4ZY4A

Crystal structure of p21 activated kinase 1 in complex with an inhibitor compound 4
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
293
structure length
288
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Structure-Guided Design of Group I Selective p21-Activated Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 288
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zy4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zy4A01
1DM2A 3A61A 4IE9A 1TKIA 3WYYA 2BKKA 4A4LA 2Z02A 3QTRA 2UZEA 3UP7A 4EH4A 3HUCA 4JS8A 3D2IA 5C4LA 4O0WA 3MH2A 4OUCA 3CD8A 4YJTA 1FPUA 4FZ7A 2QOCA 3FLNC 2C6KA 3KK9A 3VJNA 3AMAA 1G3NA 4NK9A 4RC4A 3ROCA 3L8SA 3O8PA 4KINA 5A46A 5BVDA 1OKZA 2CDZA 3F7ZA 2UVYA 4QMQA 2CSNA 2W05A 5M06A 2QNJA 4C3RA 3A7JA 4TWPA 3R7GA 4TPTA 2QG7A 4XS2A 4M12A 3W55A 2NPQA 3KRWA 3KRXA 3NZ0A 4XV9A 3UOJA 3MYGA 3VRZA 4B4LA 5FRIA 4USEA 2BTRA 4ANLA 4CV9A 5TE0A 4R8QA 4BCIA 2PZRA 4J95A 4JG6A 4G2FA 3ZHPC 1B38A 2Y0AA 2YWVA 4ZSLA 5DE2A 4AE6A 4BCGA 2PWLA 4FG7A 3LM5A 2B54A 4NH1A 4QP3A 1PJKA 3QTWA 3R8MA 4O82A 5ETCA 2GTNA 3W2RA 4TTHB 2XEYA 4Y83A 1YI3A 2VTAA 4P4CA 5HCXA 3VBTA 3ZXTA 3KGAA 2ONLC 4BCKA 3CPBA 2ZV7A 4G5JA 4WSYA 4BBEA 4BCPA 1J7LA 2WMRA 3A7GA 3ZEPA 5DEYA 5HLNA 1JWHA 2WTJA 4MHAA 1PF8A 2VTNA 2GHLA 2OIDA 2VWVA 3G33A 3N51A 2OFUA 2VUWA 3PXKA 4G31A 3UYTA 4F1OA 5J9YA 1H1QA 3ORLA 4ZJJA 4DITA 3QA0A 4XG9A 4IB5A 3TI1A 1WAKA 3VF8A 4XRLA 5AR3A 4YC8A 3PUPA 3SOAA 1S9JA 4UV0A 2REIA 1STCE 3Q5IA 3PVGA 1OBDA 3FZSA 5HIEA 4G6OA 5DH3A 4F4PA 4D28A 1V0PA 5JKGA 3OWJA 1H4LA 5EFQA 5LMAA 2ETRA 2W17A 5HTIA 4QQ5A 4FSTA 3AD4A 2DWBA 5L2TA 4Y8DA 1KE7A 3MTFA 5L2SA 1BUHA 4H1MA 4S34A 3E88A 3OCSA 3DTWA 5DHJA 4PTGA 3ZLXA 1GZNA 1OL6A 3H4JA 3DKCA 5A4LA 1REKA 2XNGA 5M57A 5JZJA 2WGJA 2XNBA 1FOTA 2J7TA 1QPJA 3PPKA 3A4PA 3F3VA 5I0BA 2GU8A 3FMNA 3TL8A 4LG4A 1PXPA 5F9EA 1E9HA 5M4UA 5I9WA 3AG9A 4EHEA 4K18A 4ZMEA 2JDRA 2C5YA 2HAKA 3MA3A 4EOIA 3NIEA 5J9ZA 3AGMA 4FV3A 5F4NA 3D5UA 3TUDA 3FY0A 1YXUA 5AP6A 2JDOA 2RIOA 3SX9A 3O96A 2JAMA 3DDQA 5HHWA 4FKUA 4GFMA 4JXFA 4BDHA 3O0GA 1A9UA 3VUKA 5KBQA 2UZWE 3DKGA 3N4TA 1UNLA 3I7BA 3E3BX 4CD0A 4L3JA 5AEPA 1YDTE 3FPMA 5E9EA 3EQPA 4O84A 2NRUA 2BRBA 1Y8GA 2PTKA 4WNOA 3SDJA 3P0MA 4FR4A 5CEIA 4YGAA 2X4ZA 4L52A 3KXXA 4RMZA 2X9EA 1BMKA 1WMKA 5HLWA 4ZY6A 1Q41A 2WTDA 3L9LA 4IZ7A 2QHMA 4KABA 1KE5A 2BTSA 2IVTA 4H3BA 4QMWA 2WMXA 2JBPA 3PZEA 3QAME 5EYKA 5KO1A 5GJDA 3RHKA 2VTPA 2JFMA 5AV4A 4YZDA 2PHKA 3RPRA 4ANQA 3WIKA 4WRGA 4TNBA 3VW6A 4XEYA 2YIRA 2OGVA 1JOWB 2H8HA 3BGZA 4HGSA 4PTEA 3UYSA 4DYMA 4BI2A 3D5WA 4C36A 5B7VA 4PPAA 2Z8CA 2CCHA 5AJQA 5L2WA 2JDTA 3MVJA 1NT2A 3BGPA 4KB8A 5HIDA 4ZLOA 1Q99A 1P2AA 3RNYA 4RIWB 2ETKA 3PWYA 4U3YA 5F20A 3UQFA 2CGWA 3C4EA 5G1XA 5HG7A 5JEBA 3GU4A 4YPDA 3Q53A 2ZV2A 4N0SA 3VS3A 4WBOA 2WMWA 3MVHA 4J8MA 4KBCA 3TEIA 3BU6A 3NVKI 2Z60A 3QTSA 4GSBA 5B2MA 2BRGA 3GI3A 3IW4A 4ZTRA 3WZUA 5BQ0A 3UVQA 3DXQA 3HMOA 3RM7A 5BUIA 2Y6OA 1QPCA 1J1BA 4CCUA 3EL7A 3PDTA 2C0OA 4OLIA 4R3CA 5EYMA 1B6CB 4MWIA 4FT3A 4QNYA 4XBRA 1UWHA 4M97A 1PMUA 2J6MA 2E9VA 4UX9A 2HXLA 4AA4A 1J91A 4RX8A 3JY0A 4EH7A 3LHJA 4BYIA 4GH2A 2I0YA 1AQ1A 2VTHA 4QMOA 2JKKA 2RG6A 1XWSA 3U4WA 4BI0A 2R3QA 3D94A 3QGWA 4ONAA 4MQ1A 4FTQA 4U5JA 4FZ6A 3ZZEA 4ZJVA 4UMQA 3ORTA 4BCMA 2ITZA 3KN5A 4M69A 4WHZA 3OG7A 2XUUA 3S4QA 2PUNA 3FLSA 3RAHA 5IA3A 2B9HA 2JIUA 2QOIA 4I41A 4C58A 2NNWB 4ASXA 3I6WA 4CRSA 1PXNA 5ANGA 4G3CA 1YRPA 1CSNA 4E1ZA 4E4MA 3QUEA 4G9RA 4DG0E 4CMOA 4EH9A 4EK8A 1GJOA 3IPHA 4D5HA 4O0RA 3VQHA 1YI6A 2CNQA 4BKYA 3LZBA 4NKSA 2H96A 2JDVA 2QOLA 2QODA 3Q60A 4EK3A 4KS8A 3O17A 4IAFA 3CQWA 4UALA 3WF5A 3COIA 4QTCA 4RBLA 5GJFA 2YIXA 5FLFA 2UW9A 3MWUA 4TYHA 1XBBA 1KOBA 2BVAA 4CG8A 3P4KA 4FKRA 2IW9A 4O0TA 3EQCA 1KUTA 3K2LA 4XLIA 2BPMA 4IX3A 5D9HA 3MB6A 4G16A 5CLPA 2YA9A 2BRHA 2W1DA 1KV2A 3UIBA 2UW3A 2JKQA 4ZEGA 3ZC6A 4BZNA 3ZO3A 5F94A 1OECA 2JKMA 3PPJA 4JBOA 4L44A 4QQJA 3JR1A 1DI9A 3F3UA 3V8SA 1I44A 3FLWA 2BHEA 4F65A 2UZBA 3RALA 3ORNA 4PDPA 2PL0A 4ANOA 5CAUA 2VWUA 3TXOA 4Y46A 4HJOA 3KXHA 2QOKA 4NIFA 4BDKA 4IAIA 4RZWA 3WF6A 3E87A 2W7XA 5E8UA 4UWBA 3ZO2A 2RFSA 1OB3A 3F3ZA 4FL1A 4O91A 4ALUA 4ZLYA 2QO2A 5BVFA 3CLYA 5EQPA 4EOKA 3EZRA 3Q9YA 5IMEA 5CEQA 3B2WA 5IA5A 4BCQA 3BYUA 2X7OA 5M53A 5KNJA 3MY5A 3FI2A 2VNYA 3KULA 3QX2A 4WNKA 4CFUA 2WQNA 3FZPA 2HCKA 3DZQA 3LFAA 3KF7A 3MY0A 3PJCA 4EJNA 1IG1A 2UZOA 4Q9SA 1JLUE 1OL2A 2X8EA 4UEUA 5AM6A 2PZIA 4DGMA 3GVUA 4K9YA 4XBUA 2LGCA 3LFDA 4UYNA 4L7FA 2OXXA 4PL3A 4EONA 5FEDA 5C8NA 3LQ5A 4GG5A 3I5ZA 4JIKA 4MYGA 2XK9A 4E5AX 3A99A 5LVPA 5JGBA 2W1ZA 3ORPA 4TW9A 5I9YA 3MH3A 2PULA 3R9NA 4F70A 5IUHA 2XKFA 4QP4A 3E62A 2XK7A 4RGJA 5JFWA 3LLAA 4JBPA 3VS0A 2H6DA 1FGKA 2CLQA 1E1VA 3QHRA 4IWPA 5IQDA 1PMNA 2QOQA 5BVNA 4F1TA 4HPTE 1MQ4A 2J0MB 5F95A 1BYGA 4RVTA 3FMHA 4V01A 4ALVA 3TNWA 2PZYA 3GBZA 4IC7A 2YITA 4D1ZA 3PSDA 4UXQA 4F6SA 2X2MA 3LFSA 3R7OA 4TNDA 4FNWA 2BALA 3HL7A 2UW4A 3KVWA 3QTXA 4RIYA 2J0LA 5FXSA 5HI2A 4RSSA 3RI1A 3OP5A 2EXCX 4KKEA 3Q4ZA 4BZDA 4G3EA 5EOBA 1OITA 3D5XA 2GFCA 3EH9A 4DEIA 3P7AA 3QC9A 1U59A 4KIKA 5DRBA 3UODA 3JPVA 5KZ0A 