJA 5CNNA 5E1SA 3UG1A 3E7OA 2IVUA 3ZO3A 4D9UA 4NCTA 4X3FB 5F9EA 4C02A 2YZLA 3BQCA 3W10A 4L68A 5A4EA 5IISA 2IG7A 4ANNA 4MD8E 4IM2A 4EWHA 3R83A 4M12A 3M11A 5DEWA 5KMOA 4I93A 4O0WA 3DAEA 5DIAA 2C4GA 4UXLA 3WF5A 5HX6A 3EH9A 4NL0A 3MFRA 4KRCA 3PXZA 2VWYA 3ACJA 4BKJA 1R78A 5FLFA 3PFQA 4IE9A 4PP7A 5HNIX 3HV6A 1U46A 3KMWA 4ITHA 4Q9ZA 3NZ0A 5AFVA 4JX7A 4GJ2A 4LFIA 2H34A 4BCPA 4BKYA 3FEGA 1MRYA 4PTGA 3ZC5A 2VWZA 3JVSA 3QQKA 3POOA 3FZSA 4DGNA 5JT2A 1WVXA 3D7TA 5LOHA 4KKEA 1GAGA 3IDPA 4YZBA 2OBJA 3CY3A 2XA4A 3BU5A 4BCMA 2PVFA 4I92A 3GC0A 5KMMA 4ZJIA 3DQWA 4W8DA 3PWYA 2ITPA 4C7TA 5JKGA 4CYJA 3KC3A 3PIZA 5K5NA 2WTIA 3R9NA 4F9AA 2CKOA 3OY3A 3MA3A 3VW6A 2V62A 2ZMCA 4UMUA 2BKKA 2R3HA 2XCKA 2ZV2A 3FKLA 3FPQA 3ULZA 5EW8A 4U80A 4DH8A 3G0FA 1LEZA 3ZXTA 3UMXA 3GU4A 5T6KA 5EQPA 2VTJA 3TZ8A 2YM5A 4AOJA 4FKPA 4K11A 2C5OA 4EUUA 3NAYA 2X6DA 3LJ1A 3NUPA 2Z60A 3RCJA 2C6DA 3OT8A 5CZIA 5AV2A 1H28A 3QQFA 4BTMA 4C4IA 3F61A 3KVXA 1FVRA 3LHJA 3QD0A 2YHVA 4JG6A 5FP6A 3BYUA 2O3PA 3ALOA 3AOXA 5HE3A 3KQ7A 4XNEA 2PVKA 2PPQA 3VBTA 4ACMA 4S31A 4E7WA 4RJ3A 2OJFE 4XJ0A 3RAHA 1CSNA 3RM6A 4GMYA 4YC8A 4J97A 3RPYA 4HZSA 4FV0A 4RA4A 2CMWA 4U9AA 5KHXA 4Y5HA 4FTIA 4A07A 1XH8A 3I6WA 2Q0NA 4FIIA 2OKRA 4L3LA 3WYYA 4K1BA 4MCVA 4OBOA 3U8WA 1KV1A 3PVBA 5IA0A 3F3WA 1PKGA 4BTJA 3U55A 3I79A 2C3JA 3OUKA 2NRUA 2PUUA 5A3XA 3RVGA 4O84A 5E4HA 2YLEA 3FXXA 1WFCA 5JGDA 4AGUA 4DGGA 4EQUA 1R1WA 3C0HA 3F88A 2C6KA 2A1AB 3MTLA 3LFSA 3SRVA 4O7SA 4DBXA 1ZOEA 4KBAA 3L8PA 3Q53A 4RJ7A 2G1TA 4CSVA 4O7TA 4IFCA 4O83A 5IH5A 2OXXA 4ZS0A 4LQMA 2W17A 3LVPA 2QD9A 3P4KA 4RFMA 5IQIA 2BRHA 4CMOA 3HMMA 4BDHA 3Q6WA 4M69A 4L44A 3OXIA 5AMNA 2ITNA 1M2QA 2GHLA 3BRBA 2C47A 4UX9A 3FLZA 2YJSA 4QP1A 2QC6A 4U6RA 3WE8A 4LI5A 2W5AA 5KO1A 5HLPA 2W5HA 3KU2A 4BYIA 4EORA 5DR9A 3LMIA 1GZNA 3S95A 5BVKA 3VJNA 2RFSA 4F9WA 3MW1A 3BLRA 4FOCA 4HNFA 5J1WA 5AUVA 2ZV7A 3OUNB 4USFA 2B0QA 3SA0A 2GNLA 3FQSA 2CLXA 3BU6A 4F99A 4P5ZA 3SV0A 4NH1A 4ZK5A 5JFSA 2W5BA 4YMJA 3DBDA 3UGCA 2RSVA 4YP8A 4D9TA 1OI9A 3LFDA 3PZHA 3CQEA 1KE8A 3WF9A 3D0EA 4X21A 1OL5A 3W2PA 5CEQA 1Y8YA 4FEVA 3VIDA 2YIWA 5F94A 4V01A 2HXQA 2Q0BA 3D2IA 3VUKA 5IG1A 1MP8A 3QA8A 5L2SA 4UMPA 3W2SA 4QTDA 5FDPA 1CTPE 2OSCA 4D5KA 4DT9A 1OBDA 1J91A 1B39A 2BALA 4V0GB 1NVQA 3IECA 4FTOA 2ITYA 3QUEA 2Q83A 1ZYJA 1LR4A 2FYSA 2QKRA 3N9XA 3OS3A 3QRTA 1LUFA 1ZLTA 4NFNA 4W4YA 3V5LA 4BGGA 3FC2A 1VZOA 2JFMA 3TZMA 1YW2A 3E63A 4I0TA 3VHEA 2WTVA 2GHMA 3R21A 1B6CB 3UNKA 4U42A 3P08A 5F1ZA 5EQYA 2C3IB 3RM7A 5CAPA 2W1ZA 3HV4A 4CCUA 3GCVA 1YXSA 4QQTA 4YJTA 3AGLA 3R6XA 2FGIA 4I5CA 3GU8A 1PXJA 3UIMA 4BIBA 4O0UA 2WU6A 5FEEA 4IVDA 4J8NA 3G5DA 3TWJA 2O2UA 3TT0A 4JDJA 3OOMA 3HMOA 4AT4A 4AXAA 3LZBA 5EH0A 3W2CA 3NIEA 3LM0A 2JIUA 5ANKA 3BHHA 4D4RA 5CU0A 1J7LA 4RWJA 4I5PA 2ZB0A 3FZ1A 3GGFA 3GEQA 2VWWA 3HP5A 3IOPA 4RJ4A 2PVJA 3D5VA 4BDDA 5M57A 2OJIA 2UW7A 1YI6A 1WBOA 3QCYA 4ALWA 2HZ0A 3ULIA 4AF3A 4E26A 3TUCA 5JQ5A 1CDKA 2J0KA 5CT7A 3TACA 4EOJA 5A4QA 4I41A 2QO2A 4RG0A 3F3UA 5HIEA 3BIZA 4G34A 