3F6XA 5EW9A 1WVWA 4K8AA 2PVJA 5EW8A 5HBEA 1SVGA 5CAPA 3HUBA 3Q2MA 4ZSGA 3ZFYA 4I1ZA 2ZVAA 5EM8A 4HNFA 3EQRA 3I0OA 4FTIA 3VHEA 4EOPA 3HKOA 3K3IA 3UIUA 4O1PA 4XYFA 5EHYA 2IZRA 2ITTA 3V5WA 2XM9A 3L8VA 2WTVA 2O5KA 3SRVA 2VNWA 2J5FA 1XO2B 5HQ0A 5CWZA 2GCDA 4FNXA 3F5XA 3POOA 2B53A 4J7BA 3E8NA 2ACXA 3OY1A 4YU2A 2C69A 3Q9ZA 4HVGA 5IH4A 2X39A 3DT1A 4LV5A 4EQCA 5CU0A 3DBCA 1PXKA 5AX9A 3B8QA 4FIIA 3KCKA 4DAWA 2X1NA 3GCPA 3AT2A 3BBWA 5FM2A 1PW2A 3BV3A 2YIYA 1RJBA 5EM5A 3W2SA 1J7UA 4NUSA 2W9ZB 3MGYA 5G6VA 4AGWA 4JLCA 1GIJA 4TYEA 5C26A 1H28A 2R3IA 3BYVA 3DA6A 1XKKA 1MRUA 1Z57A 3ANQA 4MCVA 4PNKA 2GNLA 5AWMA 3QF9A 2YM6A 4CCBA 3V6RA 4PMTA 4PMPA 4UMPA 1W83A 2EB3A 1JNKA 4I5HA 4NW6A 4MTAA 3FPQA 3R7IA 3UC4A 4J97A 4L45A 4WKQA 3BHVA 4RJ6A 4I5PA 3ACKA 2PUPA 3OMVA 2YAKA 4ACHA 5FXQA 1OKWA 3PY1A 1U5QA 3VUTA 3LLTA 2C6LA 2WMUA 3C51A 3PXZA 4YJVA 3RZFA 4BIEA 3T3VA 5LCKA 5JGDA 4DFXE 3COHA 4ZLZA 3D7TA 3MN3A 3ORMA 2ZV8A 4FKOA 5KE0A 3UG1A 5CAVA 3FXWA 4EOQA 3UZTA 1L3RE 1IA8A 3IW8A 4D4YA 3ORXA 4N70A 4IC8A 4IBMA 4ZSAA 4IDVA 3DK7A 4EQMA 4NCTA 4CNHA 3DK3A 4EHGA 4UZHA 4AA0A 1OPJA 3PJ2A 5E8XA 2BRMA 5AP7A 4C37A 2WPAA 3U55A 2IVVA 1MUOA 4FIHA 1HCKA 3EQFA 2IWIA 5CASA 4ZMFA 4YHFA 2WIPA 3VJOA 2WMTA 4TYJA 4OTQA 4C3FA 4CTCA 1XH4A 3DDPA 4QQCA 5CU6A 4FTLA 3GENA 5IZFA 3SQQA 3V5JA 4ACMA 2C6OA 4GYIA 2DQ7X 5B2LA 3DBEA 2P0CA 3VS7A 1H07A 5C9CA 3RWQA 4HVIA 5GNKA 4Q9ZA 4R3RA 2B9IA 3PY0A 2WOTA 1OL1A 4JT3A 3F2NA 3G2FA 4M3QA 4M15A 3FZTA 2OI4X 2J90A 3I81A 3WZDA 3DZOA 5CS6A 3JYAA 4ZP5A 5CQWA 2A1AB 4G6LA 4ERWA 4QPSA 3P9JA 2GDOA 2B1PA 3UIMA 1BI8A 2PVYA 3ALOA 3E93A 3ZRKA 5LMBA 1FVRA 3QKMA 5IF1A 1PXMA 4BTKA 3LFNA 4DGLC 3GFWA 2JC6A 3BQCA 3SG8A 3OEZA 4GCJA 3T3UA 4DCEA 3CEKA 1FMOE 3BBTB 2FVDA 4FSMA 4YP8A 3PVBA 4F08A 5IDNA 5L6OA 4GRBA 3NUAA 4KBKA 3QQHA 4GYGA 4HGEA 4XX9A 2XNEA 2UVXA 4DG3E 3F88A 5CSPA 1KE6A 3SD0A 3TWJA 2XYUA 4KAOA 4BC6A 1RQQA 3BEAA 4MEDA 3MESA 5AUVA 4JVGA 4FSWA 5KMKA 3QQJA 4BZOA 1Q3WA 2PK9A 3HECA 4FSRA 4H39A 3EZVA 4MX9A 4QYYA 4YSMA 2QLUA 2E9OA 1ZWSA 3GC7A 5EHLA 4DTKA 5CF5A 2XNNA 4YHJA 3W8LA 5DA3A 3B8RA 3OD6X 3HYHA 5CF4A 1A48A 3TNPC 3RCJA 5CU3A 4PRJA 3H30A 3VS4A 3FWQA 2RFEA 4C02A 5HNIX 3HZTA 3QD2B 3ZFMA 4HYUA 4I6HA 4FVRA 4I0RA 3FI3A 4JAJA 1XR1A 1YOJA 2R3JA 4AOJA 3TNQB 2EB2A 2R2PA 3AT4A 2QQ7A 2JGZA 2JLDA 2X7FA 3GCVA 4FF8A 3CTQA 4G9CA 3R04A 4CMUA 1KE8A 2JKOA 1M52A 4EK4A 1QMZA 4XG7A 2XNMA 4TN6A 2W1GA 3LJ0A 2OKRA 3EB0A 3MH0A 5AUYA 5J87A 5JSMA 4N57A 2WKMA 4BI1A 4QD6A 4ZS4A 3QC4A 3ZUVA 4CT1A 4CZTA 4ZIMA 2VO6A 3PG3A 3MFTA 3TIZA 4J52A 5FG8A 3VO3A 2UW6A 4GU6A 5TOZA 4AW2A 2EXMA 5C8KA 2VRXA 4W8EA 1Y91A 3FQSA 1MRVA 2BAJA 1B39A 1FVTA 2ITVA 2XIKA 3NAYA 3Q6UA 4O7TA 4RX9A 4GUEA 4DEGA 4F9AA 2ITOA 3NX8A 5EOLA 3NCZA 3PJ3A 4TZRA 3F5UA 1PY5A 1O6KA 2WB8A 3VVHA 4UMRA 2OXYA 2R3NA 3IO7A 4II5A 2F7ZE 5CF8A 1GZ8A 2GHGA 4L67A 3OXTA 1ZOEA 3HV4A 4RT7A 2ZB0A 3OW4A 5FBNC 4GKIA 3OHTA 3PSCA 3TDVA 4IMYA 5EK7A 1ZAOA 1UNGA 3R01A 4FTUA 4MXOA 4BDGA 1U46A 3M1SA 4XP2A 3UG2A 3V04A 3KFAA 4IM0A 3U8WA 5M56A 3EQGA 5HVJA 4HW7A 3UO5A 3ZFXA 4LI5A 4RRVA 4ITJA 5CEOA 4LOOA 3IOKA 4PWNA 1ZRZA 5D11A 2WAJA 3PA5A 2WTWA 3EKNA 3BGQA 4O96A 4HGTA 2UUEA 2FGIA 1YXSA 3U6IA 4QYFA 4CXAA 3NNXA 3LQ3A 4AW0A 2RFNA 4JAIA 3OOGA 4WNMA 2UW5A 1Y8YA 2JDSA 3QRIA 4WIHA 2Q0NA 4C8BA 1IAJA 2HOGA 2OU7A 2WQBA 2QI8A 2BFXA 2X8DA 3LM0A 3LCDA 1HOWA 4R6VA 4EEVA 5AUUA 2W1CA 5CU4A 4CT2A 4YLKA 1KOAA 3Q96A 3P1AA 4A07A 3ZCLA 5B2KA 2GQRA 2PVKA 4IANA 2HWPA 1YXTA 4X2GA 3I60A 2R3MA 4J99A 3R9OA 2F49A 1SMHA 3MY1A 2B9FA 5C01A 4ARKA 2VGOA 4U7ZA 4XP0A 2V55A 1Y6BA 2JEDA 4D9UA 4IB1A 4RVKA 2FA2A 5EYCA 5DRDA 3ZH8A 3RBWA 2OIQA 4G1WA 3MVLA 3DOGA 1WVYA 2GNFA 3D14A 3G0EA 4MXAA 1ZYLA 3S3IA 3W32A 4LFIA 4OTRA 3TT0A 3LOKA 4IQ6A 3R9DA 2CKEA 3RGFA 4L53A 2AC3A 2HIWA 2O0UA 5TT7A 4IX6A 3DJ5A 3C4ZA 5L8KA 3GOKA 4MNEA 2W1IA 4HZRA 4V0GA 5CZIA 2ETMA 3U6HA 3LKMA 5E1EA 3U9NA 2YERA 5FTGA 1GZOA 4FIEA 4XUFA 3FQEA 2IVSA 4FG8A 4F1MA 5HE1A 3CGOA 5HG5A 2VTQA 5IEXA 3QUPA 3W1FA 4WRSA 3ZLYA 4FV2A 1M7NA 4GK3A 4D2PA 1IAHA 1OIRA 2ESMA 3FZRA 2QG5A 4MXCA 4F9BA 3TUCA 4TRLA 4AZWA 3ENHA 4FC0A 4ERKA 2IZSA 3Q4UA 3G9NA 4RX5A 4AZFA 4LUEA 2C4GA 5K0XA 3SW7A 4FI1A 2V7OA 5JT2A 2R0UA 4L43A 4XOZA 2VO3A 4BVUA 4LRJA 4QMMA 4K33A 2XKEA 3NLBA 4EH3A 2EUFB 4PP9A 1YOMA 2EXEA 2YACA 3VAPA 5EI6A 2OZAA 4XCUA 3NR9A 4BL1A 2R3RA 3RVGA 3RMFA 3PTGA 4CFFA 3MSSA 4KBAA 3ERKA 4DTBA 4O0YA 1F5QA 4LL5A 3FI4A 3COKA 4IACA 4D55A 3A8XA 2FUMA 3CGFA 3QRKA 3RHXA 3EN5A 4EOJA 5JQ5A 4JBVA 1UV5A 2GNHA 3VS6A 2UW0A 4NM3A 4PTCA 3EOCA 3LCSA 4RC3A 5AP4A 3TKIA 3W2QA 4NYEA 1JSUA 5CXHA 2OJIA 3ODYX 3P7BA 3VBWA 4HVHA 5EW3A 1ZY4A 1YWRA 3Q5ZA 4IDTA 1JBPE 5A54A 2QLQA 3AGLA 4IW0A 2VAGA 2RSVA 3C1XA 1FVVA 2VX3A 3OC1A 2XVDA 5KMNA 2CNVA 3VWAA 5A6OA 1OPKA 2XKDA 2XRWA 1WVXA 1ND4A 2PZ5A 3DK6A 3V5PA 4JBQA 2E9PA 2B55A 4P90A 3CY3A 2CPKE 4E73A 1O9UA 5T6KA 4LYNA 2YM3A 1Q8WA 3D9VA 4JR7A 5FP5A 4AT5A 5A14A 1H24A 2OJ9A 5DN3A 2R4BA 5IQIA 3C4WA 5CTPA 1VYZA 3Q4TA 1G8AA 1F3MC 1UU9A 2WEIA 3DTCA 4CYIA 3KRLA 5AFVA 3U54A 4U44A 4B8MA 1CM8A 3R7VA 3HMMA 2J5EA 4I6FA 1V0BA 4FEVA 3N9XA 4WBBB 1GAGA 5HE3A 