4FI1A 1PMVA 2NRYA 3I6UA 3NUSA 5E8UA 4ZMFA 1ZMUA 4FKJA 4TRLA 2X9FA 3L8XA 4ALUA 2C3KA 4FNWA 3BCEA 5IA5A 3V5PA 3WZEA 4I1ZA 4ASXA 4O38A 5EM8A 4QP6A 4YZMA 3QZFA 4U8ZA 3OW3A 2BAKA 4WRGA 5HBJA 4XCUA 3C0GA 3VS4A 3TUBA 3DDQA 5C01A 4ZJVA 4C61A 4ASEA 3L9NA 5E9EA 4L00A 3ETAA 4KSQA 4O1OA 3FYKX 3ORIA 2J5FA 3W8LA 2OG8A 1JSTA 4RGJA 4LGHA 1ERKA 4U43A 4R5SA 4DFBA 1VEBA 3TNPC 4IADA 4H39A 5KMIA 1QCFA 2RFNA 4DFXE 4GJ3A 3MV5A 3AC4A 3KULA 4A7CA 3R2BA 5TKDA 2EWAA 5L8LA 4KIPA 1IG1A 1XHAA 3DK6A 3UO6A 4WNPA 4E5WA 3HUBA 2WU7A 4OT6A 4ZLOA 1O6YA 5CU2A 3E87A 2XRUA 4ANMA 3FMDA 4MAOA 4C8BA 4X0MA 4LRMA 1Q99A 3IW8A 3ACKA 5DE2A 1ZARA 3BYVA 3ZUVA 5HU3A 4PRJA 5J79A 2W1CA 2QHNA 4I6BA 1J7UA 3ATTA 4RVLA 2P55A 4CFVA 3BLHA 1U5QA 5CAUA 1PYXA 2X8EA 4G9RA 3EL8A 3CTQA 3DXNA 2VTPA 3QWKA 4RC4A 1H1QA 3QX4A 2GMXA 2IN6A 5DNRA 4RIYB 4DH7A 4EOPA 2YISA 2Z8CA 3FMLA 4FTAA 4HCUA 3ZRKA 3RMFA 5JEBA 2ONLA 4IC7A 5DR6A 2QVSE 2OI4X 4FODA 4H3BA 3EFWA 4NT4A 5E8ZA 3VS2A 3WYXA 3LCTA 4LMUA 4NSTA 2QODA 2OK1A 2WQEA 4XG6A 2XVDA 4H58A 4DH3A 3AC3A 5DVRA 4CFFA 2ITUA 2VU3A 2C5YA 3QRUA 4GS6A 3C4FA 4XOZA 1RE8A 4HCTA 5JK3A 2GFCA 5ETCA 4YHJA 5A4LA 4DEAA 2IZTA 5I9VA 1ZMVA 2PSQA 2QG5A 4NFMA 3VRZA 4FTKA 5HGIA 3RK9A 4EOKA 2VWIA 3LQ8A 3PE2A 4K33A 1E1VA 1OB3A 4Z7GA 5KMJA 4U81A 3R22A 5IQEA 3W2RA 3R8PA 4B8LA 4E93A 3F7ZA 4DITA 4FICA 5AUZA 2BHHA 1P14A 4Y95A 1SVEA 5ANEA 1J1CA 3ZTXA 4O7RA 3LW0A 3U6HA 2XEZA 3QCSA 4PPBA 1GNGA 2OW3A 1YDRE 1ZXEA 2XNEA 2C6LA 2W1GA 5BX0A 3Q4UA 4ZSGA 4F64A 4JLCA 3HZTA 1H1SA 4MNEB 3RK7A 4CFWA 5FDXA 4M7IA 5T3QA 4BC6A 3KXXA 4QPMA 3ZLWA 2Y9QA 1OKVA 3MSSA 4D5HA 5A54A 3FXZA 3F5PA 1XO2B 3OG7A 4HJOA 5E8WA 3P9JA 2PZ5A 5CVGA 2PU8A 3KKVA 3UJGA 1H0VA 1Q8UA 3OXZA 4O7VA 4HYSA 2ZYBA 1OPJA 4AFEA 2BKZA 2RFEA 4AA5A 3A2CA 4C0TA 2CNQA 1UNHA 3W2QA 3SC1A 1W8CA 1TQIA 5DG5A 3B8RA 2G15A 4I23A 4F0GA 3NVKI 2GS7A 4JR3A 3QAME 4FKVA 4BWPA 4M67A 1JKKA 3EQGA 2CNVA 2CKQA 2XM9A 2VWUA 2VWBA 4FF8A 3LXKA 1R0PA 5CSVA 3FC1X 5TT7A 2ITXA 2YIQA 3BYSA 1M2RA 3RNIA 3IW6A 4CVAA 5HBEA 5IQBA 4D1SA 4DFNA 3SG8A 4BBMA 4FV7A 4CEGA 3BLQA 4NM7A 4OTWA 4XG2A 3IO7A 4FV1A 2WFYA 1OVEA 2ZMDA 2ZOQA 3PP1A 3PPKA 4GH2A 4OTRA 5AP7A 3CQUA 3SG9A 2H8HA 4OTDA 4DG3E 5KHWA 4F09A 1BYGA 4Y73A 3MH2A 2XIZA 5H2UA 1IAHA 2PZYA 4YPSA 4FIJA 4NM0A 2B9JA 3RALA 3W2OA 3EN6A 4X2NA 4HZRA 3TN8A 4BYJA 4C58A 3UPZA 3I5ZA 2B55A 2YFXA 2Z2WA 4E4XA 4M68A 1H8FA 5I5ZA 4YJRA 5LVLA 4ZSLA 2JAMA 3UO5A 1XQZA 3F5GA 1LPUA 3LIJA 3FLQA 3KULB 4KS7A 5CSHA 4OR5A 4UMRA 3DK7A 5ANDA 3BHVA 3BEAA 4RRVA 5HICA 3R73A 4DLIA 2J0MB 3OT3A 4YR8A 4M13A 5CAQA 3NIZA 2IZUA 3NNWA 4QT1A 4O91A 2XMYA 3QYZA 1TQPA 2WQMA 2I7QA 5I3OA 1JVPP 3O7LB 5L2QA 4QNAA 2O63A 2QOOA 3HV7A 3CGOA 2JKMA 3I81A 3R9DA 2VUWA 1I09A 3LCKA 3UDBA 3CD8A 3G33A 3VS1A 4EHGA 4BCKA 4EK4A 4IZAA 3IDCA 2ZB1A 4AZVA 1CM8A 3EFKA 1BL7A 4DEHA 1H27A 4JXFA 4IAAA 4LL5A 5HO8A 4Q5EA 3HUCA 4MXXA 2VD5A 2XIKA 5HO6A 4I0RA 3TCPA 3R9HA 3BBWA 4EOLA 3OFMA 2ZM3A 5FTGA 5EKOA 3DKOA 3QTWA 2CKEA 1IA8A 3HRFA 4QMTA 1MQ4A 3COIA 4QNYA 1YKRA 4EBWA 4EKKA 4FV9A 3R7OA 1OPLA 2AYPA 3G9LX 4AWIA 4TYJA 4P4CA 3HECA 2UZEA 4MQ2A 1PMNA 2WOTA 3DCVA 2XH5A 1XJDA 3RWQA 4U41A 4EZ5A 2PY3A 4D0WA 4AOIA 2J6MA 4UV0A 3ODZX 4JAJA 4U3YA 4R3RA 2PZIA 2FO0A 2IZRA 1IR3A 5JH6A 4DTAA 2RL5A 4N6YA 3VUMA 3SKCA 4ZJJA 4PMMA 3OZ6A 4JX3A 3FZPA 4GW8A 4K18A 3R8LA 4W9WA 3ZYAA 4RLLA 4OT5A 5I9WA 1FINA 4ZTNA 4Y8DA 2WMAA 5HTIA 2YCFA 1QPJA 4TNBA 3SHEA 4HVDA 2GFSA 3MVLA 5KX8A 2YLFA 4CQEA 2JDSA 1W0XC 1A9UA 4AACA 4FEXA 2CKPA 5JZJA 4BDKA 5A6OA 5GJDA 3TEIA 5AR4A 3PVGA 3H10A 4M0YA 3HV5A 2WO6A 4QP9A 4C62A 4FNXA 3VWAA 4R3CA 4WOVA 3DQXA 3VS5A 3DKCA 4W8EA 4TTHB 5AM7A 1MRVA 4IZ7A 1FBNA 5AM6A 1FQ1B 3UVQA 3EQBA 5D11A 4FSYA 4QMMA 5C8KA 2QLUA 1YDSE 4G5JA 4U44A 3WOWA 5M4CA 3WZJA 3F69A 2OIQA 4CRSA 3BPRA 2OZAA 4LV5A 5DBXA 5CANA 4IWPA 4TWPA 3C5IA 4F63A 1VYZA 4IB1A 3K54A 3OWKA 3NW5A 4JDKA 1QPCA 2WMXA 5K3YA 3SAYA 1YI3A 1NVRA 4JBPA 2WTDA 4F6WA 4R8QA 1YHWA 5EOLA 2ETMA 3PXRA 4RJ8A 3TTIA 3FAAA 2BPMA 2UUEA 2BZJA 5CF6A 5GIPE 2OZOA 3Q60A 4GL9A 5EI2A 3SD0A 5J87A 3V3VA 3MFUA 4HPUE 2X7OA 2W9FB 4FIGA 4RC2A 2W96B 2X8DA 2OJGA 4HGSA 3SDJA 4X7QA 4LGGA 5DN3A 5GZ9A 3QHWA 2R3LA 3TV7A 4EK3A 4FSNA 5HE2A 4UN0C 4YJPA 5IUHA 1DM2A 2IW8A 2G2IA 4D1XA 1ZY5A 2BRMA 3L8VA 3NR9A 3G6GA 4LRKA 4P90A 3P78A 3TZ9A 4LRJA 4FKWA 4HGTA 2HWOA 4XLVA 2IZSA 4WIHA 4DHFA 2E9OA 2OIBA 2PUIA 3PLSA 2J2IB 5J8IA 4PDPA 4JDHA 4IMYA 1Q8WA 1UU9A 2C6EA 4AU8A 5EG3A 2I0YA 3I1AA 1UU8A 3CS9A 1UNLA 4YSJA 1YXXA 4IANA 4P5QA 4YJSA 3VBXA 4GFMA 4O2ZA 4U97A 3BHTA 1ZY4A 4TWOA 4O0VA 1IEPA 4DGLC 4XBUA 3WZDA 2J5EA 4FZ7A 5E8XA 4O82A 2CLQA 2X8IA 1YHVA 2XK7A 3ZH8A 4DBNA 3HA6A 4KINA 4NWMA 4OAUC 2YIYA 1K2PA 2CCHA 3S00A 5EM6A 5EK7A 1SNUA 3F2NA 3R7EA 3V04A 2UZNA 5IDPA 3VS0A 3NMUF 4E4NA 1AD5A 4C38A 3ZLXA 4R77A 3BQRA 3NCGA 4XG9A 4XRLA 3NS9A 3QWJA 5GHVA 4B8MA 1Z5MA 4KIKB 3Q4TA 2FSTX 2Y4IB 4JDIA 4BHZA 2OLCA 5BPYA 1PMUA 3ZXZA 5AX3A 3EQIA 3FZOA 2WELA 3PJ2A 3HX4A 4ZZMA 3T9IA 2UVZA 5EOBA 4AE9A 4QMZA 2Z7QA 4NM5A 1ZZLA 3W16A 2RG5A 3NAXA 4LM5A 3PY0A 4IAIA 4FE2A 4DF3A 3QHRA 2WXVA 4BCJA 4LL0A 4CKJA 5KUPA 1U54A 3PZEA 1V0BA 1WBSA 3GFEA 2R3FA 4I6QA 3P86A 5LCJA 4PQNA 4IEBA 4W4WA 4TY1A 4KUJA 2VO6A 3QQHA 1S9JA 4LUDA 5FQDC 5ITAA 4IJ9A 1OL2A 3OWPA 1HCKA 5HU9A 2QOQA 3EJ1A 1O6LA 2PUPA 2WIHA 3DS6A 1H01A 2XNMA 4PF4A 1PKDA 2BROA 5D7AA 5EDQA 5EHOA 3LCDA 1XH6A 1H0WA 4RQKA 3ZUUA 3AMYA 4MWHA 3TKHA 4D4YA 4AAAA 5H8BA 4RX7A 2XKCA 4FK6A 3I0OA 3BYMA 4KKHA 4YO6A 4O1PA 4AX8A 4O0XA 5C26A 5M4FA 4FGBA 4R5YA 4G1WA 3LKMA 4YJVA 1ZYCA 4FGRA 3MS9A 3ZRLA 4QTBA 5KBQA 3UNJA 1NXKA 2XF0A 5CEPA 3QGYA 3ZEWA 2W05A 2A27A 3KCFA 1WBNA 3O8UA 3HDMA 4C35A 3NNUA 4LGDA 2AUHA 1WBTA 5CT0A 4L3JA 5J9ZA 4CT1A 4WBOA 4FSWA 2VTNA 2BR1A 2OFUA 1XH7A 5CVFA 3ODYX 1K3AA 4W4XA 2Y7JA 4NU1A 4O0SA 5AA9A 5CI6A 3R8MA 5L6WL 5EQEA 1CKPA 3QQJA 4V04A 3Q96A 4NKSA 3ZDIA 3ZC6A 4F1MA 3NX8A 3OW4A 2DYLA 2C0IA 4GVAA 5L4QA 4FIEA 3LFAA 4BKZA 4UWCA 1LP4A 1WBPA 4GVJA 4AZTA 3VBWA 1HOWA 3VW8A 4FTTA 3DKGA 3RINA 3VBQA 1DS5A 4CTCA 3OXTA 1XWSA 2PL0A 1QPEA 2R3QA 4QP7A 4X6QC 3MN3A 3LMHA 2HZNA 