4BBMA 3UMXA 5KKRB 4FKTA 4RVLA 4WOVA 4XRJA 5C1QB 4EORA 2G15A 2YLFA 4G5PA 5GIPE 1SNXA 2UV2A 1NA7A 2W4JA 4CFWA 1AD5A 4BICA 2VTOA 3KCFA 3KVXA 3C7QA 2WELA 3A8WA 4D0WA 1ZZ2A 3GCQA 2EVAA 3LXLA 1PKGA 2R3GA 4QMSA 2X2KA 3R0TA 4AE9A 4DGGA 1YDRE 1OUKA 1LP4A 2YZAA 4FTKA 3E8EA 4K11A 5DPVA 5LMKC 2Y7JA 3AC3A 3NYXA 3FBVA 4PY1A 4XG3A 3IW6A 5I3RA 3DGKA 5H8EA 4YJSA 5HX8A 3FKLA 2VWZA 4AUAA 1ZYDA 3NNUA 1VZOA 4NM7A 3GQLA 1M17A 4BHNA 5BUJA 2PMOX 3OCGA 2WQMA 3BRBA 4ACDA 4NWMA 3AOXA 4MBJA 5HU9A 5EI2A 4BCHA 2DYLA 4B9DA 4D2WA 4DFYA 5IQBA 4OT6A 4JRNA 4DTAA 3BWJA 3FC1X 1UU8A 3NMUF 4TYGA 3HV7A 3O50A 4DBNA 2YM4A 2XCKA 5HX6A 3E8CA 4I24A 4RWLA 2CCIA 1CKPA 4WT6A 1OIUA 1FMKA 3MV5A 2PMNX 2VV9A 2X6EA 4O7ZA 3RM6A 3LVPA 3SHEA 4CFNA 3RPOA 3OZ6A 4F7LA 3KXMA 1OGUA 3GC8A 2I0HA 2W4OA 4MNFA 4C35A 4WD5A 3ZRMA 3TNHA 3R7YA 2ITUA 4CTBA 2R7IA 5AV0A 3CC6A 2R9SA 4C2VA 5HOAA 3VW8A 3W33A 5HE0A 1X8BA 5ANOA 3TCPA 2YDIA 4FTMA 5E90A 3NVMB 3BLRA 4PPCA 3I1AA 2GPHA 3ULIA 5A4TA 4QMZA 3VUGA 4JQ7A 2W5AA 2WTCA 4LM5A 3OWLA 3MA6A 4HYIA 4YJQA 3CSVA 2ERZE 3KXNA 3QXOA 2YCQA 4RLKA 2KULA 3GT8A 4EI4A 2HK5A 3ATSA 4FG9A 2OF2A 5KUPA 4O7VA 4QYHA 4DFNA 3ZO4A 4UY9A 4DT9A 3WILA 5HLPA 4MF0A 1R0PA 3HRFA 5JK3A 2Y9QA 2ZM1A 4RLLA 4TYIA 3O2MA 5IG1A 4IIRA 3CR0A 4W4VA 2GS2A 4XG6A 3T9TA 4FKLA 4FEUA 4TT7A 3IDCA 5C03A 1ZY5A 4FT9A 4E3CA 4BDBA 2QCSA 4BGHA 3P08A 2BMCA 5BVWA 2GHMA 2YDKA 3FUPA 3MB7A 3P23A 1Q5KA 4EHVA 3QCSA 1R1WA 4U41A 3TZ7A 1IRKA 2C30A 2ZYBA 4OT5A 5AR4A 4A9TA 2B4SB 3OVVA 1GIIA 4I6BA 2ITPA 4O21A 4CV8A 5IPJA 5J1VA 5IQFA 5GZ8A 3TUBA 1PRYA 3NIZA 3FC2A 4FGBA 3PVWA 4GT3A 2ZAZA 3EYHA 5JN2A 3LXKA 5HVKA 4E93A 2YAAA 4Y5HA 5HGIA 1JSTA 2FSMX 5HTBA 4PDSA 5BYLA 3KREA 1P5EA 1GY3A 5E92A 3MPTA 5HD7A 5TR6A 2C0IA 2BZJA 4H58A 4E8AA 4NM0A 3DJ7A 3ZEWA 4KWPA 5A3XA 2WTIA 4DEHA 4F9YA 5CEPA 4GJ2A 2VO0A 4BBFA 3F5GA 4EHZA 3O8UA 3ZYAA 4M69B 1S9IA 2C68A 2PVMA 4WUAA 5ANKA 2XIRA 4I5CA 3ZMMA 3LFCA 1H27A 2CJMA 4JI9A 4BY9E 5I4NA 1GOLA 2G01A 4XNEA 5CZHA 4D58A 5I5ZA 3PJ1A 4DGOA 4DEDA 3OEFX 4ZTHA 2C5VA 3FAAA 5EDQA 3D7ZA 4GMYA 2SRCA 3ZUUA 3A62A 4FE2A 4DFUA 2UW7A 2LAVA 2A19B 4QTAA 5K3YA 3NNWA 3UPZA 3QALE 3WF7A 4FZDB 5TO8A 3NUYA 3QA8A 4O22A 4W4YA 4S33A 3THBA 3IKAA 5LWMA 5HBJA 2XK3A 3IG7A 4FKJA 4F9CA 5L3AA 3ZOSA 4FNZA 2I7QA 4P2KA 1R0EA 4DC2A 5IQHA 4C4EA 5KHWA 5E4HA 4YZ9A 4TYHB 4UXLA 3C13A 5HO8A 1P14A 3GXLA 3B2TA 3F69A 2QONA 2WU6A 3PSBA 4AZSA 4NU1A 4RX7A 1JKTA 2YN8A 3LXPA 1Y6AA 3OWKA 4BCOA 4A9RA 3KK8A 4DINA 2Q0BA 4EJ7A 4EUTA 2VTIA 1IA9A 2WXVA 1YVJA 5HG8A 3OBJA 3TNIA 1RDQE 3CTJA 2C1AA 4F99A 5IEVA 2CKOA 3ZBFA 4QMTA 4QTDA 1M7QA 3O23A 3FEGA 2HZNA 5LCJA 3PG1A 4TKSA 3OOMA 3QZFA 4HCTA 4GT4A 4NIFB 3QYWA 4EK5A 4F0IA 1F0QA 3WZKA 3E92A 3BELA 3MW1A 3NYOA 2BRNA 5I9VA 5J1WA 1WCCA 3EN4A 3ZUTA 5AUTA 3ET7A 4XG2A 2BDWA 5HORA 3Q2JA 4MK0A 5IH6A 2BAQA 1GNGA 3I7CA 4AFEA 2C6DA 5M08A 4NT4A 3QKLA 1H0VA 1XH8A 5E8VA 4DH8A 3AC4A 3MPAA 4L68A 4DEEA 5GIOE 4NTSA 4U81A 3PVUA 3SW4A 3ITZA 2P3GX 5FUTA 1OIYA 3R21A 4X0MA 4YC3A 5L4QA 5H8GA 4YLLA 5DI1A 5AV3A 4CKJA 5AA9A 2R5TA 3F5PA 1YWVA 3EFJA 3LAUA 4IZYA 4BDJA 1P4OA 4ZTSA 2WQEA 5HVYA 2X4FA 2YABA 3E5AA 2UZDA 1ERKA 2Z7QA 3OCBA 2C6IA 3RKBA 3ORKA 4CGAA 2OH4A 4Z55A 3BX5A 3KMWA 4WUNA 3W8QA 5AM7A 4C3PA 2XK8A 4DH5A 1UKIA 2XJ2A 3H0YA 3O51A 2RL5A 4BDDA 4EH2A 5H3QA 5J7HA 5J95A 4BRXA 1XH6A 4O27B 3EJ1A 4FL3A 4M13A 4FMQA 4LGDA 4W9WA 2JAVA 2RKUA 3R8UA 4OAVB 3R8PA 4QYEA 4BDIA 5KX8A 1XQZA 3BV2A 3SXFA 3WZJA 2PUIA 5IQAA 3OWPA 4RIYB 2B0QA 4O7YA 4HNIA 3QKKA 4GEOA 4X3FA 4U80A 1QL6A 3W2PA 4F0FA 2PE1A 4QMPA 5KKRC 3SG9A 1U54A 3N4UA 4DH7A 4KIKB 3R6XA 3DXPA 5FQDC 2FH9A 3CS9A 4TWCA 4JDHA 3LCKA 4QNAA 3W16A 4AG8A 5EM7A 5C8MA 1CTPE 1M2PA 4FEQA 1VEBA 3FYJX 4C59A 3QZHA 3GQIA 4F9WA 4J96A 5DG5A 5FTOA 2Q83A 5DLSA 4FKGA 2WTKB 2OJJA 3UQGA 2J50A 3SRVB 5CSHA 3FI8A 3PE1A 4ZZMA 1QCFA 3IGGA 4FTJA 2OWBA 3HA8A 3UIXA 3R00A 4Z9LA 3IDBA 3QQKA 4IWDA 4IAYA 2YFXA 1UA2A 2B7AA 2X9FA 3AC5A 4O38A 3NWWA 3RCDA 3OCTA 1DI8A 2PVFA 4D4SA 4FKQA 5AP5A 3ZS5A 3LXNA 4I23A 3TV4A 3RAWA 4ENYA 4O86A 4FV9A 1FQ1B 2GMXA 2YJSA 2PMLX 4R3PA 5AX3A 5J8IA 4DFBA 3CCNA 5BNJA 3D4QA 5K9IA 2CN8A 5BX0A 4XP3A 4A4OA 4FTNA 3M2WA 5HEZA 5C27A 3FMLA 4W4XA 3RZBA 4LOPA 4NJDA 4EC9A 4QTBA 4N4SA 4S32A 1UU3A 2W5HA 3TJDA 4EOOA 4GW8A 4RG0A 4F7JA 2EWAA 3G51A 3ZTXA 4FZFB 4IJ9A 5M4CA 5AUXA 3QFVA 1BX6A 2RFDA 5FWKK 4HCUA 1QPDA 3TZMA 4GIIA 5HE2A 4QMUA 4RQKA 5CSXA 4O0XA 3ZSIA 1NVSA 5IA2A 4DFZE 4ZSEA 3A2CA 3QWKA 2PPQA 4IX4A 4USDA 3PXYA 5AIKA 3R22A 1YWNA 2C47A 2ONLA 4BWKA 3AQVA 5LWNA 2PY3A 1URWA 3P7CA 3JS2A 3UDBA 2OH0E 5HBHA 4S2ZA 5L6WL 3WF8A 2R3KA 1RW8A 3D7TB 1MQBA 4YJRA 4HYSA 3BLQA 5HG9A 1ZOGA 1YHSA 1MP8A 3NDMA 4FTOA 4I4FA 3R9RA 2CGVA 5DWRA 5D7AA 5KMJA 2IG7A 1Q4LA 4TL0A 2HZ4A 2C3IB 4DEAA 2GNJA 3L8PA 4RVMA 1ZZLA 3G0FA 5H2UA 3ODZX 1UKHA 5CU2A 4E4NA 3PLSA 3DS6A 4G3GA 5CENA 4A4XA 2BKZA 4CVAA 5AP1A 3AC2A 1XH5A 5ETFA 3UPXA 4ANBA 4ZSJA 3P78A 4JR3A 3BWFA 4P5QA 4FOBA 2ITYA 3CD3A 1KE9A 4CZUA 3UOHA 3UGCA 3ZDIA 4I6QA 4LRKA 2AUHA 4TWOA 5AAFA 4CLIA 3BU5A 2Y6MA 1J7IA 4IB0A 5HIBA 4G34A 4R1VA 4OBOA 4Z16A 4GV1A 5AR8A 5BMMA 2X2LA 3UOLA 4AT3A 