5LCKA 4H3PA 3ZFYA 1P2AA 4MVFA 2WPAA 3PA5A 4FKUA 2H9VA 1Q62A 2UVXA 4HOKA 4QQJA 4ZSEA 3VS7A 4AGWA 1MUOA 2PVMA 5HKMA 3AG9A 3ZFXA 4RX5A 3KMMA 4CZTA 4JR7A 4ZTMA 2OICA 4ACGA 4EKLA 3QZIA 3O50A 3NW6A 2WQNA 4RIWA 4D58A 5M08A 1DAYA 3I7BA 2C6IA 5CU6A 2FSOX 4UB7A 5AP0A 3ZUTA 3LQ3A 2V7AA 3BGPA 3AMAA 3COKA 4LYNA 3W18A 3E92A 3R63A 2EXMA 3P1AA 1QMZA 4C3PA 4L53A 3LXLA 2B9FA 5J95A 4FZ6A 2YWVA 4BTKA 5JN2A 1OZ1A 3ZSGA 2ERKA 3TDVA 4X2GA 4ANOA 4WSQA 2KTYA 5AV3A 1GJOA 3GOPA 2J0LA 4CFMA 2CGUA 3HNGA 2EXCX 3O8TA 1X8BA 4DH1A 5DYJA 2XJ2A 5A6NA 3ORLA 1I44A 2ITWA 4NCTC 4FL2A 2PE1A 5CEOA 3QXOA 3UP7A 1V1KA 4E4LA 4O6LA 4IAFA 4QMSA 3BI6A 2AC3A 4BDGA 4AN3A 1KE5A 5IQGA 2Y4PA 5BUJA 2B54A 5EI8A 4N57A 2HY81 5D41A 2KULA 2YZAA 4TW9A 4I5HA 2X1NA 3CTJA 3QTSA 4DT8A 5EW9A 2VAGA 4ZAUA 5I9XA 4QMPA 5C8NA 3D15A 1H24A 1KV2A 3G51A 2R7BA 3AC2A 4IX6A 3JXWA 3OEFX 5JQ8A 3HV3A 1WCCA 3KRXA 3MWUA 5HG8A 3HRBA 3A8XA 5IUIA 3V51A 4DYMA 5LJJA 5KCVA 3JY0A 3V5QA 2ITVA 4BGHA 3MTFA 3O8PA 4LOPA 2WMTA 4I24A 2QR7A 4F7SA 3UE4A 4DFYA 4IWQA 4EJ7A 3AXWA 4E8AA 5FXQA 3MPTA 4U5JA 4GV1A 5BVFA 4YUQA 1Q61A 4YJUA 5LARA 4EOQA 5HOAA 2X39A 4J7BA 3UOJA 4YHTA 4QMQA 4FT0A 3BE2A 3LJ2A 4CV8A 5LQFA 3R8ZA 3GP0A 4JS8A 2OJ9A 3CE3A 4OTHA 5IH4A 3C51A 4OTPA 4GEOA 3PA3A 4QQ5A 2J0JA 3DNEA 3HA8A 2W1HA 4Y85A 1ZWSA 3FDNA
chains in the Genus database with same CATH superfamily
2J7TA 5DR2A 5KNJA 4IB3A 3ZO4A 4BDEA 4JBOA 4JG7A 1L8TA 2CDZA 1OKYA 2VX0A 3EN4A 4AA4A 4FEUA 3NLBA 1WVYA 3UP2A 4TN6A 4C4HA 4FSZA 4DG0E 4TL0A 4TZRA 3UYTA 3Q04A 5EKNA 3W0SA 3GC9A 4QMYA 4CFXA 5D7VA 4NUSA 3OF0A 3PXQA 4NIFA 5D12A 4BDBA 3A4PA 3WF8A 4I3ZA 4DGMA 5H9BA 4QP4A 3LOKA 3KRLA 4FKSA 3QD4A 1JOWB 2C6TA 2VO7A 1TVOA 3QCQA 2VTAA 3ZU7A 5GIOE 2PVNA 2VTIA 4QMLA 5ANJA 2PMLX 5JGAA 4IIRA 4NEUA 2WOUA 5HG9A 2PE2A 4E6QA 3K2LA 4IC8A 4J95A 4CZUA 1YHSA 5CQUA 1Z9XA 4FKRA 1H4LA 1OGUA 4RFYA 3UODA 2XK9A 4BCGA 2VTRA 3HL7A 5BUIA 5M09A 4IDTA 3TIZA 3U6IA 5JFWA 2GDOA 3NYXA 4TT7A 4O7NA 5AA8A 3KF4A 3S0OA 1OIRA 3EZRA 3VAPA 2H6DA 3VBYA 4GK2A 4O81A 2WGJA 3U54A 2XB7A 3QUPA 4IFGA 4UZDA 4BFMA 4PP9A 5CF5A 4K2RA 5HCYA 4BDFA 1XH4A 4FEQA 4IB0A 3PRIA 4GT5A 3VN9A 3FV8A 3GT8A 1FVTA 3ANRA 4UMTA 4KB8A 2BIKB 2WMSA 2WNTA 4H05A 2B7AA 3D7TB 3BBTB 3PVUA 1PW2A 4YC3A 4PPCA 4N4SA 5TF9A 3NYOA 4FT5A 4GK3A 4IZYA 4G31A 4FTNA 4NW6A 3TTJA 3AD5A 4F7JA 4FR4A 4FKLA 4DEGA 3PIYA 4IAKA 4JVGA 3AT4A 4FSTA 3ZBFA 5DMZA 3TZ7A 5ICPA 4MF0A 2QU6A 2V7OA 3ZEPA 3DTWA 3DXPA 2R3RA 1H00A 3GB2A 1JSUA 1VYWA 3JYAA 1JLUE 3FPMA 2C1BA 3CJFA 3I7CA 4GKHA 2F57A 2IW6A 3ATSA 1YWNA 5JSMA 4AW5A 2G01A 3OTUA 3H9FA 3C0IA 3C5UA 4FT3A 4YTHA 3HAMA 4IQ6A 5E8VA 3NWWA 3LCSA 2W4OA 4H1JA 4H36A 5IKWA 2FSMX 1BLXA 4EH3A 3HDNA 4PX6A 4I0SA 3NFGB 1Q3DA 3U9CA 2YCQA 5EHLA 3ORTA 5IA4A 2FH9A 3PP0A 4DEBA 3PPZA 4O4CA 4TWCA 5CI7A 4M15A 5GJGA 5GZAA 2XIXA 4C4EA 5IZFA 2GTNA 3PSDA 2X9EA 2ITZA 3UVPA 3GU5A 1XBBA 4QMUA 3FMEA 3MESA 4X6RA 1UWJA 3ZBXA 3EYGA 5ETFA 3HRCA 5AUXA 3BHUA 4DC2A 3FMMA 4C4JA 4EHZA 5JFXA 5J9YA 4RX8A 4FKTA 3PXYA 2UZDA 2ZFYA 4HVHA 