3BHTA 3FY2A 3K5VA 4KUJA 4U79A 4YZBA 3HV3A 4QT1A 1CMKE 2AYPA 2E2BA 3AD6A 3IW5A 4RJ3A 4Y85A 2ZOQA 3RWPA 3ZZWA 5JFVA 4E6QA 4CFXA 4JJRA 3HX4A 3JY9A 4QMLA 4RFZA 4HPUE 4WG5A 2VGPA 3RJCA 4JL9A 4D0XA 3LMIA 5IQEA 3DNEA 2RGPA 3NW7A 3LFEA 2J0JA 4L01A 2ERKA 4LGHA 4HYHA 4OBQA 3V3VA 2ITWA 3MH1A 2XKCA 4CSVA 3FMMA 3FJQE 2XIYA 2HELA 2ZDUA 3EN6A 3HP5A 4M0ZA 3G90X 5E8WA 3SXSA 4YMJA 2C6EA 4RPVA 5LQFA 2Z7LA 2I0EA 2JD5A 3QTIA 3SV0A 3SXRA 4O0VA 5BYYA 3NRMA 5K4IA 2UZUE 1H26A 3DFCB 4NFMA 4PUZA 2W1FA 2ZJWA 3C4FA 3NCGA 4KIPA 4R1YA 3IGOA 5FP6A 2WZJA 4DLIA 4O7RA 4Y72A 4TWNA 5BYZA 1WBWA 2F7EE 1OKVA 3C0GA 2VWBA 5AV1A 1Q62A 1W7HA 1YKRA 2UZTA 4J8NA 3FHIA 3VQUA 4GK2A 3ZO1A 5CI6A 3U51A 4HVDA 4X2JA 3VBYA 2XK6A 3EWHA 5DT3A 3LCOA 4FYOA 5ITAA 4F09A 3KN6A 3KL8A 3BEGA 3IS5A 2O2UA 5FGKA 4AU8A 2BIYA 3PP1A 4XV1A 3JVSA 5JQ8A 4E6DA 4NFNA 5L8LA 2QO7A 3PY3A 2J51A 3AT3A 5T68A 3HAVA 5FBOA 3ORZA 3E3PA 4FT5A 2XP2A 3U4UA 4QPMA 3UVPA 4IXPA 3D2KA 1BLXA 3A4OX 5M4FA 2RG5A 2RF9A 5FD2A 1SVEA 4GU9A 4KNBA 3LCTA 2IPXA 1KWPA 3R28A 4ALWA 3OTVA 4IAKA 4FKVA 4UB7A 3A7IA 4M14A 5GZ9A 4BTMA 1QPEA 5M55A 5JRSA 5EQYA 4I21A 2DS1A 4QP7A 3QLGA 2UZNA 3FSFA 3QGYA 4NL0A 5EDPA 3WI6A 2V22A 5E8YA 4FIFA 2C6MA 3Q52A 1PYXA 2OK1A 2WEVA 4P5ZA 3D5VA 5CVGA 3SA0A 5E8TA 3TTJA 4APPA 4E26A 5HESA 4O83A 2XS0A 3PA3A 3NUPA 4ZOGA 1U5RA 4MQ2A 4BCJA 3KF4A 4J53A 4IZ5A 1V0OA 3ENMA 4BTJA 5KZIA 2E9UA 2WMQA 4DE4A 3H10A 4MXXA 2Y4IB 2VTJA 3NYVA 4R5YA 3DPKA 1PXLA 1G8SA 3WBLA 3GC9A 3KC3A 5EKOA 3TJCA 1ZYCA 2J0KA 5CSWA 1OZ1A 2GQGA 4V04A 3I79A 2IO6A 3ZSGA 4D5KA 2QOFA 3NW6A 1OM1A 4GJ3A 3GP0A 2BZIB 1Q97A 3FMDA 3KKVA 4MXYA 5KMLA 3HP2A 2WFYA 2OXDA 2BHHA 2GQSA 3CKWA 4O0SA 3DU8A 4IWQA 5IQGA 5LXMA 2QC6A 3K54A 2JBOA 4FIGA 4NEUA 2W99B 1XBCA 5D12A 4IEBA 1H0WA 5CT0A 4C7TA 4F7NA 3CXWA 4IFCA 5EYDA 4DHFA 5BVKA 3DB6A 3HRCA 3WE4A 2OF4A 4DG2E 2FSTX 4YZCA 2FSLX 3ZBXA 3TTIA 4I4EA 3QHWA 4AX8A 2CNUA 3CTHA 4KRDA 4XG8A 4RIXA 4QMNA 1OBGA 2OICA 2BDFA 3MIYA 5LVOA 3JXWA 4G6NA 3ZU7A 4KA3A 4BF2A 2C1BA 3POZA 4ACGA 4YC6A 3TM0A 1ZYJA 4AP7A 3FXXA 5CVFA 2R64A 3CBLA 3HMIA 1ZMWA 4BTFA 1BL7A 2PVLA 3QX4A 4FUXA 4GK4A 2ITQA 2YIQA 4Z3VA 2AC5A 3HMNA 2G9XA 2OW3A 3M42A 2QKRA 3DBFA 4YZMA 3UBDA 3S00A 4FT0A 3E64A 5ETIA 5IEYA 2CGUA 4N6YA 3IW7A 3OUNB 1TVOA 3DCVA 3UC3A 2BAKA 2X81A 1OUYA 1T45A 2XMYA 1TQPA 2OZOA 2W96B 2WTKC 5JFSA 2GNGA 3MIAA 4RWKA 1PXJA 2O3PA 3GU5A 1M2QA 1UVRA 3QTQA 4MNEB 4V0GB 4K2RA 4AN9A 5J5TA 5J5SA 3GC0A 3NAXA 2QHNA 4IADA 2XJ1A 4H3PA 2XJ0A 5ACKA 3HA6A 4Q5EA 5AP2A 2XK4A 4U43A 4ZTLA 2XRUA 3TN8A 1WZYA 2NRYA 5DYJA 2OFVA 4R5SA 1NVQA 3R8LA 2XIZA 3BCEA 5GJGA 2HY0A 3T8OA 5AAGA 2QR7A 1ATPE 2BUJA 3NSZA 3KMMA 4KKHA 3RPYA 1M2RA 4U9AA 2X6DA 3KXZA 2R3OA 4A9SA 4UMUA 4DA5A 4LOQA 5KMOA 2BILB 4LGGA 3R2BA 4MBIA 3U9CA 5HD4A 4EZ7A 4FSNA 1E1XA 2C5NA 4EBVA 5D7VA 5AADA 2PMIA 4FGRA 2B52A 2YM5A 3RINA 2J2IB 4FV7A 5EH0A 4AGUA 5IDPA 3VUDA 3R8VA 5BVOA 2YDJA 5TF9A 4A9UA 3VIDA 3DQXA 3EFWA 3KU2A 3VS1A 2ITNA 1IR3A 3FQHA 2KTYA 3PPZA 2CN5A 3PWDA 1XH7A 2OZAB 4Y5QA 5AR7A 4ZXTA 3SKCA 4ANSA 5I3OA 3UTOA 1DAYA 2HZ0A 1R78A 3SOCA 4F0GA 1H1WA 3ZLSA 1REJA 4CLJA 1ZYSA 4GVAA 3Q4CA 3DAJA 5GINE 3EMGA 3ZM4A 4X2FA 1JVPP 2CGXA 5KCVA 5FDPA 4ANNA 4EYMA 4D2VA 4CRLA 4OR5A 2VTLA 4K0YA 4YHTA 5DGZA 5HO6A 5IU2A 3NNVA 1DS5A 3NPCA 4LL0A 3I0QA 4IAZA 3GCUA 2G2HA 2P55A 3GB2A 1URCA 5IH5A 1YW2A 4JX3A 4NCTC 3LFBA 3LQ8A 1P4FA 2C5OA 1EH4A 3GGFA 4FUYA 3ZDUA 2PSQA 1Z5MA 4YNEA 4CYJA 2WMVA 3QQGA 3CPCA 1JKLA 4TXCA 4O7LA 1I09A 4KKGA 3OT3A 4PNIA 3EYGA 5AR2A 3ANRA 4D4VA 4QMVA 3HDNA 2QVSE 4YSJA 5IA4A 5M44A 4QTEA 4J1RA 4CFMA 3F61A 3FL5A 4O2ZA 4F7SA 2XB7A 3PIXA 2I40A 4YJOA 3MPMA 3FV8A 2F9GA 4WA9A 1V1KA 4X21A 4AA5A 4JG7A 4K1BA 3KRRA 3BIZA 3AMBA 4JOAA 4QPAA 4XMOA 4DGNA 1GIHA 3DLSA 5KMMA 5CAOA 4J71A 5D1JA 5BMSA 2A2AA 4I3ZA 2W1EA 4IM2A 3UNKA 3DV3A 3TDWA 4IM3A 4QP2A 5ETAA 4OTDA 4DEBA 4YZNA 1L8TA 2FYSA 5AP3A 4EWQA 5CI7A 4NTTA 3AXWA 5ANDA 5J79A 2WMBA 3Q9XA 4MXZA 5EM6A 3FLZA 4FV1A 3IQ7A 1LPUA 1SM2A 5FEQA 5AUZA 3V51A 4EKKA 3LPBA 5ANJA 1ZARA 2O8YA 5DR2A 5HKMA 1WFCA 1RE8A 4IZAA 4KD1A 5IUIA 3CKXA 2WIHA 4QP1A 3V5TA 2YCSA 1IEPA 3BKBA 3Q3BA 4JQ8A 3BHUA 3TZ8A 3R71A 3NS9A 3MJ2A 4EH5A 4AXAA 1WBSA 3QD3A 4FKSA 3U87A 1UWJA 5DVRA 5AR5A 2J9MA 4B7TA 1AGWA 2OLCA 4DBXA 2JFLA 3RPSA 4I92A 4GG7A 1JSVA 4IVCA 4FSQA 4MH7A 4UYAA 5AP0A 4YTCA 2VZ6A 3MI9A 3EQDA 4QP6A 3BPRA 3MFUA 3R9HA 3ZM9A 3C50A 5CQUA 4ENXA 2I0VA 1SNUA 3D83A 4QQTA 4H36A 2NP8A 3BZ3A 3NW5A 4WNPA 3O8TA 4XLVA 5FDXA 4EYJA 4PP7A 3CJFA 3BE2A 3W10A 3ALNA 3TIYA 2QKWB 1NVRA 4HCVA 4BN1A 3A7HA 4AGCA 4C4HA 3QRTA 1YHVA 2Y4PA 3UE4A 4F64A 4Q5HA 5F1ZA 3EN7A 1Q3DA 1Q61A 3HGKA 4I0SA 2O65A 5IQCA 4EWHA 5L8JA 1A06A 5M51A 1YXVA 1H1SA 2WD1A 2J4ZA 2WO6A 3NUXA 3R7UA 4I22A 2WQOA 5AAEA 1OKYA 1Q8UA 4O6LA 4EOSA 2R0IA 2XZSA 4QMYA 3UVRA 3PZHA 4ITHA 4FTRA 1CKIA 4FYNA 4FSYA 4JDKA 4ACCA 3ELJA 4FV4A 5KMIA 4RIWA 4LQMA 3UOKA 4BHZA 4IB3A 4LUDA 4FT7A 4DLJA 5KHXA 4L7SA 2XEZA 3MS9A 4XH6A 4CG9A 2EU9A 4RC2A 4M0YA 3H9RA 5LOHA 2BCJA 4CMTA 2GFSA 4O7SA 5JZNA 1Q8YA 3NGAA 3EQIA 3FZOA 4IH8A 2PVHA 2DUVA 3BHHA 3LMGA 2P2IA 3PFQA 4LMNA 4Y73A 2XF0A 3CP9A 