1DI9A 5EFQA 3TNIA 1TZDA 4EK6A 3O96A 4BTFA 4QMOA 5H8GA 2J0IA 4UMQA 1SMHA 5E91A 5K0XA 2ACXA 3UOHA 2LAVA 1SZMA 4FSQA 4RIXA 5DT4A 3BV2A 3SRVB 4GKIA 4ZEGA 5B0XA 4PNKA 1H1RA 4L6QA 1M52A 1PXNA 2XUUA 4JRVA 2EB3A 3GCQA 3D2KA 3LE6A 4JBQA 4LUEA 4LV7A 2HW7A 3QGWA 4AFJA 4G17A 2WMQA 2GU8A 4I94A 5I9ZA 4LG4A 3ORPA 2JKQA 4JQEA 5LMBA 2O0UA 3C1XA 3KA0A 2ZM4A 4L9IA 4M69B 4D4VA 2JBPA 2C0OA 2OU7A 2EXEA 1PMEA 3DOGA 4QD6A 5CQWA 4ZTQA 5AR7A 4ZXTA 3LQ5A 3UZPA 3WF7A 2YA9A 4O22A 2GS6A 3VF9A 3LMGA 5CX9A 5IEYA 3FY0A 3CKXA 4JOAA 5DRDA 2ZJWA 5AR8A 3R9OA 4JNWA 5ETAA 2B52A 2JITA 2HZIA 2DWBA 2JDVA 2UZWE 3UOKA 4JRNA 4RLKA 5DEYA 3GXLA 1H07A 3R1SA 3R0TA 3JVRA 1W2DA 5L8JA 3BL9A 3NYNA 4YBJA 1R0EA 2BUJA 3FI4A 2R3GA 2DS1A 3PXKA 4HYHA 5CNOA 1YRPA 2OXDA 3OCTA 5AAGA 4B6LA 3KRRA 3VBVA 5BQ0A 1REJA 2YM7A 4I20A 1GIIA 3BE9A 4XV3A 2PVHA 5HE1A 3EWHA 1FGIA 4XP3A 2YWPA 2UW5A 3Q6UA 3WBLA 3HVCA 4RFZA 3BX5A 4IHPA 2JDRA 3II5A 3MJ1A 4QP2A 5FG8A 4E6CA 3QTIA 5HD4A 3FHIA 1A48A 4L43A 4NTTA 4QTEA 1HCLA 3OBJA 4KKGA 4UXQA 2ONLC 2QHMA 3A4OX 3ANQA 3QLGA 2X7GA 4XV2A 3MYGA 3EN9A 2WD1A 3OWJA 4WKQA 4RQVA 4IB5A 3ZZWA 3EQFA 4EQMA 4AZSA 4Z9LA 1PJKA 1T45A 2YJRA 3LXPA 4KIOA 1PXIA 2X4FA 3L9MA 3R7IA 5E8TA 2GHGA 3PWDA 2REIA 1QL6A 4D2WA 4CMTA 1PXOA 1Q3WA 2BFYA 2WB8A 2YDIA 1Q8TA 2VTSA 4BDCA 3TJDA 3ROYA 3A7HA 2R3OA 3ID6C 3CTHA 4ZTHA 2XYUA 4MQ1A 4ENYA 4EOOA 4WD5A 2O8YA 4ASZA 2O64A 3E8CA 4MH7A 2UZLA 3GI3A 2C30A 3F3TA 3CD3A 3E88A 3U51A 5ANOA 2FUMA 4AG8A 1Q4LA 3ZOSA 1FMKA 4BR3A 2ZM1A 4I5MA 2R4BA 4GFGA 4IVCA 4C36A 1UNGA 2BVAA 1OBGA 1V0OA 3WIKA 5IMEA 3NUYA 3EQRA 4IH8A 2DUVA 2XKFA 5DA3A 5F20A 5HBHA 1IAJA 5EYCA 1GZ8A 2W7XA 1P5EA 2LGCA 3BZ3A 4EK8A 3MFSA 4Z3VA 4DFUA 5EYDA 4FKQA 4A4LA 5AJQA 4KAOA 1JBPE 1M7QA 4WUAA 5M53A 4MXZA 5AR3A 1UU3A 4N6ZA 4D28A 4M0ZA 5J5SA 3C9WA 2YDKA 2O65A 1E9HA 2R3PA 3OWLA 3QLFA 4MYGA 5CY3A 2QURA 2YCSA 2HIWA 4F7NA 3TNQB 2Z7LA 3IW5A 3DA6A 1XBCA 5FWKK 5J1VA 1DI8A 3MVHA 5AV4A 4YLKA 4NW5A 2H96A 1WVWA 3LAUA 5EHYA 3ZONA 5K9IA 3HP2A 4FMQA 3O17A 2QQ7A 2B4SB 2WTJA 5BMSA 5DT3A 1JSVA 4XUFA 3RNYA 2F49A 2XIYA 5AP4A 3AD4A 4EC9A 5HNBA 3SX9A 4R6VA 2VO0A 5JRQA 4ZY6A 4M84A 4UY9A 4IVBA 2Z7SA 4KSPA 3Q4CA 1JNKA 5ACKA 4HVGA 4E5AX 2Z02A 4U3ZA 5T68A 4L01A 4NKAA 4YLJA 4O0YA 3PRFA 4ZTLA 2QCSA 5G6VA 4YLLA 4BCIA 2SRCA 4DEIA 3A99A 4EZ3A 2YN8A 4FA2A 5CENA 3L9PA 3QTRA 2NO3A 3RZFA 3R8VA 4AN2A 5IA2A 2BAQA 3O51A 4FNYA 3D5WA 2XNPA 5EI6A 1ZOHA 3R7VA 4D4SA 3CXWA 3FMJA 3AC8A 5DWRA 3I4BA 4G3DA 3R9RA 2VTHA 2F2UA 4NTSA 1NT2A 4BZOA 3W55A 5AUYA 1R39A 1PXKA 3NGAA 5TOZA 5FTQA 3RWPA 4JT3A 4D2PA 4DHJA 2QR8A 2WEVA 5BMMA 1KE6A 2YM6A 4XRJA 3IS5A 4WG4A 4HVIA 1YWVA 5JMSA 4EOMA 1IRKA 4ACDA 4ZLYA 3TMOA 1STCE 3ENMA 3C4CA 2BRBA 3QTXA 3T9TA 2VTQA 4MBLA 4C37A 3FI3A 1JKTA 3IPHA 1J7IA 3CKWA 4IJPA 3FLWA 4FT9A 3OROA 3DK3A 4PL5A 2R3JA 3IGGA 3PJ8A 5GNKA 5CYIA 4C2WA 5LMAA 5E8SA 3FWQA 2Y0AA 3LFFA 3QUDA 4I4FA 3ERKA 4PDSA 3SXRA 3UIBA 3MH0A 3OY1A 2UW6A 1BI7A 2VGOA 4YHFA 5HCXA 4YPDA 4CQGA 3EB0A 1XH5A 2XM8A 3R1NA 5FXSA 4GYGA 3CJGA 5CWZA 3O5AA 3FLNC 2Y4IC 1V0PA 4WUNA 3MDYA 2JGZA 3VS6A 3EQPA 4ANSA 3ET7A 3FMKA 3FE3A 1Y6AA 2UW8A 4C34A 1YWRA 3P0MA 3TKIA 3ZLSA 5AV1A 3MY1A 4TYEA 4F0FA 1SVHA 1Q41A 5AP1A 2VNYA 4EONA 3UIXA 1H25A 2FA2A 2BDWA 3VNTA 3MI9A 3EFJA 4RWLA 3R01A 4FL3A 1JPAA 4MEDA 4PL4A 2XIRA 3PIXA 3RAWA 4A9RA 1FMOE 2UZOA 4E6DA 2XS0A 3GCSA 4I6HA 3DGKA 5HZNA 3IDBA 3P7AA 2NP8A 3P79A 4BI1A 3FI8A 2XKDA 3GU7A 4KWPA 3EQCA 4WNMA 5CU4A 1FOTA 3KFAA 4U40A 3L9LA 2C68A 5AIKA 4RA5A 4GYIA 5ANIA 3BV3A 3ZHPC 3ZFMA 4YTCA 2E9UA 3LFCA 3WF6A 1T46A 3NPCA 3U6JA 3ZZEA 2HZ4A 3Q2JA 3F66A 3A62A 5IPJA 3NUUA 4BCQA 2J51A 2CGVA 4XX9A 2CN5A 1G8SA 4F9YA 4H3QA 5C4KA 3V5WA 3ZRMA 3ZLYA 1OM1A 2FB8A 2OJJA 2NYAA 3UC3A 2W4JA 4J71A 4BN1A 2CPKE 4FIFA 4RWIA 2PVLA 4EH8A 5IQFA 2YM8A 1RW8A 4EOIA 4CG9A 3QF9A 4O6EA 4R78A 5DGZA 3LM5A 5I0BA 3FMNA 3QQUA 5CAVA 4FTMA 2ITQA 3R1YA 5I9YA 1L3RE 4D1ZA 2IVSA 2WMBA 4FV8A 3TI1A 4G3GA 3QRIA 4RVMA 1O9UA 2WQBA 3DBCA 4S34A 1UWHA 4F9BA 5AUTA 3FSKA 3HGKA 5CU3A 3GENA 3B2TA 4I4EA 4R7IA 2PMNX 3BWFA 1KE9A 4QOXA 4X3FA 2WTWA 4G16A 4MNFA 4OTGA 4RVTA 2F2CB 1OITA 4EH7A 4FVRA 4JQ8A 3DLZA 5L2WA 1YOLA 4HPTE 4GUBA 3RAKA 3U4WA 5DOSA 1PXPA 4YC6A 4IAYA 2WMWA 5EDRA 4M97A 3OVVA 3F9NA 3ORNA 4R1VA 4YZ9A 3WZUA 4Y83A 5A9UA 3FKNA 4J1RA 5CXZA 2OXYA 5JGBA 3E8DA 5LVMA 4CG8A 4IWOA 1GZKA 1Y6BA 4XP2A 5HLNA 5HESA 4A06A 3VQHA 5L6OA 4R7BA 3L8SA 2JIVA 3Q5IA 3BL7A 5E90A 5CSWA 4IWDA 2CGWA 3QZGA 2JKKA 4UWYA 3WZKA 4FTUA 4MXYA 3DAJA 3RKBA 4BDJA 5BNJA 3BGQA 4MBJA 1SNXA 5CF4A 5LWNA 3P7CA 3JR1A 4L67A 4OGRA 5D9HA 3QA0A 4AT3A 3KB7A 1UA2A 4K6ZA 4G3EA 4PDOA 3DV3A 4W9XA 4CTBA 2B9IA 4ALVA 3LCOA 2UW4A 2IO6A 2YITA 4FTJA 4HGEA 2HCKA 4ITIA 4A9SA 4MK0A 3WILA 1M7NA 2OH0E 4IX5A 2RG6A 3VONA 4BI2A 2IWIA 4YSMA 1IA9A 3D94A 3UDZA 3PDTA 3MJ2A 3DXQA 5IQDA 4QTCA 5D10A 4QP3A 4F1OA 1H26A 3HLLA 3IW4A 4CKIA 2WQOA 5CXHA 4AOTA 3QTUA 3QQGA 2BZHB 3H30A 4U79A 4WG3A 3RAIA 1H1WA 1KWPA 3SGCA 4PPAA 3HEGA 3S4QA 5BV3A 3IGOA 2R3IA 3OCBA 4QYYA 3KK8A 4X2JA 1APME 2I0HA 2WMRA 5F95A 4A9UA 3U4UA 4C2VA 2HWPA 3A7IA 5EDPA 1ZOGA 4F70A 3I5NA 4OTIA 2CNUA 3TV6A 5LMKA 1CMKE 4QO9A 3THBA 3A7GA 4TWNA 3VQUA 4QEBA 4RC3A 4BCNA 3LLAA 4FKGA 3KXMA 2F7EE 1PXMA 5FGKA 2R64A 3ORXA 3R30A 4WNKA 1YVJA 4Q5HA 2OZAB 1G5SA 4FKIA 4FV3A 3G0EA 3D7ZA 2BZKB 5ETIA 3KVWA 2XAMA 2BCJA 3ENHA 2ERZE 3F2AA 2C6MA 4XP0A 5KBRA 4CV9A 4O4BB 4L3PA 3UC4A 4IZ5A 5C1QB 4FTQA 4HNIA 4AE6A 3G90X 3KCKA 3LXNA 5KKRC 3SVVA 5FUTA 3V8SA 3GVUA 5M44A 4A9YA 4XOYA 3MVJA 4HGLA 4L8MA 1E1XA 4A9TA 1P4OA 4B9DA 1PHKA 3DJ5A 4ZMEA 1WAKA 4ERKA 1G3NA 3NNVA 5HG7A 5CS6A 5IQHA 2W9ZB 2R3MA 3EN7A 4A4XA 3IONA 3KRWA 5HLWA 3BKBA 1OL6A 2HENA 4EQCA 2JLDA 4ZOGA 3VC4A 4M3QA 2A0CX 2JKOA 3ELJA 3FXWA 4FYNA 1P4FA 1Q8YA 2WTKC 4FVQA 4FZDB 4PWNA 3RGFA 5TR6A 3CGFA 3S3IA 3OC1A 3CIKA 1EH4A 3W32A 3TV4A 4CNHA 2GS2A 3VS3A 2ZV8A 3QALE 4FOBA 1A06A 4JAIA 4DEEA 5HO7A 2R0IA 4K0YA 4CKRA 4GRBA 5AEPA 5DI1A 2C1AA 1WBWA 2VX3A 1BUHA 3DU8A 3EHAA 2X7FA 4FC0A 4J52A 4KNBA 4MHAA 4OW8A 3SOCA 4OTQA 5M4IA 4WRSA 5HEZA 4AW2A 2QLQA 4JIAA 4UBAA 4DG2E 