3V6SA 5I9XA 4YR8A 2GS6A 4RFYA 1LUFA 4FX3A 2CLXA 3F2AA 4ZJIA 4M8TA 4TY1A 3VUIA 3L9PA 2W06A 2C0TA 4J98A 5DEWA 2F57A 4APCA 4D4RA 3F2RA 4XV2A 2QURA 1H8FA 1UNHA 4GVJA 3QD4A 3QXPA 5JMSA 4EZ5A 3DKFA 2W9FB 3PA4A 1W82A 2VTTA 4U97A 4X7QA 5IKWA 1WBOA 4BIBA 4R77A 4EH6A 2Y4IC 4LMUA 4ITIA 2BDJA 4QYGA 3FKOA 4DFLA 5BUEA 3PXFA 4BWXA 4B8LA 3SAYA 3TKHA 5C4KA 4PF4A 4BGQA 5IUGA 2IVUA 3FDNA 3QYZA 4S31A 5HNBA 4BDCA 5L2QA 2BIKB 5JH6A 3CQUA 5AMNA 2F2UA 2YM8A 5DBXA 4UN0C 2ZB1A 4G3FA 3DFAA 2YCRA 4L42A 3QCQA 1XH9A 3V8WA 1SZMA 3PXRA 2VWXA 4AFJA 4AGDA 2I6LA 5LVLA 4O7NA 4F6UA 4YJNA 2FSOX 2G2FA 5E8SA 2FO0A 3S0OA 5HTCA 3REPA 4NZWB 2X0GA 5M4IA 3QCXA 4IHPA 1YI4A 4W8DA 2PUUA 3NUSA 3QRJA 4Y95A 4HGLA 1JPAA 4IFGA 2W1HA 5TKDA 3FLQA 4BCNA 3VS2A 2UZLA 3FL4A 1BI7A 3SVVA 2R3FA 3RK5A 3CE3A 4PL5A 4A06A 1WBVA 3GEQA 4Z7HA 2WMAA 3DB8A 3F7WA 4I5MA 4OBPA 3S1HA 4BDEA 4OTHA 5AIRA 3UMWA 2O63A 2Y8OA 3HV6A 2XIXA 3C4XA 2BZKB 3PRIA 3BQRA 3KMUA 3DAEA 5H8BA 5FXRA 2R3LA 2YHVA 2C3LA 2W5BA 3BI6A 2BZHB 4W4WA 4XV3A 3TV7A 4UWYA 4CQEA 5GZAA 5CAQA 4FEXA 4MD7E 2IJMA 1OL5A 2YWPA 5I9UA 5K4JA 4CKRA 5E1SA 4A9YA 4USFA 4S30A 3ROYA 2ZMDA 2VTRA 3UP2A 2YLEA 3HVCA 2HXQA 3BLHA 3NYNA 3VRYA 1J1CA 2F2CB 3VN9A 4WG4A 3GOPA 3LFQA 3ZONA 4O81A 2VD5A 1XJDA 3HEGA 3PP0A 1U4DA 4U0IA 1ZOHA 2C3JA 4EBWA 2VWYA 1XHAA 2PVNA 4AW5A 2GTMA 1JQHA 3CY2A 3H9OA 3R1SA 1KV1A 4BCFA 3UO4A 3QQFA 2OSCA 2XCHA 4X6RA 3EFLA 5EKNA 3N4VA 2XBAA 2HW7A 3E7VA 3PJ8A 4CEGA 3PRFA 3TKUA 3I5NA 3EQBA 4JNWA 4OTGA 3ULZA 4GT5A 3CJGA 4C57A 2IZTA 2V7AA 4DH3A 1VJYA 1LEWA 3L8XA 5BVEA 3G15A 2G2IA 2H9VA 4C2WA 4FK6A 3W2CA 1PXOA 1IASA 4CQGA 3F66A 4BFMA 3TZ9A 3KULB 2QR8A 3ZSHA 4FZAB 5BPYA 2V5QA 4UBAA 4UZDA 1LEZA 5ACBC 4AF3A 4GUBA 4KSPA 3MFRA 2HZIA 3E7OA 3F3WA 4FEWA 1VR2A 3LJ1A 3HLLA 3C0HA 1W8CA 2ITXA 1ZMUA 3MJ1A 4YJUA 3Q04A 3RPVA 4ASZA 2HW6A 4RFMA 2YZLA 1W98A 4ZY4A 3JVRA 4FVPA 4DT8A 3H0ZA 4C4GA 2I1MA 3RK9A 1YOLA 2OJFE 2WNTA 5A6NA 2W4KA 3WZEA 3DBDA 1OL7A 4BIDA 5HU3A 5IISA 5LVMA 5K5XA 2PE2A 3HNGA 4EOMA 3UJGA 4F63A 2VO7A 2CHLA 3VF9A 3QZGA 3ETAA 3IK3A 3K5UA 3QD0A 3Q32A 1CKJA 4PDYA 4AWIA 4EKLA 3KQ7A 3R02A 5ANIA 5JGAA 1OIQA 3BHYA 2P4IA 1CDKA 2YIWA 3Q6WA 5AA8A 3AMYA 1JKKA 4BDFA 3IDPA 4QP8A 4H3QA 1GZKA 5CF6A 1YQJA 1H25A 2BR1A 4OTIA 4FVQA 5E91A 4NSTA 2QD9A 3C0IA 4U40A 4XG4A 4B99A 4DH1A 3RAIA 4EL9A 4U3ZA 1R3CA 3R1YA 3MTLA 4IVAA 5M09A 2R3HA 3BYSA 3T9IA 4D2SA 3R1NA 5CT7A 3ZLWA 1H08A 2GS7A 4JX7A 3OBGA 3RP9A 4KIQA 2OJGA 4CKIA 3I4BA 3F82A 2J0IA 4YNOA 4BKJA 2P33A 3CIKA 1MRYA 1YHWA 4PMMA 4O7WA 3OROA 3FMEA 3KB7A 1ZMVA 3D0EA 4X3FB 3MFSA 3IOPA 4PL4A 1U54B 2IW6A 1UU7A 1Z9XA 4L3LA 4ZTNA 3UQCA 2YISA 4YLJA 2IW8A 4FTCA 2CKQA 4FOCA 3L1SA 3SGCA 3IECA 2VN9A 3WE8A 4W9XA 3S95A 2XH5A 5DNRA 1H00A 2W0JA 4GIHA 3C5IA 4MAOA 2OBJA 4LRMA 4H1JA 4OTPA 2GNIA 2WU7A 3GNIB 4UMTA 4L8MA 4K77A 4UWCA 5K0KA 3TG1A 4YO4A 3RNIA 3G6HA 3NUUA 4JDIA 3W2OA 2XA4A 4ZZOA 3KXGA 3PLAE 3PIZA 2VTSA 4EUUA 3FZ1A 4WSQA 4NW5A 4U42A 1SVHA 4CFVA 4L6QA 4KRCA 3E63A 3UZPA 3EHAA 2ZM4A 4BR3A 3GU6A 2XNOA 3BYOA 4U6RA 2IN6A 3COMA 3VHKA 3KA0A 3V8TA 1BKXA 5CX9A 5L2IA 2WHBA 3LMHA 3GU7A 3MBLA 4U8ZA 4K6ZA 3O7LD 4E4LA 3VS5A 4X6QC 4R7HA 3VNTA 3GU8A 3MVMA 4ANMA 2YCFA 1K9AA 2QO9A 3GCSA 1APME 1PMEA 4EZ3A 5HZNA 1PXIA 2YM7A 4B6LA 4FSZA 5CALA 5A4EA 2GSFA 4AAAA 3TV6A 1OVEA 5FM3A 4C4JA 2QU6A 4MBLA 3DKOA 2UVZA 3DNDA 4O6EA 2PE0A 4XJ0A 4BGGA 3I6UA 4QMXA 5JFXA 5DR9A 3OTUA 2VWIA 4AT4A 4F6WA 1OPLA 2YEXA 2ZV9A 4HOKA 1K3AA 3OUKA 4MVFA 1HCLA 3DAKA 4OTWA 4D2RA 3RAKA 3QQLA 3QTUA 3FXZA 4OGRA 5EQEA 2OIBA 4E6CA 4AN3A 1J3HA 4PPBA 4EQUA 4GFGA 2YJRA 1O6LA 3WARA 5JRQA 5D41A 2G1TA 4YTFA 3P79A 5HCYA 4IVDA 2B9JA 4NJ3A 3OFMA 2HYYA 4IX5A 2PYWA 1NY3A 1H01A 3F9NA 4BB4A 4G17A 4IAAA 4FV6A 3R63A 3FMJA 3OS3A 4R7IA 3FHRA 3ACJA 4YPSA 4EK6A 2VU3A 4OAUC 4M84A 5L6PA 2C6TA 2OO8X 1Q8TA 4YBJA 5LARA 2ZDTA 5E7RA 5B0XA 5HNGA 5LJJA 3BYMA 2F7XE 1ZXEA 4IVBA 1WBTA 3NUNA 4RJ8A 3L9MA 5KBRA 5K5NA 5T3QA 3R2YA 3M11A 2XBJA 4O2PA 1G5SA 3AC8A 5DT4A 4ASDA 3QL8A 3KRJA 5LMKA 3OXZA 5AV2A 2XNPA 4NM5A 4MD9E 5ANEA 3ZRLA 4AS0A 4C4IA 4MWHA 4B0GA 5J7BA 3FYKX 4I0TA 1WBNA 4C34A 4FA2A 3KY2A 3HRBA 4KSQA 4YJPA 3VBQA 2H34A 4MF1A 4ZY5A 5LVNA 3UNJA 5EI8A 3OW3A 2VWWA 3G6GA 3V5LA 4X2NA 1H1RA 3G5DA 3LJ2A 2A27A 5CEMA 3F3TA 3EL8A 4RA4A 1Y57A 3QRUA 5DFPA 3Q9WA 4FV5A 4XHKB 4ID7A 1YXXA 4DCAA 3DBQA 5CY3A 4AZVA 5IA0A 3ZXZA 4I93A 3NEWA 3D15A 2R3PA 2Z2WA 4FBXA 3P5KA 4C62A 3CQEA 2R7BA 3VC4A 3BE9A 2X8IA 2PVRA 2QOBA 3FE3A 3ID6C 3LFFA 4HZSA 4N6ZA 5D10A 4FTTA 4EH8A 2A0CX 2O64A 5FTQA 4OTFA 3R83A 5CVHA 3H9FA 4D1XA 4HVSA 4R78A 4RIOA 3VBVA 5HCZA 1LR4A 2Z7RA 3DQWA 3SC1A 4L3PA 4AOTA 4O1OA 4C4FA 4M66A 3SLSA 1OI9A 4RWJA 2HWOA 3GUBA 3EQHA 1PYEA 2PZPA 5CANA 5IMXA 4ZTQA 4RA5A 2F4JA 3EN9A 3GFEA 1PHKA 4EOLA 5EHOA 4FIJA 4RJ4A 3P86A 4LV8A 4PV0A 4GKHA 4D9TA 1WBPA 3C4CA 3QQUA 3QU0A 2UW8A 5IA1A 4YO6A 3VUMA 1KSWA 1XBAA 2FB8A 3ATTA 4L46A 5CSVA 3O7LB 4GL9A 5CNOA 1K2PA 5FEEA 3UO6A 4QO9A 3VULA 2V0DA 4IJPA 5HO7A 4YBKA 5CYIA 3VBXA 2OG8A 3QWJA 1JAMA 4ZK5A 4MKCA 3C9WA 4M68A 4L00A 3U6JA 3II5A 4EC8A 2JITA 3FSKA 4JG8A 3WYXA 4XOYA 4GFOA 3FMKA 3DJ6A 4A7CA 1W0XC 1NW1A 4C0TA 1Q24A 3PIYA 1BL6A 2HY81 3QCYA 4G3DA 4QP9A 2PU8A 2E9NA 3V01A 3TACA 2A4LA 3FLYA 4AZTA 1FGIA 1H1PA 3RK7A 4RZVA 3L9NA 2IZUA 1NXKA 3OT8A 4PDOA 5DR6A 3EKKA 4FKIA 5E8ZA 4JIAA 3QBNA 4ORKA 4MD8E 3R73A 3QLFA 5GHVA 3S2PA 2UZVA 1JKSA 3FKNA 4O0UA 3R30A 4PQNA 5J9LA 4E20A 4C61A 3UZRA 4E5BA 1T46A 4FODA 4D1SA 4X2KA 3H3CA 4C38A 3BU3A 3AD5A 4FV8A 5EDRA 4JQEA 3W18A 4AQCA 4YUQA 4Z7GA 4OW8A 2CMWA 3MDYA 3HMPA 5AUWA 4P7EA 4FV0A 2C3KA 2VX1A 1TQIA 1ZLTA 2WOUA 3IONA 4IWOA 4U45A 3V5QA 3WOWA 3HV5A 1SYKA 2BROA 3DY7A 4CZYB 2JIVA 5A4CA 4I94A 3PXQA 4R7BA 4JDJA 3A7FA 3E8DA 4M67A 4YTIA 2VX0A 3K3JA 3QUDA 5EG3A 3AC1A 3PYYA 2WMSA 4BKZA 3O71A 5CXZA 3WF9A 5ICPA 3LIJA 4Q2AA 3ZC5A 1O6YA 3LE6A 4E7WA 3HAMA 3LW0A 5A4QA 3UNZA 4RWIA 4YTHA 3HDMA 4KS7A 4NKAA 2ZMCA 4I20A 1FBNA 1VYWA 2QU5A 4FK3A 1OMWA 3G9LX 4RJ5A 5I9ZA 1Q8ZA 2JIIA 3A60A 3OY3A 4FSUA 1TQMA 1DAWA 3DXNA 4FNYA 2QOHA 2CKPA 3OXIA 3EIDA 4FL2A 4AW1A 4FKPA 5DIAA 4ASEA 4D2TA 4C33A 3DLZA 4AACA 4RJ7A 4V05A 4ZZNA 2NO3A 3QZIA 4FICA 4FTAA 4BDAA 5DMZA 4RIXB 1M14A 2VTMA 4QRCA 2ZM3A 4AN2A 4DN5A 4YURA 4PX6A 3EFKA 4DF3A 4H05A 4ZTMA 1FINA 4E6AA 2XYNA 2QOOA 3KEXA 3QTZA 4FKWA 3R7EA 4M7IA 5CNNA 3RTPA 2P2HA 4RQVA 3PE2A 4X3FC 5A9UA 2BFYA 1PMVA 2Z7SA 4BYJA 2X7GA 4X3JA 4JRVA 3R1QA 4QOXA 1W84A 1R39A 3JUHA 1PKDA 4WO5A 4ZAUA 5M07A 3WIGA 3ORIA 5HICA 2HENA 4AOIA 3VUHA 5DOSA 5H9BA 3R8ZA 4GS6A 2XM8A 2C5XA 1YDSE 3C5UA 4ZS0A 4KIOA 4L9IA 3OF0A 4PMSA 4E5WA 4AZEA 4E4XA 5CEKA 2V62A 5DT0A 4BWPA 4WG3A
chains in the Genus database with same CATH superfamily
1DM2A 3A61A 4IE9A 1TKIA 3WYYA 2BKKA 4A4LA 2Z02A 3QTRA 2UZEA 3UP7A 4EH4A 3HUCA 4JS8A 3D2IA 5C4LA 4O0WA 3MH2A 4OUCA 3CD8A 4YJTA 1FPUA 4FZ7A 2QOCA 3FLNC 2C6KA 3KK9A 3VJNA 3AMAA 1G3NA 4NK9A 4RC4A 3ROCA 3L8SA 3O8PA 4KINA 5A46A 5BVDA 1OKZA 2CDZA 3F7ZA 2UVYA 4QMQA 2CSNA 2W05A 5M06A 2QNJA 4C3RA 3A7JA 4TWPA 3R7GA 4TPTA 2QG7A 4XS2A 4M12A 3W55A 2NPQA 3KRWA 3KRXA 3NZ0A 4XV9A 3UOJA 3MYGA 3VRZA 4B4LA 5FRIA 4USEA 2BTRA 4ANLA 4CV9A 5TE0A 4R8QA 4BCIA 2PZRA 4J95A 4JG6A 4G2FA 3ZHPC 1B38A 2Y0AA 2YWVA 4ZSLA 5DE2A 4AE6A 4BCGA 2PWLA 4FG7A 3LM5A 2B54A 4NH1A 4QP3A 1PJKA 3QTWA 3R8MA 4O82A 5ETCA 2GTNA 3W2RA 4TTHB 2XEYA 4Y83A 1YI3A 2VTAA 4P4CA 5HCXA 3VBTA 3ZXTA 3KGAA 2ONLC 4BCKA 3CPBA 2ZV7A 4G5JA 4WSYA 4BBEA 4BCPA 1J7LA 2WMRA 3A7GA 3ZEPA 5DEYA 5HLNA 1JWHA 2WTJA 4MHAA 1PF8A 2VTNA 2GHLA 2OIDA 2VWVA 3G33A 3N51A 2OFUA 2VUWA 3PXKA 4G31A 3UYTA 4F1OA 5J9YA 1H1QA 3ORLA 4ZJJA 4DITA 3QA0A 4XG9A 4IB5A 3TI1A 1WAKA 3VF8A 4XRLA 5AR3A 4YC8A 3PUPA 3SOAA 1S9JA 4UV0A 2REIA 1STCE 3Q5IA 3PVGA 1OBDA 3FZSA 5HIEA 4G6OA 5DH3A 4F4PA 4D28A 1V0PA 5JKGA 3OWJA 1H4LA 5EFQA 5LMAA 2ETRA 2W17A 5HTIA 4QQ5A 4FSTA 3AD4A 2DWBA 5L2TA 4Y8DA 1KE7A 3MTFA 5L2SA 1BUHA 4H1MA 4S34A 3E88A 3OCSA 3DTWA 5DHJA 4PTGA 3ZLXA 1GZNA 1OL6A 3H4JA 3DKCA 5A4LA 1REKA 2XNGA 5M57A 5JZJA 2WGJA 2XNBA 1FOTA 2J7TA 1QPJA 3PPKA 3A4PA 3F3VA 5I0BA 2GU8A 3FMNA 3TL8A 4LG4A 1PXPA 5F9EA 1E9HA 5M4UA 5I9WA 3AG9A 4EHEA 4K18A 4ZMEA 2JDRA 2C5YA 2HAKA 3MA3A 4EOIA 3NIEA 5J9ZA 3AGMA 4FV3A 5F4NA 3D5UA 3TUDA 3FY0A 1YXUA 5AP6A 2JDOA 2RIOA 3SX9A 2XAMA 3O96A 2JAMA 3DDQA 5HHWA 4FKUA 4GFMA 4JXFA 4BDHA 3O0GA 1A9UA 3VUKA 5KBQA 2UZWE 3DKGA 3N4TA 1UNLA 3I7BA 3E3BX 4CD0A 4L3JA 5AEPA 1YDTE 3FPMA 5E9EA 3EQPA 4O84A 2NRUA 2BRBA 1Y8GA 2PTKA 4WNOA 3SDJA 3P0MA 4FR4A 5CEIA 4YGAA 2X4ZA 4L52A 3KXXA 4RMZA 2X9EA 1BMKA 1WMKA 5HLWA 4ZY6A 1Q41A 2WTDA 3L9LA 4IZ7A 2QHMA 4KABA 1KE5A 2BTSA 2IVTA 4H3BA 4QMWA 2WMXA 2JBPA 3PZEA 3QAME 5EYKA 5KO1A 5GJDA 3RHKA 2VTPA 2JFMA 3BL9A 5AV4A 4YZDA 2PHKA 3RPRA 4ANQA 3WIKA 4WRGA 4TNBA 3VW6A 4XEYA 2YIRA 2OGVA 1JOWB 2H8HA 3BGZA 4HGSA 4PTEA 3UYSA 4DYMA 4BI2A 3D5WA 4C36A 5B7VA 4PPAA 2Z8CA 2CCHA 5AJQA 5L2WA 2JDTA 3MVJA 1NT2A 3BGPA 4KB8A 5HIDA 4ZLOA 1Q99A 1P2AA 3RNYA 4RIWB 2ETKA 3PWYA 4U3YA 5F20A 3UQFA 2CGWA 3C4EA 5G1XA 5HG7A 5JEBA 3GU4A 4YPDA 3Q53A 2ZV2A 4N0SA 3VS3A 4WBOA 2WMWA 3MVHA 4J8MA 4KBCA 3TEIA 3BU6A 3NVKI 2Z60A 3QTSA 4GSBA 5B2MA 2BRGA 3GI3A 3IW4A 4ZTRA 4O4FA 3WZUA 3UVQA 5BQ0A 3HMOA 3DXQA 3RM7A 5BUIA 2Y6OA 1QPCA 2A98A 1J1BA 4CCUA 3EL7A 3PDTA 2C0OA 4OLIA 4R3CA 5EYMA 1B6CB 4MWIA 4FT3A 4QNYA 4XBRA 1UWHA 4M97A 1PMUA 2J6MA 2E9VA 4UX9A 2HXLA 4AA4A 1J91A 4RX8A 3JY0A 4EH7A 3LHJA 4BYIA 4GH2A 2I0YA 1AQ1A 2VTHA 4QMOA 2JKKA 2RG6A 1XWSA 3U4WA 4BI0A 2R3QA 3D94A 3QGWA 4ONAA 4MQ1A 4FTQA 4U5JA 4FZ6A 3ZZEA 4ZJVA 4UMQA 3ORTA 4BCMA 2ITZA 3KN5A 4M69A 4WHZA 3OG7A 2XUUA 3S4QA 2PUNA 3FLSA 3RAHA 5IA3A 2B9HA 2JIUA 2QOIA 4I41A 4C58A 2NNWB 4ASXA 3I6WA 4CRSA 1PXNA 5ANGA 4G3CA 4LV7A 1YRPA 1CSNA 4E1ZA 4E4MA 3QUEA 4G9RA 4DG0E 4CMOA 4EH9A 4EK8A 1GJOA 3IPHA 4D5HA 4O0RA 3VQHA 1YI6A 2CNQA 4BKYA 3LZBA 4NKSA 2H96A 2JDVA 2QOLA 2QODA 3Q60A 4EK3A 4KS8A 3O17A 4IAFA 3CQWA 4UALA 3WF5A 3COIA 4QTCA 4RBLA 5GJFA 2YIXA 5FLFA 2UW9A 3MWUA 4TYHA 1XBBA 1KOBA 2BVAA 4CG8A 3P4KA 4FKRA 2IW9A 4O0TA 3EQCA 1KUTA 3K2LA 4XLIA 2BPMA 4IX3A 5D9HA 3MB6A 4G16A 5CLPA 2YA9A 2BRHA 2W1DA 1KV2A 3UIBA 2UW3A 2JKQA 4ZEGA 3ZC6A 4BZNA 4DHZA 3ZO3A 5F94A 1OECA 2JKMA 3PPJA 4JBOA 4L44A 4QQJA 3JR1A 1DI9A 3F3UA 3V8SA 1I44A 3FLWA 2BHEA 4F65A 2UZBA 3RALA 