5BVEA 2JC6A 4QYGA 1Y57A 5CSXA 3NUNA 3SQQA 3D83A 3WI6A 3WIGA 2RIOA 4BI0A 5L2TA 4K8AA 3EYHA 1ZYSA 2WIPA 2DQ7X 3TXOA 5TO8A 3ALNA 4C3RA 3Q9ZA 4EYJA 1OMWA 4S2ZA 3KGAA 3GUBA 1UVRA 5BYZA 5IUGA 5J5TA 3QTZA 2CN8A 1KSWA 3H3CA 4CYIA 4GG7A 4ANLA 3IOKA 3ZCLA 3P23A 2WZJA 4E1ZA 3UDTA 2UW3A 4YZDA 2BMCA 4ZSAA 4AZWA 4EH6A 4QMVA 5DH3A 4M66A 3UZRA 3S1HA 1F5QA 3AMBA 3A7JA 3R00A 4RMZA 2XANA 3RHXA 4GUEA 3DLSA 5BVWA 5HNGA 3EN5A 1IASA 2YABA 4V0GA 2F9GA 1Q8ZA 2VNWA 1Q97A 4YBKA 3SXSA 5CF8A 2RF9A 1U54B 2UZTA 5B2LA 1YOJA 4M14A 2QONA 4AXCA 4S33A 1M2PA 2P3GX 2B53A 4D2SA 5L8KA 3E8EA 3F5UA 4D55A 3C7QA 2CGXA 4FZFB 4IM0A 3K5VA 3KK9A 4F0IA 2RGPA 4QDVA 2BDFA 4L45A 3N4UA 4RSSA 3QX2A 3A61A 3DY7A 4K9YA 2F4JA 3MH3A 3UBDA 4MF1A 3QRJA 1BL6A 2IJMA 2RFDA 5KKRB 5C03A 3COHA 4IM3A 3W1FA 4UWBA 5I4NA 4GCJA 3T3VA 1XKKA 4DTKA 3PSCA 4X2KA 2G2FA 4XH6A 4P7EA 4YZNA 4EI4A 4EK5A 5L2IA 2PVRA 1YXVA 4FZAB 2JBOA 2XRWA 3O0GA 1URWA 5J7BA 3F7WA 2QG7A 4AXDA 3MPMA 3POZA 4F65A 3UO4A 1WMKA 3PA4A 3QD3A 3QC4A 4BIDA 2ESMA 4QYEA 5B2KA 5JFVA 2WTKB 3NSZA 3VRYA 2JDTA 3IW7A 4BZNA 4F1TA 4FKOA 4O0RA 4DFZE 4BWKA 3EQDA 5AAEA 3PY3A 4D2VA 4FG9A 2AC5A 4JJRA 4RJ6A 4F7LA 3C13A 4QMWA 2XK6A 3Q52A 5B2MA 3K3JA 3W0PA 3IKAA 4HYIA 4Q9SA 3RJCA 3PUPA 4E20A 3MGYA 4RWKA 5DT0A 3ZDUA 1TKIA 4ANQA 1ZRZA 3KEXA 2PE0A 1KOAA 2NPQA 5KZIA 3TNWA 4DCAA 4MD7E 4EHVA 2PTKA 2ZV9A 4GU9A 5M55A 1ZYDA 2VTMA 4QYFA 4ZTSA 2V22A 2C3LA 4PV0A 4BIEA 4ZS4A 4LOOA 2YEXA 2BTRA 2FSLX 3NW7A 3M2WA 3NYVA 4MXOA 2GQRA 3N4VA 1W98A 4PMTA 5GINE 2F7XE 2XK8A 2VO3A 4KBCA 3HYHA 3UIUA 5HHWA 3HMPA 4RBLA 4RIWB 3GOKA 3H9OA 4Q2AA 3Q9YA 4F08A 5CEIA 5CAOA 4N0SA 4CGAA 3V8TA 3AGMA 5JZNA 2C6OA 2VWVA 3DBEA 2XK3A 4USDA 5BVDA 3R71A 4QPSA 4RIYA 3B8QA 3MFTA 1QPDA 3V5JA 5C9CA 2X81A 4AP7A 5M4UA 4G2FA 3NUXA 3Q5ZA 3V6RA 1ZYLA 3PG3A 4CLIA 4K77A 3VUDA 2XARA 4TPTA 3KY2A 3Q32A 1JKLA 4TYHA 5KMLA 4L52A 4JMQA 2X2LA 3C50A 5AUUA 3OMVA 3BLAA 4KRDA 4AS0A 3GFWA 5E1EA 3DTCA 4O0TA 4RZVA 1RQQA 3FI2A 2RKUA 2A2AA 4LV8A 5IH6A 4YZCA 3FYJX 4MD9E 3GBZA 2PULA 2J4ZA 4TKSA 4B4LA 3HAVA 3F6XA 4IXPA 4XEYA 3V8WA 4ERWA 5A4CA 5EM5A 2PHKA 5K5XA 3SLSA 3U9NA 5IDNA 1W2FA 2W1FA 3N51A 5AR2A 4FEWA 3RP9A 4HCVA 3DB6A 1GY3A 2GNHA 4MWIA 4EUTA 3KIOC 2UV2A 4FV2A 4G6NA 3EIDA 3PPJA 3SXFA 4USEA 3BHYA 4C4FA 2UW0A 4I6FA 3VVHA 3CCNA 3L1SA 2XNBA 2X0GA 5CALA 3EQHA 4PL3A 4ORKA 2C0TA 1W2CA 1XBAA 5DPVA 1H1PA 3DDPA 4HW7A 3O71A 4Y46A 4MNEA 4EOSA 1BI8A 2A4LA 4E6AA 2GQGA 2YIRA 4J96A 4ZY4A 4FUXA 4WT6A 1RJBA 3OD6X 3D14A 5GJFA 5CZHA 4GFOA 3M1SA 5FBNC 5A4TA 5KMNA 3TUDA 1YOMA 2VN9A 4KBKA 4EH4A 3DFCB 4ZLZA 2XJ1A 3VULA 3EMGA 5BYYA 4BICA 3R1QA 4CFNA 1TQMA 2PVYA 3MVMA 4EL9A 1OECA 2J9MA 4OBPA 5HVJA 3C4EA 3R04A 3VUIA 2C5XA 3PYYA 2P33A 3MPAA 4V05A 3OOGA 5IQAA 4AW1A 4TNDA 4AQKA 5FXRA 2X6EA 5CASA 3OCGA 4WBBB 4DHZA 2OWBA 4QDEA 4AW0A 2WTCA 2V55A 4DTBA 2JAVA 3F5XA 4G6LA 4KABA 5LVPA 4FYOA 1Q5KA 4AT5A 4TYIA 1Z57A 2HAKA 2UZBA 4OUCA 1W82A 4RJ5A 4ZIMA 3UQCA 4I22A 4WSYA 4XG4A 1W83A 3NEWA 3BWJA 4NIFB 2I6LA 5DFPA 3UPXA 2A98A 2HK5A 4FSRA 