3ORNA 4PDPA 2PL0A 4ANOA 5CAUA 2VWUA 3TXOA 4Y46A 4HJOA 3KXHA 2QOKA 4NIFA 4BDKA 4IAIA 4RZWA 3WF6A 3E87A 2W7XA 5E8UA 4UWBA 3ZO2A 2RFSA 1OB3A 3F3ZA 4FL1A 4O91A 4ALUA 4ZLYA 2QO2A 5BVFA 3CLYA 5EQPA 1W2CA 4EOKA 3EZRA 3Q9YA 5IMEA 5CEQA 3B2WA 5IA5A 4BCQA 3BYUA 2X7OA 5M53A 5KNJA 3MY5A 3FI2A 2VNYA 3KULA 3QX2A 4WNKA 4CFUA 2WQNA 3FZPA 2HCKA 3DZQA 3LFAA 3KF7A 3MY0A 3PJCA 4EJNA 1IG1A 2UZOA 4Q9SA 1JLUE 1OL2A 2X8EA 4UEUA 5AM6A 2PZIA 4DGMA 3GVUA 4K9YA 4XBUA 2LGCA 3LFDA 4UYNA 4L7FA 2OXXA 4PL3A 4EONA 5FEDA 5C8NA 3LQ5A 4GG5A 3I5ZA 4JIKA 4MYGA 2XK9A 4E5AX 3A99A 5LVPA 5JGBA 2W1ZA 3ORPA 4TW9A 5I9YA 3MH3A 2PULA 3R9NA 4F70A 5IUHA 2XKFA 4QP4A 3E62A 2XK7A 4RGJA 5JFWA 3LLAA 4JBPA 3VS0A 2H6DA 1FGKA 2CLQA 1E1VA 3QHRA 4IWPA 5IQDA 1PMNA 2QOQA 5BVNA 4O4BB 3O5AA 4F1TA 4HPTE 1MQ4A 2J0MB 5F95A 1BYGA 4RVTA 3FMHA 4V01A 4ALVA 3TNWA 2PZYA 3GBZA 4IC7A 2YITA 4D1ZA 3PSDA 4UXQA 4F6SA 2X2MA 3LFSA 3R7OA 4TNDA 4FNWA 2BALA 3HL7A 2UW4A 3KVWA 3QTXA 4RIYA 2J0LA 5FXSA 5HI2A 4RSSA 3RI1A 3OP5A 2EXCX 4KKEA 3Q4ZA 4BZDA 4G3EA 5EOBA 1OITA 3D5XA 2GFCA 3EH9A 4DEIA 3P7AA 3QC9A 1U59A 4KIKA 5DRBA 3UODA 3JPVA 5KZ0A 3F6XA 5EW9A 1WVWA 4K8AA 2PVJA 5EW8A 5HBEA 1SVGA 5CAPA 3HUBA 3Q2MA 4ZSGA 3ZFYA 4I1ZA 2ZVAA 5EM8A 4HNFA 3EQRA 3I0OA 4FTIA 3VHEA 4EOPA 3HKOA 3K3IA 3UIUA 4O1PA 4XYFA 5EHYA 2IZRA 2ITTA 3V5WA 2XM9A 3L8VA 2WTVA 2O5KA 3SRVA 2VNWA 2J5FA 1XO2B 5HQ0A 5CWZA 2GCDA 4FNXA 3F5XA 3POOA 2B53A 4J7BA 3E8NA 2ACXA 3OY1A 4YU2A 2C69A 3Q9ZA 4HVGA 5IH4A 2X39A 3DT1A 4LV5A 4EQCA 5CU0A 3DBCA 1PXKA 5AX9A 3B8QA 4FIIA 3KCKA 4DAWA 2X1NA 3GCPA 3AT2A 3BBWA 5FM2A 1PW2A 3BV3A 2YIYA 1RJBA 5EM5A 3W2SA 1J7UA 4NUSA 2W9ZB 3MGYA 5G6VA 4AGWA 4JLCA 1GIJA 4TYEA 1XMLA 5C26A 1H28A 2R3IA 3BYVA 3DA6A 1XKKA 1MRUA 1Z57A 3ANQA 4MCVA 4PNKA 2GNLA 5AWMA 3QF9A 2YM6A 4CCBA 3V6RA 4PMTA 4PMPA 4UMPA 1W83A 2EB3A 1JNKA 4I5HA 4NW6A 4MTAA 3FPQA 3R7IA 3UC4A 4J97A 4L45A 4WKQA 3BHVA 4RJ6A 4I5PA 3ACKA 2PUPA 3OMVA 2YAKA 4ACHA 5FXQA 1OKWA 3PY1A 1U5QA 3VUTA 3LLTA 2C6LA 2WMUA 3C51A 3PXZA 4YJVA 3RZFA 4BIEA 3T3VA 5LCKA 5JGDA 4DFXE 3COHA 4ZLZA 3D7TA 3MN3A 3ORMA 2ZV8A 4FKOA 5KE0A 3UG1A 5CAVA 3FXWA 4EOQA 3UZTA 1L3RE 1IA8A 3IW8A 4D4YA 3ORXA 4N70A 4IC8A 4IBMA 4ZSAA 4IDVA 3DK7A 4EQMA 4NCTA 4CNHA 3DK3A 4EHGA 4UZHA 4AA0A 1OPJA 3PJ2A 5E8XA 2BRMA 5AP7A 4C37A 2WPAA 3U55A 2IVVA 1MUOA 4FIHA 1HCKA 3EQFA 2IWIA 5CASA 4ZMFA 4YHFA 2WIPA 3VJOA 2WMTA 4TYJA 4OTQA 4C3FA 4CTCA 1XH4A 3DDPA 4QQCA 5CU6A 4FTLA 3GENA 5IZFA 3SQQA 3V5JA 4ACMA 2C6OA 3W0PA 4GYIA 2DQ7X 5B2LA 3DBEA 2P0CA 3VS7A 3NFGB 1H07A 5C9CA 3RWQA 4HVIA 5GNKA 4Q9ZA 4R3RA 2B9IA 3PY0A 2WOTA 1OL1A 4JT3A 3F2NA 3G2FA 4M3QA 4M15A 3FZTA 2OI4X 2J90A 3I81A 3WZDA 3DZOA 5CS6A 3JYAA 4ZP5A 5CQWA 2A1AB 4G6LA 4ERWA 4QPSA 3P9JA 2GDOA 2B1PA 3UIMA 1BI8A 2PVYA 3ALOA 3E93A 3ZRKA 5LMBA 1FVRA 3QKMA 5IF1A 1PXMA 4BTKA 3LFNA 4DGLC 3GFWA 2JC6A 3BQCA 3SG8A 3OEZA 4GCJA 3T3UA 4DCEA 3CEKA 1FMOE 3BBTB 2FVDA 4FSMA 4YP8A 3PVBA 4F08A 5IDNA 5L6OA 4GRBA 3NUAA 4KBKA 3QQHA 4GYGA 4HGEA 4XX9A 2XNEA 2UVXA 4DG3E 3F88A 5CSPA 1KE6A 3SD0A 3TWJA 2XYUA 4KAOA 4AXFA 4BC6A 1RQQA 3BEAA 4MEDA 3MESA 5AUVA 4JVGA 4FSWA 5KMKA 3QQJA 4BZOA 1Q3WA 2PK9A 3HECA 4FSRA 4H39A 3EZVA 4MX9A 4QYYA 4YSMA 2QLUA 2E9OA 1ZWSA 3GC7A 5EHLA 4DTKA 5CF5A 2XNNA 4YHJA 3W8LA 5DA3A 3B8RA 3OD6X 3HYHA 5CF4A 1A48A 3TNPC 3RCJA 5CU3A 4PRJA 3H30A 3VS4A 3FWQA 2RFEA 4C02A 5HNIX 3HZTA 3QD2B 3ZFMA 4HYUA 4I6HA 4FVRA 4I0RA 3FI3A 4JAJA 1XR1A 1YOJA 2R3JA 4AOJA 3TNQB 3UDTA 2EB2A 2R2PA 3AT4A 2QQ7A 3AKLA 2JGZA 2JLDA 2X7FA 3GCVA 4FF8A 3CTQA 4G9CA 3R04A 4CMUA 1KE8A 2JKOA 1M52A 4EK4A 1QMZA 4XG7A 2XNMA 4TN6A 2W1GA 3LJ0A 2OKRA 3EB0A 3MH0A 5AUYA 5J87A 5JSMA 4N57A 2WKMA 4BI1A 4QD6A 4ZS4A 3QC4A 3ZUVA 4CT1A 4CZTA 4ZIMA 2VO6A 3PG3A 3MFTA 3TIZA 4J52A 5FG8A 3VO3A 2UW6A 4GU6A 5TOZA 4AW2A 2EXMA 5C8KA 2VRXA 4W8EA 1Y91A 3FQSA 1MRVA 2BAJA 1B39A 1FVTA 2ITVA 2XIKA 3NAYA 3Q6UA 4O7TA 4RX9A 4GUEA 4DEGA 4F9AA 2ITOA 3NX8A 5EOLA 3NCZA 3PJ3A 4TZRA 3F5UA 1PY5A 1O6KA 2WB8A 3VVHA 4UMRA 2OXYA 2R3NA 3IO7A 4II5A 2F7ZE 5CF8A 1GZ8A 2GHGA 4L67A 3OXTA 1ZOEA 3HV4A 4RT7A 2ZB0A 3OW4A 5FBNC 4GKIA 3OHTA 3PSCA 3TDVA 4IMYA 5EK7A 1ZAOA 1UNGA 3R01A 4FTUA 4MXOA 4BDGA 1U46A 3M1SA 4XP2A 3UG2A 3V04A 3KFAA 4IM0A 3U8WA 5M56A 3EQGA 5HVJA 4HW7A 3UO5A 3ZFXA 4LI5A 4RRVA 4ITJA 5CEOA 4LOOA 3IOKA 4PWNA 1ZRZA 5D11A 2WAJA 3PA5A 2WTWA 3EKNA 3BGQA 4O96A 4HGTA 2UUEA 2FGIA 3NFFB 4DDGA 1YXSA 3U6IA 4QYFA 4CXAA 3NNXA 3LQ3A 4AW0A 2RFNA 4JAIA 3OOGA 4WNMA 2UW5A 1Y8YA 2JDSA 3QRIA 4WIHA 2Q0NA 4C8BA 1IAJA 2HOGA 2OU7A 2WQBA 2QI8A 2BFXA 2X8DA 3LM0A 3LCDA 1HOWA 4R6VA 4EEVA 5AUUA 2W1CA 5CU4A 4CT2A 4YLKA 1KOAA 3Q96A 3P1AA 4A07A 3ZCLA 5B2KA 2GQRA 2PVKA 4IANA 2HWPA 1YXTA 4X2GA 3I60A 2R3MA 4J99A 3R9OA 2F49A 1SMHA 3MY1A 2B9FA 5C01A 4ARKA 2VGOA 4U7ZA 4XP0A 2V55A 1Y6BA 2JEDA 4D9UA 4IB1A 4RVKA 2FA2A 5EYCA 5DRDA 3ZH8A 3RBWA 2OIQA 4G1WA 3MVLA 3DOGA 1WVYA 2GNFA 3D14A 3G0EA 4MXAA 1ZYLA 3S3IA 3W32A 4LFIA 4OTRA 3TT0A 3LOKA 4IQ6A 3R9DA 2CKEA 3RGFA 4L53A 2AC3A 2HIWA 2O0UA 5TT7A 4IX6A 3DJ5A 3C4ZA 5L8KA 3GOKA 4MNEA 2W1IA 4HZRA 4V0GA 5CZIA 2ETMA 3U6HA 3LKMA 5E1EA 3U9NA 2YERA 5FTGA 1GZOA 4FIEA 4XUFA 3FQEA 2IVSA 4FG8A 4F1MA 5HE1A 3CGOA 5HG5A 2VTQA 5IEXA 3QUPA 3W1FA 4WRSA 3ZLYA 3P5JC 4FV2A 1M7NA 4GK3A 4D2PA 1IAHA 1OIRA 2ESMA 3FZRA 2QG5A 4MXCA 4F9BA 3TUCA 4TRLA 4AZWA 3ENHA 4FC0A 4ERKA 2IZSA 3Q4UA 3G9NA 4RX5A 4AZFA 4LUEA 2C4GA 5K0XA 3SW7A 4FI1A 2V7OA 5JT2A 2R0UA 4L43A 4XOZA 2VO3A 4BVUA 4LRJA 4QMMA 4K33A 2XKEA 3NLBA 4EH3A 2EUFB 4PP9A 1YOMA 2EXEA 2YACA 3VAPA 5EI6A 2OZAA 4XCUA 3NR9A 4BL1A 2R3RA 3RVGA 3RMFA 3PTGA 4CFFA 3MSSA 4KBAA 3ERKA 4DTBA 4O0YA 1F5QA 4LL5A 3FI4A 3COKA 4IACA 4D55A 3A8XA 2FUMA 3CGFA 3QRKA 3RHXA 3EN5A 4EOJA 5JQ5A 4JBVA 1UV5A 2GNHA 3VS6A 2UW0A 4NM3A 4PTCA 3EOCA 3LCSA 4RC3A 5AP4A 3TKIA 3W2QA 4NYEA 1JSUA 5CXHA 2OJIA 3ODYX 3P7BA 3VBWA 4HVHA 5EW3A 1ZY4A 1YWRA 3Q5ZA 4IDTA 1JBPE 5A54A 2QLQA 3AGLA 4AXDA 4IW0A 2VAGA 2RSVA 3C1XA 1FVVA 2VX3A 3OC1A 2XVDA 5KMNA 2CNVA 3VWAA 5A6OA 1OPKA 2XKDA 2XRWA 1WVXA 1ND4A 2PZ5A 3DK6A 3V5PA 4JBQA 2E9PA 2B55A 4P90A 3CY3A 2CPKE 4E73A 1O9UA 5T6KA 4LYNA 2YM3A 1Q8WA 3D9VA 4JR7A 5FP5A 4AT5A 5A14A 1H24A 2OJ9A 5DN3A 4AQKA 2R4BA 5IQIA 3C4WA 5CTPA 1VYZA 3Q4TA 1G8AA 1F3MC 1UU9A 2WEIA 3DTCA 4CYIA 3KRLA 5AFVA 3U54A 4U44A 4B8MA 1CM8A 3R7VA 1ST0A 3HMMA 2J5EA 4I6FA 1V0BA 3VONA 4FEVA 3N9XA 4WBBB 1GAGA 5HE3A 4BBMA 3UMXA 5KKRB 4FKTA 4RVLA 4WOVA 4XRJA 5C1QB 4EORA 2G15A 2YLFA 4G5PA 5GIPE 1SNXA 2UV2A 1NA7A 2W4JA 4CFWA 1AD5A 4BICA 2VTOA 3KCFA 3KVXA 3C7QA 2WELA 3A8WA 4D0WA 5BV3A 1ZZ2A 3GCQA 2EVAA 3LXLA 1PKGA 2R3GA 4QMSA 2X2KA 3R0TA 4AE9A 4DGGA 1YDRE 1OUKA 1LP4A 2YZAA 4FTKA 3E8EA 4K11A 5DPVA 5LMKC 2Y7JA 3AC3A 3NYXA 3FBVA 4PY1A 4XG3A 3IW6A 5I3RA 3DGKA 5H8EA 4YJSA 5HX8A 2XALA 3FKLA 2VWZA 4AUAA 1ZYDA 3NNUA 1VZOA 4NM7A 3GQLA 1M17A 4BHNA 5BUJA 2PMOX 3OCGA 2WQMA 3BRBA 4ACDA 4NWMA 3AOXA 4MBJA 5HU9A 5EI2A 4BCHA 2DYLA 4B9DA 4D2WA 4DFYA 5IQBA 4OT6A 4JRNA 4DTAA 3BWJA 3FC1X 1UU8A 3NMUF 4TYGA 4FRFA 3HV7A 3O50A 4DBNA 2YM4A 2XCKA 5HX6A 3E8CA 4I24A 4RWLA 2CCIA 1CKPA 4WT6A 1OIUA 1FMKA 3MV5A 2PMNX 2VV9A 2X6EA 4O7ZA 3RM6A 3LVPA 4DHJA 3SHEA 4CFNA 3RPOA 3OZ6A 4F7LA 3KXMA 1OGUA 3GC8A 2I0HA 2W4OA 4MNFA 4C35A 4WD5A 3ZRMA 3TNHA 1OGYA 4QDEA 3R7YA 2ITUA 4CTBA 2R7IA 5AV0A 3CC6A 2R9SA 4C2VA 5HOAA 3VW8A 3W33A 5HE0A 1X8BA 5ANOA 3TCPA 1W2DA 2YDIA 4FTMA 5E90A 3NVMB 3BLRA 4PPCA 3I1AA 2GPHA 3ULIA 5A4TA 4QMZA 3VUGA 4JQ7A 2W5AA 2WTCA 4LM5A 3OWLA 3MA6A 4HYIA 4YJQA 3CSVA 2ERZE 3KXNA 3QXOA 2YCQA 4RLKA 2KULA 3GT8A 4EI4A 2HK5A 3ATSA 4FG9A 2OF2A 5KUPA 4O7VA 4QYHA 4DFNA 3ZO4A 4UY9A 4DT9A 3WILA 5HLPA 4MF0A 1R0PA 3HRFA 5JK3A 2Y9QA 2ZM1A 4RLLA 4TYIA 3O2MA 5IG1A 4IIRA 3CR0A 4W4VA 2GS2A 4XG6A 3T9TA 4FKLA 4FEUA 4TT7A 3IDCA 5C03A 1ZY5A 4FT9A 4E3CA 4BDBA 2QCSA 4BGHA 3P08A 2BMCA 5BVWA 2GHMA 2YDKA 3FUPA 3MB7A 3P23A 1Q5KA 4EHVA 3QCSA 1R1WA 4U41A 3TZ7A 1IRKA 2C30A 2ZYBA 4OT5A 5AR4A 4A9TA 2B4SB 3OVVA 1GIIA 4I6BA 2ITPA 4O21A 4CV8A 5IPJA 5J1VA 5IQFA 5GZ8A 3TUBA 1PRYA 3NIZA 4O4DA 3FC2A 4FGBA 3PVWA 4GT3A 2ZAZA 3EYHA 2X0PA 3LXKA 5HVKA 5JN2A 4E93A 2YAAA 4Y5HA 5HGIA 1JSTA 2FSMX 5HTBA 4PDSA 5BYLA 3KREA 1P5EA 1GY3A 5E92A 3MPTA 5HD7A 5TR6A 2C0IA 2BZJA 4H58A 4E8AA 4NM0A 3DJ7A 3ZEWA 4KWPA 5A3XA 2WTIA 4DEHA 4F9YA 5CEPA 4GJ2A 2VO0A 4FJVA 4BJJA 4BBFA 3F5GA 4EHZA 3O8UA 2XAOA 3ZYAA 4M69B 1S9IA 2C68A 2PVMA 4WUAA 5ANKA 4AXCA 2XIRA 4I5CA 3ZMMA 3LFCA 1H27A 2CJMA 4JI9A 4BY9E 5I4NA 1GOLA 2G01A 4XNEA 5CZHA 4D58A 5I5ZA 3PJ1A 4DGOA 4DEDA 3OEFX 4ZTHA 2C5VA 3FAAA 5EDQA 3D7ZA 4GMYA 2SRCA 3ZUUA 3A62A 4FE2A 4DFUA 2UW7A 2LAVA 2A19B 4QTAA 5K3YA 3NNWA 3UPZA 3QALE 3WF7A 4FZDB 5TO8A 3NUYA 3QA8A 4O22A 4W4YA 4S33A 3THBA 3IKAA 5LWMA 5HBJA 2XK3A 3IG7A 4FKJA 4F9CA 5L3AA 3ZOSA 4FNZA 2I7QA 4P2KA 1R0EA 4DC2A 5IQHA 4C4EA 5KHWA 5E4HA 4YZ9A 4TYHB 4UXLA 3C13A 5HO8A 1P14A 3GXLA 3B2TA 3F69A 2QONA 2WU6A 3PSBA 4AZSA 4NU1A 4RX7A 1JKTA 2YN8A 3LXPA 1Y6AA 3OWKA 4BCOA 4A9RA 3KK8A 4DINA 2Q0BA 4EJ7A 4EUTA 2VTIA 1IA9A 2WXVA 1YVJA 5HG8A 3OBJA 3TNIA 1RDQE 3CTJA 2C1AA 4F99A 5IEVA 2CKOA 3ZBFA 4QMTA 4QTDA 1M7QA 3O23A 3FEGA 2HZNA 5LCJA 3PG1A 4TKSA 3OOMA 3QZFA 4HCTA 4GT4A 4NIFB 3QYWA 4EK5A 4F0IA 1F0QA 3WZKA 3E92A 3BELA 3MW1A 3NYOA 2BRNA 5I9VA 5J1WA 1WCCA 3EN4A 3ZUTA 5AUTA 3ET7A 4XG2A 2BDWA 5HORA 3Q2JA 4MK0A 5IH6A 2BAQA 1GNGA 3I7CA 4AFEA 2C6DA 5M08A 4NT4A 3QKLA 1H0VA 1XH8A 5E8VA 4DH8A 3AC4A 3MPAA 4L68A 4DEEA 5GIOE 4NTSA 4U81A 3PVUA 3SW4A 3ITZA 2P3GX 5FUTA 1OIYA 4I6LA 3R21A 4X0MA 4LDTA 4YC3A 5L4QA 5H8GA 4YLLA 5DI1A 5AV3A 4CKJA 5AA9A 2R5TA 3F5PA 1YWVA 3EFJA 3LAUA 4IZYA 4BDJA 1P4OA 4ZTSA 2WQEA 5HVYA 2X4FA 2YABA 3E5AA 2UZDA 1ERKA 2Z7QA 3OCBA 2C6IA 3RKBA 3ORKA 4CGAA 2OH4A 4Z55A 3BX5A 3KMWA 4DHIB 4WUNA 3W8QA 5AM7A 4C3PA 2XK8A 4DH5A 1UKIA 2XJ2A 3H0YA 3O51A 2RL5A 4BDDA 4EH2A 5H3QA 5J7HA 5J95A 4BRXA 1XH6A 4O27B 3EJ1A 4FL3A 4M13A 4FMQA 4LGDA 4W9WA 2JAVA 2RKUA 3R8UA 4OAVB 3R8PA 4QYEA 4BDIA 5KX8A 1XQZA 3BV2A 3SXFA 3WZJA 2PUIA 5IQAA 3OWPA 4RIYB 2B0QA 4O7YA 4HNIA 3QKKA 4GEOA 3W0OA 4X3FA 4U80A 1QL6A 3W2PA 4F0FA 2PE1A 4QMPA 5KKRC 3SG9A 1U54A 3N4UA 4DH7A 4KIKB 3R6XA 3DXPA 5FQDC 2FH9A 3CS9A 4TWCA 3BLAA 4JDHA 3LCKA 4QNAA 3W16A 4AG8A 5EM7A 5C8MA 1CTPE 1M2PA 4FEQA 1VEBA 3FYJX 4C59A 3QZHA 3GQIA 4F9WA 4J96A 5DG5A 5FTOA 2Q83A 5DLSA 4FKGA 2WTKB