4DGOA 4EC8A 1OIYA 2HYYA 2XZSA 5KZ0A 2BHEA 2E9PA 4YURA 3KREA 3EKKA 3GQIA 1SYKA 4ID7A 4Y72A 5I3RA 2JD5A 3OEZA 2QOBA 2W0JA 5AP3A 2QO7A 5AV0A 5HTBA 4ZY5A 4IX3A 4O2PA 4HVSA 1CKJA 1M14A 1ATPE 3PJ1A 5CVHA 3A60A 4EJNA 3ORZA 2BZIB 5M06A 4U0IA 3MY5A 2YAAA 1W7HA 3QU0A 2FVDA 5HIDA 2JEDA 2R0UA 1OIQA 5A46A 3TIYA 5TE0A 2WKMA 5KE0A 2YCRA 4IAZA 3KRJA 3FQEA 3IK3A 4MBIA 1R3CA 4L46A 5FD2A 5HD7A 4B0GA 5IF1A 4TXCA 3FL4A 3D4QA 4PMPA 1WZYA 2JFLA 2GCDA 2QKWB 2UZUE 3ORMA 4C33A 3Q9WA 4G9CA 1JKSA 5EYMA 1S9IA 4BCOA 3TDWA 3DAKA 4RT7A 5CEKA 2NNWB 2YM3A 4DFLA 3QRKA 4MTAA 2A19B 4G5PA 4WG5A 4YJQA 2WAJA 5JRSA 4F6UA 4YTIA 1FGKA 2QU5A 3NUAA 2PYWA 2Z7RA 3LJ0A 3R7YA 5CTPA 3GC7A 4FV6A 3MA6A 5HCZA 3CEKA 4ENXA 4XG3A 3ZSIA 1VJYA 2UVYA 3E5AA 4GT4A 2XKEA 4CD0A 3QKLA 4O27B 3UQGA 4AGDA 5E92A 3WE4A 1PXLA 2CHLA 3ITZA 4TYHB 5BUEA 3A7FA 2ZAZA 2J90A 2R7IA 3D5UA 3PG1A 3AT3A 2EU9A 3COMA 3R2YA 4EEVA 4XS2A 4GU6A 4JIKA 4JG8A 4LOQA 4D2RA 2GNIA 4GIIA 4MXAA 5EW3A 3TL8A 1UKHA 3PXFA 4ZP5A 5E7RA 2PZRA 1O6KA 4HYUA 4DEDA 2YACA 4O7ZA 4O7YA 3H0YA 3QKKA 4MX9A 4C57A 2IPXA 3W0NA 2XBAA 3FJQE 3Q3BA 4FK3A 3U87A 4AA0A 4QRCA 5AIRA 3E3PA 2R5TA 3DZQA 3RBWA 2E9VA 5EYKA 2WHBA 3EFLA 3FQHA 1GOLA 3LFQA 3ZO2A 4QMNA 4EZ7A 4EWQA 3PUFC 4D0XA 3G9NA 4ACCA 4NK9A 3AQVA 3FY2A 2X2KA 3QYWA 4NZWB 5J7HA 4JQ7A 4Z55A 4YJOA 2EVAA 3C4ZA 3FL5A 3C4XA 3ROCA 5CSPA 4MUQA 4YO4A 3DKFA 4E3CA 4FVPA 5DRBA 2ZDTA 1M17A 2XNOA 3F3VA 1BX6A 1G8JA 2BILB 3QBNA 3F2RA 4XBRA 2QOCA 2GTMA 4FL1A 3DJ7A 4CLJA 3NNXA 3MY0A 2ZVAA 3QKMA 4PTCA 4YNEA 5M56A 2R2PA 4L42A 2HELA 2P2HA 3TNHA 4FTLA 2R3NA 5CLPA 5G1XA 4II5A 2XNGA 4ZZNA 1BKXA 2IW9A 3QTQA 3R7GA 5IA1A 2E9NA 2HW6A 3R02A 4ITJA 3CC6A 1JQHA 4DA5A 4P2KA 1OL7A 5AAFA 1ZAOA 4RZWA 4RIXB 4C59A 1VR2A 2P0CA 3DT1A 4O86A 3H9RA 1XH9A 2X0OA 3UQFA 4RPVA 4ONAA 2HXLA 4J98A 2XJ0A 3RI1A 2GNGA 2WMUA 2XK4A 4ARKA 2BIYA 4BZDA 4O4DA 1PY5A 4F9CA 4FTCA 3SW7A 3DFAA 4NYEA 2C69A 1UU7A 5IQCA 2V5QA 4FSUA 5GZ8A 3AC1A 3R8UA 1YXUA 4PUZA 4QMXA 2XBJA 4KIQA 5F4NA 3P7BA 4CT2A 5LVNA 1YXTA 2R9SA 4EH2A 5HTCA 4FUYA 5AX9A 4ASDA 4G3CA 5AP2A 4DINA 4PMSA 4BY9E 2B9HA 5C4LA 4PNIA 2BDJA 3DJ6A 2VV9A 3UYSA 3G15A 2I0EA 1G8KA 1PYEA 5ACBC 3UTOA 4QYHA 5AR5A 4X3JA 4BWXA 4F6SA 1YDTE 4FBXA 4O4FA 4FV5A 4CFUA 4FG8A 3CQWA 1J3HA 2QI8A 3I60A 4UALA 2BRNA 4OBQA 2VX1A 4O96A 4BCHA 3RCDA 4RIOA 3KXNA 1NW1A 3B2WA 2W06A 3RPRA 1AQ1A 3VUGA 3E7VA 3T3UA 3FSFA 3OHTA 4AQCA 2W1EA 3QXPA 4BB4A 3MIAA 4BDIA 4L7FA 3RHKA 4GG5A 3OCSA 4R7HA 4Y5QA 4CXAA 3DBQA 3Q2MA 3K3IA 4AGCA 4NM3A 4XG8A 4BF2A 4KIKA 3NVMB 5IU2A 3ORKA 4YGAA 3EOCA 4ZZOA 3QL8A 5K0KA 1G8AA 5DLSA 1NA7A 1NY3A 2HY0A 4WNOA 4B7TA 3MB6A 4KA3A 4JL9A 3G2FA 4IW0A 3ZSHA 3MBLA 2OO8X 3HMIA 3E3BX 4ACHA 2G2HA 2F7ZE 5BYLA 2C5NA 2VTTA 4QQCA 5DHJA 5FBOA 4ANBA 4FG7A 1SM2A 4NJ3A 4UEUA 3UG2A 3F3ZA 3GCUA 4BVUA 4EH9A 3QFVA 1PRYA 3QQLA 2GPHA 2QNJA 2AEGA 3PE1A 3O2MA 3Q9XA 4DAWA 4FIHA 4BRXA 3VJOA 5HVKA 5CEMA 2W4KA 2JIIA 3CPCA 5C8MA 5J9LA 1Y91A 1OKWA 4J99A 4BBEA 1YI4A 5FM2A 2WMVA 3RTPA 1OL1A 3CP9A 5FRIA 4LMNA 1YQJA 2ZDU<